(data stored in ACNUC7421 zone)

EMBL: FN392235

ID   FN392235; SV 1; circular; genomic DNA; STD; PRO; 4026286 BP.
XX
AC   FN392235;
XX
PR   Project:PRJEA37877;
XX
DT   07-JAN-2010 (Rel. 103, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 2)
XX
DE   Erwinia pyrifoliae DSM 12163 complete genome, culture collection DSM:12163
XX
KW   complete genome.
XX
OS   Erwinia pyrifoliae DSM 12163
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Erwiniaceae; Erwinia.
XX
RN   [1]
RP   1-4026286
RA   Jaenicke S.;
RT   ;
RL   Submitted (06-MAY-2009) to the INSDC.
RL   Jaenicke S., Universitaet Bielefeld, CeBiTec, 33594 Bielefeld, N/A,
RL   GERMANY.
XX
RN   [2]
RA   Smits T.H.M., Jaenicke S., Rezzonico F., Kamber T., Goesmann A., Frey J.E.,
RA   Duffy B.;
RT   "Complete genome sequence of the fire blight pathogen Erwinia pyrifoliae
RT   DSM 12163T and comparative genomic insights into plant pathogenicity";
RL   BMC Genomics 11(2):0(2010).
XX
DR   MD5; 1dfeadd7d6793a286fdc84f06b20a2b2.
DR   BioSample; SAMEA2272353.
DR   CABRI; DSM 12163.
DR   EnsemblGenomes-Gn; EBG00001093561.
DR   EnsemblGenomes-Gn; EBG00001093562.
DR   EnsemblGenomes-Gn; EBG00001093563.
DR   EnsemblGenomes-Gn; EBG00001093564.
DR   EnsemblGenomes-Gn; EBG00001093565.
DR   EnsemblGenomes-Gn; EBG00001093566.
DR   EnsemblGenomes-Gn; EBG00001093567.
DR   EnsemblGenomes-Gn; EBG00001093568.
DR   EnsemblGenomes-Gn; EBG00001093569.
DR   EnsemblGenomes-Gn; EBG00001093570.
DR   EnsemblGenomes-Gn; EBG00001093571.
DR   EnsemblGenomes-Gn; EBG00001093572.
DR   EnsemblGenomes-Gn; EBG00001093573.
DR   EnsemblGenomes-Gn; EBG00001093574.
DR   EnsemblGenomes-Gn; EBG00001093575.
DR   EnsemblGenomes-Gn; EBG00001093576.
DR   EnsemblGenomes-Gn; EBG00001093577.
DR   EnsemblGenomes-Gn; EBG00001093578.
DR   EnsemblGenomes-Gn; EBG00001093579.
DR   EnsemblGenomes-Gn; EBG00001093580.
DR   EnsemblGenomes-Gn; EBG00001093581.
DR   EnsemblGenomes-Gn; EBG00001093582.
DR   EnsemblGenomes-Gn; EBG00001093583.
DR   EnsemblGenomes-Gn; EBG00001093584.
DR   EnsemblGenomes-Gn; EBG00001093585.
DR   EnsemblGenomes-Gn; EBG00001093586.
DR   EnsemblGenomes-Gn; EBG00001093587.
DR   EnsemblGenomes-Gn; EBG00001093588.
DR   EnsemblGenomes-Gn; EBG00001093589.
DR   EnsemblGenomes-Gn; EBG00001093590.
DR   EnsemblGenomes-Gn; EBG00001093591.
DR   EnsemblGenomes-Gn; EBG00001093592.
DR   EnsemblGenomes-Gn; EBG00001093593.
DR   EnsemblGenomes-Gn; EBG00001093594.
DR   EnsemblGenomes-Gn; EBG00001093595.
DR   EnsemblGenomes-Gn; EBG00001093596.
DR   EnsemblGenomes-Gn; EBG00001093597.
DR   EnsemblGenomes-Gn; EBG00001093598.
DR   EnsemblGenomes-Gn; EBG00001093599.
DR   EnsemblGenomes-Gn; EBG00001093600.
DR   EnsemblGenomes-Gn; EBG00001093601.
DR   EnsemblGenomes-Gn; EBG00001093602.
DR   EnsemblGenomes-Gn; EBG00001093603.
DR   EnsemblGenomes-Gn; EBG00001093604.
DR   EnsemblGenomes-Gn; EBG00001093605.
DR   EnsemblGenomes-Gn; EBG00001093606.
DR   EnsemblGenomes-Gn; EBG00001093607.
DR   EnsemblGenomes-Gn; EBG00001093608.
DR   EnsemblGenomes-Gn; EBG00001093609.
DR   EnsemblGenomes-Gn; EBG00001093610.
DR   EnsemblGenomes-Gn; EBG00001093611.
DR   EnsemblGenomes-Gn; EBG00001093612.
DR   EnsemblGenomes-Gn; EBG00001093613.
DR   EnsemblGenomes-Gn; EBG00001093614.
DR   EnsemblGenomes-Gn; EBG00001093615.
DR   EnsemblGenomes-Gn; EBG00001093616.
DR   EnsemblGenomes-Gn; EBG00001093617.
DR   EnsemblGenomes-Gn; EBG00001093618.
DR   EnsemblGenomes-Gn; EBG00001093619.
DR   EnsemblGenomes-Gn; EBG00001093620.
DR   EnsemblGenomes-Gn; EBG00001093621.
DR   EnsemblGenomes-Gn; EBG00001093622.
DR   EnsemblGenomes-Gn; EBG00001093623.
DR   EnsemblGenomes-Gn; EBG00001093624.
DR   EnsemblGenomes-Gn; EBG00001093625.
DR   EnsemblGenomes-Gn; EBG00001093626.
DR   EnsemblGenomes-Gn; EBG00001093627.
DR   EnsemblGenomes-Gn; EBG00001093628.
DR   EnsemblGenomes-Gn; EBG00001093629.
DR   EnsemblGenomes-Gn; EBG00001093630.
DR   EnsemblGenomes-Gn; EBG00001093631.
DR   EnsemblGenomes-Gn; EBG00001093632.
DR   EnsemblGenomes-Gn; EBG00001093633.
DR   EnsemblGenomes-Gn; EBG00001093634.
DR   EnsemblGenomes-Gn; EBG00001093635.
DR   EnsemblGenomes-Gn; EBG00001093636.
DR   EnsemblGenomes-Gn; EBG00001093637.
DR   EnsemblGenomes-Gn; EBG00001093638.
DR   EnsemblGenomes-Gn; EBG00001093639.
DR   EnsemblGenomes-Gn; EBG00001093640.
DR   EnsemblGenomes-Gn; EBG00001093641.
DR   EnsemblGenomes-Gn; EBG00001093642.
DR   EnsemblGenomes-Gn; EBG00001093643.
DR   EnsemblGenomes-Gn; EBG00001093644.
DR   EnsemblGenomes-Gn; EBG00001093645.
DR   EnsemblGenomes-Gn; EBG00001093646.
DR   EnsemblGenomes-Gn; EBG00001093647.
DR   EnsemblGenomes-Gn; EBG00001093648.
DR   EnsemblGenomes-Gn; EBG00001093649.
DR   EnsemblGenomes-Gn; EBG00001093650.
DR   EnsemblGenomes-Gn; EBG00001093651.
DR   EnsemblGenomes-Gn; EBG00001093652.
DR   EnsemblGenomes-Gn; EBG00001093653.
DR   EnsemblGenomes-Gn; EBG00001093654.
DR   EnsemblGenomes-Gn; EBG00001093655.
DR   EnsemblGenomes-Gn; EBG00001093656.
DR   EnsemblGenomes-Gn; EBG00001093657.
DR   EnsemblGenomes-Gn; EBG00001093658.
DR   EnsemblGenomes-Gn; EBG00001093659.
DR   EnsemblGenomes-Gn; EBG00001093660.
DR   EnsemblGenomes-Gn; EBG00001093661.
DR   EnsemblGenomes-Gn; EBG00001093662.
DR   EnsemblGenomes-Gn; EBG00001093663.
DR   EnsemblGenomes-Gn; EBG00001093664.
DR   EnsemblGenomes-Gn; EBG00001093665.
DR   EnsemblGenomes-Gn; EBG00001093666.
DR   EnsemblGenomes-Gn; EBG00001093667.
DR   EnsemblGenomes-Gn; EBG00001093668.
DR   EnsemblGenomes-Gn; EBG00001093669.
DR   EnsemblGenomes-Gn; EBG00001093670.
DR   EnsemblGenomes-Gn; EBG00001093671.
DR   EnsemblGenomes-Gn; EBG00001093672.
DR   EnsemblGenomes-Gn; EBG00001093673.
DR   EnsemblGenomes-Gn; EBG00001093674.
DR   EnsemblGenomes-Gn; EBG00001093675.
DR   EnsemblGenomes-Gn; EBG00001093676.
DR   EnsemblGenomes-Gn; EBG00001093677.
DR   EnsemblGenomes-Gn; EBG00001093678.
DR   EnsemblGenomes-Gn; EBG00001093679.
DR   EnsemblGenomes-Gn; EBG00001093680.
DR   EnsemblGenomes-Gn; EBG00001093681.
DR   EnsemblGenomes-Gn; EBG00001093682.
DR   EnsemblGenomes-Gn; EBG00001093683.
DR   EnsemblGenomes-Gn; EBG00001093684.
DR   EnsemblGenomes-Gn; EBG00001093685.
DR   EnsemblGenomes-Gn; EBG00001093686.
DR   EnsemblGenomes-Gn; EBG00001093687.
DR   EnsemblGenomes-Gn; EBG00001093688.
DR   EnsemblGenomes-Gn; EBG00001093689.
DR   EnsemblGenomes-Gn; EBG00001093690.
DR   EnsemblGenomes-Gn; EBG00001093691.
DR   EnsemblGenomes-Gn; EBG00001093692.
DR   EnsemblGenomes-Gn; EBG00001093693.
DR   EnsemblGenomes-Gn; EBG00001093694.
DR   EnsemblGenomes-Gn; EBG00001093695.
DR   EnsemblGenomes-Gn; EBG00001093696.
DR   EnsemblGenomes-Gn; EBG00001093697.
DR   EnsemblGenomes-Gn; EBG00001093698.
DR   EnsemblGenomes-Gn; EBG00001093699.
DR   EnsemblGenomes-Gn; EBG00001093700.
DR   EnsemblGenomes-Gn; EBG00001093701.
DR   EnsemblGenomes-Gn; EBG00001093702.
DR   EnsemblGenomes-Gn; EBG00001093703.
DR   EnsemblGenomes-Gn; EBG00001093704.
DR   EnsemblGenomes-Gn; EBG00001093705.
DR   EnsemblGenomes-Gn; EBG00001093706.
DR   EnsemblGenomes-Gn; EBG00001093707.
DR   EnsemblGenomes-Gn; EBG00001093708.
DR   EnsemblGenomes-Gn; EBG00001093709.
DR   EnsemblGenomes-Gn; EBG00001093710.
DR   EnsemblGenomes-Gn; EBG00001093711.
DR   EnsemblGenomes-Gn; EBG00001093712.
DR   EnsemblGenomes-Gn; EBG00001093713.
DR   EnsemblGenomes-Gn; EBG00001093714.
DR   EnsemblGenomes-Gn; EBG00001093715.
DR   EnsemblGenomes-Gn; EBG00001093716.
DR   EnsemblGenomes-Gn; EBG00001093717.
DR   EnsemblGenomes-Gn; EBG00001093718.
DR   EnsemblGenomes-Gn; EBG00001093719.
DR   EnsemblGenomes-Gn; EBG00001093720.
DR   EnsemblGenomes-Gn; EBG00001093721.
DR   EnsemblGenomes-Gn; EBG00001093722.
DR   EnsemblGenomes-Gn; EBG00001093723.
DR   EnsemblGenomes-Gn; EBG00001093724.
DR   EnsemblGenomes-Gn; EBG00001093725.
DR   EnsemblGenomes-Gn; EBG00001093726.
DR   EnsemblGenomes-Gn; EBG00001093727.
DR   EnsemblGenomes-Gn; EBG00001093728.
DR   EnsemblGenomes-Gn; EBG00001093729.
DR   EnsemblGenomes-Gn; EPYR_r001.
DR   EnsemblGenomes-Gn; EPYR_r002.
DR   EnsemblGenomes-Gn; EPYR_r003.
DR   EnsemblGenomes-Gn; EPYR_r004.
DR   EnsemblGenomes-Gn; EPYR_r005.
DR   EnsemblGenomes-Gn; EPYR_r006.
DR   EnsemblGenomes-Gn; EPYR_r007.
DR   EnsemblGenomes-Gn; EPYR_r008.
DR   EnsemblGenomes-Gn; EPYR_r009.
DR   EnsemblGenomes-Gn; EPYR_r010.
DR   EnsemblGenomes-Gn; EPYR_r011.
DR   EnsemblGenomes-Gn; EPYR_r012.
DR   EnsemblGenomes-Gn; EPYR_r013.
DR   EnsemblGenomes-Gn; EPYR_r014.
DR   EnsemblGenomes-Gn; EPYR_r015.
DR   EnsemblGenomes-Gn; EPYR_r016.
DR   EnsemblGenomes-Gn; EPYR_r017.
DR   EnsemblGenomes-Gn; EPYR_r018.
DR   EnsemblGenomes-Gn; EPYR_r019.
DR   EnsemblGenomes-Gn; EPYR_r020.
DR   EnsemblGenomes-Gn; EPYR_r021.
DR   EnsemblGenomes-Gn; EPYR_r022.
DR   EnsemblGenomes-Gn; EPYR_t001.
DR   EnsemblGenomes-Gn; EPYR_t002.
DR   EnsemblGenomes-Gn; EPYR_t003.
DR   EnsemblGenomes-Gn; EPYR_t004.
DR   EnsemblGenomes-Gn; EPYR_t005.
DR   EnsemblGenomes-Gn; EPYR_t006.
DR   EnsemblGenomes-Gn; EPYR_t007.
DR   EnsemblGenomes-Gn; EPYR_t008.
DR   EnsemblGenomes-Gn; EPYR_t009.
DR   EnsemblGenomes-Gn; EPYR_t010.
DR   EnsemblGenomes-Gn; EPYR_t011.
DR   EnsemblGenomes-Gn; EPYR_t012.
DR   EnsemblGenomes-Gn; EPYR_t013.
DR   EnsemblGenomes-Gn; EPYR_t014.
DR   EnsemblGenomes-Gn; EPYR_t015.
DR   EnsemblGenomes-Gn; EPYR_t016.
DR   EnsemblGenomes-Gn; EPYR_t017.
DR   EnsemblGenomes-Gn; EPYR_t018.
DR   EnsemblGenomes-Gn; EPYR_t019.
DR   EnsemblGenomes-Gn; EPYR_t020.
DR   EnsemblGenomes-Gn; EPYR_t021.
DR   EnsemblGenomes-Gn; EPYR_t022.
DR   EnsemblGenomes-Gn; EPYR_t023.
DR   EnsemblGenomes-Gn; EPYR_t024.
DR   EnsemblGenomes-Gn; EPYR_t025.
DR   EnsemblGenomes-Gn; EPYR_t026.
DR   EnsemblGenomes-Gn; EPYR_t027.
DR   EnsemblGenomes-Gn; EPYR_t028.
DR   EnsemblGenomes-Gn; EPYR_t029.
DR   EnsemblGenomes-Gn; EPYR_t030.
DR   EnsemblGenomes-Gn; EPYR_t031.
DR   EnsemblGenomes-Gn; EPYR_t032.
DR   EnsemblGenomes-Gn; EPYR_t033.
DR   EnsemblGenomes-Gn; EPYR_t034.
DR   EnsemblGenomes-Gn; EPYR_t035.
DR   EnsemblGenomes-Gn; EPYR_t036.
DR   EnsemblGenomes-Gn; EPYR_t037.
DR   EnsemblGenomes-Gn; EPYR_t038.
DR   EnsemblGenomes-Gn; EPYR_t039.
DR   EnsemblGenomes-Gn; EPYR_t040.
DR   EnsemblGenomes-Gn; EPYR_t041.
DR   EnsemblGenomes-Gn; EPYR_t042.
DR   EnsemblGenomes-Gn; EPYR_t043.
DR   EnsemblGenomes-Gn; EPYR_t044.
DR   EnsemblGenomes-Gn; EPYR_t045.
DR   EnsemblGenomes-Gn; EPYR_t046.
DR   EnsemblGenomes-Gn; EPYR_t047.
DR   EnsemblGenomes-Gn; EPYR_t048.
DR   EnsemblGenomes-Gn; EPYR_t049.
DR   EnsemblGenomes-Gn; EPYR_t050.
DR   EnsemblGenomes-Gn; EPYR_t051.
DR   EnsemblGenomes-Gn; EPYR_t052.
DR   EnsemblGenomes-Gn; EPYR_t053.
DR   EnsemblGenomes-Gn; EPYR_t054.
DR   EnsemblGenomes-Gn; EPYR_t055.
DR   EnsemblGenomes-Gn; EPYR_t056.
DR   EnsemblGenomes-Gn; EPYR_t057.
DR   EnsemblGenomes-Gn; EPYR_t058.
DR   EnsemblGenomes-Gn; EPYR_t059.
DR   EnsemblGenomes-Gn; EPYR_t060.
DR   EnsemblGenomes-Gn; EPYR_t061.
DR   EnsemblGenomes-Gn; EPYR_t062.
DR   EnsemblGenomes-Gn; EPYR_t063.
DR   EnsemblGenomes-Gn; EPYR_t064.
DR   EnsemblGenomes-Gn; EPYR_t065.
DR   EnsemblGenomes-Gn; EPYR_t066.
DR   EnsemblGenomes-Gn; EPYR_t067.
DR   EnsemblGenomes-Gn; EPYR_t068.
DR   EnsemblGenomes-Gn; EPYR_t069.
DR   EnsemblGenomes-Gn; EPYR_t070.
DR   EnsemblGenomes-Gn; EPYR_t071.
DR   EnsemblGenomes-Gn; EPYR_t072.
DR   EnsemblGenomes-Gn; EPYR_t073.
DR   EnsemblGenomes-Gn; EPYR_t074.
DR   EnsemblGenomes-Tr; EBT00001548114.
DR   EnsemblGenomes-Tr; EBT00001548115.
DR   EnsemblGenomes-Tr; EBT00001548116.
DR   EnsemblGenomes-Tr; EBT00001548117.
DR   EnsemblGenomes-Tr; EBT00001548118.
DR   EnsemblGenomes-Tr; EBT00001548119.
DR   EnsemblGenomes-Tr; EBT00001548120.
DR   EnsemblGenomes-Tr; EBT00001548121.
DR   EnsemblGenomes-Tr; EBT00001548122.
DR   EnsemblGenomes-Tr; EBT00001548123.
DR   EnsemblGenomes-Tr; EBT00001548124.
DR   EnsemblGenomes-Tr; EBT00001548125.
DR   EnsemblGenomes-Tr; EBT00001548126.
DR   EnsemblGenomes-Tr; EBT00001548127.
DR   EnsemblGenomes-Tr; EBT00001548128.
DR   EnsemblGenomes-Tr; EBT00001548129.
DR   EnsemblGenomes-Tr; EBT00001548130.
DR   EnsemblGenomes-Tr; EBT00001548131.
DR   EnsemblGenomes-Tr; EBT00001548132.
DR   EnsemblGenomes-Tr; EBT00001548133.
DR   EnsemblGenomes-Tr; EBT00001548134.
DR   EnsemblGenomes-Tr; EBT00001548135.
DR   EnsemblGenomes-Tr; EBT00001548136.
DR   EnsemblGenomes-Tr; EBT00001548137.
DR   EnsemblGenomes-Tr; EBT00001548138.
DR   EnsemblGenomes-Tr; EBT00001548139.
DR   EnsemblGenomes-Tr; EBT00001548140.
DR   EnsemblGenomes-Tr; EBT00001548141.
DR   EnsemblGenomes-Tr; EBT00001548142.
DR   EnsemblGenomes-Tr; EBT00001548143.
DR   EnsemblGenomes-Tr; EBT00001548144.
DR   EnsemblGenomes-Tr; EBT00001548145.
DR   EnsemblGenomes-Tr; EBT00001548146.
DR   EnsemblGenomes-Tr; EBT00001548147.
DR   EnsemblGenomes-Tr; EBT00001548148.
DR   EnsemblGenomes-Tr; EBT00001548149.
DR   EnsemblGenomes-Tr; EBT00001548150.
DR   EnsemblGenomes-Tr; EBT00001548151.
DR   EnsemblGenomes-Tr; EBT00001548152.
DR   EnsemblGenomes-Tr; EBT00001548153.
DR   EnsemblGenomes-Tr; EBT00001548154.
DR   EnsemblGenomes-Tr; EBT00001548155.
DR   EnsemblGenomes-Tr; EBT00001548156.
DR   EnsemblGenomes-Tr; EBT00001548157.
DR   EnsemblGenomes-Tr; EBT00001548158.
DR   EnsemblGenomes-Tr; EBT00001548159.
DR   EnsemblGenomes-Tr; EBT00001548160.
DR   EnsemblGenomes-Tr; EBT00001548161.
DR   EnsemblGenomes-Tr; EBT00001548162.
DR   EnsemblGenomes-Tr; EBT00001548163.
DR   EnsemblGenomes-Tr; EBT00001548164.
DR   EnsemblGenomes-Tr; EBT00001548165.
DR   EnsemblGenomes-Tr; EBT00001548166.
DR   EnsemblGenomes-Tr; EBT00001548167.
DR   EnsemblGenomes-Tr; EBT00001548168.
DR   EnsemblGenomes-Tr; EBT00001548169.
DR   EnsemblGenomes-Tr; EBT00001548170.
DR   EnsemblGenomes-Tr; EBT00001548171.
DR   EnsemblGenomes-Tr; EBT00001548172.
DR   EnsemblGenomes-Tr; EBT00001548173.
DR   EnsemblGenomes-Tr; EBT00001548174.
DR   EnsemblGenomes-Tr; EBT00001548175.
DR   EnsemblGenomes-Tr; EBT00001548176.
DR   EnsemblGenomes-Tr; EBT00001548177.
DR   EnsemblGenomes-Tr; EBT00001548178.
DR   EnsemblGenomes-Tr; EBT00001548179.
DR   EnsemblGenomes-Tr; EBT00001548180.
DR   EnsemblGenomes-Tr; EBT00001548181.
DR   EnsemblGenomes-Tr; EBT00001548182.
DR   EnsemblGenomes-Tr; EBT00001548183.
DR   EnsemblGenomes-Tr; EBT00001548184.
DR   EnsemblGenomes-Tr; EBT00001548185.
DR   EnsemblGenomes-Tr; EBT00001548186.
DR   EnsemblGenomes-Tr; EBT00001548187.
DR   EnsemblGenomes-Tr; EBT00001548188.
DR   EnsemblGenomes-Tr; EBT00001548189.
DR   EnsemblGenomes-Tr; EBT00001548190.
DR   EnsemblGenomes-Tr; EBT00001548191.
DR   EnsemblGenomes-Tr; EBT00001548192.
DR   EnsemblGenomes-Tr; EBT00001548193.
DR   EnsemblGenomes-Tr; EBT00001548194.
DR   EnsemblGenomes-Tr; EBT00001548195.
DR   EnsemblGenomes-Tr; EBT00001548196.
DR   EnsemblGenomes-Tr; EBT00001548197.
DR   EnsemblGenomes-Tr; EBT00001548198.
DR   EnsemblGenomes-Tr; EBT00001548199.
DR   EnsemblGenomes-Tr; EBT00001548200.
DR   EnsemblGenomes-Tr; EBT00001548201.
DR   EnsemblGenomes-Tr; EBT00001548202.
DR   EnsemblGenomes-Tr; EBT00001548203.
DR   EnsemblGenomes-Tr; EBT00001548204.
DR   EnsemblGenomes-Tr; EBT00001548205.
DR   EnsemblGenomes-Tr; EBT00001548206.
DR   EnsemblGenomes-Tr; EBT00001548207.
DR   EnsemblGenomes-Tr; EBT00001548208.
DR   EnsemblGenomes-Tr; EBT00001548209.
DR   EnsemblGenomes-Tr; EBT00001548210.
DR   EnsemblGenomes-Tr; EBT00001548211.
DR   EnsemblGenomes-Tr; EBT00001548212.
DR   EnsemblGenomes-Tr; EBT00001548213.
DR   EnsemblGenomes-Tr; EBT00001548214.
DR   EnsemblGenomes-Tr; EBT00001548215.
DR   EnsemblGenomes-Tr; EBT00001548216.
DR   EnsemblGenomes-Tr; EBT00001548217.
DR   EnsemblGenomes-Tr; EBT00001548218.
DR   EnsemblGenomes-Tr; EBT00001548219.
DR   EnsemblGenomes-Tr; EBT00001548220.
DR   EnsemblGenomes-Tr; EBT00001548221.
DR   EnsemblGenomes-Tr; EBT00001548222.
DR   EnsemblGenomes-Tr; EBT00001548223.
DR   EnsemblGenomes-Tr; EBT00001548224.
DR   EnsemblGenomes-Tr; EBT00001548225.
DR   EnsemblGenomes-Tr; EBT00001548226.
DR   EnsemblGenomes-Tr; EBT00001548227.
DR   EnsemblGenomes-Tr; EBT00001548228.
DR   EnsemblGenomes-Tr; EBT00001548229.
DR   EnsemblGenomes-Tr; EBT00001548230.
DR   EnsemblGenomes-Tr; EBT00001548231.
DR   EnsemblGenomes-Tr; EBT00001548232.
DR   EnsemblGenomes-Tr; EBT00001548233.
DR   EnsemblGenomes-Tr; EBT00001548234.
DR   EnsemblGenomes-Tr; EBT00001548235.
DR   EnsemblGenomes-Tr; EBT00001548236.
DR   EnsemblGenomes-Tr; EBT00001548237.
DR   EnsemblGenomes-Tr; EBT00001548238.
DR   EnsemblGenomes-Tr; EBT00001548239.
DR   EnsemblGenomes-Tr; EBT00001548240.
DR   EnsemblGenomes-Tr; EBT00001548241.
DR   EnsemblGenomes-Tr; EBT00001548242.
DR   EnsemblGenomes-Tr; EBT00001548243.
DR   EnsemblGenomes-Tr; EBT00001548244.
DR   EnsemblGenomes-Tr; EBT00001548245.
DR   EnsemblGenomes-Tr; EBT00001548246.
DR   EnsemblGenomes-Tr; EBT00001548247.
DR   EnsemblGenomes-Tr; EBT00001548248.
DR   EnsemblGenomes-Tr; EBT00001548249.
DR   EnsemblGenomes-Tr; EBT00001548250.
DR   EnsemblGenomes-Tr; EBT00001548251.
DR   EnsemblGenomes-Tr; EBT00001548252.
DR   EnsemblGenomes-Tr; EBT00001548253.
DR   EnsemblGenomes-Tr; EBT00001548254.
DR   EnsemblGenomes-Tr; EBT00001548255.
DR   EnsemblGenomes-Tr; EBT00001548256.
DR   EnsemblGenomes-Tr; EBT00001548257.
DR   EnsemblGenomes-Tr; EBT00001548258.
DR   EnsemblGenomes-Tr; EBT00001548259.
DR   EnsemblGenomes-Tr; EBT00001548260.
DR   EnsemblGenomes-Tr; EBT00001548261.
DR   EnsemblGenomes-Tr; EBT00001548262.
DR   EnsemblGenomes-Tr; EBT00001548263.
DR   EnsemblGenomes-Tr; EBT00001548264.
DR   EnsemblGenomes-Tr; EBT00001548265.
DR   EnsemblGenomes-Tr; EBT00001548266.
DR   EnsemblGenomes-Tr; EBT00001548267.
DR   EnsemblGenomes-Tr; EBT00001548268.
DR   EnsemblGenomes-Tr; EBT00001548269.
DR   EnsemblGenomes-Tr; EBT00001548270.
DR   EnsemblGenomes-Tr; EBT00001548271.
DR   EnsemblGenomes-Tr; EBT00001548272.
DR   EnsemblGenomes-Tr; EBT00001548273.
DR   EnsemblGenomes-Tr; EBT00001548274.
DR   EnsemblGenomes-Tr; EBT00001548275.
DR   EnsemblGenomes-Tr; EBT00001548276.
DR   EnsemblGenomes-Tr; EBT00001548277.
DR   EnsemblGenomes-Tr; EBT00001548278.
DR   EnsemblGenomes-Tr; EBT00001548279.
DR   EnsemblGenomes-Tr; EBT00001548280.
DR   EnsemblGenomes-Tr; EBT00001548281.
DR   EnsemblGenomes-Tr; EBT00001548282.
DR   EnsemblGenomes-Tr; EPYR_r001-1.
DR   EnsemblGenomes-Tr; EPYR_r002-1.
DR   EnsemblGenomes-Tr; EPYR_r003-1.
DR   EnsemblGenomes-Tr; EPYR_r004-1.
DR   EnsemblGenomes-Tr; EPYR_r005-1.
DR   EnsemblGenomes-Tr; EPYR_r006-1.
DR   EnsemblGenomes-Tr; EPYR_r007-1.
DR   EnsemblGenomes-Tr; EPYR_r008-1.
DR   EnsemblGenomes-Tr; EPYR_r009-1.
DR   EnsemblGenomes-Tr; EPYR_r010-1.
DR   EnsemblGenomes-Tr; EPYR_r011-1.
DR   EnsemblGenomes-Tr; EPYR_r012-1.
DR   EnsemblGenomes-Tr; EPYR_r013-1.
DR   EnsemblGenomes-Tr; EPYR_r014-1.
DR   EnsemblGenomes-Tr; EPYR_r015-1.
DR   EnsemblGenomes-Tr; EPYR_r016-1.
DR   EnsemblGenomes-Tr; EPYR_r017-1.
DR   EnsemblGenomes-Tr; EPYR_r018-1.
DR   EnsemblGenomes-Tr; EPYR_r019-1.
DR   EnsemblGenomes-Tr; EPYR_r020-1.
DR   EnsemblGenomes-Tr; EPYR_r021-1.
DR   EnsemblGenomes-Tr; EPYR_r022-1.
DR   EnsemblGenomes-Tr; EPYR_t001-1.
DR   EnsemblGenomes-Tr; EPYR_t002-1.
DR   EnsemblGenomes-Tr; EPYR_t003-1.
DR   EnsemblGenomes-Tr; EPYR_t004-1.
DR   EnsemblGenomes-Tr; EPYR_t005-1.
DR   EnsemblGenomes-Tr; EPYR_t006-1.
DR   EnsemblGenomes-Tr; EPYR_t007-1.
DR   EnsemblGenomes-Tr; EPYR_t008-1.
DR   EnsemblGenomes-Tr; EPYR_t009-1.
DR   EnsemblGenomes-Tr; EPYR_t010-1.
DR   EnsemblGenomes-Tr; EPYR_t011-1.
DR   EnsemblGenomes-Tr; EPYR_t012-1.
DR   EnsemblGenomes-Tr; EPYR_t013-1.
DR   EnsemblGenomes-Tr; EPYR_t014-1.
DR   EnsemblGenomes-Tr; EPYR_t015-1.
DR   EnsemblGenomes-Tr; EPYR_t016-1.
DR   EnsemblGenomes-Tr; EPYR_t017-1.
DR   EnsemblGenomes-Tr; EPYR_t018-1.
DR   EnsemblGenomes-Tr; EPYR_t019-1.
DR   EnsemblGenomes-Tr; EPYR_t020-1.
DR   EnsemblGenomes-Tr; EPYR_t021-1.
DR   EnsemblGenomes-Tr; EPYR_t022-1.
DR   EnsemblGenomes-Tr; EPYR_t023-1.
DR   EnsemblGenomes-Tr; EPYR_t024-1.
DR   EnsemblGenomes-Tr; EPYR_t025-1.
DR   EnsemblGenomes-Tr; EPYR_t026-1.
DR   EnsemblGenomes-Tr; EPYR_t027-1.
DR   EnsemblGenomes-Tr; EPYR_t028-1.
DR   EnsemblGenomes-Tr; EPYR_t029-1.
DR   EnsemblGenomes-Tr; EPYR_t030-1.
DR   EnsemblGenomes-Tr; EPYR_t031-1.
DR   EnsemblGenomes-Tr; EPYR_t032-1.
DR   EnsemblGenomes-Tr; EPYR_t033-1.
DR   EnsemblGenomes-Tr; EPYR_t034-1.
DR   EnsemblGenomes-Tr; EPYR_t035-1.
DR   EnsemblGenomes-Tr; EPYR_t036-1.
DR   EnsemblGenomes-Tr; EPYR_t037-1.
DR   EnsemblGenomes-Tr; EPYR_t038-1.
DR   EnsemblGenomes-Tr; EPYR_t039-1.
DR   EnsemblGenomes-Tr; EPYR_t040-1.
DR   EnsemblGenomes-Tr; EPYR_t041-1.
DR   EnsemblGenomes-Tr; EPYR_t042-1.
DR   EnsemblGenomes-Tr; EPYR_t043-1.
DR   EnsemblGenomes-Tr; EPYR_t044-1.
DR   EnsemblGenomes-Tr; EPYR_t045-1.
DR   EnsemblGenomes-Tr; EPYR_t046-1.
DR   EnsemblGenomes-Tr; EPYR_t047-1.
DR   EnsemblGenomes-Tr; EPYR_t048-1.
DR   EnsemblGenomes-Tr; EPYR_t049-1.
DR   EnsemblGenomes-Tr; EPYR_t050-1.
DR   EnsemblGenomes-Tr; EPYR_t051-1.
DR   EnsemblGenomes-Tr; EPYR_t052-1.
DR   EnsemblGenomes-Tr; EPYR_t053-1.
DR   EnsemblGenomes-Tr; EPYR_t054-1.
DR   EnsemblGenomes-Tr; EPYR_t055-1.
DR   EnsemblGenomes-Tr; EPYR_t056-1.
DR   EnsemblGenomes-Tr; EPYR_t057-1.
DR   EnsemblGenomes-Tr; EPYR_t058-1.
DR   EnsemblGenomes-Tr; EPYR_t059-1.
DR   EnsemblGenomes-Tr; EPYR_t060-1.
DR   EnsemblGenomes-Tr; EPYR_t061-1.
DR   EnsemblGenomes-Tr; EPYR_t062-1.
DR   EnsemblGenomes-Tr; EPYR_t063-1.
DR   EnsemblGenomes-Tr; EPYR_t064-1.
DR   EnsemblGenomes-Tr; EPYR_t065-1.
DR   EnsemblGenomes-Tr; EPYR_t066-1.
DR   EnsemblGenomes-Tr; EPYR_t067-1.
DR   EnsemblGenomes-Tr; EPYR_t068-1.
DR   EnsemblGenomes-Tr; EPYR_t069-1.
DR   EnsemblGenomes-Tr; EPYR_t070-1.
DR   EnsemblGenomes-Tr; EPYR_t071-1.
DR   EnsemblGenomes-Tr; EPYR_t072-1.
DR   EnsemblGenomes-Tr; EPYR_t073-1.
DR   EnsemblGenomes-Tr; EPYR_t074-1.
DR   EuropePMC; PMC2827408; 20047678.
DR   EuropePMC; PMC3019718; 21037298.
DR   EuropePMC; PMC3890574; 24289541.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00077; SraB.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00106; RNAI.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01385; isrA.
DR   RFAM; RF01396; isrN.
DR   RFAM; RF01402; STnc150.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01728; STAXI.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01748; nuoG.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01794; sok.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; FN392235.
DR   SILVA-SSU; FN392235.
DR   StrainInfo; 150671; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4026286
FT                   /organism="Erwinia pyrifoliae DSM 12163"
FT                   /strain="DSM 12163"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:644651"
FT                   /culture_collection="DSM:12163"
FT   gene            complement(1..591)
FT                   /gene="mioC"
FT                   /locus_tag="EPYR_00001"
FT   CDS_pept        complement(1..591)
FT                   /transl_table=11
FT                   /gene="mioC"
FT                   /locus_tag="EPYR_00001"
FT                   /product="Sulfite reductase"
FT                   /function="Flavodoxins"
FT                   /EC_number="1.8.1.2"
FT                   /note="Sulfite reductase [NADPH] flavoprotein
FT                   alpha-component (SIR-FP), Flavodoxin/nitric oxide synthase,
FT                   Flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00001"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72280"
FT                   /db_xref="GOA:D2TBC9"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBC9"
FT                   /protein_id="CAY72280.1"
FT                   /translation="MVTSGSGPLPFRCFLPGVADGDKKYPYLPTGRSQSDHSVQCPPLS
FT                   HWDQIMADITLISGSTLGSSEYVADHLDEKLSEAGHTATTLHGPELAELKLEGIWIIVT
FT                   STHGAGELPDNIQPLFEAIKEQQPDLSKLRYGAIGLGNREYDLFCGAIQQFDELLTSLG
FT                   AQRIGERLEIDVLEHEIPEDPAGEWIEHWEKLI"
FT   gene            complement(634..1095)
FT                   /gene="asnC"
FT                   /locus_tag="EPYR_00002"
FT   CDS_pept        complement(634..1095)
FT                   /transl_table=11
FT                   /gene="asnC"
FT                   /locus_tag="EPYR_00002"
FT                   /product="Regulatory protein asnC"
FT                   /function="Transcriptional regulators"
FT                   /note="Bacterial regulatory proteins, AsnC/Lrp, AsnC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00002"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72281"
FT                   /db_xref="GOA:D2TBD0"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBD0"
FT                   /protein_id="CAY72281.1"
FT                   /translation="MAENMQPDNLDRGILIALMDNARTAYAELAKQFNVSPGTIHVRVE
FT                   KMKQAGIIKGTRVEIDPKQLGYDVCCFIGIILKSARDYPAAVAKLEQLEEVVEAWYTTG
FT                   HYSIFIKVMCRSIDALQQVLINKIQTIDEIQSTETLISLQNPIMRTIIP"
FT   gene            complement(1213..3372)
FT                   /locus_tag="EPYR_00003"
FT   CDS_pept        complement(1213..3372)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00003"
FT                   /product="Meiotically up-regulated gene 158 protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /note="Sulphate-modifying factor-like, Domain of unknown
FT                   function (DUF323)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00003"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72282"
FT                   /db_xref="GOA:D2TBD1"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR027577"
FT                   /db_xref="InterPro:IPR027625"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBD1"
FT                   /protein_id="CAY72282.1"
FT                   /translation="MARWEHHVTAQQHQTALPAPTRMPTLSGSDPQQKRLEILSYFRQT
FT                   WELYESLFDCLADERAWYNKAISLRHPLIFYYGHTATFYINKLMAGGLIDARIDDKIEA
FT                   TMAIGVDEMSWDDLDNSHYSWPPLAELRDYRGKVRHLIEQFIQQMPLTLPIDWNSPAWV
FT                   ILMGIEHERIHLETSSVLIRQLPLAWVKPQPHWPACPEARHDRQAVPHNSLMAVSAGRV
FT                   TQGKTDDTYGWXNEYGSQVTEVKPFQASRMLVSNAEFFAFIAAGGYQTQRWWDDEGWGW
FT                   REFAGAHMPTFWVGSPQQPEALRLRLLAEEVAMPWDWPAEVNQLEAAAFCRWKAEETGL
FT                   AVQLPSESEWMRLREQVEGDQPDWREAPGNINLARWASSCPVDRFAQGEFYDLVGNVWQ
FT                   WTTTPTSGFPGFRVHPLYDDFSTPTFDGKHTLMKGGSWISTGNEALKSARYAFRRHFFQ
FT                   HAGFRYVVSQHQESLRANPYETDSMVSQYLDFQYGAEYFGVENYAKALAQIACRISQRH
FT                   LRALDIGCATGRASFELARHFDRVVGMDYSARFIDVALQLTRGENFRYVTQEEGDLIEY
FT                   HQVHLQDFDLGPEQAGRIRFVQGDACNLKPQAEAWDLVLAANLLDRLRQPKRFLTDITQ
FT                   MIRPGGVLMLSSPYTWLEEFTPKENWLGGMRENGEALSTYQALQRLLSADFEEIAPPQD
FT                   VPFVIRETARKYQHSVAQLTLWRKR"
FT   gene            complement(3436..4896)
FT                   /gene="yieM"
FT                   /locus_tag="EPYR_00004"
FT   CDS_pept        complement(3436..4896)
FT                   /transl_table=11
FT                   /gene="yieM"
FT                   /locus_tag="EPYR_00004"
FT                   /product="Protein viaA"
FT                   /function="Uncharacterized protein containing a von
FT                   Willebrand factor type A (vWA) domain"
FT                   /note="Protein viaA (VWA domain protein interacting with
FT                   AAA ATPase), von Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00004"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72283"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR023481"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBD2"
FT                   /protein_id="CAY72283.1"
FT                   /translation="MISLDTLSLFLSINENDLVEELIMTLLASPQLAIFFEKFPALKTA
FT                   LTRDLPRRKAEILQQLKSTALPPQLEAEFQRFQQFQTLSLGDFNAGLAELLVWLNQQRS
FT                   TFHQKAQELVDNNDTRQLSSAQQTLFLQRWRLSLTLQTLTLNQQLLDQERERLLAELQQ
FT                   RLAVSGQLAPVLADDDEAAAGRLWDLTRGELQRGDYQLIVQYGDFLASQPELLKLAQQL
FT                   GRSRKAQAVPSDNAPAQTCQQRVREPANVPEEVNGLHQSDDILRLLPPELATLGISELE
FT                   IEFYRRLVEKRLLTYRLQGEGWHNHITQRPVVHPHQDPQQRGPFIVCVDTSGSMGGFNE
FT                   RCAKAFCLALLKVALADNRRCHIMLFAHQVVSYELTAGDGISQAIRFLSQRFRGGTDLT
FT                   ACLEAVLVKLSDPQWHDADAVVLSDFIAQRLPDALVQRVRIHQQQQQQRFHAVAMSDHG
FT                   KPAIMRIFNHIWRFDTGLKSRLLRSWKR"
FT   gene            complement(4893..6386)
FT                   /gene="yieN"
FT                   /locus_tag="EPYR_00005"
FT   CDS_pept        complement(4893..6386)
FT                   /transl_table=11
FT                   /gene="yieN"
FT                   /locus_tag="EPYR_00005"
FT                   /product="ATPase ravA"
FT                   /function="MoxR-like ATPases"
FT                   /EC_number="3.6.3.-"
FT                   /note="ATPase ravA (Regulatory ATPase variant A), AAA+
FT                   ATPase, core, ATPase family associated with various
FT                   cellular activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00005"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72284"
FT                   /db_xref="GOA:D2TBD3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR022547"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041538"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBD3"
FT                   /protein_id="CAY72284.1"
FT                   /translation="MAHSQLLAERISRLSNALEKGLYERHHAIRLCLLAALCGESVFLL
FT                   GPPGIAKSLIARRLKFAFQHARAFEYLMTRFSTPEEVFGPLSIQALKDEGRYQRLTKGY
FT                   LPDAEIVFLDEIWKAGPAILNTLLTAINERRFRNGDSEETIPMRLLVTASNELPEADSG
FT                   LEALYDRMLIRLWLDNVHAKQNFRSLLTHQQDENQNPVAESLRISDEEYQQWQLGISQV
FT                   SLPDDVFELIFMLRERLEGQPEAPYISDRRWKKAIHLLQASAFYSGRNAIAPIDLILLK
FT                   DCLWHDTGSMKLLERELDNLITQYAWQQQPMLFKLQQINARRLALQQQQSVEQAIRLEK
FT                   HGGMFSRKPHYDLPAALAAESLTLMLQKPLTLHEIQVTHIALTREALENWLQKGGEVRG
FT                   KLNGIGFAQILDLHVDDSDCLTLRDISLQVSRLMLPGKAQQGLPEEISQALDELDTRLR
FT                   AQRTLFSQHHRCLFISDDWLAKVEESLQQVAEQLKQARQ"
FT   gene            6644..8512
FT                   /gene="kup"
FT                   /locus_tag="EPYR_00006"
FT   CDS_pept        6644..8512
FT                   /transl_table=11
FT                   /gene="kup"
FT                   /locus_tag="EPYR_00006"
FT                   /product="Potassium transport system protein kup"
FT                   /function="Amino acid transporters"
FT                   /note="K+ potassium transporter, TC 2.A.72.1.1 Low affinity
FT                   potassium transport system protein kup"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00006"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72285"
FT                   /db_xref="GOA:D2TBD4"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBD4"
FT                   /protein_id="CAY72285.1"
FT                   /translation="MSSEKKQSLGAVTLAAIGVVYGDIGTSPLYTLRECLSGQFGFGVE
FT                   HDAVFGFLSLISWLLILIVSLKYLSYVMRADNAGEGGILTLMSLAGRYTGSRATAILVI
FT                   MGLIGGSFFYGEVVITPAVSVLSAMEGLEVIAPSLDRYIVPMAIAVLTLLFVIQKHGTG
FT                   MVGKLFAPVMLLWFIVLAVLGVRGIADNPQVLHALNPYWAAHFFVEYKSVSFFALGAVV
FT                   LAITGVEALYADMGHFGKFPIRLAWFAVVLPSLVLNYFGQGALLLKHPEAIKNPFFLLA
FT                   PEWALIPMLILAALATVIASQAVISGVFSLTRQAVRLGYLPPMRIVYTSEQESGQIYIP
FT                   VINWLLFMAVVLVILGFEHSSNLAAAYGIAVTGTMVLTAILCSTVAIQNWHWNRYLVMM
FT                   LLVGMLCIDVSLFSANVVKLLSGGWLPLSLALVMFIVMTTWKSERFRLLRRIHEHGNSL
FT                   EAMIASLEKSPPVRVPGTAVYMSRALNVIPFAMLHNLKHNKVLHERVVLLTLRTEDAPY
FT                   VHNVKRVTIEQLSPTFWRVVASYGWRETPNVEEIFHRCGLEGLSCRMTETSFFMSHESL
FT                   ILGKRPWYLRLRGKLFLMLQKNALRAPDQFEIPPNRVIELGTQIEI"
FT   gene            complement(8616..14888)
FT                   /locus_tag="EPYR_00007"
FT   CDS_pept        complement(8616..14888)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00007"
FT                   /product="Toxin A"
FT                   /function="FOG: Glucan-binding domain (YG repeat)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00007"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72286"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBD5"
FT                   /protein_id="CAY72286.1"
FT                   /translation="MIEITRENAERAPQLSAANLKSKASRVTNETSPLTIRIKSANKSH
FT                   GHLSKQHDVISSTSPGRRVLNTLKRGLRWRTDEAGKEDVELSAVISEGEALYQEAEALR
FT                   DARSQMNQQQVLPLSLKRKTAFAMGAVVILAGAGLCRRQFSQSGAKTAYEPASSAMADT
FT                   FETANLFSTHSTPLDGEIKVARHVRRHLAIAQQVSTVLPYSGVSQKKLFDYSCQKEREA
FT                   LSFSDVLRNIANTLHSPIEMAGEEWQIVYDYEYLKKGCPKATDKIFLLNIMHYIDSISK
FT                   TILHSFSDLIPLMILQNLIPPVLISIADRLEGKTMDFSLIIEINSEFLSVSQMISASLD
FT                   LHSIKLLSSEQKDPIKDIIPDKLNIKNGGVFVEINGGEFKLNRDSGGVFIYDIEQKSLQ
FT                   LKKHYITYSREKKLWINGKKSIVMSPDNTSGGSVLDAGRRLLAYARNEASKQTSSVDFV
FT                   ISVLAKSGLVDEKTLDLFRNSINKSSSCLNYMEDTINVAELNQLLKIKTGQVVIFMKET
FT                   GKDLYVKQTMLAMGNGLFSGVNNEVLATEFAHDGITLTAEQLGRFKNGDLISSEGNKFK
FT                   VFAGTIKNTRLPFDKSYKDAVLNLENEAYSAGGIHAIGAVLSRTGDLSPELVSVMHEDI
FT                   LNKAPIYPYITADKLWLNNEEIETHIPPGGIIFLTNKPEENYESGIFALRLNDDEYFIP
FT                   ELFEPALKIGGRSTIYKKSELNHQIKERKFWVKPVSFNLQKTRTKALLGKDARFYSFGD
FT                   FLRIRAHGGPRNINYKSPSEIVSIIKGLAKYKDIDLDKINSIEIESCFGASGFPSSGRI
FT                   ISSSMGKRVIAWRGKYRTTNDAESEAKVIYNPTPLTYLEKISAEVKDRNNIFIDKIKGV
FT                   YFYLLNMIKEPPAPAPPRIKRNSRLFNLFLIDLGRLVLGKTDIESFIKNNALFYGHREG
FT                   DITLIRDRLLAYPVKDALAFFELCMEVLYISHEATDYLDAYLSRPVSDEYYSLALTSPP
FT                   PEVSKYETGFNKNVSMTALLDIAYALGISTENMYLSPKSWGQFGFQGDIFLNNKRNKFF
FT                   EFRKEGFPSSHYWHYPADASDDENWLYAGRHPGTIDQPKHWYEYGKAGSVYYDVKHGYL
FT                   ILKTDGRPSDHQWHFPPGGQSDKRWEFITWQAGTFITPLAWNDKGAVGSVYYSDENEAF
FT                   YILRIKGRPSTHGWHYPVEKKDNVYWIYAGKNRGTLDVPKQWYEYGKAGSVYFLVGWGY
FT                   MSLITEGRPSDNNWVYPIVGDSNAYWAFICHEVGSFLSPKLPNVEGTSGEVYYCVQNQA
FT                   FYILRKDGKPARQGWSFPAGKADDGNWIYAGENPGTPDLPKTWTEYGKSGSLYHQPGVG
FT                   YFSLKTEGRPSDNNWQYPDSGKLSQRWKLISWERGSFNAPKSLNEQGKAGDVYYSDEHQ
FT                   SFYILKASGNPSLHGWLFPSNEHDDENWINAGRNKGTPDSPKTWDEYGRAGSLYHQPGY
FT                   GYLTLKTEGRPASSGWRFTDGGQSDRHWKFISWDLGTFDAPKKQNLQGKAGEVYFSGES
FT                   ASFYILRNNKMPLTDDWHFPPGNMDNEHWFYAGKNRGTLESPKPWSEYGKAGSVYFQRE
FT                   YGYLTLKTEGRPPDEKWPFPPEGTSNEYWQFISWEVGSFNAPKQLTAGGVAGEVYYSEE
FT                   HHLFYLLRNAGNPSDNGWSFPPGTADNENWICAGENRGTPESPKAWNEYGKVGSVYYHA
FT                   GYGYLTLKTAGRPSEHNWSFPLSGTSNPHWNVISWLMGSFKNPKNQRVKGTIGEVYYNE
FT                   KNQFLYILKREGTPADNGWHFPSGKTDNANWIYSGENHGTLESPKIWHEYGKAGAVYHT
FT                   FKYGYLVLLTEGRPADNKWYFPPEGQSDSHWKFISWEAGSFTAPKRLTEEGVAGEVYYS
FT                   DENRTFYILRKAGNPASHGWHLPADEEDDANWIYAGKHKGTLHSPKPWEEYGKVGSVYY
FT                   QTGHGFLVLKTAGCPADYQWPFPEPGKSNRHWKFISFKAGAYTAPKRPTEAGVAGEVYY
FT                   CFDNHLFYILRKEGTPSLNGWTFPDGAKDNWNWLYGGENKGTLAYPKNWNEYGKVGSVY
FT                   YKAGYGYHILQTEGSPSTHKWYFPPHGESNDHWTHTERW"
FT   gene            complement(15051..20594)
FT                   /locus_tag="EPYR_00008"
FT   CDS_pept        complement(15051..20594)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00008"
FT                   /product="Glucosyltransferase-I precursor"
FT                   /function="FOG: Glucan-binding domain (YG repeat)"
FT                   /EC_number="2.4.1.5"
FT                   /note="Glucosyltransferase-I precursor (GTF-I)
FT                   (Dextransucrase) (Sucrose 6-glucosyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00008"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72287"
FT                   /db_xref="GOA:D2TBD6"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBD6"
FT                   /protein_id="CAY72287.1"
FT                   /translation="MLTDAGLCLRRSNQYGRPDTRPLHTPEAGSVSSAMATPATPTYSF
FT                   QNHSCRHDEAMKIRQHVRRHQPRSLPLTTALPETDFVRKEPLDFLCAKERQELSFSDVL
FT                   RNIAETLKSPVKKLVEESQIVHTYNSMKKGCPIESDRRYLADIMHYIDVVANKVMSFFP
FT                   EFVPIMILQNIIPPVLQSIADRADGKKMDSDLIMEMNNQLLTLPMLFASSLDLHGRNML
FT                   SEKKRERMSGIIPEKIKVKNGDIYVSISGGEFKMMRDEKGVYIYDIDRKSLQLRKKHIH
FT                   YLRNSRRWMVGKNSKIMLPETGDIESSLERSQRLVTFARNESKKTDRKGSSVKFVIETL
FT                   AKAGLIKKESLHLLQSKITQSAYSFNYIKDLTHITNENQLLRIKQGQVVIFTDTLDSAI
FT                   NVQHIMLATGNGMFAGINNERISIEPGFMNTIITAEQLGLFKNKLLTGREGKQFNVHAG
FT                   FLKETQISLSENYINSVMELEEKTIKSDSTHAIASVLLKTGDLSPEFVSVLSESVGNIN
FT                   HLSKFIKSGSGWLSNEELAERVLPGEMIYLTDNLSGNYDKGTFALRLSKDEFFIPKLFD
FT                   PVLESSVSSTIYKLSALEENIIERNLRVKVVEFNLAGTRTESLLGKDSRFYAVDNVLHV
FT                   RAHGLPMTINYMSPLEIVSIIKGLCTIKAIDLNKISTIVLESCFGATGYPSTGKFISAV
FT                   MNKRVIAYRGKYRTGHGAEEENRVIYNPTPLSYLENIVADITERNIDFMRKLRGVFTYF
FT                   ENTEREPIPSTSQRSKRDNSHFNLLLMDIGRLVLGKKDVNAFINDNAHFFNRNKGEMIL
FT                   PHRKILLHIPKNSYEFFEQCMELIYSNPDITKHLDFYISKTPIDNFDEDIYAQQKKLEL
FT                   RDKQDVARIIVNSITADLNEIANSMGISNVNKYISCKNSNEFGFPGEVYWDDKKKRFFV
FT                   LLHEGIPANHYWNYPDDALDNDHWLYAGRHPGTLAQPKDWYEYGKAGCVYYEENYGYMM
FT                   LKTDGRPSDYLWYFPHNGESSIHWQFIKWKAGTFSSPLDWNDEGISGNAYYYGDNDAFY
FT                   IIKKTGNPSDRDWYFPAIESDNEHWIYAGKNRGNLDSPKEWHEYGQVGSIYYEKEYGYM
FT                   MLKTDGRPSDKSWYFPFKGQSNNRWQFLCFEIGSFESPKLPDNEGLAGEVYYSIEEKTF
FT                   YILRKDGKPSSHGWHFPSDEMDDGNWIYGGKNMGTLNSPKTWYDHGNTGSLYYEDGYGY
FT                   LALKTNGRPSDHGWYFPYGGESDNHWTYISYAEGSFESPKGWGAKGKQGEVYYSDGNKA
FT                   YYILRKQGKPSDHDWHFPEEKGDNENWLYAGENKGTLYSPKKWNEYGIAGSVYYDSHYG
FT                   YSILKTEGKPYDNNWIYPGLGVSNDHWKFISYDVGTFDAPKKWNEEGVAGEVYYSEINH
FT                   SFYILKNTGQPFDNGWHFPSGDNANWIYAGSHRGTLESPKVWNEYGKVGSVYYDAEYGY
FT                   VTLKSEGRPSKNNWFYPKEGRSNAYWNFISWEAGTFEAPKRQEESGVAGEVYYSDVNQL
FT                   FYLIKYSGNPAINEWHFPYGKADNENWAYAGEHKGTLDSPKYWSEYGKAGSIYYKSGHG
FT                   YLILKTEGVPEKNKWYFPNNAESDNHWKFVSYEAGSFTAPKRLNSEGMTGDVYYSDEYE
FT                   NFYILRKSGNPANNGWYFSFDDDTNWFCAGKNKGTLDSTKKWNEYGKPGSLYYDSQYGF
FT                   LTLKTEGRPSDHNWFFPDGAKSNEHWDFISYLAGSFMAPKQLSDKGVAGEIYYSHKLHC
FT                   FFILKRNGTPSTDGWPFPSEKVNNLNWIYAGENKGTLDSPKHWNEYGKAGLIYYKADYG
FT                   YLMLKTEGNPSQNEWYFPLSEKSNSHWVFIKR"
FT   gene            21286..21690
FT                   /gene="ygiW"
FT                   /locus_tag="EPYR_00009"
FT   CDS_pept        21286..21690
FT                   /transl_table=11
FT                   /gene="ygiW"
FT                   /locus_tag="EPYR_00009"
FT                   /product="Protein ygiW precursor"
FT                   /function="Uncharacterized conserved protein"
FT                   /note="Conserved hypothetical protein CHP00156, Domain
FT                   unknown function (DUF388), TIGR00156: conserved
FT                   hypothetical protein TIGR00156"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00009"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72288"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="InterPro:IPR016052"
FT                   /db_xref="InterPro:IPR036700"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBD7"
FT                   /protein_id="CAY72288.1"
FT                   /translation="MIMKKAAVLLALTALISTPLLAAQSGGFVDPDAPAASAQKGGFSG
FT                   PNGTQATVKQAQEMKDDAWVTLRGHIDKRVGDEDYLFRDATGSITVEIDHKRWDGQTIG
FT                   PKDQVELMGKLDKDLNSLELDVKQVRKIAG"
FT   gene            complement(21697..22578)
FT                   /gene="alsR"
FT                   /locus_tag="EPYR_00010"
FT   CDS_pept        complement(21697..22578)
FT                   /transl_table=11
FT                   /gene="alsR"
FT                   /locus_tag="EPYR_00010"
FT                   /product="HTH-type transcriptional regulator alsR"
FT                   /function="Transcriptional regulator"
FT                   /note="LysR-type transcriptional regulator alsR (Als operon
FT                   transcriptional regulator)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00010"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72289"
FT                   /db_xref="GOA:D2TBD8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037410"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBD8"
FT                   /protein_id="CAY72289.1"
FT                   /translation="MELRYLRYFVAVAETRHFTRAADMLGISQPPLSQQIKKLEEEIGT
FT                   PLLKRLTRGVELTDAGEAFYQDARQILELTGHTLEKAKGIARGISGRLSIGFASSTAFH
FT                   PQIFRLLHRFQHRFPAIKLLPREENMAALMHDLQEGLLDAAFVRLPCESSKAFNLKVIA
FT                   IEKMALVLPAKHRLCDTPCLSLAQLQDDPLIMFPREVAPSLYEVIISACLRAGFQPQRL
FT                   QQAPQISSAISMVAAGFGISIVPDSLRSIQLPGVSFHQIDDAVLSSDIALAWRRWDRSP
FT                   AVNHLVTTLADE"
FT   gene            22683..23465
FT                   /gene="alsD"
FT                   /locus_tag="EPYR_00011"
FT   CDS_pept        22683..23465
FT                   /transl_table=11
FT                   /gene="alsD"
FT                   /locus_tag="EPYR_00011"
FT                   /product="alpha-acetolactate decarboxylase"
FT                   /EC_number="4.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00011"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72290"
FT                   /db_xref="GOA:D2TBD9"
FT                   /db_xref="InterPro:IPR005128"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBD9"
FT                   /protein_id="CAY72290.1"
FT                   /translation="MAHSATDCSCVEELTTTVKEMQKERPESVIYQTSLMSALLSGVYD
FT                   GTTTVADLLKKGDFGLGTFNQLDGELIAFNSEVYQLRSDGSARAARSDQKTPFAVMTFF
FT                   HPQYQHRFSGPVTRAEVHQIVDQQVSSDNQFCALRIDGLFSHAQTRTVPCQHRPYRSMP
FT                   EVLGKQPTFEFAQRNGVLIGFRTPQYMQGINVAGYHEHFITDDRQGGGHLLDYQLDHGM
FT                   LTFGEISKLVIDLPGDRDFLQANLSPENLDSAIRSVES"
FT   gene            23485..25164
FT                   /gene="alsS"
FT                   /locus_tag="EPYR_00012"
FT   CDS_pept        23485..25164
FT                   /transl_table=11
FT                   /gene="alsS"
FT                   /locus_tag="EPYR_00012"
FT                   /product="acetolactate synthase large subunit"
FT                   /function="Thiamine pyrophosphate-requiring enzymes
FT                   [acetolactate synthase, pyruvate dehydrogenase
FT                   (cytochrome), glyoxylate carboligase, phosphonopyruvate
FT                   decarboxylase]"
FT                   /EC_number="2.2.1.6"
FT                   /note="Acetolactate synthase, catabolic (ALS), Thiamine
FT                   pyrophosphate enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00012"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72291"
FT                   /db_xref="GOA:D2TBE0"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012782"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBE0"
FT                   /protein_id="CAY72291.1"
FT                   /translation="MKNVTDVQQWAHGADLVAAQLEAQGVKHVFGIPGAKIDKVFDSLL
FT                   DTSIQTIPVRHEANAAFMAAAVGRLTGKAGVALVTSGPGCSNLITGMATATTEGDPLVA
FT                   LGGAVKRADSAKQVHQSMDTVAMFRPVSKYAVEVGSSDAIGEVLSNAFRSAEQGRPGGA
FT                   FVSLPQDIVNEPAHGHLLNTQGHLLLGSAPDAAIAAVAQQIALAKNPVILLGLMASQPA
FT                   NSEALYHLLERSHIPVTSTYQAAGAVRQEHFSRFAGRVGLFNNQAGDRLLRGADLIITI
FT                   GYSPVEYEPAMWNSGTATLVHIDVLPADSDNCYQPDAELVGDIAATLEKLTARINHPLT
FT                   LSPQATEILQDRQQQRELLALRGHQLNQFALHPLRIVRAMQDIINSDVTLTVDMGSFHI
FT                   WIARYLYSFRARQVMISNGQQTMGVALPWAIGAWLVDPSRKVVSVSGDGGFLQSSMELE
FT                   TAVRLGANLLHIIWVDEEYNMVAMQEEKKYQRVSGVKFGPVDFKAYAESFGAAGFAVES
FT                   AEQLEPTLRKAMDVQGPAVVAVPVDYADNHLLMGQLHLSQIL"
FT   gene            25383..25802
FT                   /gene="rbsD"
FT                   /locus_tag="EPYR_00013"
FT   CDS_pept        25383..25802
FT                   /transl_table=11
FT                   /gene="rbsD"
FT                   /locus_tag="EPYR_00013"
FT                   /product="High affinity ribose transport protein rbsD"
FT                   /note="RbsD transport, TC 3.A.1.2.1 High affinity ribose
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00013"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72292"
FT                   /db_xref="GOA:D2TBE1"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBE1"
FT                   /protein_id="CAY72292.1"
FT                   /translation="MKKGTLLHSAISSVIARLGHTDRLVIGDAGLPIPDGSERIDLALT
FT                   PGIPSFLQVVQAVTSEMQVESAIMAQEMRQHNPQRHSELVAMLDALQQQQGNVITIRYI
FT                   SHQQFKQQAQCSQATIRSGEITPYANVILVAGVTF"
FT   gene            25810..27315
FT                   /gene="rbsA"
FT                   /locus_tag="EPYR_00014"
FT   CDS_pept        25810..27315
FT                   /transl_table=11
FT                   /gene="rbsA"
FT                   /locus_tag="EPYR_00014"
FT                   /product="high affinity ribose transport protein"
FT                   /function="ABC-type sugar transport system, ATPase
FT                   component"
FT                   /EC_number="3.6.3.17"
FT                   /note="Ribose import ATP-binding protein rbsA 1, TC
FT                   3.A.1.2.1 Ribose transport ATP-binding protein rbsA"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00014"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72293"
FT                   /db_xref="GOA:D2TBE2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBE2"
FT                   /protein_id="CAY72293.1"
FT                   /translation="MQPLLQLKGIDKSFPGVKALSGAALSVYPGRVMALVGENGAGKST
FT                   MMKVLTGIYARDAGSFLWLGQETLFNGPKASQEAGIGIIHQELNLIPPLSVAENIFLGR
FT                   EPVNRFGRIQWKKMYAAADALLQRLNLRFRSDRLVGELSIGDRQMVEIAKVLSYESKVV
FT                   VMDEPTDALTDTETASLFRVIGELKAQGCGIVYISHRMKEIFAICDDVTIFRDGQFIAE
FT                   YNVAALNEASLIEMMVGRKLEEQYPRVHNAPGEVRLKVENLSGSGVENVSFTLRKGEIL
FT                   GVAGLMGAGRSELMKVLYGALPRSKGRVTLEGKAVLARSPQEGLANGIVYISEDRKHDG
FT                   LVLGMSVKENMSLTALNHFSYGAGRLKHAQEQQAVEDFIKLFNVKTPSMDQAIGLLSGG
FT                   NQQKVAIARGLMTRPKVLILDEPTRGVDVGAKKEIYQLINQFKQEGLSIILVSSDLPEV
FT                   LGMSDRVLVMHEGRLNGDFPIEQASQEMLMAAAVGKHDSTERV"
FT   gene            27318..28286
FT                   /gene="rbsC"
FT                   /locus_tag="EPYR_00015"
FT   CDS_pept        27318..28286
FT                   /transl_table=11
FT                   /gene="rbsC"
FT                   /locus_tag="EPYR_00015"
FT                   /product="Ribose transport system permease protein rbsC"
FT                   /function="Ribose/xylose/arabinose/galactoside ABC-type
FT                   transport systems, permease components"
FT                   /note="Ribose transport system permease protein, TC
FT                   3.A.1.2.1 Ribose transport system permease protein rbsC"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00015"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72294"
FT                   /db_xref="GOA:D2TBE3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBE3"
FT                   /protein_id="CAY72294.1"
FT                   /translation="MSTHILSSRSLITKAWLLEQKSLIALVLLIAIVSSISPNFFTVGN
FT                   LFNILQQTSVNAIMAVGMTLVILTSGIDLSVGSLLALTGAVAASLVGLEVNALVAVAAS
FT                   LVLGAGIGAITGLIVAKGNVQAFIATLVMMLLLRGVTMVYTNGSPVNTGFSDNADLFGW
FT                   FGIGRPLGIPTPVWLMAVVFLAAWYMLHHTRLGRYIYALGGNEAATRLSGISVNRVKII
FT                   VYSLCGMLAALAGTIEVARLSSAQPTAGTGYELDAIAAVVLGGTSLAGGKGRIMGTLIG
FT                   ALILGFLNNGLNLLGVPSYYQTIVKAVVILLAVLVDNKSSK"
FT   gene            28436..29317
FT                   /gene="rbsB"
FT                   /locus_tag="EPYR_00016"
FT   CDS_pept        28436..29317
FT                   /transl_table=11
FT                   /gene="rbsB"
FT                   /locus_tag="EPYR_00016"
FT                   /product="D-ribose transport periplasmic binding protein
FT                   precursor"
FT                   /function="ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /note="D-ribose-binding periplasmic protein
FT                   precursor,Periplasmic binding protein/LacI transcriptional
FT                   regulator, TC 3.A.1.2.1 D-ribose-binding periplasmic
FT                   protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00016"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72295"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBE4"
FT                   /protein_id="CAY72295.1"
FT                   /translation="MKMKKWTMLALLLGATLSANALAKETITLVVSTLNNPFFVSLKEG
FT                   AQKEADKLGYHLVVLDSQNNPAKELANVQDLTVRGSKLLLLNPTDSDAVGNAVKMANQA
FT                   NIPVITLDRLATQGKVVSHVASDNRAGGKLAGDYMAQKVGEGAKIIELQGIAGTSAARE
FT                   RGEGFKQAAVAHKFNILASQPADFDRTRGLNVMQNLLTAHPDVQAVFAQNDEMALGALR
FT                   ALQTAGKTDVVVVGFDGTPDGIKAVQGGKLAATVAQLPEQIGAIGVETADKVLKGQQVP
FT                   AINPVELKLVTP"
FT   gene            29379..30308
FT                   /gene="rbsK"
FT                   /locus_tag="EPYR_00017"
FT   CDS_pept        29379..30308
FT                   /transl_table=11
FT                   /gene="rbsK"
FT                   /locus_tag="EPYR_00017"
FT                   /product="ribokinase"
FT                   /function="Sugar kinases, ribokinase family"
FT                   /EC_number="2.7.1.15"
FT                   /note="Ribokinase, bacterial, pfkB family carbohydrate
FT                   kinase, D_ribokin_bact: ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00017"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72296"
FT                   /db_xref="GOA:D2TBE5"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBE5"
FT                   /protein_id="CAY72296.1"
FT                   /translation="MKKTGRLAVLGSINADHILNLAHFPRPGETVIGKQYQVAFGGKGA
FT                   NQAVAAARSGADMAFIACVGEDDIGGRIRQQLANDRIDVASVAVISGGATGVALIFVNG
FT                   EGENTIGIYAGANAALTPERVLEHQQTIAQAQVLLMQLESPLDSVLAAARIAQHHHTRV
FT                   VLNPAPATQLSDELLALVDIITPNETEAQILTGIAVNSDEDAARAAQKLHEKGIATVLI
FT                   TLGSRGVWLSEQGNGHCVPAFSVAAVDTIAAGDTFNGALMTALLEQRPMTESVRFAHAA
FT                   AAIAVTRHGAQPSVPWRDEIDSFLQRRG"
FT   gene            30311..31312
FT                   /gene="rbsR"
FT                   /locus_tag="EPYR_00018"
FT   CDS_pept        30311..31312
FT                   /transl_table=11
FT                   /gene="rbsR"
FT                   /locus_tag="EPYR_00018"
FT                   /product="HTH-type ribose operon repressor rbsR"
FT                   /function="Transcriptional regulators"
FT                   /note="Ribose operon repressor, Periplasmic binding
FT                   protein/LacI transcriptional regulator, Periplasmic binding
FT                   proteins and sugar binding domain of the LacI family, ccpA:
FT                   catabolite control protein A"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00018"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72297"
FT                   /db_xref="GOA:D2TBE6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBE6"
FT                   /protein_id="CAY72297.1"
FT                   /translation="MATMKDVARLAGVSTSTVSYVINNNRFVSPAVREKVTSAVRQLNY
FT                   APSALARSLKLNQTRTIGMLLTASSNPFYAEVVRGVERSCYERGYSLVLCNTEGDEDRM
FT                   NRSLETLMQKRVDGLLIMCTESHLPSADILSRYPGVPAVMMDWAPFEWSKDIIQDNALL
FT                   GGNVATRHLISRGYSRIACITGPLDKTPARMRLKGYQQAMANAGLTIPAGYIMSSDFEF
FT                   QGGFNAMNELLALRPAPQAVFACNDAMAVGVYHALYQAGMSIPQDMAVVGYDDIELARY
FT                   LTPPLSTIHQPKDELGELAINALLHRLADPMAETQLLVLTPELIERASVDEI"
FT   gene            complement(31309..32706)
FT                   /gene="yieO"
FT                   /locus_tag="EPYR_00019"
FT   CDS_pept        complement(31309..32706)
FT                   /transl_table=11
FT                   /gene="yieO"
FT                   /locus_tag="EPYR_00019"
FT                   /product="putative major facilitator superfamily
FT                   transporter"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /note="Major Facilitator Superfamily, TC 9.B.70.1.1 Inner
FT                   membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00019"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72298"
FT                   /db_xref="GOA:D2TBE7"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBE7"
FT                   /protein_id="CAY72298.1"
FT                   /translation="MIKSARSMAGLPWIAAMAFFMQALDATILNTALPAIAQSMERSPL
FT                   AMQSTIISYTLTVAMLIPVSGWLADRFSTRRVFISAVFLFSLGSLACALSGSLEMLVAS
FT                   RIVQGVGGAMMMPVARLALLRAYPRSELLQVLNFVTMPGLVGPVLGPLLGGVLVTWASW
FT                   QWIFLINIPIGVLGIFFARKYMPDFTTPKRRFDVLGFLLFGLGLVGISSGIELFGERVV
FT                   SSLIALVVLLAGIALLLLYIVHARRHPSPMIPLPIFKTRTFSVGIVGNIFSRLGTGSVP
FT                   FLMPLMLQVGFGYTALLAGCMMAPLALGSVLAKSMVTSVLRGFGYRKTLGGISVIIGVL
FT                   VASFSLQSENWNILALLIPLFILGLAMSTQFTAMNTITLADLNDGSASSGNSLLAVTQQ
FT                   LAIGFGVAVSAAVLRFYEDFGGGTLYQFHATFLTMGIVTVLSALVFLLLKPGDGGNLIS
FT                   DRDKQKT"
FT   gene            33276..34803
FT                   /locus_tag="EPYR_r001"
FT   rRNA            33276..34803
FT                   /locus_tag="EPYR_r001"
FT                   /product="16S ribosomal RNA"
FT   gene            34880..34955
FT                   /locus_tag="EPYR_t001"
FT   tRNA            34880..34955
FT                   /locus_tag="EPYR_t001"
FT                   /product="tRNA-Glu"
FT                   /anticodon="(pos:34914..34916,aa:Glu)"
FT   gene            35183..38177
FT                   /locus_tag="EPYR_r002"
FT   rRNA            35183..38177
FT                   /locus_tag="EPYR_r002"
FT                   /product="23S ribosomal RNA"
FT   gene            38415..38529
FT                   /locus_tag="EPYR_r003"
FT   rRNA            38415..38529
FT                   /locus_tag="EPYR_r003"
FT                   /product="5S RNA"
FT   gene            complement(38617..39180)
FT                   /gene="mobA"
FT                   /locus_tag="EPYR_00020"
FT   CDS_pept        complement(38617..39180)
FT                   /transl_table=11
FT                   /gene="mobA"
FT                   /locus_tag="EPYR_00020"
FT                   /product="probable molybdopterin-guanine dinucleotide
FT                   biosynthesis protein A"
FT                   /function="Molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A"
FT                   /note="Molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A, molyb_mobA: molybdopterin-guanine dinucleotide
FT                   biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00020"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72299"
FT                   /db_xref="GOA:D2TBE8"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBE8"
FT                   /protein_id="CAY72299.1"
FT                   /translation="MTKLPVTGVILAGGRSSRMGGADKGLIKWHNQPLYQHVLQRLQPQ
FT                   VTTVWISANRNIEVYQQSGVPVIRDTMADFPGPLAGILAALQQVETDWVVFTSCDTPCL
FT                   PENMAQHLWLYRGKARAVWARTGERDHPTQVLLHRSLADSLQQYLMQGDRKLMLFLQQA
FT                   GGHSVLFAQGEPAFRNFNYPEDLL"
FT   gene            39560..40552
FT                   /gene="yihE"
FT                   /locus_tag="EPYR_00021"
FT   CDS_pept        39560..40552
FT                   /transl_table=11
FT                   /gene="yihE"
FT                   /locus_tag="EPYR_00021"
FT                   /product="Protein rdoA"
FT                   /function="Putative homoserine kinase type II (protein
FT                   kinase fold)"
FT                   /note="Protein kinase-like, Phosphotransferase enzyme
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00021"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72300"
FT                   /db_xref="GOA:D2TBE9"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBE9"
FT                   /protein_id="CAY72300.1"
FT                   /translation="MPEPAFNFDTLTPDTILDALWGTGLRVESGLTALNSYENRVYQFF
FT                   DDEKRRYVAKFYRPQRWSQAQIAEEHQFSAELLADEIPIAAPLMLQEAMLHQHQGFWFA
FT                   VFPSLGGRQYETDNYDHLEWVGRFLGRIHQVGQRREFSARPTIGLQEYIDQPLQILSTS
FT                   PLVPAKLKDQLLTCVERLRATLLNCWHTQWQPLRLHGDCHPGNILWRDGPLFVDLDDAR
FT                   NGPAIQDLWMLVNGDRREQRLQWEILLEAYGEFCEFDTHQLSLIEPLRAMRMVYYLAWV
FT                   VRRWQDPAFPVNFPWMTDEDFWRRQISIFNEQNKLLQEPPLQLLPVFPV"
FT   gene            40602..41231
FT                   /gene="dsbA"
FT                   /locus_tag="EPYR_00022"
FT   CDS_pept        40602..41231
FT                   /transl_table=11
FT                   /gene="dsbA"
FT                   /locus_tag="EPYR_00022"
FT                   /product="Thiol:disulfide interchange protein dsbA
FT                   precursor"
FT                   /function="Thiol-disulfide isomerase and thioredoxins"
FT                   /note="Thioredoxin fold, DSBA-like thioredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00022"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72301"
FT                   /db_xref="GOA:D2TBF0"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBF0"
FT                   /protein_id="CAY72301.1"
FT                   /translation="MKKIWLALVGMVLAFSASAAPFTNGQQYVTLDKPVTGEPQVLEFF
FT                   SFYCPHCYEFERVWHVSEAVKKNLPANVKVTKYHVEFLGGDMGKAVTQAWAVAMALGVE
FT                   DKVTAPVFEGIQKTQTITDPATLKETFVKAAGIKPADYDAAWNSFVVRSLVAQQEKAAA
FT                   DMDLRGVPAMFVNGKYMVNSGGLDTSSMDNYVQQYANLVNFLTTQK"
FT   gene            41277..41387
FT                   /locus_tag="EPYR_00023"
FT   CDS_pept        41277..41387
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00023"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72302"
FT                   /db_xref="GOA:D2TBF1"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBF1"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72302.1"
FT                   /translation="MTIISCHYPHKVGFYPLNISHIYVDVLIYIHIALVV"
FT   gene            41641..44430
FT                   /gene="polA"
FT                   /locus_tag="EPYR_00024"
FT   CDS_pept        41641..44430
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="EPYR_00024"
FT                   /product="DNA polymerase I"
FT                   /function="DNA polymerase I - 3'-5' exonuclease and
FT                   polymerase domains"
FT                   /EC_number="2.7.7.7"
FT                   /note="DNA polymerase A"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00024"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72303"
FT                   /db_xref="GOA:D2TBF2"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBF2"
FT                   /protein_id="CAY72303.1"
FT                   /translation="MAQIAENPLILVDGSSYLYRAYHAFPPLTNSAGEPTGAMYGVLNM
FT                   LRSLLLQYKPSHVAVVFDAKGKTFRDELFDAYKSHRPPMPDDLRAQIEPLHKMVKAMGL
FT                   PLLAISGVEADDVIGTLALEAEKAGRAVLISTGDKDMAQLVTPDITLINTMNNAILGPD
FT                   EVVEKYGIPPSLMIDFLALMGDSSDNIPGVAGVGEKTAQALLQGLGGVKEIYDNLDKVA
FT                   TLTFRGAKTMAARLEQNKEMALLSYQLATIKTDVELELTSDQLTVEEPAVEELLALFKH
FT                   YEFKRWITDLEDGKWLQGNKGSPSTKKKAAVQNEPAVAEATSMLSSDGYVTILDEDTFT
FT                   SWLKKLQDSELFAFDLETDSLDTLSANIIGLSFATAPGEAAYLPVAHDYLDAPEQLDRS
FT                   DVLARLKPLLEDPQAQKVGQNLKFDRGVLKRYDIELQGIRFDTMLESYALNSVAGRHDM
FT                   DTLASRWLNHKTVTFEEIAGKGKNQLTFNQIALEQAAHYAAEDADVTLQLHVKMWPELE
FT                   KEQGPKNVFEQVEMPLVPVISRIERNGVLIDPGILATHSQELGSRLAELELKAHELAGE
FT                   PFNLSSPKQLQTILFEKQGIKPTKKTPGGAPSTSEEVLAELALDYPLPKVILEHRGLAK
FT                   LKSTYTDKLPLMINPHSGRVHTSYHQTVTATGRLSSSDPNLQNIPVRNDEGRRIRQAFI
FT                   APQGHRIVAADYSQIELRIMAHLSQDKGLLSAFASEQDIHRATAAEVFGVSLDKVSGEQ
FT                   RRSAKAINFGLIYGMSAFGLSRQLNIGAGEAKKYMDLYFERYPGVLQYMESTRELAAQK
FT                   GYVSTLDGRRLYLPDIKASNAMRRKAAERAAINAPMQGTAADIIKRAMIAVDRWLEQQP
FT                   SPEVKMIMQVHDELVFEVHADAVEAACAQIRALMEGSMKLDVPLRVDIGVGDNWDQAH"
FT   gene            44778..44897
FT                   /locus_tag="EPYR_00025"
FT   CDS_pept        44778..44897
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00025"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72304"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBF3"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72304.1"
FT                   /translation="MTGAFFIACRLDFCVPAAPGHLSYCMINACVFYAFAARG"
FT   gene            complement(44919..45548)
FT                   /gene="yihA"
FT                   /locus_tag="EPYR_00026"
FT   CDS_pept        complement(44919..45548)
FT                   /transl_table=11
FT                   /gene="yihA"
FT                   /locus_tag="EPYR_00026"
FT                   /product="probable GTP-binding protein engB"
FT                   /function="Predicted GTPase"
FT                   /note="GTP-binding protein, HSR1-related, GTPase of unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00026"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72305"
FT                   /db_xref="GOA:D2TBF4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBF4"
FT                   /protein_id="CAY72305.1"
FT                   /translation="MSGWNYHLTHFVTSAPDIRHLPADTGIEVAFAGRSNAGKSSALNT
FT                   LTNQRSLARTSKTPGRTQLINLFQVAEGYRLVDLPGYGYAEVPEETKLKWQRSLAEYLH
FT                   DRHCLKGLVVLMDIRHPLKELDRQMVLWAVQSGREVLVLLTKADKLASGARKAQLNAVR
FT                   EEAKTFLGTVEVELFSSLKKIGVDKLSQKLDSWYRDLPPATEENAV"
FT   gene            46110..46634
FT                   /gene="yihI"
FT                   /locus_tag="EPYR_00027"
FT   CDS_pept        46110..46634
FT                   /transl_table=11
FT                   /gene="yihI"
FT                   /locus_tag="EPYR_00027"
FT                   /product="UPF0241 protein in hemN 3'region (orf2)"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="Protein of unknown function DUF414, Protein of
FT                   unknown function, DUF414"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00027"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72306"
FT                   /db_xref="GOA:D2TBF5"
FT                   /db_xref="InterPro:IPR007336"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBF5"
FT                   /protein_id="CAY72306.1"
FT                   /translation="MKQPARTPQDKKPASRVKRKTREEINQEARDRKRDKKHSGNTSGS
FT                   RANPVTGSQKGDKSKPAKDPRIGSKKAIALGADIVPTKPVKAAKPAVAKKPRLSPEEEL
FT                   AMLENDPRLDALLDRLENGETLSAEDQAWLDQSLDRIDALMEQLGIALDDDAADDEQAE
FT                   EDMYRLLKGNH"
FT   gene            46890..48263
FT                   /gene="hemN"
FT                   /locus_tag="EPYR_00028"
FT   CDS_pept        46890..48263
FT                   /transl_table=11
FT                   /gene="hemN"
FT                   /locus_tag="EPYR_00028"
FT                   /product="O2-independent coproporphyrinogen III oxidase"
FT                   /function="Coproporphyrinogen III oxidase and related Fe-S
FT                   oxidoreductases"
FT                   /EC_number="1.3.99.22"
FT                   /note="Oxygen-independent coproporphyrinogen III oxidase
FT                   (Coproporphyrinogenase) (Coprogen oxidase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00028"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72307"
FT                   /db_xref="GOA:D2TBU3"
FT                   /db_xref="InterPro:IPR004558"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBU3"
FT                   /protein_id="CAY72307.1"
FT                   /translation="MQIQTTEWDLPLIEKYNLSGPRYTSYPTALEFHQNYDEQAFLQAA
FT                   LRYPERPLSLYLHIPFCHRLCYFCGCNKQVTRQQHKADDYLAALMLEIAARARLFQQRT
FT                   VSQMHWGGGTPTFLNKEQIGRLMACLRQHFHFSDTAEISIEVDPREIELDVLDHLRAEG
FT                   FNRLSMGVQDFNKQVQEKVNRVQDEETIFALVARARQLGFISTNIDLIYGLPAQTPESF
FT                   AFTLQKVAELNPDRLSVFNYAHMPALFAAQRKIREAELPDAQQKLAILQQTIATLTAQD
FT                   YQFIGMDHFARRDDELAVAQRAGELHRNFQGYTTQGNCDLLGMGVSAISRLGDSYAQNH
FT                   KELKHYYAQIHASNTALWRGLQLTEDDCLRSDVIKRLICHFSLSFKSIETRWGIRFRDY
FT                   FAQDLAQLQPLIADGLVECHDNALVVTAKGRLLIRNICMCFDRYLRQKTSGARFSRVI"
FT   gene            complement(48327..49736)
FT                   /gene="glnG"
FT                   /locus_tag="EPYR_00029"
FT   CDS_pept        complement(48327..49736)
FT                   /transl_table=11
FT                   /gene="glnG"
FT                   /locus_tag="EPYR_00029"
FT                   /product="Transcriptional regulatory protein glnG"
FT                   /function="Response regulator containing CheY-like
FT                   receiver, AAA-type ATPase, and DNA-binding domains"
FT                   /note="Nitrogen regulation protein NR(I), DNA-binding
FT                   response regulator in two-component regulatory system with
FT                   GlnL: response regulator/sigma54 interaction protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00029"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72308"
FT                   /db_xref="GOA:D2TBU4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBU4"
FT                   /protein_id="CAY72308.1"
FT                   /translation="MQRGIVWIVDDDSSIRWVLERALTGAGLQCAAFESANEVLEALAT
FT                   KTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPK
FT                   PFDIDEAVALVERAISHYQEQQQPRNQSVSGPTTDIIGEAPAMQDVFRIIGRLSRSSIS
FT                   VLINGESGTGKELVAHALHRHSPRAKAPFIALNMAAIPKDLIESELFGHEKGAFTGANQ
FT                   IRQGRFEQADGGTLFLDEIGDMPLDVQTRLLRVLADGQFYRVGGYAPVKVDVRIIAATH
FT                   QNLERRVQEGKFREDLFHRLNVIRVHLPPLRERREDIPRLAGYFLQVAARELGVEAKIL
FT                   HPETETALTRLHWSGNVRQLENTCRWLTVMAAGQEVLIQDLPPELFETATPENPAQSLP
FT                   DSWVTLLAQWADRALRSGHQNLLSEAQPELERTLLTTALRHTQGHKQEAARLLGWGRNT
FT                   LTRKLKELGME"
FT   gene            complement(49744..50793)
FT                   /gene="glnL"
FT                   /locus_tag="EPYR_00030"
FT   CDS_pept        complement(49744..50793)
FT                   /transl_table=11
FT                   /gene="glnL"
FT                   /locus_tag="EPYR_00030"
FT                   /product="histidine protein kinase sensor for GlnG
FT                   regulator (nitrogen regulator II, NRII)"
FT                   /function="Signal transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="histidine protein kinase sensor for GlnG regulator
FT                   (nitrogen regulator II, NRII), Two-component nitrogen
FT                   regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00030"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72309"
FT                   /db_xref="GOA:D2TBU5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBU5"
FT                   /protein_id="CAY72309.1"
FT                   /translation="MATGTLPDAGQILNSLINSILLVDGELVIHYANPAAQQLLAQSSR
FT                   KLFGTPLPELMGYFSLNIEVMLESLDAGQGFTDSEVTLVVDSRAHIMSLTAQRLPDGLI
FT                   LLEMAPMDNQRRLSQEQLQHAQQVAARDLVRGLAHEIKNPLGGLRGAAQLLAKALPDPA
FT                   LTEYTKVIIEQADRLRNLVDRLLGPQQPGMHITQSIHQVAERVVNLVSMELPDNVSLVR
FT                   DYDPSLPELPHDPDQIEQVLLNIVRNALQALGAEGGTITLRTRTAFQLTLHGTRYRLVA
FT                   RIDIEDDGPGIPAQLQDTLFYPMVSGREGGTGLGLSIARSLIDQHSGKIEFNSWPGHTE
FT                   FSVYLPIRQ"
FT   gene            complement(50984..52393)
FT                   /gene="glnA"
FT                   /locus_tag="EPYR_00031"
FT   CDS_pept        complement(50984..52393)
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="EPYR_00031"
FT                   /function="Glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /note="Glutamine synthetase (Glutamate-ammonia ligase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00031"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72310"
FT                   /db_xref="GOA:D2TBU6"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBU6"
FT                   /protein_id="CAY72310.1"
FT                   /translation="MSAEHVLSMMNEHEVKFVDLRFTDTKGKEQHVTIPAHQVNADFFE
FT                   EGKMFDGSSIGGWKGINESDMVLMPDATTAVLDPFFEDSTLIVRCDILEPGTMQGYDRD
FT                   PRSIAKRAEDFLRSSGIADTVLFGPEPEFFLFDDIRFGSSTSGSHVAIDDIEACWNTGK
FT                   EYEGGNKGHRPGLKGGYFPVPPVDSSQDIRSAMCLTMEQMGLVVEAHHHEVATAGQNEV
FT                   ATRFNTMTKKADEIQIYKYVVHNVAHAYGKTATFMPKPMFGDNGSGMHCHMSLSKGGTN
FT                   LFAGDKYGGLSETALFYIGGVIKHAKAINALANPTTNSYKRLVPGYEAPVMLAYSARNR
FT                   SASIRIPVVASPKARRIEARFPDPAANPYLCFAALLMAGLDGIINKIHPGDAMDKNLYD
FT                   LPPEEEAEIPKVAGSLDEALAALNEDREFLTRGGVFTDDAIEAYIELRKAEMERVRMTP
FT                   HPVEFELYYSV"
FT   gene            52829..54652
FT                   /gene="typA"
FT                   /locus_tag="EPYR_00032"
FT   CDS_pept        52829..54652
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="EPYR_00032"
FT                   /product="GTP-binding protein"
FT                   /function="Predicted membrane GTPase involved in stress
FT                   response"
FT                   /EC_number="2.7.7.4"
FT                   /note="GTP-binding protein TypA, Elongation factor Tu GTP
FT                   binding domain, TypA_BipA: GTP-binding protein TypA"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00032"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72311"
FT                   /db_xref="GOA:D2TBU7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBU7"
FT                   /protein_id="CAY72311.1"
FT                   /translation="MIENLRNIAIIAHVDHGKTTLVDKLLQQSGTFDARTEATERVMDS
FT                   NDLEKERGITILAKNTAIKWNDYRINIVDTPGHADFGGEVERVMSMVDSVLLVVDAMDG
FT                   PMPQTRFVTKKAFANGLKPIVVINKVDRPGARPDWVVDQVFDLFVNLDATDEQLDFPVI
FT                   YASALNGIAGLDHSDMAEDMTPLYEAIVKHVSPPQVEMEAPFQMQISQLDYNNYVGVIG
FT                   IGRIKRGKVKPNQQVTIVDSEGKTRNGKVGKVLTHLGLERIDATEAEAGDIIAITGLGE
FT                   LNISDTICDPQNVEALPALSVDEPTVTMYFNVNTSPFCGKEGKFVTSRQILDRLNKELV
FT                   HNVALRVEETEDSDAFRVSGRGELHLSVLIENMRREGFEIAVSRPKVINRKIDGRMQEP
FT                   FENVTLDIEEQHQGSVMQAMGERKGDVKDMIPDGKGRIRLDYLIPARGLIGFRTEFMTM
FT                   TSGTGLLYSTFSHYDDVRAGEIGQRQNGVLISNGQGKAVAFALFSLQDRGKLFLGHGAE
FT                   VYEGQIIGIHSRSNDLTVNCLTGKKLTNMRASGTDEATTLVPAIKMSLEQALEFIDDDE
FT                   LVEVTPQSVRIRKRHLTENDRKRASRGPKEA"
FT   gene            54853..55464
FT                   /gene="yihX"
FT                   /locus_tag="EPYR_00033"
FT   CDS_pept        54853..55464
FT                   /transl_table=11
FT                   /gene="yihX"
FT                   /locus_tag="EPYR_00033"
FT                   /product="Acyl-CoA dehydrogenase family member 10
FT                   (ACAD-10)"
FT                   /function="Predicted hydrolase (HAD superfamily)"
FT                   /note="Haloacid dehalogenase-like hydrolase, haloacid
FT                   dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00033"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72312"
FT                   /db_xref="GOA:D2TBU8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBU8"
FT                   /protein_id="CAY72312.1"
FT                   /translation="MLYIFDLGNVIVDIDFNRVLGVWSDLGRVPLATLQSRFQMGESFY
FT                   QHERGEISDEEFARQICDELELPLSYEQFAAGWQAVFVGVRPEVIAIMHQLREQGDRVV
FT                   ILSNTNRLHCQFWPSQYPEVQAAADKIYVSQEMGLRKPDPAIYQRLLNEEETSAEEAIF
FT                   FDDNPENIEAARALGIHSLHITDDRVIPAFFADRMPDERR"
FT   gene            55468..56340
FT                   /gene="rbn"
FT                   /locus_tag="EPYR_00034"
FT   CDS_pept        55468..56340
FT                   /transl_table=11
FT                   /gene="rbn"
FT                   /locus_tag="EPYR_00034"
FT                   /product="tRNA processing exoribonuclease BN"
FT                   /function="Predicted membrane protein"
FT                   /EC_number="3.1.-.-"
FT                   /note="tRNA-processing ribonuclease BN (RNase BN)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00034"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72313"
FT                   /db_xref="GOA:D2TBU9"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBU9"
FT                   /protein_id="CAY72313.1"
FT                   /translation="MRPLNHFLHRLRAFCAWIKLLCQRIDEDAMTVLAGHLAYVSLLSL
FT                   VPLIAVVFALFSAFPMFSDVSVQLKNFVINNFVPAAGTTVQNYLEQFVANVSKMTAVGV
FT                   GGLVVTALLLMYSIDSALNTIWRSKVKRSLVYSLAVYWMILTLGPLLAGASLAISSYLL
FT                   SLHWATIGGVSGLVDIVLRIFPLLLSCLSFWLLYSLVPTTPVAGRDALVGAIVGGVLFE
FT                   LGKKGFALYITLFPSYQLIYGVLAAVPILFIWIYWTWCIVLLGAEITATLADYRRLKQE
FT                   EQERENEGS"
FT   gene            56337..56774
FT                   /gene="dtd"
FT                   /locus_tag="EPYR_00035"
FT   CDS_pept        56337..56774
FT                   /transl_table=11
FT                   /gene="dtd"
FT                   /locus_tag="EPYR_00035"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /function="D-Tyr-tRNAtyr deacylase"
FT                   /EC_number="3.1.-.-"
FT                   /note="D-tyrosyl-tRNA(Tyr) deacylase, D-Tyr-tRNA(Tyr)
FT                   deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00035"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72314"
FT                   /db_xref="GOA:D2TBV0"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBV0"
FT                   /protein_id="CAY72314.1"
FT                   /translation="MIALIQRARQASVAVAGETIGEIGAGLLILLGVEKGDSPESARKL
FT                   ADKVLGYRIFADEDDKMNLNVLQAGGSVLVVSQFTLAADTKKGMRPSFSGGAAPADAEK
FT                   LYDYFAACCREKGVTTETGRFAADMTVALINDGPVTFWLQV"
FT   gene            56834..57772
FT                   /gene="yiiD"
FT                   /locus_tag="EPYR_00036"
FT   CDS_pept        56834..57772
FT                   /transl_table=11
FT                   /gene="yiiD"
FT                   /locus_tag="EPYR_00036"
FT                   /product="putative acetyltransferase"
FT                   /function="Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /EC_number="2.3.1.18"
FT                   /note="GCN5-related N-acetyltransferase, putative
FT                   thioesterase (yiiD_Cterm), yiiD_Cterm: thioesterase domain,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00036"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72315"
FT                   /db_xref="GOA:D2TBV1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBV1"
FT                   /protein_id="CAY72315.1"
FT                   /translation="MYHLRVPETAEELDIYYLFRWEMLRKPLHQPMGSERDAWDALAHH
FT                   QMVVDEQGDPVAIGRLYINADNEAAIRFLAVHPAVQGKGLGTLVAMTLESVARQEGVKR
FT                   VVCSAREDAVDFFAKLGYFNQGEITAPQTTPVRHFLMIKPVVTLDDILHRADWCGQLQQ
FT                   AWYQHIPLSEKMGVRILQYTGQKFATTMPETGNQNPHHTLFAGSLFSLATLTGWGLIWL
FT                   LLRERQLGGTIILADAHIRYSKPISGKPGAVANLGSLSGDLDRLARGRKARVKLEVQLF
FT                   GNEECGAVFEGVYIVLPADPDGPLEEGGCGV"
FT   gene            complement(57780..58658)
FT                   /gene="yjbC"
FT                   /locus_tag="EPYR_00037"
FT   CDS_pept        complement(57780..58658)
FT                   /transl_table=11
FT                   /gene="yjbC"
FT                   /locus_tag="EPYR_00037"
FT                   /product="putative pseudouridylate synthase"
FT                   /function="16S rRNA uridine-516 pseudouridylate synthase
FT                   and related pseudouridylate synthases"
FT                   /EC_number="4.2.1.70"
FT                   /note="Ribosomal large subunit pseudouridine synthase F"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00037"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72316"
FT                   /db_xref="GOA:D2TBV2"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBV2"
FT                   /protein_id="CAY72316.1"
FT                   /translation="MLTNPSIRLNKYIGESGICSRRDADRYIEQGNVFINGKRASVGDR
FT                   VFAGDVVKVNGQLIEPRNEEDLVVIALNKPVGIISTTEEGERDNIVDFVNHSKRVFPIG
FT                   RLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYLVTVNKPVTEEFIRGLGAGVPMLGTV
FT                   TKKCKVKKESTFVFRITLVQGLNRQIRRMSEHFGYEVSKLERTRIMNVSLKGLPPGEWR
FT                   DLTDDELIELFKLIENSSSEDGTAKKTKPKATTAKKPAASGAKGGAKATGNANPAPRKR
FT                   FAQPGRKKKGR"
FT   gene            complement(58742..60424)
FT                   /gene="yicH"
FT                   /locus_tag="EPYR_00038"
FT   CDS_pept        complement(58742..60424)
FT                   /transl_table=11
FT                   /gene="yicH"
FT                   /locus_tag="EPYR_00038"
FT                   /product="Uncharacterized protein yicH"
FT                   /note="AsmA, AsmA family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00038"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72317"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBV3"
FT                   /protein_id="CAY72317.1"
FT                   /translation="MKFLGNVLLTLLLLLLVVALGLYLLLQTHWGAGWISRQIGENSDY
FT                   QLSFSKVEHKFSSPGHLILNDVSFARKGQPASLVAQHVDLGLGMKQFSHPLHFASIQLD
FT                   RGTLNLSTHRPPFSLQADRLQLSQMALIRNLANWPLQAQRVDGGITPWKPEKDDVLGQN
FT                   ASFQLSAGALTLDGIPAANVLIQGSIKDRQLVLSNLGADMALGSVTASARRDAQGSWQV
FT                   ASLHLNRIRLQSDKSLGEFLQPLRSLPPVHIARMDVTDARLEGKDWAVTDLDLVLKDLA
FT                   LRDGDWQSDNGTLVLNANTVVNGSMQLDDPIARMTFSAQGIALNQFSTRWVNGLVRTQG
FT                   NWTRNDKKLTLDELVVAGLEYTLPLNWRERWMQALPSWLDSVQVSKLSASHNLIIDVSP
FT                   DFPFQMTALDGTGSNLLMARHGQWGIWSGDLSVNAAEATFNRVDLRHPSLALTATDSSI
FT                   NVTEMSASSAEGMLEGQATVGQQPLRSLSLTLRGRQVAPNLLHDWGWPQVPLTDAANMQ
FT                   LNIQGSLQAGKALKPGVNGTLDVTAGGRSVRQTMTAGQVVSAQ"
FT   gene            complement(60547..61935)
FT                   /gene="yicE"
FT                   /locus_tag="EPYR_00039"
FT   CDS_pept        complement(60547..61935)
FT                   /transl_table=11
FT                   /gene="yicE"
FT                   /locus_tag="EPYR_00039"
FT                   /product="putative purine permease yicE"
FT                   /function="Xanthine/uracil permeases"
FT                   /note="Xanthine/uracil permease, TC 2.A.40.4.2 putative
FT                   purine permease yicE"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00039"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72318"
FT                   /db_xref="GOA:D2TBV4"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBV4"
FT                   /protein_id="CAY72318.1"
FT                   /translation="MTVETRDVAAAPHSVTAGKSELIYRLGDRPPLPQTLFAACQHLLA
FT                   MFVAVITPALLICQALGLPAQDTQHVISMSLFASGVASILQIKTWGPVGSGLLSIQGTS
FT                   FNFVTPLIMGGLALKNGGADVPTMMAALFGTLMLASCTEMALSRVLHLARRVITPLVSG
FT                   IVVMIIGLSLIQVGLTSIGGGFAAMSDHTFGAPKNLLLAGAVLAVIIVLNRQRNPYLRV
FT                   ASLVIAMATGYLLAWVMGMLPENTAPSNSALITIPTPFYYGLGIDWNLLIPLMLVFMVT
FT                   SLETIGDITATSDVSEQPVSGPLYMKRLKGGVLANGLNSCVSALFNTFPNSCFGQNNGV
FT                   IQLTGVASRYVGFVVALMLIALGLFPAVSGFVQHIPEPVLGGATIVMFGTIAASGVRIV
FT                   SREPLNRRAMMIIALSLAVGLGVSQQPLILQFAPDWLKTLLSSGIAAGGITAIILNLVF
FT                   PLEK"
FT   gene            complement(62178..64259)
FT                   /gene="recG"
FT                   /locus_tag="EPYR_00040"
FT   CDS_pept        complement(62178..64259)
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="EPYR_00040"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /function="RecG-like helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="DNA helicase, ATP-dependent, RecG"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00040"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72319"
FT                   /db_xref="GOA:D2TBV5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBV5"
FT                   /protein_id="CAY72319.1"
FT                   /translation="MQGRLLDAVPLNTLSGVGASQATKLAKLGLVTVQDLLLHLPLRYE
FT                   DRTQLYAINNLLPGIYATVEGEVLHSDISFGRRRMLTCQIGDGTGTLTLRFFNFNAGMK
FT                   NSLAVGRRVTAYGEIKRGQRGAEIIHPEYKVQGEHSVTGLQETLTPVYSTTEGVRQATL
FT                   RNLTDQALTLLDTCAIAELLPPQLSGGLISLPDALRTLHRPPPDIALADLNSGTHPAQR
FT                   RLIMEELLAHNLSMLAVRAGAQRYHALPMSPRHELSDRLLTALPFRPTAAQQRVVREIE
FT                   NDLAHDYPMMRLVQGDVGSGKTLVAALTALNVIAWGKQVALMAPTELLAEQHANNFRQW
FT                   FAPLGLEVGWLAGKQKGKARLAQQEAIASGQVSMIVGTHAIFQQQVQFNGLALVIIDEQ
FT                   HRFGVHQRLALWEKGEEQGFHSHQLIMTATPIPRTLAMTAYADLDTSTIDELPPGRTPV
FT                   TTVAIPDTRRADIITRVKDACGSEGRQAYWVCTLIEESELLEAQAAQATWEELQLALPE
FT                   LTIGLVHGRMKPAEKQAVMQAFKQGEIHLLIATTVIEVGVDVPNASLMIIENPERLGLA
FT                   QLHQLRGRVGRGAVASHCVLLYKSPLSKTAQKRLQVLRDSNDGFVIAQCDLEIRGPGEL
FT                   LGTRQTGNAEFRVADLLRDQALIPEVQRVARHIHQHYPEQAVALIERWLPETERYTNA"
FT   gene            complement(64259..64954)
FT                   /gene="spoU"
FT                   /locus_tag="EPYR_00041"
FT   CDS_pept        complement(64259..64954)
FT                   /transl_table=11
FT                   /gene="spoU"
FT                   /locus_tag="EPYR_00041"
FT                   /product="putative RNA methylase"
FT                   /function="rRNA methylases"
FT                   /EC_number="2.1.1.34"
FT                   /note="tRNA guanosine-2'-O-methyltransferase (tRNA [Gm18]
FT                   methyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00041"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72320"
FT                   /db_xref="GOA:D2TBV6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR022724"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBV6"
FT                   /protein_id="CAY72320.1"
FT                   /translation="MNAQRYARIRAMLAARQHDLTVCMEQVHKPHNVSAVIRTADAVGV
FT                   HEVHAVWPGSRMRTMVSAAAGSNSWVQVKTHRSIAEAVACLKGQNMQILATHLSDKAVD
FT                   FREIDYTRPTCILMGQEKTGITREALDLADGDIIIPMIGMVQSLNVSVASALILYEAQR
FT                   QRQNAGMYLREESTLEYSEQQRLLFEGGYPVLARVAKHKGLPYPEINDRGEVVADPEWW
FT                   ATMQSKARK"
FT   gene            complement(65051..67174)
FT                   /gene="spoT"
FT                   /locus_tag="EPYR_00042"
FT   CDS_pept        complement(65051..67174)
FT                   /transl_table=11
FT                   /gene="spoT"
FT                   /locus_tag="EPYR_00042"
FT                   /product="guanosine-3',5'-bis(diphosphate)
FT                   3'-pyrophosphohydrolase"
FT                   /function="Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases"
FT                   /EC_number="3.1.7.2"
FT                   /note="probable GTP pyrophosphokinase (ATP:GTP
FT                   3'-pyrophosphotransferase) (ppGpp synthetase I) ((P)ppGpp
FT                   synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00042"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72321"
FT                   /db_xref="GOA:D2TBV7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBV7"
FT                   /protein_id="CAY72321.1"
FT                   /translation="MYLFESLNQLIEKYLPEEQIKRLKQAYLVARDAHEGQTRSSGEPY
FT                   ITHPVAVACILAEMKLDHETLMAALLHDVIEDTPATYQDMEQLFGQTVAELVEGVSKLD
FT                   KLKFRDKKEAQAENFRKMIMAMVQDIRVILIKLADRTHNMRTLGALRPDKKRRIALETL
FT                   EIYSPLAHRLGIHHLKTELEELGFEALYPNRYRVIKEVVKAARGNRKEMIQKILSEIDG
FT                   RLEEAGITRRVSGREKHLYSIYCKMHLKEQRFHSIMDIYAFRVIVRDVDTCYRVLGQMH
FT                   NLYKPRPGRVKDYIAIPKANGYQSLHTSMIGPHGVPVEVQIRTEDMDQMAEMGVAAHWA
FT                   YKEQGESGTTAQIRAQRWLQSLLELQQSAGSSFEFIESVKSDLFPDEIYVFTPEGRIVE
FT                   LPAGATPVDFAYAVHTDIGHACVGARVDRQPYPLSQALTSGQTVEIITAPGARPNAAWL
FT                   NFVVSSKARAKIRQLLKNLKRDDSVSLGRRLLNHALGGSRKLAEIPPTNVQHELERMKL
FT                   ASLDDLLAEIGLGNAMSVVVAKNLQQNEPSAPATGPAPAGSSRSKLPIKGADGVLITFA
FT                   KCCRPIPGDPIVAHVSPGKGLVVHHESCRNIRGYQKEPEKYMAVEWDKVTEQEFVAEIK
FT                   VDMFNHQGALANLTAAINTAGSNIQSLNTEEKDGRVYCAFIRLTARDRVHLANIMRKIR
FT                   VMPDVIKVHRNRN"
FT   gene            complement(67194..67469)
FT                   /gene="rpoZ"
FT                   /locus_tag="EPYR_00043"
FT   CDS_pept        complement(67194..67469)
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="EPYR_00043"
FT                   /product="DNA-directed RNA polymerase omega chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="DNA-directed RNA polymerase omega chain (RNAP omega
FT                   subunit) (Transcriptase omega chain) (RNA polymerase omega
FT                   subunit), RNA polymerase Rpb6"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00043"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72322"
FT                   /db_xref="GOA:D2TBV8"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBV8"
FT                   /protein_id="CAY72322.1"
FT                   /translation="MARVTVQDAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDK
FT                   STVIALREIEEGLITNQILDVRDRQEQHEQEAAELQAVTAIAEGRR"
FT   gene            complement(67526..68218)
FT                   /gene="gmk"
FT                   /locus_tag="EPYR_00044"
FT   CDS_pept        complement(67526..68218)
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="EPYR_00044"
FT                   /product="guanylate kinase"
FT                   /function="ABC-type sugar transport systems, ATPase
FT                   components"
FT                   /EC_number="2.7.4.8"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00044"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72323"
FT                   /db_xref="GOA:D2TBV9"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBV9"
FT                   /protein_id="CAY72323.1"
FT                   /translation="MTRCTCVYCAGSRLRFIGISRIIMAQGTLFIVSAPSGAGKSSLIQ
FT                   ALLKTQPLYDTQVSISHTTRGIRPGEKHAEHYYFVNHDEFRGMIREEAFLEHAEVYGNY
FT                   YGTSRKAIEQVLATGVDVFLDIDWQGAKQIRQKMPAARSIFVLPPSKDELDRRLRGRGQ
FT                   DSEEVITKRMAQAVAEMSHYAEYDYLIVNDDFDLALSDLKTIIRAERLRMGRQKARHDA
FT                   LISKLLAD"
FT   gene            complement(68251..68382)
FT                   /locus_tag="EPYR_00045"
FT   CDS_pept        complement(68251..68382)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00045"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72324"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBW0"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72324.1"
FT                   /translation="MAGSKAQHIRVSERQKSISEGGFSTFYANHARQANICVALSNF"
FT   gene            68293..68412
FT                   /locus_tag="EPYR_00046"
FT   CDS_pept        68293..68412
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00046"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72325"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBW1"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72325.1"
FT                   /translation="MVCIKSAEAAFRNALLPLANPYMLRFTACHCYDVQEKQK"
FT   gene            68409..70091
FT                   /gene="ligB"
FT                   /locus_tag="EPYR_00047"
FT   CDS_pept        68409..70091
FT                   /transl_table=11
FT                   /gene="ligB"
FT                   /locus_tag="EPYR_00047"
FT                   /product="putative NAD-dependent DNA ligase"
FT                   /function="NAD-dependent DNA ligase (contains BRCT domain
FT                   type II)"
FT                   /EC_number="6.5.1.2"
FT                   /note="DNA ligase (Polydeoxyribonucleotide synthase
FT                   [NAD+]), NAD-dependent DNA ligase, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00047"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72326"
FT                   /db_xref="GOA:D2TBW2"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR020923"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBW2"
FT                   /protein_id="CAY72326.1"
FT                   /translation="MKCAILVVWMFSTLVQAQCPVWSASRADAEISALEAQLKKWDDAY
FT                   YRRGESQIPDERYDTLHGKLQQWQRCFSPASDLRQPLLKTDGKVLHPVSHTGVKKLSDK
FT                   AAVARWMEKRDGLWIQPKVDGVAVTLLYRDGRLVQMISRGDGVKGEDWTAKARQIPAIP
FT                   KSIPRFPAVQVFQGELYLKMTDHQQATDGGKSARSIVAGALMAKAPSTMLQRVGIFVWA
FT                   WPDGPNSIAQRLTGIRALGFPDISNWTHRVENVDEVEGWRERWFHQALPFATDGIVVHS
FT                   IPTRQGTDWLPELGDWAIAWKYPPPEVTSEVRSVEFAIGRTGRINAVLNLLPVQLDDKR
FT                   VSRVNIGSIEHWKQTDVIAGDLVSISLAGLGVPRMDKVIWRVKERVLPPLPDATHFNSL
FT                   SCFRLTPQCRQQFLARLEWLSSKPVLNLSGAGRQTWQQLIQAGSMTHIFSWLALSEEQL
FT                   KAVPGIGEQRAHFFWQQFRLSRQLPFKRWVKALGVPIPERAMNTLTDDNWQQLLSHSLQ
FT                   DWQQLPGVGQTLARKIFSYLRQQEVRQLIDVLEASVALSLQGR"
FT   gene            complement(70092..70709)
FT                   /gene="yicG"
FT                   /locus_tag="EPYR_00048"
FT   CDS_pept        complement(70092..70709)
FT                   /transl_table=11
FT                   /gene="yicG"
FT                   /locus_tag="EPYR_00048"
FT                   /product="UPF0126 membrane protein HI1240"
FT                   /note="Protein of unknown function UPF0126, UPF0126 domain"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00048"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72327"
FT                   /db_xref="GOA:D2TBW3"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBW3"
FT                   /protein_id="CAY72327.1"
FT                   /translation="MLLTVLYIIGITAEAMTGALAAGRRKMDMFGVIIIASVTAIGGGS
FT                   VRDILLGHYPLGWVKHPEYIMIVAAAAVITTFTAPVMPHLRKVFLILDALGLAVFSIIG
FT                   AQVALDMGYAGIIAAIGAVVTGVFGGVLRDMFCNQIPLVFQKEIYAGIAFASGWVYILL
FT                   LKTALPQETVIIITLLTGFIARLLALRFKLGLPVFNYPHNDH"
FT   gene            71176..71820
FT                   /gene="rcsB"
FT                   /locus_tag="EPYR_00049"
FT   CDS_pept        71176..71820
FT                   /transl_table=11
FT                   /gene="rcsB"
FT                   /locus_tag="EPYR_00049"
FT                   /product="Fimbriae Z protein"
FT                   /function="Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /note="CheY-like, Bacterial regulatory proteins, luxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00049"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72328"
FT                   /db_xref="GOA:D2TBW4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBW4"
FT                   /protein_id="CAY72328.1"
FT                   /translation="MYSRFTVAVSDDHPHIIHSLKMLFSNNDKFTIATETGCGKDLLAV
FT                   LASAQTDIVITDFSLSSKRSAIDGFAKIRALSGRFPLVKIVLLTSQKNIAILRKTCDYG
FT                   VKAIVSKSDPVEDTVIACHHVMNQSGYYFSSSLSNIKSYLSKSGEKGNGLTPKELEVIR
FT                   LFSSGYTLSEIARRQNRTISTVSTQKYNAMRRLGVSSNVELIRYAYAQGLI"
FT   gene            complement(72172..73536)
FT                   /locus_tag="EPYR_00050"
FT   CDS_pept        complement(72172..73536)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00050"
FT                   /product="putative major facilitator superfamily
FT                   transporter"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /note="Major facilitator superfamily, TC 2.A.1.26.1
FT                   Hypothetical 41.4 kDa protein IN DMSC-PFLA intergenic
FT                   region (ORF Y)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00050"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72329"
FT                   /db_xref="GOA:D2TBW5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBW5"
FT                   /protein_id="CAY72329.1"
FT                   /translation="MNKTLGVFFPLYTTTLLMLLGSGLLTTYVSLRLTSAHVSGALIGA
FT                   IIAANYIGLVIGGKVGHFLIARVGHIRAYVSCAGIITAAVLGHGLTGYIPAWIGLRLII
FT                   GLCMMCQYMVLESWLNDQSESGQRGKVFGCYMVATYLGMSLGQVVLMLQTDLGLSTLLL
FT                   IALCFALCLVPIALTTRTHARQLSPAPMELRHFIGSIPKVLATTLAIGMAVGSFYGLAP
FT                   VYTSQQQLTTGQTGLFMAIAIFAGLVAQFPLSWLSDRYNRTRLLRLNAIMLAVAALPLA
FT                   LLPQLGFPLLLALGFIVSMLLFSLYPLAVALANDLVEPERRVSLAACLLMAFGVGASIG
FT                   PLMVGLLLEPLGGNTLYAFFALCGLLIVAMSRTVKKDEAQFVEDAPVPHIAMPDSLMSS
FT                   PLSPALNPAFDEQMIEETMPSLDIEPEAEQEVEVTTLQGADPDEETGLKKAWEKL"
FT   gene            complement(73699..74037)
FT                   /gene="phnA"
FT                   /locus_tag="EPYR_00051"
FT   CDS_pept        complement(73699..74037)
FT                   /transl_table=11
FT                   /gene="phnA"
FT                   /locus_tag="EPYR_00051"
FT                   /product="Protein phnA"
FT                   /note="PhnA protein, PhnA protein, phnA: alkylphosphonate
FT                   utilization operon protein PhnA"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00051"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72331"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBW6"
FT                   /protein_id="CAY72331.1"
FT                   /translation="MQTLPPCPKCHSEYSWQDGHMLNCPECGHVWAEGADAAAEDSLVV
FT                   KDANGNLLADGDSVTVIKDLKVKGSSTPLKIGTKVKSIRLVEGDHNIDCKIDGFGPMKL
FT                   KSEFVKKN"
FT   gene            74481..74855
FT                   /locus_tag="EPYR_00052"
FT   CDS_pept        74481..74855
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00052"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72332"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBW7"
FT                   /protein_id="CAY72332.1"
FT                   /translation="MRMTARKKEILSYYQPDNLEWVTGEIGSPPFDVSGLAYLVCGLDS
FT                   FDTRHHLESTRRTLEAMVKDGLLEKVTSFERRQDTTQSGDGKGIWCNCSRYGLPGSCLV
FT                   VRDEGGKGEAIDGEAVRVDN"
FT   gene            74921..75352
FT                   /locus_tag="EPYR_00053"
FT   CDS_pept        74921..75352
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00053"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72334"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBW8"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72334.1"
FT                   /translation="MNKSLSVTFRVPAELANAFISAVSESGSDKTAWLIDAVRHKLNQP
FT                   DNNADSRLLALVERMEIAAAALAVGKQGIPPCPYNEAAAIQIVAATIREGFDNGRIIAE
FT                   RLNEAGYQTKAGKAWDKDIYSAWKRQGGNSSRIAAALSA"
FT   gene            complement(75430..75618)
FT                   /locus_tag="EPYR_00054"
FT   CDS_pept        complement(75430..75618)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00054"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72337"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBW9"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72337.1"
FT                   /translation="MTDRQTLELAVLQMARQSGEPLDRHTLYTVRNGIRNALAASERHR
FT                   QRMSAPAYQWKKPAPRR"
FT   gene            complement(75767..76357)
FT                   /locus_tag="EPYR_00055"
FT   CDS_pept        complement(75767..76357)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00055"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72339"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBX0"
FT                   /protein_id="CAY72339.1"
FT                   /translation="MREQTRSYTTAQPRLTLAHLKAIRQRFSKGAKALQLATRAGEMRF
FT                   HLDGSSYTATIGGRVLPMRTTSTRAGYGVRHWYLCPYCHNRAAVLFIGKRDLACRKCWG
FT                   LHYASQSEDRLARMRRSLFKQRAAIWGNYAPAQSLFNDCALFPKPAGMRWETFSRKVLH
FT                   LQRSEQAYYRAFSPVVEKMTGMIERRTGAAGAG"
FT   gene            complement(76409..78733)
FT                   /locus_tag="EPYR_00056"
FT   CDS_pept        complement(76409..78733)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00056"
FT                   /product="Extracellular matrix-binding protein ebhB;
FT                   ECM-binding protein homolog B; Flags: Precursor"
FT                   /function="Phage-related minor tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00056"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72340"
FT                   /db_xref="InterPro:IPR009628"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBX1"
FT                   /protein_id="CAY72340.1"
FT                   /translation="MSDVKAGGIYYEVGADLEPLLKGVDKAGQALNGMGKEAGNSAAGF
FT                   SRLETQAKKSAIAVNEAASSANRLRTISGQMGYQLQDVAVQLQMGQSALMVFAQQGSQM
FT                   AGAFGPSGAVVGAVIAVAGAIGSALIPALFSGKTTAEDLQKTLSELDKVITFSQSGVAA
FT                   LSDKYALLAKTNGALAEAVRENALSKLEQDAAKAGEAIKGVIAAQQSFMPSLNGGASSV
FT                   ILMGNAMAALNITTADYQQASSAGMAFQSQAMTIGNTVGMLASNFGITNQQAYTLAQRM
FT                   IEVANTPTPQAVSQLNGYLKDLHGTTDKGSAALLDFKTSITDAGAAVSDIRARLEEFRA
FT                   SMSGAIATAQQQQTFEGLIANLKQQEIGYKQGAAAAKAYAIEHANLTETQKKEVLAQNA
FT                   ATESARQAAEDRRKADNGSKAGDSAVTGLARLSQQYDVARLKAQGMNKEAAQLAAVQSL
FT                   GAEATDREARAASNLAGKIFDLTNAEEKRRQARQGQKFAGQEIAAAQTQKDPLTGQSKD
FT                   PLAQINLQEQQKLDALAQYQAIDKQNIQIYEDAKTAIQQQAANARKQIAIDEANTQSQA
FT                   ISSIIGSVSQGFDGLANLAAGAAGKSSGAYQAMFALSKGFAVAQSALNLQLALSQVLAN
FT                   PADLTPAQKFASYAAVASAGASLLSTIGSISYGGGRKNGGPVSEGTMYQVGEGGKPEIY
FT                   QASTGKQYMIPGDNGKVISNKDMQGGGGGGVVMNVAFNIQTTNGIDEATQKQIVKQMEN
FT                   VAMFVAKRESTRPRGILQRRK"
FT   gene            complement(78743..79072)
FT                   /locus_tag="EPYR_00057"
FT   CDS_pept        complement(78743..79072)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00057"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72342"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBX2"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72342.1"
FT                   /translation="MEQLQRLAEVIAGTYLEGLIRDSGSDRVEHNGVSGKVSSPLLASG
FT                   LIDNVISAARDLCIAEDYQREAYKMLMEMISFDGPQYQLTQHGRAVIDTMNSLALAKKC
FT                   KLPTH"
FT   gene            complement(79072..79320)
FT                   /locus_tag="EPYR_00058"
FT   CDS_pept        complement(79072..79320)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00058"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72345"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBX3"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72345.1"
FT                   /translation="MILVIVAINGITITVHINNTGFIDMKKASTLRPVLLTASQMEAIR
FT                   SIQESERKNSRFGTAPTVHDIARGLISRALENAGVPV"
FT   gene            complement(79752..82580)
FT                   /locus_tag="EPYR_00059"
FT   CDS_pept        complement(79752..82580)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00059"
FT                   /product="putative P4-specific DNA primase"
FT                   /function="Superfamily II helicase and inactivated
FT                   derivatives"
FT                   /EC_number="2.7.7.-"
FT                   /note="Phage P4 alpha, zinc-binding, Zinc-binding domain of
FT                   primase-helicase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00059"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72346"
FT                   /db_xref="GOA:D2TBX4"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR009270"
FT                   /db_xref="InterPro:IPR013237"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBX4"
FT                   /protein_id="CAY72346.1"
FT                   /translation="MRNIDLIREVTAAAAGRWPGVLAMTGITVPHSPRQHSECPACGGT
FT                   DRFRFDDGGRGSHICNQCGAGDGLDLVAKVNDCDTTEAARLVADALGIDYRAAETDSEA
FT                   ASQRRAQAATERQQREQERQRQAAADEAARRANFSRHYQTLAEQAQPGESEYLITKGLN
FT                   GFTFPMLSDGRLLLALANLSGTVTAAQTITAAGVKKLVAGSAKRGAYHAVNAPEAPQSI
FT                   VIAEGLATALTAHLIRPDALAVAAVDAGNLLPVAEAMRQQHPQAKIIIAADNDHQQGGS
FT                   ENGASNTGKEAAEKAALSVAGWVSIPPTDHKADWNDHHQQNGLEAATAAFNDSLYQPQG
FT                   ESMTDEQSGAEDGNNTARDSASHTKVKLRKPGGLDSDKDPLKPRTESRSDGVFWITPKV
FT                   DNESGEIINNESWLCSPLEVIGIGRDDKDQFLIIKWFPAGASASTTQAIPLADIGEREG
FT                   WRVLKAGGVNITTKPAMRATLADWLQRSGSRELWRVAQATGWQCGAYIMPDGEIIGSPD
FT                   MPVLFNGRSSAAAGYTCKGTAAEWRDSVARLAGGNWSMMTGIGAALAAPLIGLAGADGF
FT                   GLHFYEQSSAGKTTTANAAASLYGNPDLLRLTWYGTALGLANEAAAHNDALMPLDEVGQ
FT                   GADPRSVAQSAYALFNGVGKLQGAKEGGNRDLKRWRTVAISTGEMDLETFIASTGQKIK
FT                   AGQLVRLLNIPLSKAAEFHEHQSGKQHADALKDAFMRHHGAAGRAWVKWLADHQQQAVN
FT                   AVREAESRWRSLIPADYGEQVHRVAARFAILEAALILGGVVTGWDAQTCRDAVQHSYNA
FT                   WVREFGTGNKEHQQIIAQAEAFLNAHGLSRYAPFPYDPAALPIRDLAGYRTKGGHEHDP
FT                   ITFYTFPAAFEGEIARGFNAKQFAEVLKSAGMLTPPSSDRGYQRKSPRIDGRQYRVYVL
FT                   NYLPDEESQPEE"
FT   gene            complement(82590..83201)
FT                   /locus_tag="EPYR_00060"
FT   CDS_pept        complement(82590..83201)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00060"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72348"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBX5"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72348.1"
FT                   /translation="MSKAVTLTATGVYRTEATRHGVSITRRNEAGQYEHMALIDYPDML
FT                   RKLEAGDFDGVRDIPDILRAMADGAALGYHTPTAEQELIVWRHCVALTFISEQLRKNGA
FT                   VEVENERGGTDSGVIYCGQYGCMAVYPAPERFAMANNIESALIERYGREQGERNAVLMY
FT                   QAMLEGGGLSDMGRELLADLHDGFIRMLQDEGLPPAPVAH"
FT   gene            complement(83198..83407)
FT                   /locus_tag="EPYR_00061"
FT   CDS_pept        complement(83198..83407)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00061"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72350"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBX6"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72350.1"
FT                   /translation="MKTMPLCDAICRVEQAQGVLSVWMEMGIFNRTLSPRMVGALITLL
FT                   EGVPEAMNAANSELVDYMKREGKA"
FT   gene            complement(83404..83580)
FT                   /locus_tag="EPYR_00062"
FT   CDS_pept        complement(83404..83580)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00062"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72351"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBX7"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72351.1"
FT                   /translation="MIRADTHAKNDALDALEKIKILTEAALFLTHNDTERDAQSELIGV
FT                   INDLAIRVLEASR"
FT   gene            complement(83577..83822)
FT                   /locus_tag="EPYR_00063"
FT   CDS_pept        complement(83577..83822)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00063"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72353"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBX8"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72353.1"
FT                   /translation="MRNAPAITAPSPAERLENVRHDAAMTARYAAELKALFDCHLDARL
FT                   REANPKAGARFWTLIHELYSAAGRTQMRLDRMEIPQ"
FT   gene            complement(83815..84762)
FT                   /locus_tag="EPYR_00064"
FT   CDS_pept        complement(83815..84762)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00064"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72355"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBX9"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72355.1"
FT                   /translation="MRVTQAAVQKEAFPLAGLLVNVMVQSLKEPVISRPITGSENLTKP
FT                   NAVEYFSTINRTGGNLCLNDAREEFSGTSGSFVTSTRGEFKDTLGHFATTAHKGSLEFC
FT                   ESIKKGSTANATLCHDAGNNQALGSMPSFRSLSRQESLTHELKLPCPATTFICSKSESS
FT                   KRMCFMVLPLRSNAFFSFSSCIGSYQYYNGNTDGNYHNRVKQYQSVKTTMPRSAPTLTG
FT                   HLTTADRLIIEEAVMDITTHPQGWESFGLNSGHQHRHFVWIIAAVRRDNPALSPVIHHI
FT                   AAENEREARRTLAKDNVCFFAGRLNIATTGVSHA"
FT   gene            84209..84391
FT                   /locus_tag="EPYR_00065"
FT   CDS_pept        84209..84391
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00065"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72356"
FT                   /db_xref="InterPro:IPR025030"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBY0"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72356.1"
FT                   /translation="MQDEKEKKAFDRKGSTMKHIRFEDSLLEQINVVAGQGNFSSWVKD
FT                   SCRERLRKEGIEPKA"
FT   gene            complement(84753..84926)
FT                   /locus_tag="EPYR_00066"
FT   CDS_pept        complement(84753..84926)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00066"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72358"
FT                   /db_xref="InterPro:IPR025317"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBY1"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72358.1"
FT                   /translation="MTTRTQQRQFKDSHGRTVTLRGMSGGNVVFMRPGYPHPCQQPLEK
FT                   FKAEFIEVTPCE"
FT   gene            complement(84926..85513)
FT                   /locus_tag="EPYR_00067"
FT   CDS_pept        complement(84926..85513)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00067"
FT                   /product="Uncharacterized protein HI1418"
FT                   /function="Prophage antirepressor"
FT                   /note="BRO, N-terminal, BRO family, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00067"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72359"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBY2"
FT                   /protein_id="CAY72359.1"
FT                   /translation="MTFQNMANCRDGHPHAKNQGMDIFRATAQDITVIRFDGVQVRIVN
FT                   INGEPWFMVKDICAALEMADHLVALRRLDGDEKGECLTPTPGGNQVMRTVRESGFYKLI
FT                   TRSRKASTPGTFAHRFSNWIFREVIPSIRKTGAYGVPFAFLNDHSKRKATYTTKASKRG
FT                   KALQSCKTEKANLAAEEKALWLKYQPDLLGVH"
FT   gene            complement(85529..85945)
FT                   /locus_tag="EPYR_00068"
FT   CDS_pept        complement(85529..85945)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00068"
FT                   /product="Uncharacterized protein PM1773"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00068"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72360"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBY3"
FT                   /protein_id="CAY72360.1"
FT                   /translation="MKKTRSVAGIIEQVSANDNTPTATIKPAPKKHRARIYMMRTGVNG
FT                   FTENEILRYCRLSSGRNYASELERSLDIHLERIDEKNPDGIGSHFRYRFTCRADVMRVI
FT                   QLVNHNAAAGGYRRLSQQEINDILTLYPDAFTAA"
FT   gene            complement(85945..86169)
FT                   /locus_tag="EPYR_00069"
FT   CDS_pept        complement(85945..86169)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00069"
FT                   /product="hypothetical bacteriophage protein"
FT                   /note="putative DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00069"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72361"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBY4"
FT                   /protein_id="CAY72361.1"
FT                   /translation="MTTHSTTTAHKAALPQTGYIRRYLLADALGVHVATVDRWVKAKAM
FT                   PAPVKLGEKITAFDAVEINNWLAARREAA"
FT   gene            complement(87287..88252)
FT                   /gene="int"
FT                   /locus_tag="EPYR_00070"
FT   CDS_pept        complement(87287..88252)
FT                   /transl_table=11
FT                   /gene="int"
FT                   /locus_tag="EPYR_00070"
FT                   /function="Integrase"
FT                   /note="DNA breaking-rejoining enzyme, catalytic core"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00070"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72362"
FT                   /db_xref="GOA:D2TBY5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBY5"
FT                   /protein_id="CAY72362.1"
FT                   /translation="MEADKNAMRVSDLAAEYFTRQILPRWKHPDILRRRIDKDINPRIG
FT                   SMKVEDVKPRHIDDMLKAIVDRGAPTIATDVLRWTRRIFDYGIKRHALEINPCSAFEVA
FT                   DAGGKEVSRERWLTRDELIRLFSAMRTAKGFSRQNEITFKLLLTLCVRKMELCAARWEE
FT                   FDLNGAVWHLPEERSKNGDAINIPLPPPAVKWLEELHTFSCNSKWVLPARKMQNRMIPH
FT                   IQESTLPVALSKVRAELPDVPNFTIHDFRRTARTHLAALGIDPVVAERCLNHRIKGVEG
FT                   IYNRHQYFDERKAALTQWADLLVALERGEEYNVTPLRKAK"
FT   gene            88428..89468
FT                   /locus_tag="EPYR_00071"
FT   CDS_pept        88428..89468
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00071"
FT                   /product="Insertion element IS630 uncharacterized 39 kDa
FT                   protein; ISO-IS200 39 kDa protein"
FT                   /function="Transposase and inactivated derivatives"
FT                   /note="Integrase, catalytic core"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00071"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72363"
FT                   /db_xref="GOA:D2T2W7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2W7"
FT                   /protein_id="CAY72363.1"
FT                   /translation="MPIIAPISREERRLMRKAIHKTRDKNHARRLTAILMLHRGNRVSH
FT                   VARTLCCARSSVGRWINWFTLSGVEGLKSLPAGRSRRWPFEHICTLLRELIKHSPGDFG
FT                   YQRSRWSTELLAIKIKDITGCRLHAGTVRRWLPAAGLVWRRAAPTLRIRDPHKDEKMAV
FT                   IRQALDKCSAEHPVFYEDEVDIHLNPKIGADWQLRGQQRRVVTPGQNEKYYLAGALHSG
FT                   TGKVSYVGGNSKSSVLFISLLKHLKASYRRAKTITLIVDNYIIHKSRETLSWLKQNPKF
FT                   RVIYQPVYSPWVNHVERLWQALHDTITRNHQCRSMWQLLKKVRHFMKTVSPFPGGKHGL
FT                   AKVERY"
FT   gene            complement(89465..89770)
FT                   /locus_tag="EPYR_00072"
FT   CDS_pept        complement(89465..89770)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00072"
FT                   /product="putative prophage CPZ-55 integrase"
FT                   /function="Integrase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00072"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72364"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBY7"
FT                   /protein_id="CAY72364.1"
FT                   /translation="MYPISFLYIALGTPLIQSLDIRKMPKLTDMQIRAWIKAGERFEGR
FT                   ADGGGLYLRYRQVDQSPSWRFRYKFSGKQRAMVIGSYAELSLSKARETAKELNSCV"
FT   gene            complement(89892..90755)
FT                   /gene="yicC"
FT                   /locus_tag="EPYR_00073"
FT   CDS_pept        complement(89892..90755)
FT                   /transl_table=11
FT                   /gene="yicC"
FT                   /locus_tag="EPYR_00073"
FT                   /product="Protein yicC"
FT                   /function="Uncharacterized stress-induced protein"
FT                   /note="Conserved hypothetical protein CHP00255, YicC-like
FT                   family, N-terminal region, TIGR00255: conserved
FT                   hypothetical protein TIGR00255"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00073"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72365"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBY8"
FT                   /protein_id="CAY72365.1"
FT                   /translation="MIRSMTAYARRETKGEWGSAAWELRSVNQRYLETYIRLPEQFRGL
FT                   EPVVRERIRNRLTRGKIEVNLRFDADPRAQSALVLNEKLAVQLVQAANWVKMQSDEGEI
FT                   NPVDILRWPGVMSAEEQDLDAISAQLLTALDTAIDEFIIARESEGAALKTLIEQRLQGV
FT                   SAEVIKVRAHMPDVLKWQRERLVSRLEEAQVQLENNRLEQELVMLAQRVDVAEELDRLE
FT                   AHVKETYNILKKKEAVGRRLDFMMQEFNRESNTLGSKSINAEITASAIELKVLIEQMRE
FT                   QIQNIE"
FT   gene            90906..91334
FT                   /locus_tag="EPYR_00074"
FT   CDS_pept        90906..91334
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00074"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72366"
FT                   /db_xref="InterPro:IPR021957"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBY9"
FT                   /protein_id="CAY72366.1"
FT                   /translation="MTSRIMLSTILLLALSGCRSPTNPLISSPWVACGTGDAMTQTTLY
FT                   FGLNRPQGTAINETEWQSFVDEQVTPRFKNGLTVLAAKGQWMGNDGQLARENSKALLLI
FT                   HAANQTSEQGIEALRALYKQRFAQDAVMRVDNPVCVAF"
FT   gene            complement(91369..92568)
FT                   /gene="nupC"
FT                   /locus_tag="EPYR_00075"
FT   CDS_pept        complement(91369..92568)
FT                   /transl_table=11
FT                   /gene="nupC"
FT                   /locus_tag="EPYR_00075"
FT                   /product="Sodium/nucleoside cotransporter 1"
FT                   /function="Nucleoside permease"
FT                   /note="Sodium/nucleoside cotransporter 1 (Na(+)/nucleoside
FT                   cotransporter 1) (Sodium-coupled nucleoside transporter 1)
FT                   (Concentrative nucleoside transporter 1) (CNT 1) (hCNT1),
FT                   TC 2.A.41.1.1 Nucleoside permease nupC"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00075"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72367"
FT                   /db_xref="GOA:D2TBZ0"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBZ0"
FT                   /protein_id="CAY72367.1"
FT                   /translation="MLDLRMISVFHFILALTVIGLLALLASSDRKKIRPRVLLQLVVIE
FT                   AALAWFFLHASAGLKAVTAFSGFFEVLLKYAAQGTDFVFGGMSSQGLAFIFLGVLCPIV
FT                   FISALIGILQHVKILPVLIKVIGTLLSKVNGMGKLESFNAVSTLILGQSENFIAYKGIL
FT                   ADISPRRLYSMAAAAMSTVSLSIVGAYMSMIEPRYVVAALILNMFSTFIVLSIINPTPA
FT                   GDEPEIRLEKLHEDQSFFEMLGEYILAGFKVAMIILAMLIGFIALIAAVNAVFSTLFGI
FT                   SFQQILGYVFWPFAWLIGIPVADVLPAASIMATKLVTNEFVAMIELKKIATELSPRGLG
FT                   ILSVFLVSFANFASIGIVAGAIKGLNEQQGNVVSRFGLKLIYGSTLVSLLSAAFAGLVL
FT                   "
FT   gene            92765..93481
FT                   /gene="rph"
FT                   /locus_tag="EPYR_00076"
FT   CDS_pept        92765..93481
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="EPYR_00076"
FT                   /product="ribonuclease PH"
FT                   /function="RNase PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="Ribonuclease PH (tRNA nucleotidyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00076"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72368"
FT                   /db_xref="GOA:D2TBZ1"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBZ1"
FT                   /protein_id="CAY72368.1"
FT                   /translation="MRPSGRSAQQVRPVTLTRHYTKHAEGSVLVEFGDTKVLCTATIEE
FT                   GVPRFLKGQGQGWVTAEYGMLPRATHSRNAREAAKGKQGGRTLEIQRLIARSLRAAIDL
FT                   KALGEFTITLDCDVLQADGGTRTASITGACVALADALNHLVSIGKLKANPMKGMVAAIS
FT                   VGIVNGEALCDLEYVEDSAAETDMNVVMTEDGRMIEVQGTAEGEPFSHEELLKLLELAR
FT                   GGIDTLVAAQKAALTN"
FT   gene            93538..94179
FT                   /gene="pyrE"
FT                   /locus_tag="EPYR_00077"
FT   CDS_pept        93538..94179
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="EPYR_00077"
FT                   /function="Orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="Orotate phosphoribosyltransferase (OPRT) (OPRTase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00077"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72369"
FT                   /db_xref="GOA:D2TBZ2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBZ2"
FT                   /protein_id="CAY72369.1"
FT                   /translation="MKAWQRQFIEFAINKQVLKFGEFTLKSGRKSPYFFNAGLFNTGRD
FT                   LALLGRFYAQALVDSGIDFDLVFGPAYKGIPIATTTVVALADHHDRDVPYCFNRKEAKD
FT                   HGEGGTLVGSALQGKIMLVDDVITAGTAIRESMEIIAAHQATLAGVLISLDRQERGRGE
FT                   ISAIQEVERDYGCKVISIITLNELIAYLEEKPELADRLAAVRAYRSEFGI"
FT   gene            complement(94252..94848)
FT                   /gene="ttk"
FT                   /locus_tag="EPYR_00078"
FT   CDS_pept        complement(94252..94848)
FT                   /transl_table=11
FT                   /gene="ttk"
FT                   /locus_tag="EPYR_00078"
FT                   /product="HTH-type protein slmA"
FT                   /function="Transcriptional regulator"
FT                   /note="Tetracycline transcriptional regulator,TetR-related,
FT                   C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00078"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72370"
FT                   /db_xref="GOA:D2TBZ3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBZ3"
FT                   /protein_id="CAY72370.1"
FT                   /translation="MVEKKSAKRNRREEILQALAQMLESSDGSQRITTAKLAANVGVSE
FT                   AALYRHFPSKTKMFDSLIEFIEDSLITRINLILKDEKETMPRLRLMTQLILGFGERNPG
FT                   LTRILTGHALMFEQDRLQGRINQLFERIEMQLRQVMREKKMREGEGFITDEALLATQLL
FT                   AFCEGLLSRFVRSEFRYRPTVDFDARWPLMAAQLI"
FT   gene            complement(94963..95433)
FT                   /gene="dut"
FT                   /locus_tag="EPYR_00079"
FT   CDS_pept        complement(94963..95433)
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="EPYR_00079"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /function="dUTPase"
FT                   /EC_number="3.6.1.23"
FT                   /note="Deoxyuridine 5'-triphosphate nucleotidohydrolase
FT                   (dUTP pyrophosphatase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00079"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72371"
FT                   /db_xref="GOA:D2TBZ4"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBZ4"
FT                   /protein_id="CAY72371.1"
FT                   /translation="MSPDMMKKIDVKVLDARVGTDFPLPTYATSGSAGLDLRACLDEAM
FT                   VLPPGDTTLIPTGLAIHIADPQLAAVILPRSGLGHKHGVVLGNLVGLIDSDYQGQLMVS
FT                   VWNRGRDSFTIEPGERIAQMVFVPVVQAEFNLVNDFDASARGEGGFGHSGRQ"
FT   gene            complement(95399..96613)
FT                   /gene="coaBC"
FT                   /locus_tag="EPYR_00080"
FT   CDS_pept        complement(95399..96613)
FT                   /transl_table=11
FT                   /gene="coaBC"
FT                   /locus_tag="EPYR_00080"
FT                   /product="bifunctional phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate synthase"
FT                   /function="Phosphopantothenoylcysteinesynthetase/decarbox
FT                   ylase"
FT                   /EC_number="6.3.2.5"
FT                   /note="Coenzyme A biosynthesis bifunctional protein coaBC
FT                   (DNA/pantothenate metabolism flavoprotein) [Includes:
FT                   Phosphopantothenoylcysteine decarboxylase (PPCDC) (CoaC);
FT                   Phosphopantothenate-cysteine ligase
FT                   (Phosphopantothenoylcysteine synthase) (PPC synthetase)
FT                   (PPCS) (CoaB)]"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00080"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72372"
FT                   /db_xref="GOA:D2TBZ5"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBZ5"
FT                   /protein_id="CAY72372.1"
FT                   /translation="MMELTGKRIVLGVSGGIAAYKTPELVRRLRDRGADVRVVMTDAAK
FT                   AFITPLSLQAVSGYPVSDSLLDPAAEAAMGHIELGKWADLVILAPATADLIARVAAGMA
FT                   NDLLTTICLATAAPLAIVPAMNQQMYRALPTQHNLQLLAQRGVMIWGPGSGSQACGDIG
FT                   PGRMLDPLVIVDHTAAWAAPANDLQHLNIMITAGPTREALDPVRFISNHSSGKMGFAIA
FT                   AAAAKRGATVTLVAGPVALPTPQGVNRLDVTTALEMQQAVMGLAACQQIFIGCAAVADY
FT                   RAASVAEEKIKKKGDEITLKMIKNPDIVAGVAAMQQNRPYVVGFAAETRNVEEYAQQKR
FT                   ARKNLDLICANDVAKSGQGFNSDTNALHLFWHEGEKILPLSDKPLLGQLLLEEIVTRYD
FT                   EKNRR"
FT   gene            96808..97479
FT                   /gene="grxC"
FT                   /locus_tag="EPYR_00081"
FT   CDS_pept        96808..97479
FT                   /transl_table=11
FT                   /gene="grxC"
FT                   /locus_tag="EPYR_00081"
FT                   /product="Glutaredoxin 3"
FT                   /function="Glutaredoxin and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00081"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72373"
FT                   /db_xref="GOA:D2TBZ6"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR022820"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBZ6"
FT                   /protein_id="CAY72373.1"
FT                   /translation="MEENWLGLPPREKLLKCGASSLSDTELLAIFLRTGVRGVHVMTLA
FT                   QQLLREFGSLHRLMNAPHDRFEAIHGVGMAKYAQLNAVAELARRCFSCQEALENQVVSS
FT                   VEQMLDFLNGSLAHREREIFQVIFFDNQHRVIHTSEMFSGTLNSVEVHPREIVREALKR
FT                   NAAALILAHNHPSGLAEPSRADRDITQQIVHACSLMNIRVLDHMVIGRGEYVSFAERGW
FT                   M"
FT   gene            97774..98010
FT                   /gene="rpmB"
FT                   /locus_tag="EPYR_00082"
FT   CDS_pept        97774..98010
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="EPYR_00082"
FT                   /product="50S ribosomal protein L28"
FT                   /function="Ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00082"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72374"
FT                   /db_xref="GOA:D2TBZ7"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBZ7"
FT                   /protein_id="CAY72374.1"
FT                   /translation="MSRVCQVTGKRPVTGNNRSHAMNATKRRFLPNLHSHRFWVESEKR
FT                   FVTLRVSAKGMRVIDKKGIETVLADLRTRGEKY"
FT   gene            98027..98194
FT                   /gene="rpmG"
FT                   /locus_tag="EPYR_00083"
FT   CDS_pept        98027..98194
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="EPYR_00083"
FT                   /product="50S ribosomal protein L33"
FT                   /note="Ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00083"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72375"
FT                   /db_xref="GOA:D2TBZ8"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBZ8"
FT                   /protein_id="CAY72375.1"
FT                   /translation="MAKGIREKIKLVSSAGTGHFYTTTKNKRTKPEKLELKKFDPVVRQ
FT                   HVIYKEAKIK"
FT   gene            98302..99111
FT                   /gene="mutM"
FT                   /locus_tag="EPYR_00084"
FT   CDS_pept        98302..99111
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="EPYR_00084"
FT                   /product="formamidopyrimidine DNA glycosylase"
FT                   /function="Formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="Formamidopyrimidine-DNA glycosylase (Fapy-DNA
FT                   glycosylase) (DNA-(apurinic or apyrimidinic site) lyase
FT                   mutM) (AP lyase mutM)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00084"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72376"
FT                   /db_xref="GOA:D2TBZ9"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:D2TBZ9"
FT                   /protein_id="CAY72376.1"
FT                   /translation="MPELPEVETSRRGIEPHLVGATILHAVVRNARLRWPVSQEIHALS
FT                   DQPVLSVQRRAKYLLLELPTGWIIIHLGMSGSLRVLPEDLPAAKHDHVDLVMSNGKVLR
FT                   YTDPRRFGAWLWCADLNGSSVLSHLGPEPLSDSFSARYLFEKSRGKRTAIKPWLMDNKV
FT                   VVGVGNIYASESLFVAGILPDRPAMALSEQEAGLLVSTIKAVLLRSIEQGGTTLRDFLQ
FT                   SDGKPGYFAQELQVYGRTGEPCRVCAMPVESSKHAQRSTFFCRRCQK"
FT   gene            complement(99121..99597)
FT                   /gene="kdtB"
FT                   /locus_tag="EPYR_00085"
FT   CDS_pept        complement(99121..99597)
FT                   /transl_table=11
FT                   /gene="kdtB"
FT                   /locus_tag="EPYR_00085"
FT                   /function="Phosphopantetheine adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="Phosphopantetheine adenylyltransferase
FT                   (Pantetheine-phosphate adenylyltransferase) (PPAT)
FT                   (Dephospho-CoA pyrophosphorylase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00085"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72377"
FT                   /db_xref="GOA:D2TC00"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC00"
FT                   /protein_id="CAY72377.1"
FT                   /translation="MSTKAIYPGTFDPMTNGHLDIVTRAARMFDRIVLAIAASPSKKPM
FT                   FSLEERVALASEVVAHLPNVDVVGFSDLLANFAKAQQANVLVRGLRAVSDFEYEMQLAQ
FT                   MNRHLLPTLESVFLMPSEQYAFISSSLMKEVARHGGDVESFLPTAVYQALKARF"
FT   gene            complement(99594..100370)
FT                   /gene="kdtX"
FT                   /locus_tag="EPYR_00086"
FT   CDS_pept        complement(99594..100370)
FT                   /transl_table=11
FT                   /gene="kdtX"
FT                   /locus_tag="EPYR_00086"
FT                   /product="lipopolysaccharide core biosynthesis glycosyl
FT                   transferase"
FT                   /function="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /EC_number="2.-.-.-"
FT                   /note="Lipopolysaccharide core biosynthesis
FT                   glycosyltransferase, Glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00086"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72378"
FT                   /db_xref="GOA:D2TC01"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC01"
FT                   /protein_id="CAY72378.1"
FT                   /translation="MRTRQKLSVVTIAKDAAELLPECLESVSWADEIIVLDSGSSDATP
FT                   QIAARHGAKVYHSSEWRGYGKQRQLAQSYASHPMILMIDSDERVTPELKQSIEKVLQQP
FT                   PTEVVYSLARCNLFLGRFMRHSGWYPDRVIRLYPRQFRYNDNLVHESLETAQAKTERLR
FT                   GDLLHLTCRDFSAFQWKQFAYAEAWAKQRHQQGKRCGIAAIFGHTAGAFIKTLLLRAGF
FT                   LDGKQGWLLAVVNAQYTFNKYTALWALNHASRNGRL"
FT   gene            complement(100371..101645)
FT                   /gene="kdtA"
FT                   /locus_tag="EPYR_00087"
FT   CDS_pept        complement(100371..101645)
FT                   /transl_table=11
FT                   /gene="kdtA"
FT                   /locus_tag="EPYR_00087"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase (KDO
FT                   transferase)"
FT                   /function="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /EC_number="2.-.-.-"
FT                   /note="3-deoxy-D-manno-octulosonic-acid transferase (KDO
FT                   transferase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00087"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72379"
FT                   /db_xref="GOA:D2TC02"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC02"
FT                   /protein_id="CAY72379.1"
FT                   /translation="MTTIYTVLLYLFQPFIWLRLWLRGRKAPAYRRRWAERYGFCAGKV
FT                   KPDGILLHSVSVGETLAAIPLVRALRHRYPDLPIVVTTMTPTGSERASSAFGKDVHHVY
FT                   LPYDLPGAMSRFFNTVRPRLVIIMETELWPNMITLLNARKIPLVIANARLSERSARGYQ
FT                   KIGKFMKRLLQRITLIAAQNEEDGERFIGLGVKRSQLAVTGSLKFDISVTPELAARAVT
FT                   LRRQWAPHRPVWIATSTHEGEESIILGAHRKLLERFPNLLLILVPRHPERFETARLLTQ
FT                   KNGLSYTLRSSGEIPSGSTRVVIGDTMGELMLLYGIADLAFVGGSLVERGGHNPLEPAA
FT                   HAIPVLMGPHTFNFKDICARLQQADGLITVTDADSLNKEIDTLLTDEDYRLYYGRHAVD
FT                   VLHQNQGALGRLLKLLEPHLPQRNH"
FT   gene            102015..103028
FT                   /gene="waaQ"
FT                   /locus_tag="EPYR_00088"
FT   CDS_pept        102015..103028
FT                   /transl_table=11
FT                   /gene="waaQ"
FT                   /locus_tag="EPYR_00088"
FT                   /product="Glycosyl transferase, family 9"
FT                   /function="ADP-heptose:LPS heptosyltransferase"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00088"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72380"
FT                   /db_xref="GOA:D2TC03"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC03"
FT                   /protein_id="CAY72380.1"
FT                   /translation="MKNILIIRRDNIGDLVCTTPLIEGVKTTFPDAKIYLLINSVSQDV
FT                   VKNNPYIEHTFIYRKAKHAAGKRAKLCVHLERLRMFLQLRRIRFDAAILANPQPCKYSV
FT                   RLAKMAGAKHIIGADSGDRAITVPFSRTDFRGKHQVELTFSYLSALSDKQIPIPGVRIW
FT                   LTEQERQQALCRIDKLHPGERPGLGVHISSRSAKRRWPLERYVDIIHRYLQQNSHGSVL
FT                   IFWSPQGTLAPDDIGDQHRAEQVLAACHSARVSLYPTSSVRELVAAFECCDRVLCSDGG
FT                   QMHLAAAVNKKQVVLFGDTDRKVWHPWSGQYDILQTPSGDCVDVSADEVWQCLSRL"
FT   gene            complement(103025..104122)
FT                   /gene="walW"
FT                   /locus_tag="EPYR_00089"
FT   CDS_pept        complement(103025..104122)
FT                   /transl_table=11
FT                   /gene="walW"
FT                   /locus_tag="EPYR_00089"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /function="Glycosyltransferase"
FT                   /EC_number="2.4.1.58"
FT                   /note="Uncharacterized glycosyltransferase, Glycosyl
FT                   transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00089"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72381"
FT                   /db_xref="GOA:D2TC04"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC04"
FT                   /protein_id="CAY72381.1"
FT                   /translation="MRILMIIDGLPGGGAEKVVLTLCEGMQRMGHQVSLFSLRDVCNYA
FT                   LPEGVDYQVVESHSRLPWRKLTELSRRAAALDRAVELSEKQGGDYDLIFSHLHKTDRIV
FT                   ARAKHLPAQKVWFCIHGILSTSYLGHRHGLDRWLKQRKIARVYQGKNMVAVSQAVAEDL
FT                   TVNLPVLPGRLAVINNPFDIENILAQAAQPFELPGEPYLIHVGRFHPHKRHDRLLQAYA
FT                   ESGIAAKLVLAGTGDKQQIDAVKQQAEQLGIAERVIFAGFQSNPYPLIKHAAILVLSSD
FT                   SEGFGNVLVEALLCGTPVVSTRCPGGPEEILQRAGMGNALAELNSHSLAEKMAEIYHSP
FT                   PEIDRQQLMSYDLQPICQQYLTLNG"
FT   gene            complement(104126..105253)
FT                   /gene="waaG"
FT                   /locus_tag="EPYR_00090"
FT   CDS_pept        complement(104126..105253)
FT                   /transl_table=11
FT                   /gene="waaG"
FT                   /locus_tag="EPYR_00090"
FT                   /product="probable glycosyltransferase"
FT                   /function="Glycosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /note="Lipopolysaccharide core biosynthesis protein
FT                   (Glucosyltransferase I), Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00090"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72382"
FT                   /db_xref="GOA:D2TC05"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC05"
FT                   /protein_id="CAY72382.1"
FT                   /translation="MKPIRLAIVRQKYRPDGGAERFIARALEALDQQALDLNVITRQWQ
FT                   GERQDNWHLHLCNPIKWGRISRERGFASAARAVWQREKFDIVQSHERIVGCDIYRAGDG
FT                   VHQRWLEQRCRLLPAWRQKLLLANRYHSYVMEAERAMYQAPELKAVICNAHMVRQEIIE
FT                   RFGVASDKIHVIYNAINTTQFVPVDKQQRIQIRKQLSLPPAASLLIYVGSGFERKGLAA
FT                   AIRALAGTNRYLVVVGKDKAEQQYRALASELGCAERVIFAGMQADTRPWYQAADGLLLP
FT                   TLYDPFPNVVLEAMACGLPVITSTTCGGSEFIRPGENGYICDALDIAALRDAIMALPEQ
FT                   ASGSQMALHAREQVMGSTPQRLSQQLISLYQQILD"
FT   gene            complement(105250..106323)
FT                   /gene="waaQ"
FT                   /locus_tag="EPYR_00091"
FT   CDS_pept        complement(105250..106323)
FT                   /transl_table=11
FT                   /gene="waaQ"
FT                   /locus_tag="EPYR_00091"
FT                   /product="putative heptosyl III transferase WaaQ (Glycosyl
FT                   transferase, family 9)"
FT                   /function="ADP-heptose:LPS heptosyltransferase"
FT                   /EC_number="2.4.-.-"
FT                   /note="Lipopolysaccharide core biosynthesis
FT                   glycosyltransferase waaQ, Glycosyltransferase family 9
FT                   (heptosyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00091"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72383"
FT                   /db_xref="GOA:D2TC06"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011916"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC06"
FT                   /protein_id="CAY72383.1"
FT                   /translation="MKHSDLPLSPHQPERILVIKFRHHGDMLLTTPVIRSLKAAWPEAK
FT                   IDVLLYEETRAMLACHPDIHQIYAIDRTWKKKGLRFQLGQEWRLLKTLKHQRYDVVVNL
FT                   ADQWRSAIITRFTAAPVRLGFNFPKRQGLLWQRCHTHLVATDQHQNMHTVEQNLSLLLP
FT                   LNLATLDNTVGMHYSQADDQAVRQRLNGTEKYIVVQPTSRWFFKCWSEEKFATVLQSLC
FT                   DDGHTIVLTSGPDTKELGMVKNIISRLSSDDKVISLAGQLTLNQLAALIDEARLFIGVD
FT                   SVPMHMAAALRTPCIALFGPSKLVFWRPWQVNGEVIWAGDFAPLPDPDSVDTQTSERYL
FT                   DAIPTETVLDAARRLLA"
FT   gene            106484..107440
FT                   /gene="walW"
FT                   /locus_tag="EPYR_00092"
FT   CDS_pept        106484..107440
FT                   /transl_table=11
FT                   /gene="walW"
FT                   /locus_tag="EPYR_00092"
FT                   /product="Lipopolysaccharide biosynthesis protein"
FT                   /note="Glycoside hydrolase/deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00092"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72384"
FT                   /db_xref="GOA:D2TC07"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC07"
FT                   /protein_id="CAY72384.1"
FT                   /translation="MGKPAFIITIDTEGDNLWQNHDRIMTENTHFLPRFQQLCEKYTFK
FT                   PTWLTNYEMAVDPAYVEFARDVIARNSGEIGMHLHAWNSPPLYDLTGDDWRHKPYLIEY
FT                   PEDNIREKVIYMTRLLEDTLQVKMRSHRAGRWAFNAFYARLLIEQGYQVDCSVTPRVNW
FT                   QFSPGNPEGNGGTNYQHFPDRAYFINEQDIAKAGNSALLEVPMSIQYKHPPLMNQVKTV
FT                   YDRLRGKQRSPSVHWLRPMRRNLAQMIQVAEKTLANGSDYVEFMLHSSEFMPGGSPTFK
FT                   TGADIEVLYNDLEQLFDWLHIRTVGMTLSEYYQEKVS"
FT   gene            107442..108545
FT                   /gene="waaF2"
FT                   /locus_tag="EPYR_00093"
FT   CDS_pept        107442..108545
FT                   /transl_table=11
FT                   /gene="waaF2"
FT                   /locus_tag="EPYR_00093"
FT                   /product="Glycosyl transferase, family 9"
FT                   /function="ADP-heptose:LPS heptosyltransferase"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00093"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72385"
FT                   /db_xref="GOA:D2TC08"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC08"
FT                   /protein_id="CAY72385.1"
FT                   /translation="MSKKWKINLTNWFLSNYTVKHGRLENKENFDAALSFDNIVIYSTT
FT                   ALGDFMFNTPAIRAVRERYPDAHITLVVHEKNRELVEGGKDYNRVVYWNSKIKTLMPLL
FT                   KSLREHQPDLAIILHSHLPYDVISAIMAGAKYVIRDNYSSGISGLEQWLTNYIFHYYGH
FT                   FIRRKLELISVLGCRSDDPTMFIPAPYQAAIRDPHKTTIGFQLGASTESRCWPVSHYVK
FT                   LAQQLVAQHDNVQIVLIGGGGDENKARQFMAQVNEQTRSFIDDRVGKTGLQQLITLIDG
FT                   FDVLVTGDTGPLHLAVALKAKTISLFVTADPRTTGPIQDNDLHCIIHASRSGFTLPLEA
FT                   ESPVGVIQPQRVYDEAVRLLGLLPRAS"
FT   gene            complement(108550..109539)
FT                   /gene="wabM"
FT                   /locus_tag="EPYR_00094"
FT   CDS_pept        complement(108550..109539)
FT                   /transl_table=11
FT                   /gene="wabM"
FT                   /locus_tag="EPYR_00094"
FT                   /product="Predicted glycosyl transferase, family 2"
FT                   /function="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /EC_number="2.4.-.-"
FT                   /note="Glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00094"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72386"
FT                   /db_xref="GOA:D2TC09"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC09"
FT                   /protein_id="CAY72386.1"
FT                   /translation="MLTSPPLLSVIVPFFNNEAFLIPCLESLFSQIGNDIEVILINDGS
FT                   SDNSAHLASQCLARYPEARVRYIAQQNSGIASTRNVGMQHASGRYMTFLDGDDVLSPHY
FT                   VDILKPVLLSGQYDLIDFDYQRFIHNPPEIHKQEGVRIHEYDFEKKGISCLEPLFTQSM
FT                   WHLWNRVYKRELLDKERFESGRRYEDVIFTPFIYFKSERMAHLDHTLYFYRDNSQGITR
FT                   NVKPADIEDMLFAIKKMEHYAAKKTENSALKNLAARMIVNCFGEVKSLTKAAYGYYHYN
FT                   KQTIATLQQAARLCAGSSVPAKXDLANALPSGGYVIVQNPPVLQKIVR"
FT   gene            complement(109533..110777)
FT                   /gene="waaL"
FT                   /locus_tag="EPYR_00095"
FT   CDS_pept        complement(109533..110777)
FT                   /transl_table=11
FT                   /gene="waaL"
FT                   /locus_tag="EPYR_00095"
FT                   /product="O-antigen ligase"
FT                   /function="Lipid A core - O-antigen ligase and related
FT                   enzymes"
FT                   /EC_number="6.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00095"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72387"
FT                   /db_xref="GOA:D2TC10"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC10"
FT                   /protein_id="CAY72387.1"
FT                   /translation="MLTEKSPHPALSYLIYTCCAIAFATVPFGLKFGKDIFYVASYISF
FT                   IAIVLNIRYYTLDKLKLVVSLLFLAFGLGTIFWLVAFKQPGPYIDIYRSYMSTARLVIA
FT                   MSVISLVALNERIAMQKITLGVSIAVGLLVNTYALYQRFWLLQSRIELNFDRTTIVAYL
FT                   LTAISLVMMQSILMHKIRYRLGFYIAAFMLSYSAIILTGTRAAMIAYPILILLTVMVTK
FT                   NIITVRHKITIILLIPVLLTSTSLIFKDLVMSRIHDFEKNIVAINDINSENSVFSRVWM
FT                   QVVAIRTGSEAPLGQSAEHRASEAVKIIQADPQLFNAKRYLTVHMHNEILETWSLKGIW
FT                   GVVLLLAFYGSLIVLAFRLPRNAMLFGLAVAMVIYGLSDVIFFSTEATAIFLLAIIASI
FT                   LSTKKNQTVTEQAVC"
FT   gene            complement(110798..111964)
FT                   /gene="wabK"
FT                   /locus_tag="EPYR_00096"
FT   CDS_pept        complement(110798..111964)
FT                   /transl_table=11
FT                   /gene="wabK"
FT                   /locus_tag="EPYR_00096"
FT                   /product="Lipopolysaccharide core biosynthesis
FT                   glycosyltransferase"
FT                   /function="Glycosyltransferase"
FT                   /EC_number="2.-.-.-"
FT                   /note="Lipopolysaccharide core biosynthesis
FT                   glycosyltransferase, Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00096"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72388"
FT                   /db_xref="GOA:D2TC11"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC11"
FT                   /protein_id="CAY72388.1"
FT                   /translation="MKKLHIINLAKMGGVERLFLQYINETTDGSNAVICVSNDIGEEIE
FT                   RQMPQQQVTFATRLFNKLSLRCPQFLRKYLLQWKIFRANADVIIVWDLIPGLSAKPKRG
FT                   KLLYYDHGCSWRYARNAKTLRFFSMLDGVISASHASKRVMELRFNLPCPNPVVLNRIKT
FT                   PVGISHQPRALHTPLRLGTASRLVSLKGISVSLLTLHELIRRGHDVMMEIAGKGPDKEA
FT                   FETLVQKLQLSDRVTFSGFQHNVSDFFNRIDIYMSTPITEPFGLSCMEALYYGVPVIFP
FT                   LVDGQPEAVSDGVCGLGISPKVSVMEHHKLSGLHVDFPYDVYDPVHDKMAPPKLLSHIE
FT                   CADAVEKLMVEETYRHLSLNAQNDSIQSLSFDVFKKEFDNTLNLFTGQ"
FT   gene            complement(111961..112926)
FT                   /gene="waaC"
FT                   /locus_tag="EPYR_00097"
FT   CDS_pept        complement(111961..112926)
FT                   /transl_table=11
FT                   /gene="waaC"
FT                   /locus_tag="EPYR_00097"
FT                   /product="lipopolysaccharide heptosyltransferase-1"
FT                   /function="ADP-heptose:LPS heptosyltransferase"
FT                   /EC_number="2.4.-.-"
FT                   /note="Lipopolysaccharide heptosyltransferase 1
FT                   ),Glycosyltransferase family 9 (heptosyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00097"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72389"
FT                   /db_xref="GOA:D2TC12"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011908"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC12"
FT                   /protein_id="CAY72389.1"
FT                   /translation="MRVLMIKTSSMGDVLHSLPALTDAMHAIPAIRFDWVVEEGFAQIP
FT                   CWHPAVDRVLPVAIRRWRKHWFGSQVREERVRFKRELQACEYDAIIDAQGLIKSAALVT
FT                   RLARGIKHGADSRSAREPFASWWYDKRYEISKQQHAVQRTRELFAKSLNYPLPATTGDY
FT                   AIAQHFTQALPEDAGQYLVFLHATTRDNKHWPESHWRELIALVQPAGLHIKLPWGAEHE
FT                   YQRALRLAEGFDFVEVLPRLTLEQVARTLAGARAVVSVDTGLSHLTAALDRPNITLYGP
FT                   TDPGLIGGYGKNQQALISPDKNMATLTAETVQTALQQVIA"
FT   gene            complement(112927..113973)
FT                   /gene="waaF"
FT                   /locus_tag="EPYR_00098"
FT   CDS_pept        complement(112927..113973)
FT                   /transl_table=11
FT                   /gene="waaF"
FT                   /locus_tag="EPYR_00098"
FT                   /product="ADP-heptose-LPS heptosyltransferase II"
FT                   /function="ADP-heptose:LPS heptosyltransferase"
FT                   /EC_number="2.4.-.-"
FT                   /note="ADP-heptose-LPS heptosyltransferase
FT                   2,Lipopolysaccharide heptosyltransferase
FT                   II,Glycosyltransferase family 9 (heptosyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00098"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72390"
FT                   /db_xref="GOA:D2TC13"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC13"
FT                   /protein_id="CAY72390.1"
FT                   /translation="MKILVIGPSWVGDMMMSHSLYRTLKAENPAATIDVMAPAWCRPLL
FT                   SRMPEVNQALPMPLGHGALQIAERRRLGKALRATGYDRAIVLPGSFKSALVPFFAAIPR
FT                   RTGWRGEMRYGLLNDLRVLDKNAFPLMVQRYVALGYDKASIRSANDLPQPLLRPELKVQ
FT                   DAEKQATIRVFKLDSQRPIIGFCPGAEFGPAKRWPHYHYATLAQQLIDQGYQVVLFGSA
FT                   KDRDTGQHILASLSEDSRQHCRNLAGETRLEQAVILLACCHAVVSNDSGLMHIAAALER
FT                   PLIALYGPSSPDFTPPLSEKARVIRLITGYHKLRKGDADEGYHQSLVDITPERVMAELD
FT                   MLHPTSGV"
FT   gene            complement(113988..114920)
FT                   /gene="waaD"
FT                   /locus_tag="EPYR_00099"
FT   CDS_pept        complement(113988..114920)
FT                   /transl_table=11
FT                   /gene="waaD"
FT                   /locus_tag="EPYR_00099"
FT                   /product="ADP-L-glycero-D-mannoheptose-6-epimerase"
FT                   /function="Nucleoside-diphosphate-sugar epimerases"
FT                   /EC_number="5.1.3.20"
FT                   /note="ADP-L-glycero-D-manno-heptose-6-epimerase
FT                   (ADP-L-glycero-beta-D-manno-heptose-6-epimerase)
FT                   (ADP-glyceromanno-heptose 6-epimerase) (ADP-hep
FT                   6-epimerase) (AGME)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00099"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72391"
FT                   /db_xref="GOA:D2TC14"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC14"
FT                   /protein_id="CAY72391.1"
FT                   /translation="MIIVTGGAGFIGSNIIKALNDKGITDILVVDNLKDGTKFANLADL
FT                   NIADYMDKEDFLIAILADEDFGDVEAIFHEGACSSTTEWDGKYMMDNNYQYSKELLHWC
FT                   LEHQVPFLYASSAATYGGRNADFIEERQYEQPLNVYGYSKMLFDHYVRDILPEAQSQVC
FT                   GFRYFNVYGPREGHKGSMASVAFHLNTQLNQGENPKLFAGSDGFKRDFIYVEDVAAVNL
FT                   WFWENAVSGIFNCGTGRAESFQEVADAALKYHQSGEIEYIPFPEKLKGRYQEFTLADQT
FT                   KLRAAGYDKPFKTVAEGVADYMAWLNRKA"
FT   gene            complement(115113..116027)
FT                   /gene="yigQ"
FT                   /locus_tag="EPYR_00100"
FT   CDS_pept        complement(115113..116027)
FT                   /transl_table=11
FT                   /gene="yigQ"
FT                   /locus_tag="EPYR_00100"
FT                   /product="Uncharacterized protein yibQ precursor"
FT                   /note="Protein of unknown function DUF610, YibQ,Divergent
FT                   polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00100"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72392"
FT                   /db_xref="GOA:D2TC15"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC15"
FT                   /protein_id="CAY72392.1"
FT                   /translation="MQPLRKLGEALIAIAIASPAWAGKLSIVIDDFGYRPALEQQVLQM
FT                   PAAISVAVLPNAPHAREMATKAHQSGHEVLIHLPMAPLSKQPLEKDTLRPDMPTEEIGR
FT                   IIREAAAAVPYAVGLNNHMGSAMTSSLPAMQKVMQILNHYHFYFLDSMTIGNSQATRAA
FT                   EGTNVKVVKRWVFLDDSQNEADIRVQFTRAVRLAQRDGSAIAIGHPHPSTVRVLQQMLP
FT                   GLPADIILERPSQLLNATQPVKPAPLPAHPLKPRNPFRGGSVCPVKAVPVPATRALETI
FT                   TESIKHNQMVQETASKLSVKFHF"
FT   gene            complement(116034..117323)
FT                   /gene="yibP"
FT                   /locus_tag="EPYR_00101"
FT   CDS_pept        complement(116034..117323)
FT                   /transl_table=11
FT                   /gene="yibP"
FT                   /locus_tag="EPYR_00101"
FT                   /product="Uncharacterized protein yibP"
FT                   /function="Membrane-bound metallopeptidase"
FT                   /note="Duplicated hybrid motif, Peptidase family M23"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00101"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72393"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC16"
FT                   /protein_id="CAY72393.1"
FT                   /translation="MLHSWTPRYLQVKARPQRASLSILTASALCTGALLFSFFAQAAED
FT                   SKSQLQSIQQDIAAKEKSVQLQKRQRSELLDQLQSQEKIIAQASRQLRVTQNTLSALNK
FT                   EITSLTASISHLQQRQKQQESSLGAQLDAAFRQGQHSGFQLILSGEESQRSERILAYFG
FT                   YLNEARQKAIEALKQTRSDLTLQKTSLVDKHAQQRSLLTQQQSQTQKLEGARQARKKTL
FT                   TSLESSLEKDQAQLVELQHNEIRLRDKLAKAEREARARAEQEAREAEKVRQREAQAKSK
FT                   GSTYKPTDSERALISRTGGLGRPAGQALWPVRGSIEHRFGEQLQGELRWKGLVIGAPEG
FT                   TEVKAIADGRVLMADWLQGYGLVVVIEHGKGDMSLYGYNQSALVSVGTQVHAGQPVALV
FT                   GTSGGRGTPSLYFEIRRQGQAVNPLPWLGR"
FT   gene            117692..118123
FT                   /gene="yibN"
FT                   /locus_tag="EPYR_00102"
FT   CDS_pept        117692..118123
FT                   /transl_table=11
FT                   /gene="yibN"
FT                   /locus_tag="EPYR_00102"
FT                   /product="UPF0176 protein CPS_4798"
FT                   /function="Rhodanese-related sulfurtransferase"
FT                   /note="Rhodanese-like, Rhodanese-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00102"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72394"
FT                   /db_xref="GOA:D2TC17"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC17"
FT                   /protein_id="CAY72394.1"
FT                   /translation="MQDIMQFAGNHTILALAWVVLLVLVIVTTVKGMFSKVKVISRGEA
FT                   TRLINKEEAVVVDVRGRDDYRKGHISNAINVLAAEIKKGSYGELEKHKAQPLIVVCATG
FT                   TSAGESAAQLSAAGYEQVYVLKDGVSGWSSENLPLVRGK"
FT   gene            118163..118414
FT                   /gene="grxC"
FT                   /locus_tag="EPYR_00103"
FT   CDS_pept        118163..118414
FT                   /transl_table=11
FT                   /gene="grxC"
FT                   /locus_tag="EPYR_00103"
FT                   /product="Glutaredoxin 3"
FT                   /function="Glutaredoxin and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00103"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72395"
FT                   /db_xref="GOA:D2TC18"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC18"
FT                   /protein_id="CAY72395.1"
FT                   /translation="MATVEIYTKSTCPFCHRAKALLDQKGASYQEIPIDGDATLREVMI
FT                   KRSGRTTVPQIFIDAQHIGGCDDLFALDGRNGLEALLK"
FT   gene            118497..118958
FT                   /gene="secB"
FT                   /locus_tag="EPYR_00104"
FT   CDS_pept        118497..118958
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="EPYR_00104"
FT                   /product="Protein-export protein secB"
FT                   /function="Preprotein translocase subunit SecB"
FT                   /note="Bacterial protein export chaperone SecB"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00104"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72396"
FT                   /db_xref="GOA:D2TC19"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC19"
FT                   /protein_id="CAY72396.1"
FT                   /translation="MSEQNNTEMSFQIQRIYTKDISFEAPNAPQVFQKEWEPEVKLDLD
FT                   TASSQLSDDVYEVVLRVTVTATVGEDTAFLCEVQQAGIFSIGGIEGTQMAHCLGAYCPN
FT                   ILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQSEGAVKQQDA"
FT   gene            118958..119977
FT                   /gene="gpsA"
FT                   /locus_tag="EPYR_00105"
FT   CDS_pept        118958..119977
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="EPYR_00105"
FT                   /product="glycerol-3-phosphate dehydrogenase (NAD+)"
FT                   /function="Glycerol-3-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.94"
FT                   /note="Glycerol-3-phosphate dehydrogenase [NAD(P)+]
FT                   (NAD(P)H-dependent glycerol-3-phosphate dehydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00105"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72397"
FT                   /db_xref="GOA:D2TC20"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC20"
FT                   /protein_id="CAY72397.1"
FT                   /translation="MRSAYAAMSVIGAGSYGTALAITLARNGHKVVLWGHNPRHQAQLQ
FT                   ADRCHRAFLPDVPFPDSLIVETDLAAAIAASRDLLVVVPSHVFGDVLQQIKPHLRADSR
FT                   LVWATKGLEKETGRLLQDVAREILGDNIPLAVISGPTFAKELAAGLPTAIALAATDSIF
FT                   AEELQQLLHCGKSFRVYNNPDFIGVQLGGAVKNVIAIGAGISDGIGFGANARTALITRG
FT                   LAEMSRLGAALGADPATFMGMAGLGDLVLTCTDNQSRNRRFGMMLGQGADVEGAQQAIG
FT                   QVVEGFRNTKEVKVLAERYGVEMPITEQIYQVLYCGKNAHDAALSLLGRTRKDENNGS"
FT   gene            120042..120860
FT                   /gene="cysE"
FT                   /locus_tag="EPYR_00106"
FT   CDS_pept        120042..120860
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="EPYR_00106"
FT                   /function="Serine acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="Serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00106"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72398"
FT                   /db_xref="GOA:D2TC21"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC21"
FT                   /protein_id="CAY72398.1"
FT                   /translation="MCVEPEQIWDDIKTEARELAECEPMLASFYHATLLKHDDLGSALS
FT                   YMLANKLANPIMPAIAVREVIQDAYRQEPSMIISAACDIQAVRQRDPAVDKYSTPLLYL
FT                   KGFHALQAYRIGHWLWNEGRRALAVYLQNEISVSFAVDIHPAAKIGRGIMLDHATGIVV
FT                   GETAIIEDDVSILQSVTLGGTGKTSGDRHPKIREGVMIGAGAKILGNIEVGRGAKIGAG
FT                   SVVLQPVPPHTTAAGVPARIVGKPNSDKPSMEMDQHFNGMLPGFEFGDGI"
FT   gene            complement(120959..121429)
FT                   /gene="yibK"
FT                   /locus_tag="EPYR_00107"
FT   CDS_pept        complement(120959..121429)
FT                   /transl_table=11
FT                   /gene="yibK"
FT                   /locus_tag="EPYR_00107"
FT                   /product="putative tRNA/rRNA methyltransferase"
FT                   /function="Predicted rRNA methylase (SpoU class)"
FT                   /EC_number="2.1.1.-"
FT                   /note="23S rRNA (guanosine-2'-O-)-methyltransferase rlmB
FT                   (23S rRNA Gm2251 2'-O-methyltransferase), RNA
FT                   methyltransferase TrmH, group 2, SpoU rRNA Methylase
FT                   family, rRNA_methyl_2: RNA methyltransferase, TrmH family,
FT                   group 2"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00107"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72399"
FT                   /db_xref="GOA:D2TC22"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC22"
FT                   /protein_id="CAY72399.1"
FT                   /translation="MHIVLFEPEIPPNTGNIIRLCANTGFQLHVIEPLGFAWDDKRLRR
FT                   AGLDYHEFAAIRHHASYEAFAASEAPQRLFALTTKGTPAHSAVSFQAGDYLLFGPETRG
FT                   LPARVLDALPAQQKIRIPMMPDSRSMNLSNAVSVVVYEAWRQLDYAGAILRT"
FT   gene            complement(121468..122895)
FT                   /gene="cpxA"
FT                   /locus_tag="EPYR_00108"
FT   CDS_pept        complement(121468..122895)
FT                   /transl_table=11
FT                   /gene="cpxA"
FT                   /locus_tag="EPYR_00108"
FT                   /product="two-component sensor kinase"
FT                   /function="Signal transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="Histidine kinase, Histidine kinase-, DNA gyrase B-,
FT                   and HSP90-like ATPase, cztS_silS_copS: heavy metal sensor
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00108"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72400"
FT                   /db_xref="GOA:D2TC23"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR032404"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038515"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC23"
FT                   /protein_id="CAY72400.1"
FT                   /translation="MVQNVARPGLPDGIRDMISSLTTRIFAIFWLTLALVLMLVLMLPK
FT                   LDSRQMTPLLDNEQRQGTMIEQHVEAELRQDPPNDLMWWRRLFRAIDKWAPPGQRLLLV
FT                   TSEGRVIGAQHSEMQVIRNFIGQSDNADRPQKKKYGRLEMVGPFSIRDAEDSYQLYLIR
FT                   PAGSSQLDFINLLFDRPLLLLIVTMLISSPLLLWLAWSLAKPARKLKHAADDVAAGNLR
FT                   QRPELESGPQEFLAAGASFNQMVSALERMMNAQQRLLSDISHELRTPLTRLQLATALMR
FT                   RRHGEGKELERIETEAQRLDGMINDLLVLSRTQHKNALISEAIKANHLWSDVLEDARFE
FT                   AEQMGKLLEIPYPPGPWPLYGNPSSLESALENIVRNALRYSHSKISVSFAVDKKGITVH
FT                   VDDDGPGVSEEDRGQIFRPFYRTDEARDRESGGTGLGLAIVDNAIQQHHGWVKADDSPL
FT                   GGLRLTIWLPLYTTHSE"
FT   gene            complement(122844..123545)
FT                   /gene="cpxR"
FT                   /locus_tag="EPYR_00109"
FT   CDS_pept        complement(122844..123545)
FT                   /transl_table=11
FT                   /gene="cpxR"
FT                   /locus_tag="EPYR_00109"
FT                   /product="Alkaline phosphatase synthesis transcriptional
FT                   regulatory protein phoP"
FT                   /function="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /note="CheY-like, Response regulator receiver domain,PhoB:
FT                   phosphate regulon transcriptional regulatory protein PhoB"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00109"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72401"
FT                   /db_xref="GOA:D2TC24"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC24"
FT                   /protein_id="CAY72401.1"
FT                   /translation="MNKILLVDDDRELTSLLKELLEMEGFNVLVAGDGEQALTLLDSTV
FT                   DLLLLDVMMPKKNGIDTLKELRQQHQTPVIMLTARGSELDRVLGLELGADDYLPKPFND
FT                   RELVARIRAILRRSNWSEQQHLQHDNSSPTLEIDLLRLNPGRQEASFDGETLDLTGTEF
FT                   TLLYLLAQHLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPERQDGHPWFKTL
FT                   RGRGYLMVSAT"
FT   gene            123698..124207
FT                   /gene="cpxP"
FT                   /locus_tag="EPYR_00110"
FT   CDS_pept        123698..124207
FT                   /transl_table=11
FT                   /gene="cpxP"
FT                   /locus_tag="EPYR_00110"
FT                   /product="Periplasmic protein cpxP precursor"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00110"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72402"
FT                   /db_xref="GOA:D2TC25"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC25"
FT                   /protein_id="CAY72402.1"
FT                   /translation="MRKVTAVVVVPALIITFFVAWSANAATTGEMHQDDGTNRTLRQVP
FT                   QSNMFDGISLTEQQRQEMRDLMQQARYDRSPISISDLDQLHELIIADKFDKAAYEAQAK
FT                   KIAHAEVARQVEMGRVRNQMYHLLTPQQQSILQQKHQQRLGELRRLTNMQLSSPLQAAS
FT                   STDSTP"
FT   gene            124343..125245
FT                   /gene="fieF"
FT                   /locus_tag="EPYR_00111"
FT   CDS_pept        124343..125245
FT                   /transl_table=11
FT                   /gene="fieF"
FT                   /locus_tag="EPYR_00111"
FT                   /product="putative ferrous-iron efflux pump fieF"
FT                   /function="Predicted Co/Zn/Cd cation transporters"
FT                   /note="Cation efflux protein, The Cation Diffusion
FT                   Facilitator (CDF) Family, TC 2.A.4.7.1 Ferrous-iron efflux
FT                   pump fieF"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00111"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72403"
FT                   /db_xref="GOA:D2TC26"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC26"
FT                   /protein_id="CAY72403.1"
FT                   /translation="MKANYARQVFAAAIAATVLASLLLIIKIFAWWYTGSVSVLAALVD
FT                   SLVDIAASLTNLLVVRYSLQPADAEHTFGHGKAESLAALAQSMFICGSALFLFLTGLQH
FT                   LASPEQMKAPLVGIIVTLTALVSTLILVTFQRWVVRHTCSQAIRADMLHYQSDVVMNGA
FT                   ILLALALSGYGFHRADALFALGIGCWILYSALRMGYDAVQALLDRALPVAEHQAIVDIV
FT                   AAWPGVCGAHDIRTRQSGPTRFIQLHLEMDDHLPLCKAHQLADQVEQALLHKFPGSDVI
FT                   IHQDPRSVVAKERRGKFGQ"
FT   gene            125452..126414
FT                   /gene="pfkA"
FT                   /locus_tag="EPYR_00112"
FT   CDS_pept        125452..126414
FT                   /transl_table=11
FT                   /gene="pfkA"
FT                   /locus_tag="EPYR_00112"
FT                   /product="6-phosphofructokinase I"
FT                   /function="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="6-phosphofructokinase (Phosphofructokinase)
FT                   (Phosphohexokinase), ATP-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00112"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72404"
FT                   /db_xref="GOA:D2TC27"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012828"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC27"
FT                   /protein_id="CAY72404.1"
FT                   /translation="MIKKIGVLTSGGDAPGMNAAIRGVVRAALSEGLEVCGIYDGYLGL
FT                   YEDRMINLDRYSVSDMINRGGTFLGSARFPEFRHEDVRSVAIENMKKRGIDALVVIGGD
FT                   GSYMGAKRLTEMGFPCIGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSSSHQR
FT                   ISIVEVMGRYCGDLTLAAAIAGGCEFIVLPEIPYTREELVNEIKAGIAKGKKHAIVAIT
FT                   EHICDIDELAKYIEQETKRETRSTVLGHIQRGGAPVAYDRILASRMGAYSIELLLQGYG
FT                   GRCVGIQNEKMVHHDIIDAIENMKRPFKGDWLDTAKKLY"
FT   gene            126558..127547
FT                   /gene="sbp"
FT                   /locus_tag="EPYR_00113"
FT   CDS_pept        126558..127547
FT                   /transl_table=11
FT                   /gene="sbp"
FT                   /locus_tag="EPYR_00113"
FT                   /product="Sulfate-binding protein precursor"
FT                   /function="ABC-type sulfate transport system, periplasmic
FT                   component"
FT                   /note="sulphate-binding protein, TC 3.A.1.6.1
FT                   Sulfate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00113"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72405"
FT                   /db_xref="GOA:D2TC28"
FT                   /db_xref="InterPro:IPR000957"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC28"
FT                   /protein_id="CAY72405.1"
FT                   /translation="MNKWSVGVTLLLASTSVLAKDIQLLNVSYDPTRELYEQYNRAFSA
FT                   HYKQETGDNVIIRQSHGGSGKQATSVINGIKADVVTLALASDVDAIAERGRIDKNWITR
FT                   LPDNSAPYTSTIVFLVRKGNPKQIHDWPDLIKPGVSVITPNPKTSGGARWNYLAAWGWA
FT                   LDHNHGDPAKAQEYVKALFNNVEVQDSGARGATNTFVERGIGDVLIAWENEAYLAVNKL
FT                   GKDQFEIVTPSESILAEPTVSVVDKVVDDRDTRKVADDYLKYLYSTEGQDIAAQNFYRP
FT                   RDAAVAKKYASTFQPVKLFTIDGKFGGWSQAQKTHFAEGGTYDQVMKR"
FT   gene            127734..128513
FT                   /gene="cdh"
FT                   /locus_tag="EPYR_00114"
FT   CDS_pept        127734..128513
FT                   /transl_table=11
FT                   /gene="cdh"
FT                   /locus_tag="EPYR_00114"
FT                   /product="CDP-diacylglycerol phosphotidylhydrolase"
FT                   /function="CDP-diacylglycerol pyrophosphatase"
FT                   /EC_number="3.6.1.26"
FT                   /note="CDP-diacylglycerol pyrophosphatase
FT                   (CDP-diacylglycerol phosphatidylhydrolase) (CDP-diglyceride
FT                   hydrolase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00114"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72406"
FT                   /db_xref="GOA:D2TC29"
FT                   /db_xref="InterPro:IPR003763"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR038433"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC29"
FT                   /protein_id="CAY72406.1"
FT                   /translation="MQERKRVVTVLIVFVGLMTVFFVYIALNFSNKSNYLWQVISHQCI
FT                   PGQQLKSNPAPCRQVNIADGYVVMKDRNGQLQFLLIPVSKITGIESQKLLNPATPNFLS
FT                   EAWRTRHFMEERRGELIDDRFYALAVNSRWGRTQNQLHIHISCLRPDIRQRLDHLSPKL
FT                   DATWQTYRLGEREYLLRVVTRDEFKRTSPFIRLANELPGARDDMGSYGIAVAALGDDKR
FT                   VLMVVKRHLLLLNRASAEELQDHSCALLKQNIARGGV"
FT   gene            complement(128577..129599)
FT                   /gene="yhjD"
FT                   /locus_tag="EPYR_00115"
FT   CDS_pept        complement(128577..129599)
FT                   /transl_table=11
FT                   /gene="yhjD"
FT                   /locus_tag="EPYR_00115"
FT                   /product="Inner membrane protein yhjD"
FT                   /function="Predicted membrane protein"
FT                   /note="Conserved hypothetical protein CHP00766,Ribonuclease
FT                   BN-like family, TIGR00766: ribonuclease,putative"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00115"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72407"
FT                   /db_xref="GOA:D2TC30"
FT                   /db_xref="InterPro:IPR005274"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC30"
FT                   /protein_id="CAY72407.1"
FT                   /translation="MTDNQQCDTENSQQSADKPLIAIKTGNHTIDKSITRVSRLVSWFQ
FT                   AIPAVAHFLRAGERFNDRLGSQFGAAITYFSFLSLIPILMVSFAAVGFVLASNQSLLTE
FT                   LIGKIVGNISDPSLASTLKNTVNTAIQQRTTVGLTGLLVALYSGISWMGNLREAIRAQS
FT                   RDVWERAPQDQEKIWFKYSRDFISLIGLVLALIITLSLTSIAGAAQASIVRALGLENIE
FT                   WLRPVMTLIALSISIFANYLLFLWIFWILPRHKPRKRALFRGTLLAAIGFEAIKFIMTL
FT                   TLPKLASSPSGAAFGSVLGLMAFFYFFARLILFCAAWIATAQYQNDPENPEDAEDAQKS
FT                   "
FT   gene            129582..129674
FT                   /locus_tag="EPYR_00116"
FT   CDS_pept        129582..129674
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00116"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72408"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC31"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72408.1"
FT                   /translation="MLIIRHESFFNPSEKRSAANYSLLVSQRKV"
FT   gene            130401..130865
FT                   /locus_tag="EPYR_00117"
FT   CDS_pept        130401..130865
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00117"
FT                   /product="S-adenosylmethionine decarboxylase proenzyme;
FT                   AdoMetDC; SAMDC; Contains: RecName:
FT                   Full=S-adenosylmethionine decarboxylase beta chain;
FT                   Contains: RecName: Full=S-adenosylmethionine decarboxylase
FT                   alpha chain; Flags: Precursor"
FT                   /function="S-adenosylmethionine decarboxylase"
FT                   /EC_number="4.1.1.50"
FT                   /note="S-adenosylmethionine
FT                   decarboxylase,S-adenosylmethionine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00117"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72409"
FT                   /db_xref="GOA:D2TC32"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR017716"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC32"
FT                   /protein_id="CAY72409.1"
FT                   /translation="MLEIISQGKYFVVFFKIHKEILAMSLGNKDSSGFSFSGKHVFAEF
FT                   YGVLNSLLNDEDHLAKIMRDAVAASGATILNETSHKFIPEGCTALLLLSESHASIHTYP
FT                   SHSAAFIDIFTCGDCNPNLAIREIEKALNPTRVNSTCVIRGDAKYVEQNH"
FT   gene            130846..131703
FT                   /gene="speE"
FT                   /locus_tag="EPYR_00118"
FT   CDS_pept        130846..131703
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="EPYR_00118"
FT                   /product="putative spermidine synthase"
FT                   /function="Spermidine synthase"
FT                   /EC_number="2.5.1.16"
FT                   /note="Spermine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00118"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72410"
FT                   /db_xref="GOA:D2TC33"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC33"
FT                   /protein_id="CAY72410.1"
FT                   /translation="MLSKIIEPIGKGVSRVWDIEEIIFSKKTPFQEMVIAKTGQGVSLF
FT                   CNNERQSVEESQLIYHEGQIIPAALFCGEIKHVLVVGSSEGVISKLALELGAKKVTHVD
FT                   IDAECVDACARFLPYGYTTEEVQLAKEDNGPVHLIIGDGYKFIDDAIARGDKYDIIVLD
FT                   LPDEQEDSVQQNRLYTSEFNEKITQLLTPEGVYISQAGCSTWWRNKTLSQSVKRFNDSF
FT                   KSIVFFEMEEQNWVWLVGANFACDDIVGRMKQKLINLPYLPKFIDSQSIIKSTILPVSL
FT                   RNSQ"
FT   gene            131720..132820
FT                   /gene="hsvA"
FT                   /locus_tag="EPYR_00119"
FT   CDS_pept        131720..132820
FT                   /transl_table=11
FT                   /gene="hsvA"
FT                   /locus_tag="EPYR_00119"
FT                   /product="hrp-associated systemic virulence protein HsvA"
FT                   /function="N-Dimethylarginine dimethylaminohydrolase"
FT                   /EC_number="2.1.4.1"
FT                   /note="Similar to L-arginine:lysine amidinostransferase
FT                   (AmtA) of Pseudomonas syringae pv. phaseolicola, Required
FT                   for systemic infection in apple shoots"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00119"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72411"
FT                   /db_xref="GOA:D2TC34"
FT                   /db_xref="InterPro:IPR033195"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC34"
FT                   /protein_id="CAY72411.1"
FT                   /translation="MNFQKEESRIYAPEKSPVEVYTEWDPLEEVIVGIVDDIRVPEWDP
FT                   GLDAVIPKNAKNFFKKHSAGRFPEELIALAKKDVDRLADILRSEGVRVRRPEEVNHHKT
FT                   IITPHFTTGGGFYSAMPRDCLLAIGKKIIEVPMAWRSRYFETFSFREILNDYFTRGAEW
FT                   LAAPKPMLKDSLWKANHDCEQEEKFDSAIDESEPVFDAADFMKMGKDIIGQRSHVTNDK
FT                   GIEWLRRTLGDEYRIHIYEFDDASPMHIDTTILPLAPGRVLVNKAWVSQIPDIFRDWEI
FT                   LTPPPSTLDNAHPLFMTSKWIHTNVLMLDEKTVVIEKDEVFLQQAFCQWGFKTILCPFK
FT                   HFQTFGGSFHCATLDVKRSGSLKSYV"
FT   gene            132813..134195
FT                   /gene="capK"
FT                   /locus_tag="EPYR_00120"
FT   CDS_pept        132813..134195
FT                   /transl_table=11
FT                   /gene="capK"
FT                   /locus_tag="EPYR_00120"
FT                   /product="possible CapK protein"
FT                   /function="Coenzyme F390 synthetase"
FT                   /EC_number="6.2.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00120"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72412"
FT                   /db_xref="GOA:D2TC35"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC35"
FT                   /protein_id="CAY72412.1"
FT                   /translation="MSEVYNVREYHGGIQTIMRYADVEPLGVESIERQTEMRQLLEKEY
FT                   AEFRGRLTLDREQLDAWKLERLRSMVDWAFTTSPFYHEKYRSCGYEKGAIRTYRDFATL
FT                   PSISKDDVIAHFPLGMPSNKFKPASCRWMSSSGSSGKQVQIILPQHRANLDILHKYRMF
FT                   EFMSGRHLDPSRWIYNIHYCVWWHTSVLGDYRVFTLSQDCPGFYALKHIKYLRPQIISS
FT                   IGSYLQQLAAIGERLDVHGVELISTNSETTTQQERDRYESIFRVPVRDEYSSEELDILA
FT                   MQCRDKHYHVVEDDVHLEIINCDSNGVGEIVGTDLWNQAMPMIRYEQGDLCEMDENEQS
FT                   CTCGSHFHRLKKLHGRADQGLTTQQGKTIPPASILDAVERFFCQDDSNILEFRVVQRAP
FT                   DHIDVLYICRDKTVSQNDSMFDAFQAHLCKIFAHKVYVKPVQLDEIPPEKSYKRRTVIN
FT                   QC"
FT   gene            134203..135426
FT                   /gene="hsvC"
FT                   /locus_tag="EPYR_00121"
FT   CDS_pept        134203..135426
FT                   /transl_table=11
FT                   /gene="hsvC"
FT                   /locus_tag="EPYR_00121"
FT                   /product="hrp-associated systemic virulence protein HsvC"
FT                   /function="Biotin carboxylase"
FT                   /EC_number="6.3.5.5"
FT                   /note="Required for systemic infection in apple shoots"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00121"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72413"
FT                   /db_xref="GOA:D2TC36"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC36"
FT                   /protein_id="CAY72413.1"
FT                   /translation="MKKILVVSCELDITEKIGELEEIYHIPSSRFVFLIEDFTAAGTLT
FT                   ESERYFIVRDFAVHSEVAAVIENIFLIHQITEVISNDEFSVFVASYVRERLQLAGMKCE
FT                   EARKYRDKQQMKKVASFHGIPTPEQFSQEDVRRGDVPFPLVLKPRSLAGAVGVTVLQSA
FT                   AELPAELVRCAEDYRDMDDGQFIIEAYHPGDIFHIDCAIFAGRIVFISVGVYDGKPLDY
FT                   LHGALLGSVSVPHEDVAAIWQPFTEKLRGAFNFPDGVFHIEAFGGSDKEPALLEIAFRP
FT                   GGGPITDAVLHAYGIDLRRVHLAAQLGLISELRVSGTDNAYAWLLYPKDHSSSDRKKVR
FT                   HVTIPRLEKLSTLKAYTLAKIGDMASGAFYCHKDCLGMFVFSGDRELINRDYKQLKTEC
FT                   AFLLGMAE"
FT   gene            135423..136442
FT                   /gene="rbsA"
FT                   /locus_tag="EPYR_00122"
FT   CDS_pept        135423..136442
FT                   /transl_table=11
FT                   /gene="rbsA"
FT                   /locus_tag="EPYR_00122"
FT                   /product="high affinity ribose transport protein"
FT                   /function="ABC-type sugar transport system, ATPase
FT                   component"
FT                   /EC_number="3.6.3.17"
FT                   /note="Ribose import ATP-binding protein rbsA 1, TC
FT                   3.A.1.2.1 Ribose transport ATP-binding protein rbsA"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00122"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72414"
FT                   /db_xref="GOA:D2TC37"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC37"
FT                   /protein_id="CAY72414.1"
FT                   /translation="MISPLIEVSNVSKIYRSKIKGKGFRGRLDNIFRPQYTRSKVIENI
FT                   SFTLYQGQSLAILGPNGAGKSTLIKILSGIQRTDEGSVRVLAMDPYEKKKKLFTNLGVV
FT                   FGHKNCLWWDLPLYRSLEMVQPLYGLERDTFRQDLAEISTLLNIDNIMDKPVRLLSLGE
FT                   RVKSELAFNLSFRPKILFLDEPTIGLDISSKYEIRELLKTLKRERGVSYIITSHDMGDI
FT                   DGYVDDIILLHKGKEQFYGNIDELKNRIPSMVTITLFCENLMTPSAAAQRVDEIAIKAS
FT                   VILQGKLIKDDEIAIDISLSREACPRFIQALTAELSCAFSVSTPSLEEMLRVKFKEFN"
FT   gene            136417..137250
FT                   /locus_tag="EPYR_00123"
FT   CDS_pept        136417..137250
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00123"
FT                   /product="hypothetical protein"
FT                   /function="ABC-type uncharacterized transport
FT                   system,permease component"
FT                   /note="Protein of unknown function DUF990"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00123"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72415"
FT                   /db_xref="GOA:D2TC38"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC38"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72415.1"
FT                   /translation="MLNLKNLTNRFFAIYLYARNGMLTVVNDKAMFFTDFVMGTLSPFI
FT                   VQLILWSAIFTAERNSVNNFNFNDIVYYYAFALILSRLNNGYDLIRTLSEHIREGALEV
FT                   WLTKPFSYLTQRLFTFLGESVLYAIPLLVIYSIKHTSMDYEGNAVFILLNALMTIIMVI
FT                   VLSQLLCFLLSFGLSLLSFWVIEYNILLSFSILSSSLLGGVLLPPSFWPEWLMPVMKYN
FT                   PWHFIISAPAEYLTTYNQAILHHFLLGSVAYIIMILLFVRVVWDKGMKVYNGAGG"
FT   gene            137252..138022
FT                   /locus_tag="EPYR_00124"
FT   CDS_pept        137252..138022
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00124"
FT                   /product="hypothetical protein"
FT                   /note="Protein of unknown function DUF990"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00124"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72416"
FT                   /db_xref="GOA:D2TC39"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC39"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72416.1"
FT                   /translation="MKIIFYYIYMNACRQFVYGKNLSGEFILSLSYYLVQFVFIDQLSS
FT                   FSGRLGSYSKEEVHLIFVVFVLLGLLLSIFTHSVETFFDKVAHGKIEVYLTKPVSIWIM
FT                   MLLGWCKPLHLINFIILFLCAYLFVSVPEMSGSDLNWLSFILALVCIFLINICFFMIFN
FT                   FLTFITSRKMPVDYFHEMIFELSFIPVAIYPSAIVKWLLFLLPMGFSASLPVSLLLGKN
FT                   EWNIGYLLLSTVIIITVTTISYRVSIGKFNGLGG"
FT   gene            138024..138917
FT                   /locus_tag="EPYR_00125"
FT   CDS_pept        138024..138917
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00125"
FT                   /product="Omega-3 fatty acid desaturase, chloroplastic;
FT                   Flags: Precursor"
FT                   /function="Fatty acid desaturase"
FT                   /EC_number="1.14.19.-"
FT                   /note="Fatty acid desaturase, type 1"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00125"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72417"
FT                   /db_xref="GOA:D2TC40"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC40"
FT                   /protein_id="CAY72417.1"
FT                   /translation="MDVQLINKIKHENKRKSIFKASIIAFVNVFIPWLIACLSCWATTY
FT                   SPIFYLLFPFLSFYIGTRFRAINNMSHEAIHFSFCRNRKANEIFGEIFAVAEFSKFELI
FT                   RKEHMTHHKYLGDMKRDMDFSGIRQYGLHKKMTRRRTLRHLRQALLLQQIKDTFFFIIF
FT                   DRDAPDWANTLRVCYLLILFPVFICFPLWFFCLFIIPFCYFYQVQKHLTDVFDHGGLLK
FT                   NDDPVHKSRNFIIKNRFLSALLLPRFDGYHLVHHLLPWVSVENHRQAHHILLENSEYRS
FT                   REHAALKQLREWLNDK"
FT   gene            138907..140211
FT                   /locus_tag="EPYR_00126"
FT   CDS_pept        138907..140211
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00126"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72418"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC41"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72418.1"
FT                   /translation="MTNSSLYSTNKLIDLSAANAWRLQAIEHGIIDPSWEWLLTAVAYH
FT                   HDPLQRLQLSLARIERLMEEVWIAYFHQPATLLRELGIPEWMLNYIKLDKCVMPVPLRW
FT                   DAICRETHWKIIEINTGFCLGGLNGFSVNQQREDFYARSGSDIAMAQLDNTFRFLAESL
FT                   RPVVGDNAVIPVIETAGGYEKYGFYLHHFVMNMNKTRSGFYISGTVADFEIIEEQIFFK
FT                   GHAVMHFIPMFNLYELSENQPDHRFFLHHLKEESLVSLLGFRELIFSNKAFIPWLVSYA
FT                   AATRSAEEAQEIADLFPRSTVLSNGNVRSFFDGDFILKPAEGYGGNGIVCSWLCQRDDW
FT                   INALQHVLSDGDLWLIQERIIGNVSYMQSVDASGNMKEGCSSVVHGFITLRGKFIGNLT
FT                   RAAIGIQQPGIINAHQGAAFGLSGLNLNMSAKRIL"
FT   gene            140455..140964
FT                   /locus_tag="EPYR_00127"
FT   CDS_pept        140455..140964
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00127"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72419"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC42"
FT                   /protein_id="CAY72419.1"
FT                   /translation="MAVYNKVVADDFDVPLVVQGDRFTLRPLSPEYADLDYAAVTASKP
FT                   ILGDIFSDCWPEDIRSREDNLAYISEDYQDFIDRTGFSYIILDNDERFCIGCVYLFPSL
FT                   YEGSDVAVYYWFNIEVVETPLAEKVESFIRQWVGDFWRIEKPAYPGRDIPWGEWLSRSR
FT                   KIFPEN"
FT   gene            complement(141045..141896)
FT                   /gene="pab"
FT                   /locus_tag="EPYR_00128"
FT   CDS_pept        complement(141045..141896)
FT                   /transl_table=11
FT                   /gene="pab"
FT                   /locus_tag="EPYR_00128"
FT                   /product="Diaminopimelate epimerase"
FT                   /function="Predicted epimerase, PhzC/PhzF homolog"
FT                   /EC_number="5.1.1.7"
FT                   /note="Diaminopimelate epimerase (DAP epimerase),Phenazine
FT                   biosynthesis PhzC/PhzF protein, Phenazine biosynthesis-like
FT                   protein, PhzF_family: phenazine biosynthesis protein PhzF
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00128"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72420"
FT                   /db_xref="GOA:D2TC43"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC43"
FT                   /protein_id="CAY72420.1"
FT                   /translation="MTLKRPFKQVDVFTTTPCNGNPLAVIMDASGLSNAQMQSIARWTH
FT                   LSETTFVLPPTDAAADYRVRIFTKDMELPFAGHPTLGTAHALLEAGHALKHPGQIVQEC
FT                   QLGLVKVKIGAGGALAFAAPEAILTPFNDAPISSALNSERLEEQLPMMIADMGIRWLLV
FT                   PMTSAEAVLAAKPDAVEFTRLVQKARVNGVMIFAPLQGANEQYEVRALMIEQGALAEDP
FT                   VTGSANACLARYFQARGVELDYHVRQGTAIQRAGRLSVNYACDGIWIGGQTVTVINGTV
FT                   TI"
FT   gene            complement(142247..143809)
FT                   /gene="mqo"
FT                   /locus_tag="EPYR_00129"
FT   CDS_pept        complement(142247..143809)
FT                   /transl_table=11
FT                   /gene="mqo"
FT                   /locus_tag="EPYR_00129"
FT                   /product="malate dehydrogenase (acceptor)"
FT                   /function="Predicted dehydrogenase"
FT                   /EC_number="1.1.99.16"
FT                   /note="probable malate:quinone oxidoreductase (Malate
FT                   dehydrogenase [acceptor])"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00129"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72421"
FT                   /db_xref="GOA:D2TC44"
FT                   /db_xref="InterPro:IPR006231"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC44"
FT                   /protein_id="CAY72421.1"
FT                   /translation="MRKMAVDNHVDVLLIGGGVMSATLGTYLQELEPEWRISMVERLDG
FT                   VAEESSNGWNNAGTGHSALMELNYTPENADGSVSIKKAIEINEAFQISRRFWAHQVQRH
FT                   VMSNPQSFITSVSHMSFVWGDANVKFLKKRFTALQQSTLFRGMEFSEDPQQIGEWVPLV
FT                   MEGRDPTQKVAATRIPTGTDVNFGEITRQLVASLQKSENFQRQTSREVRSIKRNTDGSW
FT                   CVTVSDLKNNDEKTVIRAKYVFIGAGGAVLKLLQESGIPEAKNYAGFPVGGEFLVTDNP
FT                   ELVNSHHAKVYGKASVGAPPMSVPHLDSRVLDGKQVLLFGPFATFSTKFLKQGSLWDMF
FT                   SSITPSNLAPMLRVGLDNFNLVKYLVGQVMLGEDDRINALREYFPQAQKHDWRRVKAGQ
FT                   RVQIIQKDASKGGVLKLGTEVVTSQDGTISALLGASPGASTAAPIMLELMSKVFKQQMA
FT                   TPQWQSKLKAIIPFYGQKLNGNVAATEKELAETSRILQLDYTPMDPAANDEPTITTHSV
FT                   IGK"
FT   gene            complement(144189..144956)
FT                   /gene="tpiA"
FT                   /locus_tag="EPYR_00130"
FT   CDS_pept        complement(144189..144956)
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /locus_tag="EPYR_00130"
FT                   /function="Triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="Triosephosphate isomerase (TIM) (Triose-phosphate
FT                   isomerase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00130"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72422"
FT                   /db_xref="GOA:D2TC45"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC45"
FT                   /protein_id="CAY72422.1"
FT                   /translation="MRHPLVMGNWKLNGNKHMVNELIAGLRTELSGVDGCGVAIAPPVM
FT                   YLDQAKQAISGSPVALGAQNVDVNLSGAFTGEVSAEMLKDIGARYIIIGHSERRTWHAE
FT                   SDELIAKKFAVLKATGLIPVLCIGETEAENEAGKTEEVCARQIDAVLNSQGADAFTGVV
FT                   IAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAQKDATVAAQVIIQYGGSVNDKNAAELF
FT                   AQPDIDGALVGGASLKADAFAAIVKAAAAAKRA"
FT   gene            complement(145075..145668)
FT                   /gene="yiiQ"
FT                   /locus_tag="EPYR_00131"
FT   CDS_pept        complement(145075..145668)
FT                   /transl_table=11
FT                   /gene="yiiQ"
FT                   /locus_tag="EPYR_00131"
FT                   /product="Uncharacterized protein yiiQ precursor"
FT                   /note="Protein of unknown function DUF1454, Protein of
FT                   unknown function (DUF1454)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00131"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72423"
FT                   /db_xref="InterPro:IPR009918"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC46"
FT                   /protein_id="CAY72423.1"
FT                   /translation="MKKAIWAGIVLLAAITTTATYAAVDPAGQTDPISAAPYLQTGAPV
FT                   FDITIAQFREKYNAANAALPLVEYRAIDSRNDKSNLTRAASKINENLYSSTALEHGTGK
FT                   IKTLQITWLPIPGPEQKASRDKALAYMTAFIRFFEPMLSAEKSLQRANALLAKGKGLRF
FT                   SQQTEGALRYIVADNGEKGLTFAVEPVKLALATP"
FT   gene            145759..146202
FT                   /gene="yiiR"
FT                   /locus_tag="EPYR_00132"
FT   CDS_pept        145759..146202
FT                   /transl_table=11
FT                   /gene="yiiR"
FT                   /locus_tag="EPYR_00132"
FT                   /product="Uncharacterized protein yiiR"
FT                   /note="Protein of unknown function DUF805, Protein of
FT                   unknown function (DUF805)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00132"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72424"
FT                   /db_xref="GOA:D2TC47"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC47"
FT                   /protein_id="CAY72424.1"
FT                   /translation="MTLQQWCFSYRGRLRRRDFWIWQFCWLLMLVLLFTLAGNGLLDTQ
FT                   TAAFCVVALLWPTSAVLVKRLHDRNKGGQWALLMVMAWMLMAGNWAMLPNEAQWLVGRI
FT                   IPTLILVSMLVELGGFAGTIGDNRFGKPAQSVVLLRRRMADYQ"
FT   gene            complement(146193..146939)
FT                   /gene="fpr"
FT                   /locus_tag="EPYR_00133"
FT   CDS_pept        complement(146193..146939)
FT                   /transl_table=11
FT                   /gene="fpr"
FT                   /locus_tag="EPYR_00133"
FT                   /product="ferredoxin-NADP reductase"
FT                   /function="Flavodoxin reductases (ferredoxin-NADPH
FT                   reductases) family 1"
FT                   /EC_number="1.18.1.2"
FT                   /note="Ferredoxin-NAD(+) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00133"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72425"
FT                   /db_xref="GOA:D2TC48"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC48"
FT                   /protein_id="CAY72425.1"
FT                   /translation="MAVWVNARVKKVTDWTDSLFSLTVTAPIDPFTAGQYAKLALEIDG
FT                   ERVVRAYSYVNAPGSADLEFYLVTVPQGKLSPKLHALQPGDEVMITADAQGFFILDEIP
FT                   PCETLWMLATGTAIGPYLSILQEGKGLARFKNIVLIHAARYAQDLSYLPLMQQLQQRYS
FT                   GQLQIHTVVSREEITGSLTGRVPALIANGQLEAVTGLKMDAENSHVMLCGNPQMVRDTQ
FT                   QLLKESRAMRKHLKRKPGHITSEHYW"
FT   gene            146966..147181
FT                   /locus_tag="EPYR_00134"
FT   CDS_pept        146966..147181
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00134"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72426"
FT                   /db_xref="GOA:D2TC49"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC49"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72426.1"
FT                   /translation="MIGVSAAIFTSHDGFCQLAAVVKAHIDKVCARMAPSVKKNVQQRL
FT                   FLLTVKRLLFMAPHSLCLIILIFSPP"
FT   gene            147249..148427
FT                   /gene="emrD"
FT                   /locus_tag="EPYR_00135"
FT   CDS_pept        147249..148427
FT                   /transl_table=11
FT                   /gene="emrD"
FT                   /locus_tag="EPYR_00135"
FT                   /product="Multidrug resistance protein emrD"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /note="Major facilitator superfamily, TC 2.A.1.2.9
FT                   Multidrug resistance protein D"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00135"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72427"
FT                   /db_xref="GOA:D2TC50"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC50"
FT                   /protein_id="CAY72427.1"
FT                   /translation="MKKIDNGYLLVMLIALLAVGQMAQTIYVPAMPTIAAAFHIGDGMV
FT                   QRVMAAYLMTYGASQLFYGPLSDGIGRRPVIFLGMAVFIIGSVTALLASSLNALVLGAA
FT                   IQGMGTGVAGVMARTMPRDLYCGSALRHANSLLNMGILVSPLIAPAIGAGLTYLFGWQA
FT                   CFAFLLLLCLMVSAAMMRWLPETRPAHQPQRPFFSRYRPLLADGHFVRYLVILIGALAG
FT                   IAVFEASCGVLMGGVLGMSSLAISLLFILPLPAAFFGAWFAGRSNKPFVSVMWYAVNSC
FT                   LLAGVMMWIPGWLGIMNLWTLIVPASLFFFGAGMLFPLATTGAMEPWPYMAGTAGALVG
FT                   GLQNLGSGLTAWLSAMLPQNGQFSLGMLMFATALLILLCWLPLSKEPEPHRV"
FT   gene            complement(148474..149484)
FT                   /gene="glpX"
FT                   /locus_tag="EPYR_00136"
FT   CDS_pept        complement(148474..149484)
FT                   /transl_table=11
FT                   /gene="glpX"
FT                   /locus_tag="EPYR_00136"
FT                   /product="Fructose-1,6-bisphosphatase class II glpX"
FT                   /function="Fructose-1,6-bisphosphatase/sedoheptulose
FT                   1,7-bisphosphatase and related proteins"
FT                   /EC_number="3.1.3.11"
FT                   /note="Fructose-1,6-bisphosphatase class II glpX
FT                   (D-fructose-1,6-bisphosphate 1-phosphohydrolase class II
FT                   glpX) (FBPase II glpX)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00136"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72428"
FT                   /db_xref="GOA:D2TC51"
FT                   /db_xref="InterPro:IPR004464"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC51"
FT                   /protein_id="CAY72428.1"
FT                   /translation="MKRELAIEFSRVTEAAALAGYQWLGRGDKNAADGAAVHAMRIMLN
FT                   KVDIDGQIVIGEGEIDEAPMLYIGEKVGTGNGDAVDIAVDPIEGTRMTALGQANALAVM
FT                   AVGDKGTFLHAPDMYMEKLVVGPAAKGTIDLNLPLEENLQRVANAMNKPLSELTVTLLA
FT                   KPRHDAVIARLQQLGVRVFTFPDGDVAASILTCMPDSEVDVMYGIGGAPEGVVSAAVIR
FT                   ALDGDMQARLLARHEVKGDSTENRRLGEQEQARCREMGIETGQVLALEQMARNDNVIFS
FT                   ATGITSGDLLKGITRKGNMATSETLLIRGKSRTIRRIQSIHFLDLKDENLHRYIL"
FT   gene            149698..150690
FT                   /locus_tag="EPYR_00137"
FT   CDS_pept        149698..150690
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00137"
FT                   /product="putative transporter"
FT                   /function="Arsenite efflux pump ACR3 and related permeases"
FT                   /note="putative transporter, TC 2.A.59.-.-Arsenite efflux
FT                   pump ACR3 and related permeases"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00137"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72429"
FT                   /db_xref="GOA:D2TC52"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC52"
FT                   /protein_id="CAY72429.1"
FT                   /translation="MFVSAANMATRIRDGFEHHQVIIYFMAVMTAGLAALVLPATTALR
FT                   SAINPALALMLFVTFLQVPVAGLVKAITRLRFLLPLLLANFLFIPVLVAILIPFLPQNT
FT                   LLRLGVLLVLLTPCIDYVVTFAQLGRSDFRLLLASTPVLLIAQVLLLPLYLHLFLGEQA
FT                   TGLVQPKPFIDAFLWLIAAPLCLAAVTQLWSRRSRLGGSVAVGLGLLPVPATAVVLFIV
FT                   VAAMLPQLGEGWPLALQAIPVYVAFAVLAPLAGWTAGRMFRLEPAAGRAVAFSAGTRNS
FT                   LVVLPLALAVPGAIPVLPAIIVTQTLVELLSELIYIRLIPKLGQMRQNQ"
FT   gene            complement(150746..152260)
FT                   /gene="glpK"
FT                   /locus_tag="EPYR_00138"
FT   CDS_pept        complement(150746..152260)
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="EPYR_00138"
FT                   /function="Glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /note="Glycerol kinase (ATP:glycerol 3-phosphotransferase)
FT                   (Glycerokinase) (GK)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00138"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72430"
FT                   /db_xref="GOA:D2TC53"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC53"
FT                   /protein_id="CAY72430.1"
FT                   /translation="MTAEKKYIVALDQGTTSSRAVILDHDANIVAVSQREFQQIYPKPG
FT                   WVEHDPMDIWASQSSTLVEVLAHADINSDEIAAIGITNQRETTIVWEKQTGKPIYNAIV
FT                   WQDPRTADYCAKLKKEGLEEYIRHTTGLVINPYFSGTKLKWILDHVEGSRERARRGELL
FT                   FGTVDSWLVWKMTQGRVHITDYTNASRTMMFNIHQLEWDQRMLEILDIPREMLPEVKSS
FT                   SEVYGQTNIGGKGGTRIPIAGIAGDQQAALYGQLCVQPGMAKNTYGTGCFMLMNTGTEA
FT                   VTSTQGLLTTIACGPRGEVNYALEGAVFIGGASIQWLRDEMKLIGDAADSEYFATKVKD
FT                   TNGVYMVPAFTGLGAPYWDPYARGAIFGLTRGANANHIIRATLESIAYQTRDVLEAMQN
FT                   DANTRLQSLRVDGGAVANNFLMQFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWKD
FT                   LDEVRAKSVIEREFRPGIETTRRNVLYAGWKKAVARAQAWEEADDR"
FT   gene            complement(152304..153137)
FT                   /gene="glpF"
FT                   /locus_tag="EPYR_00139"
FT   CDS_pept        complement(152304..153137)
FT                   /transl_table=11
FT                   /gene="glpF"
FT                   /locus_tag="EPYR_00139"
FT                   /product="Glycerol uptake facilitator protein"
FT                   /function="Glycerol uptake facilitator and related
FT                   permeases (Major Intrinsic Protein Family)"
FT                   /note="Glycerol uptake facilitator protein
FT                   (Aquaglyceroporin), Major intrinsic protein, TC 1.A.8.1.1
FT                   Glycerol uptake facilitator protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00139"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72431"
FT                   /db_xref="GOA:D2TC54"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC54"
FT                   /protein_id="CAY72431.1"
FT                   /translation="MSYATSTLKGQCIAEFLGTATIIFFGAGCVAAMKVAGSSFGQWEI
FT                   SIVWGLAVAMAVYLTAGISGAHLNPAVSVAMWLFANFDGRKVIPYALAQVAGAFCSAAL
FT                   VYGLYHNLFLDYEQTHQMVRGSVESLDLAGVFSTYPNPHISVGQAFLVELTITAIMMAL
FT                   IMALTDDGNGLPRGPIAPLLIGLLIATIGASMGPLTGFALNPARDFGPKLFAWVAGWGS
FT                   VAFTGGRDIPYFLVPVFGPLLGASLGAFGYRALIASNLPGEVVEKHDKPASRAEQ"
FT   gene            153577..153816
FT                   /gene="yiiU"
FT                   /locus_tag="EPYR_00140"
FT   CDS_pept        153577..153816
FT                   /transl_table=11
FT                   /gene="yiiU"
FT                   /locus_tag="EPYR_00140"
FT                   /product="1-phosphatidylinositol-4,5-bisphosphate
FT                   phosphodiesterase beta 2"
FT                   /EC_number="3.1.4.11"
FT                   /note="1-phosphatidylinositol-4,5-bisphosphate
FT                   phosphodiesterase beta 2 (Phosphoinositide phospholipase C)
FT                   (Phospholipase C-beta-2) (PLC-beta-2), Protein of unknown
FT                   function DUF904, Protein of unknown function (DUF904)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00140"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72432"
FT                   /db_xref="GOA:D2TC55"
FT                   /db_xref="InterPro:IPR009252"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC55"
FT                   /protein_id="CAY72432.1"
FT                   /translation="MSFEVFEKLEAKVQQAIDTITLLQMEIEELKEQNGNLNHQVQQAS
FT                   GSRETLVHENQQLKEEQHVWQERLRALLGKMEEV"
FT   gene            complement(153912..154397)
FT                   /gene="rraA"
FT                   /locus_tag="EPYR_00141"
FT   CDS_pept        complement(153912..154397)
FT                   /transl_table=11
FT                   /gene="rraA"
FT                   /locus_tag="EPYR_00141"
FT                   /product="Regulator of ribonuclease activity A"
FT                   /function="Demethylmenaquinone methyltransferase"
FT                   /note="RraA_entero: regulator of ribonuclease activity A"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00141"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72433"
FT                   /db_xref="GOA:D2TC56"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR014339"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC56"
FT                   /protein_id="CAY72433.1"
FT                   /translation="MKYDTSELCDIYHEDVNVVEPLFSNFGGRTSFGGQIITVKCFEDN
FT                   GLLYDLLEENGRGRILLVDGGGSVRRALVDAALARLALQNEWEGIVVYGSVRQVDDLEE
FT                   LDIGIQAIAAIPAGAAGEGIGESDVRVNFGGVTFFSGDHLYADNTGMILSEVPLDIE"
FT   gene            complement(154581..155912)
FT                   /gene="hslU"
FT                   /locus_tag="EPYR_00142"
FT   CDS_pept        complement(154581..155912)
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="EPYR_00142"
FT                   /product="ATP-dependent hsl protease ATP-binding subunit
FT                   hslU"
FT                   /function="ATP-dependent protease HslVU (ClpYQ), ATPase
FT                   subunit"
FT                   /note="Heat shock protein HslU, ATPase family associated
FT                   with various cellular activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00142"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72434"
FT                   /db_xref="GOA:D2TC57"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC57"
FT                   /protein_id="CAY72434.1"
FT                   /translation="MSAMTPREIVSELNRFIIGQDGAKRAVAIALRNRWRRMQLDEELR
FT                   HEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLT
FT                   DSAIKMVRSQAIEKNRYRAEEMAEERVLDVLIPPAKNNWGQNEAAAEPSAARQAFRKKL
FT                   REGQLDDKEIEIDLAAISGGVEIMAPPGMEEMTSQLQSMFQNIGGQQQKPRKLKIKEAM
FT                   KLLVEEEAAKLVNPEELKQEAIEAVEQHGIVFIDEIDKVCKRGESSGPDVSREGVQRDL
FT                   LPLVEGCTVSTKHGMVKTDHILFIASGAFQVASPSDLIPELQGRLPIRVELQALTTNDF
FT                   ERILTEPSASITVQYKALMNTEGVDINFTADGVSKIAAAAWQVNETAENIGARRLHTVL
FT                   ERLMEEISYDASDLNGQSITIDAEYVSKHLDELVADEDLSRFIL"
FT   gene            complement(155925..156455)
FT                   /gene="hslV"
FT                   /locus_tag="EPYR_00143"
FT   CDS_pept        complement(155925..156455)
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="EPYR_00143"
FT                   /product="ATP-dependent protease HslV"
FT                   /function="ATP-dependent protease HslVU (ClpYQ),peptidase
FT                   subunit"
FT                   /EC_number="3.4.25.-"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00143"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72435"
FT                   /db_xref="GOA:D2TC58"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC58"
FT                   /protein_id="CAY72435.1"
FT                   /translation="MTTIVSVRRNGQVVIGGDGQATLGNTVMKGNVKKVRRLYNDKVIA
FT                   GFAGGTADAFTLFELFERKLEMHQGHLVKAAVELAKDWRTDRMLRKLEALLAVADENAS
FT                   LIITGNGDVIQPENDLIAIGSGGPYAQAAARALLENTDIGARDIVEKALGIAGDICIYT
FT                   NHHLTIEELPSKA"
FT   gene            complement(156547..157326)
FT                   /gene="ftsN"
FT                   /locus_tag="EPYR_00144"
FT   CDS_pept        complement(156547..157326)
FT                   /transl_table=11
FT                   /gene="ftsN"
FT                   /locus_tag="EPYR_00144"
FT                   /product="Cell division protein FtsN"
FT                   /function="Cell division protein"
FT                   /EC_number="3.4.21.72"
FT                   /note="essential cell division protein FtsN"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00144"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72436"
FT                   /db_xref="GOA:D2TC59"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR011930"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC59"
FT                   /protein_id="CAY72436.1"
FT                   /translation="MIVLAVAVLVTFVGGLWFIAHHKKEETPMMADHKATGNGLPPKPE
FT                   ERWRYIKELENRQIGVPTPTEPTSGGEAHSQAQLTDEQRQLLDQMQADMRQQPTQLNEV
FT                   PWNEQTPVQRQQTLQRQQQNQLQQQSRMPAQIIQSSRTPIPSPHSVTVTPATREPVRQV
FT                   KPEAAPQPKAENKPKEAEKQAAQRWVVQCGSFKGSEQAESIRAQLAFEGFESRITTGGG
FT                   WNRVVIGPYNGLSAADNTLKRLHGSGHSNCIPVAAGG"
FT   gene            complement(157605..158642)
FT                   /gene="cytR"
FT                   /locus_tag="EPYR_00145"
FT   CDS_pept        complement(157605..158642)
FT                   /transl_table=11
FT                   /gene="cytR"
FT                   /locus_tag="EPYR_00145"
FT                   /product="DNA-binding transcriptional regulator CytR"
FT                   /function="Transcriptional regulators"
FT                   /note="HTH-type transcriptional repressor cytR; regulator
FT                   for deo operon, udp, cdd, tsx, NupC, and NupG"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00145"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72437"
FT                   /db_xref="GOA:D2TC60"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC60"
FT                   /protein_id="CAY72437.1"
FT                   /translation="MEHNQDTTVATMKDVANKAGVSTATVSRALMNPEKVSAATRSKVE
FT                   QAVIAVGYSAHSIARNARRGESRTILVIVPDICDPFFSEIIRGIEVVAAGHGYLVLIGD
FT                   CAHQSQQEKSFRNMMLTRQTDGVVVLGSSIPFDTSMEDPRLLPPMVMANEFDPEREIPT
FT                   VHIDNLTAAFEAVSHLQKLGHRRIACIGGPEEMPLCQYRLQGYIQALRRHGVTVDPQYI
FT                   VRGDFTFDAGSQAMKQLMRLPKPPDALFCHSDIIALGAMSQAKNMGLRVPQDLSLIGFD
FT                   DIELSRYSDPQLTTVAQPRFNIGREAMLLLLEQLQGKTVSNGSRLLDFELKIRGSTAPS
FT                   LRERD"
FT   gene            complement(158852..161167)
FT                   /gene="priA"
FT                   /locus_tag="EPYR_00146"
FT   CDS_pept        complement(158852..161167)
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="EPYR_00146"
FT                   /product="Primosomal protein N'"
FT                   /function="Primosomal protein N' (replication factor Y)
FT                   -superfamily II helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="Primosomal protein N' (ATP-dependent helicase priA)
FT                   (Replication factor Y)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00146"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72438"
FT                   /db_xref="GOA:D2TC61"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC61"
FT                   /protein_id="CAY72438.1"
FT                   /translation="MPYQRRRTIQKLTTRCNRIRTLRTTQCTLTRSVFHPDESMPVVQV
FT                   ALPVPLARNFDYLLPPHLSHAVIGGRVSVPFGQRRAIGVVVAIGEHSDFPPDQLKSVHE
FT                   VLDACSLYPPSLWRILQWAADYYHFPLGEVLFHAMPVLLRQGKAAEEAPLWQWLITDEG
FT                   RATAPESLKPAPKQQQALAVLRNRVLYRHEVRQHNITEATLKALRAKGLCELKAQPRAQ
FT                   QDWRENYAVNGERLRLNTEQATAVGAIRSADDQFSAWLLAGITGSGKTEVYLSVLENVL
FT                   ASGHQALVLVPEIGLTPQTIARFSQRFNAPVDVLHSALNDSERLAVWLRARSGETAIVI
FT                   GTRSALFTPFARLGAIVIDEEHDSSYKQQEGWRYHARDLAVFRARQENIPIIMGSATPA
FT                   LETLHNVQLGKYRQLNLSKRAGNASKATQLLVDLKGVKLQGGLSPMLVKKIGQHLKADN
FT                   QVLLFLNRRGFSPTLLCHECGWIAECQRCDHYYTLHQHQRQLRCHHCDSQRPIPHQCPQ
FT                   CGSTHLVPVGLGTEQLEQNLGELFPDVPLTRIDRDTTSRKGALERQLAEVHRGGARLLV
FT                   GTQMLAKGHHFPDVTLVSLLDVDGALFSADFRSAERFAQLYTQVAGRAGRAGKQGEVLL
FT                   QTHHPEHPLLQTLLHQGYDAFASQALSERNSVFLPPFTRHALFRAEDHDNQQASLFLQQ
FT                   LRNLLEASPLNDRSFWVMGPVPALQAKRSGRYRWQLLLQHPSRALLQRLIKNSLPLIGT
FT                   LPQARKVKWTLDIDPTES"
FT   gene            161267..161479
FT                   /gene="rpmE"
FT                   /locus_tag="EPYR_00147"
FT   CDS_pept        161267..161479
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="EPYR_00147"
FT                   /product="50S ribosomal protein L31"
FT                   /function="Ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00147"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72439"
FT                   /db_xref="GOA:D2TC62"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC62"
FT                   /protein_id="CAY72439.1"
FT                   /translation="MKKGIHPNYAEVTAKCSCGNEIKTRSTVGHDLNLDVCGNCHPFYT
FT                   GKQRDVASGGRVDRFNKRFSIPGSK"
FT   gene            complement(161457..161561)
FT                   /locus_tag="EPYR_00148"
FT   CDS_pept        complement(161457..161561)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00148"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72440"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC63"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72440.1"
FT                   /translation="MLNKRHKKTQPKPGFLASETVNVSGGLLICCLGC"
FT   gene            161510..161647
FT                   /locus_tag="EPYR_00149"
FT   CDS_pept        161510..161647
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00149"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72441"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC64"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72441.1"
FT                   /translation="MQENPASAGFFYGVYSANGGDAGYRITAPHRTMTDAESTDRHADA
FT                   "
FT   gene            161613..161795
FT                   /locus_tag="EPYR_00150"
FT   CDS_pept        161613..161795
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00150"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72442"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC65"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72442.1"
FT                   /translation="MQKVLTGMPMRDPYNEGEKAAINAVVAAAGVLEDEVHIHLNTTSM
FT                   KTGGNGRGDSVSSQA"
FT   gene            161895..162116
FT                   /locus_tag="EPYR_00151"
FT   CDS_pept        161895..162116
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00151"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72443"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC66"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72443.1"
FT                   /translation="MLINLNTFAAMLRARPGELLHNVRNTGCFKGMTLPKAIDKNLDKR
FT                   YKFAPHYMFDMTDAIEFKTKIDNAQPKR"
FT   gene            162524..163294
FT                   /gene="rfbD"
FT                   /locus_tag="EPYR_00152"
FT   CDS_pept        162524..163294
FT                   /transl_table=11
FT                   /gene="rfbD"
FT                   /locus_tag="EPYR_00152"
FT                   /product="Capsule polysaccharide export inner-membrane
FT                   protein"
FT                   /function="ABC-type polysaccharide/polyol phosphate export
FT                   systems, permease component"
FT                   /note="ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00152"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72444"
FT                   /db_xref="GOA:D2TC67"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC67"
FT                   /protein_id="CAY72444.1"
FT                   /translation="MNDLKAALARYQLWVSLGWNDVLGRYRRSVLGPFWITISMGVTIS
FT                   AMGPLYGSLFGAGSENFIMHLALGMIFWAFLSSSINDSCGIFNDSATIIKQSDLPLYIY
FT                   ILRVFYRQLSILLHNCIIIPFIIYITHSSVNWHLILFLPALAVTSVTLVSVGMILGVFC
FT                   TRYRDMGPVVQSIITLCFFVTPIIWSPEQLPQGRREFVDYNIFYYYLELLRKPLMGAAP
FT                   ETYIWVVAGATSVIMLILSGLILSKNRSKIVYWL"
FT   gene            163298..164005
FT                   /gene="rfbB"
FT                   /locus_tag="EPYR_00153"
FT   CDS_pept        163298..164005
FT                   /transl_table=11
FT                   /gene="rfbB"
FT                   /locus_tag="EPYR_00153"
FT                   /product="putative O-antigen export system ATP-binding
FT                   protein"
FT                   /function="ABC-type sugar transport systems, ATPase
FT                   components"
FT                   /EC_number="3.6.3.38"
FT                   /note="putative O-antigen export system ATP-binding
FT                   protein, TC 3.A.1.103.1 O-antigen export system ATP-binding
FT                   protein RfbB"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00153"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72445"
FT                   /db_xref="GOA:D2TC68"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC68"
FT                   /protein_id="CAY72445.1"
FT                   /translation="MKIKCQQVGVKFPIFNSNQRSFKKSLFGAASGGRIGSTKSGLVEV
FT                   EALKNITFELSRGDRLALIGHNGSGKTTMLRVLAGAYKPTSGKFESHGRVTSLIDPMMG
FT                   MDGELTGLENIKLRGLFLGLSKVEIKNITEEVVEFSELGDFIKVPVRTYSSGMVLRLGF
FT                   SISTAITPEILLMDEWMSVGDENFKKKAEQRLNDFISKAGIMVMATHDHNLAKSVCNKF
FT                   IKLEHGEIVTLAD"
FT   gene            164042..165103
FT                   /gene="wabM"
FT                   /locus_tag="EPYR_00154"
FT   CDS_pept        164042..165103
FT                   /transl_table=11
FT                   /gene="wabM"
FT                   /locus_tag="EPYR_00154"
FT                   /product="Predicted glycosyl transferase, family 2"
FT                   /function="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /EC_number="2.4.-.-"
FT                   /note="Glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00154"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72446"
FT                   /db_xref="GOA:D2TC69"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2TC69"
FT                   /protein_id="CAY72446.1"
FT                   /translation="MNQNVQNFDGKIELSIIIPAFNVMEYIIECIDSVLVQWTESIEII
FT                   VVNDGSTDGTDVLLAKVYGSNEKVTIINQENKGLSSARNMGLSKARGRYIALLDGDDTL
FT                   KSNSLKKIMSCLEKNSPDVLMVDHMMSWDDGGLYVKKYEGKLVKNNLLDVEENAVLSKV
FT                   YDNSEVYIWKYIFRSDFYRKKEFPVGRNFEDVRIFPFLLKQCRTFFYLPVIFINYKQRE
FT                   ASILKTKSVKNVLDLSSSPVDFLDEGGKDLLTKNEAISYTAFCMKVFVWSVQDLLISNG
FT                   GYQHVKVLLDNNKKSIICDKNEALKLLKLNDRKNYVLYRMLTSSVITLKAVFYLFNKNK
FT                   FTKNFLRKIYNSI"
FT   gene            165147..166217
FT                   /locus_tag="EPYR_00155"
FT   CDS_pept        165147..166217
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00155"
FT                   /product="putative peptidoglycan O-acetyltransferase yrhL"
FT                   /function="Predicted acyltransferases"
FT                   /EC_number="2.3.1.-"
FT                   /note="Acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00155"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72447"
FT                   /db_xref="GOA:D2TCK9"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCK9"
FT                   /protein_id="CAY72447.1"
FT                   /translation="MRNNYLQVSRGLASLIVCLHHLFVTPYFFYNASSQLSHSSLANLG
FT                   DLSVSFFFALSGFVLIHSLEKNKVKPFGFITNRILRVYPEYILWTTIAVFIYSIYGNVL
FT                   FNVNFYPRDLTEWIYTYTLIPLFAKKDFAMVSGTSWSLVYEMYFYVLLFFTLFFVKKIK
FT                   QTPLILTITFFFLSYMGSHYFHTDKGGWVYYPYIISDFNCLSFSFGMMVYYFKDKFKFS
FT                   LFSALSIIFSILIVFILTGSTDTSHVNYVFISTFILFFVTNIRQVNSTSLVGKKLLSCA
FT                   IFLGDSSYTLYITHLLYAKLAWAIISMGHYLLAVILNIFVILIACVKYQYIGKPLNSFV
FT                   KKWQIKAKSHLRFYHF"
FT   gene            166251..166355
FT                   /locus_tag="EPYR_00156"
FT   CDS_pept        166251..166355
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00156"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72448"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCL0"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72448.1"
FT                   /translation="MVTLRQAMKKRQVFSTNDSVGKVTYLANRDASEK"
FT   gene            166441..166623
FT                   /locus_tag="EPYR_00157"
FT   CDS_pept        166441..166623
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00157"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72449"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCL1"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72449.1"
FT                   /translation="MAVTQNYLQGRAGAILLPVAIMAVRWSNAARINQAEVVGRSSRWW
FT                   LSGQGGICYGNSCPT"
FT   gene            complement(166642..166959)
FT                   /gene="metJ"
FT                   /locus_tag="EPYR_00158"
FT   CDS_pept        complement(166642..166959)
FT                   /transl_table=11
FT                   /gene="metJ"
FT                   /locus_tag="EPYR_00158"
FT                   /product="Met repressor"
FT                   /function="Transcriptional regulator of met regulon"
FT                   /note="Met repressor (Met regulon regulatory protein metJ),
FT                   Methionine repressor MetJ"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00158"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72450"
FT                   /db_xref="GOA:D2TCL2"
FT                   /db_xref="InterPro:IPR002084"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR023453"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCL2"
FT                   /protein_id="CAY72450.1"
FT                   /translation="MAEWNGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQ
FT                   VNNLRHATNSELLCEAFLHAFTGQPLPDDVDLRKERSDEIPEEAKAIMRAMGVDPDSWE
FT                   Y"
FT   gene            167203..168363
FT                   /gene="metB"
FT                   /locus_tag="EPYR_00159"
FT   CDS_pept        167203..168363
FT                   /transl_table=11
FT                   /gene="metB"
FT                   /locus_tag="EPYR_00159"
FT                   /product="cystathionine gamma-synthase"
FT                   /function="Cystathionine beta-lyases/cystathionine
FT                   gamma-synthases"
FT                   /EC_number="2.5.1.48"
FT                   /note="Cystathionine gamma-synthase (CGS)
FT                   (O-succinylhomoserine (thiol)-lyase), PLP-dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00159"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72451"
FT                   /db_xref="GOA:D2TCL3"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR011821"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCL3"
FT                   /protein_id="CAY72451.1"
FT                   /translation="MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFTDFNQPRAHD
FT                   YSRRGNPTRDVVQRALAELEGGAGAVMTNTGMSAIHLVCTVFLQPGDLLVAPHDCYGGS
FT                   YRLFDSLSKRGAYRVKFVDQGDKAALHAALAENPKLVLIESPSNPLLRVVDIPTLCQAA
FT                   AAAGAISVVDNTFLSPALQNPLALGADLVIHSCTKYLNGHSDVVAGAVIAKDPQHVTEL
FT                   AWWANNIGVTGAAFDSYLLLRGLRTLSPRMAAAQRNALAIVDYLKQQPLVKKLYHPSLP
FT                   ENAGHQFALTQQKGFGAMLSFELDGDEATLRRFLKALHLFTLAESLGGVESLISHTATM
FT                   THAGMSAEARAAAGISETLLRISVGIEDHEDLIADLDNAFQVAAKR"
FT   gene            168366..170801
FT                   /gene="metL"
FT                   /locus_tag="EPYR_00160"
FT   CDS_pept        168366..170801
FT                   /transl_table=11
FT                   /gene="metL"
FT                   /locus_tag="EPYR_00160"
FT                   /product="bifunctional aspartokinase/homoserine
FT                   dehydrogenase II"
FT                   /function="Aspartokinases"
FT                   /EC_number="2.7.2.4"
FT                   /note="Bifunctional aspartokinase/homoserine dehydrogenase
FT                   II (AKII-HDII) [Includes: Aspartokinase II ; Homoserine
FT                   dehydrogenase II ]"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00160"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72452"
FT                   /db_xref="GOA:D2TCL4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCL4"
FT                   /protein_id="CAY72452.1"
FT                   /translation="MSYSAVAKAGSARQLHKFGGSSLADAKCYQRVAGIMAEYSEPGDL
FT                   MVVSAAGSTTNQLISWLKLSQSDRLSAHQVQQALRRYQSDLISSLLPPEVAAPLIAEFI
FT                   SDLEKLAALLDGVISDVAYAEVVGHGEIWSARLMSAVLTLRDIEAGWLDARHFLRAERA
FT                   VQPQVDEAKSLPLLQQLMAQHPSQRLVVTGFICGNDAGETVLLGRNGSDYSATQIGALA
FT                   GVSRVTIWSDVAGVYSADPRKVKDACLLPLLRLDEASELARLAAPVLHSRTLQPVSGSD
FT                   IDLQLRCSYQPEQGSTRIERVLASGTGARIVTSHDDVCLIEFQVPAHHDFASLHKEIDQ
FT                   LLQRAQVRPLATGVHPDRNLLQLCYTSEVVNSALTLLQDAALPGRLQLREGMALVAMVG
FT                   AGVCRNPLHSHRFWQQMKDQPVEFIWQSQDGISLVAVLRVGPTEHLIRGLHQTLFRAEK
FT                   QIGLVLFGKGNIGSRWLELFAREQETISARTGFEYILAGVVDSRRSLLSYEGLDASRAL
FT                   AFFEDEAVLQDTESLFLWMRAHPFDDLVVLDVTASETLAEQYLDFASYGFHVIGANKVA
FT                   GASTSDSYRQIRDAFAKTGGHWLYNATVGAGLPVNHTVRDLRESGDSILSISGIFSGTL
FT                   SWLFLQFDGTVPFTELLDQAWQQGLTEPDPRVDLSGQDVMRKLVILAREAGYDIEPDQV
FT                   RVESLVPADCQSGSVDHFFDNGDALNDQMLQRFEAAQEMGLVLRYVARFDANGKARVGV
FT                   EAVRADHPLAALLPCDNVFAIESRWYRDNPLVIRGPGAGRDVTAGAIQSDLNRLAQLL"
FT   gene            complement(170816..170962)
FT                   /locus_tag="EPYR_00161"
FT   CDS_pept        complement(170816..170962)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00161"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72453"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCL5"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72453.1"
FT                   /translation="MAIGLDIFSRADEEISGMGKQRRIQKAAEAIKQGNAAAPQRSACY
FT                   AGA"
FT   gene            171060..171971
FT                   /gene="metF"
FT                   /locus_tag="EPYR_00162"
FT   CDS_pept        171060..171971
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="EPYR_00162"
FT                   /function="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="5,10-methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00162"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72454"
FT                   /db_xref="GOA:D2TCL6"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCL6"
FT                   /protein_id="CAY72454.1"
FT                   /translation="MSFFHANQREALNQSLAEISGQINVSFEFFPPRTGEMEDILWNSI
FT                   DRLSSLKPKFVSVTYGANSGERDRTHSIIKGIKERTGLEAAPHLTCVDATRDELRTIAE
FT                   DYWNNGIRHIVALRGDLPPGGGQPEMYGADLVALLKEVGDFDISVAAYPEVHPEAKSAQ
FT                   SDLINLKRKIDAGANRAITQFFFDVESYLRFRDRCVSTGIDVEIVPGILPVSNFKQLQR
FT                   FATMTNVRVPGWMTSMFAGLDDDPETRKMVGANVAMDMVKILSREGVKDFHFYTLNRAE
FT                   LSYAICHTLGVRPAPALVLAAS"
FT   gene            complement(172098..172235)
FT                   /locus_tag="EPYR_00163"
FT   CDS_pept        complement(172098..172235)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00163"
FT                   /product="Uncharacterized protein in traD-traI intergenic
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00163"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72455"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCL7"
FT                   /protein_id="CAY72455.1"
FT                   /translation="MIAIDRTRIISSVGESWDNWFDGENVTADFMDDREQPSEQRREHV
FT                   "
FT   gene            complement(172491..175142)
FT                   /gene="ppc"
FT                   /locus_tag="EPYR_00164"
FT   CDS_pept        complement(172491..175142)
FT                   /transl_table=11
FT                   /gene="ppc"
FT                   /locus_tag="EPYR_00164"
FT                   /function="Phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="Phosphoenolpyruvate carboxylase (PEPCase) (PEPC)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00164"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72456"
FT                   /db_xref="GOA:D2TCL8"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCL8"
FT                   /protein_id="CAY72456.1"
FT                   /translation="MNEQYSAMRSNVSMLGKLLGDTIKDALGENILDRVETIRKLSKSS
FT                   RAGHDAHRQELLSTLQNLSNDELLPVARAFSQFLNLTNVAEQYHTISPNGEGAKNPELL
FT                   AKTFQRLKQQPALTEAAVHEALGSLSLELVLTAHPTEITRRTLIHKLVEVNSCLKQLDH
FT                   NDLSDYEHAQIMRRLRQLVAQAWHTDEIRKYRPSPVDEAKWGFAVVENSLWEGVPQFLR
FT                   ELNEQVEAAFGYTLPVDFVPVQFTSWMGGDRDGNPNVTADITRHVMQLSRWKATDLFLR
FT                   DIAVLISELSMSECTPEVRELCGNPEALEPYREIMKNLRSQLMSTQAYLAGRLKGERLA
FT                   RPADLLISNEQLWNPLYTCYQSLQACGMGIIANGQLLDTLRRVKCFGVPLVRIDIRQES
FT                   TRHTEAIAEITRYLGLGDFESWSEADKQAFLIRELNSKRPLTPRQWEPSAETKEVLDTC
FT                   RVAAEAPQGSIAAYVISMAKTPSDVLTVHLLLKEAGIGYAMPVAPLFETLDDLNNANAV
FT                   MSQLLNIDWYRGLIQGKQMVMIGYSDSAKDAGVMAASWAQYQAQDALIKTCEKAGITLT
FT                   LFHGRGGSIGRGGAPAHAALLSQPPGSLKGGLRVTEQGEMIRFKYGLPEVTISSLSLYT
FT                   GAILEANLLPPPEPKTEWIGIMDRLSTVSCQMYRGYVREHADFVPYFRSATPEQELAKL
FT                   PLGSRPAKRRPAGGVESLRAIPWIFAWTQNRLMLPAWLGAGAALQQAMADGHQDQLEAM
FT                   CRDWPFFSTRLGMLEMVFSKADLWLAEYYDQRLVDKSLWPLGKQLRDRLESDIKAVLTI
FT                   ANDAHLMADQPWIAESIALRNVYTDPLNVLQAELLHRSRQQEAAGGEPDARVEQALMVT
FT                   IAGVAAGMRNTG"
FT   gene            complement(175377..176528)
FT                   /gene="argE"
FT                   /locus_tag="EPYR_00165"
FT   CDS_pept        complement(175377..176528)
FT                   /transl_table=11
FT                   /gene="argE"
FT                   /locus_tag="EPYR_00165"
FT                   /product="acetylornithine deacetylase"
FT                   /function="Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /EC_number="3.5.1.16"
FT                   /note="Acetylornithine deacetylase (Acetylornithinase) (AO)
FT                   (N-acetylornithinase) (NAO)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00165"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72457"
FT                   /db_xref="GOA:D2TCL9"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCL9"
FT                   /protein_id="CAY72457.1"
FT                   /translation="MKTKLPNFIEIYRQLIATPSISATDSALDQSNETLINLLGGWFRD
FT                   LGFTVEVQPVPGTRNKFNMLAKSGSGAGGLLLAGHTDTVPFDDGRWTRDPFTLTEHDNK
FT                   LFGLGTADMKGFFAFILDTLRDVELSTLKKPLYILATADEETTMAGAKYFSESTALRPD
FT                   CAIIGEPTSLKPVRAHKGHISNVIRIQGQSGHSSDPGRGVNAIELMHESITRLMGLRNT
FT                   LKERYHHAGFAIPYPTMNFGHIHGGDAANRICACCELHMDIRPLPGLTLSDLDGLLNEA
FT                   LAPVSARWPGRLTVGELHPPIPGYECPREHQLVQVVEKLLGSETEVVNYCTEAPFIQQI
FT                   CPTLVLGPGSIDQAHQPDEFIDTAFIKPTHELIAQVVHHFCHH"
FT   gene            176700..177476
FT                   /gene="argB"
FT                   /locus_tag="EPYR_00166"
FT   CDS_pept        176700..177476
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="EPYR_00166"
FT                   /function="Acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="Acetylglutamate kinase (NAG kinase) (AGK)
FT                   (N-acetyl-L-glutamate 5-phosphotransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00166"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72458"
FT                   /db_xref="GOA:D2TCM0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041731"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCM0"
FT                   /protein_id="CAY72458.1"
FT                   /translation="MTNPLIIKLGGVLLDSEEALERLFTALVSYRSTHQRPLLIVHGGG
FT                   CLVDELMSKLSLPVTKKNGLRVTPADQIDVITGALAGTANKTLLAWSKKHGIDAVGLCL
FT                   GDGGSVNVERFDEELGHVGLATPGMPRLMNTLLAAGYLPVVSSIGITQDGLLMNVNADQ
FT                   AATALAATLGADLILLSDVSGILDASKQRIAEMTAEKAERLIADGVITDGMIVKVNAAL
FT                   EAARTLGRPVDIASWRHAEQLPDLFNGVSIGTRILA"
FT   gene            177508..178722
FT                   /gene="argG"
FT                   /locus_tag="EPYR_00167"
FT   CDS_pept        177508..178722
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="EPYR_00167"
FT                   /function="Argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="Argininosuccinate synthase (Citrulline--aspartate
FT                   ligase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00167"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72459"
FT                   /db_xref="GOA:D2TCM1"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCM1"
FT                   /protein_id="CAY72459.1"
FT                   /translation="MQDKSIKKIVLAYSGGLDTSAIIPWLKENYGGCEVVAFVADIGQE
FT                   RGDLEGVEQKALQSGASECHVVDLREEFISEYVYPVLQTGALYEGTYLLGTSMARPIIA
FT                   KAQVELALKVGADALCHGATGKGNDQVRFETTYTALAPQLKVVAPWREWDLRSREALLD
FT                   YLKERNIPTTASLEKIYSRDENAWHISTEGGVLESPWNAPNKDCWVWTVDPLEAPDQPE
FT                   QVTVAVEKGRVVAVNGEALSPFGCLDKLNAIGARHGVGRIDIVENRLVGIKSRGCYETP
FT                   GGTIMVNALRAVEQLVLDRDSFKWREQLGLEMSYVVYDGRWFAPLRKSIQASAEALAEE
FT                   VNGEVVLQLYKGQVTAIQKKSANSLYSEEFATFGEDEVYDHRHAGGFIRLFSLSSRIRA
FT                   LNEKK"
FT   gene            178815..180188
FT                   /gene="argH"
FT                   /locus_tag="EPYR_00168"
FT   CDS_pept        178815..180188
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="EPYR_00168"
FT                   /function="Argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="Argininosuccinate lyase (Arginosuccinase) (ASAL)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00168"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72460"
FT                   /db_xref="GOA:D2TCM2"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCM2"
FT                   /protein_id="CAY72460.1"
FT                   /translation="MALWGGRFTQPADQRFKQFNDSLRFDYRLAEQDIIGSVAWSKALV
FT                   TVNVLTHAEQQQLESALNTLLDEVRADPQQILASDAEDIHSWVEGKLIDKVGVLGKKLH
FT                   TGRSRNDQVATDLKLWCKAQVGELLVATRQFQQALVATAEANQDAVMPGYTHLQRAQPV
FT                   TFAHWCLAYVEMLARDESRLQDTLKRLDVSPLGCGALAGTAYGIDREQLAGWLGFAYAT
FT                   RNSLDTVSDRDHVLELLSDASIGMVHLSRFAEDLIFFNTGEAGFVELSDKVTSGSSLMP
FT                   QKKNPDALELIRGKVGRVQGALTAMSMTLKGLPLAYNKDMQEDKEGLFDALDTWADCLH
FT                   MAALVLDGIQVKRLRCKEAAEQGYANSTELADYLVAKGVPFREAHHIVGETVVEAIKQG
FT                   VALEALKLSELQKFSSVIGDDVYAILSLQSCLDKRNAKGGVSLHQISQAITEAKQRLA"
FT   gene            complement(180240..180971)
FT                   /gene="aHP1"
FT                   /locus_tag="EPYR_00169"
FT   CDS_pept        complement(180240..180971)
FT                   /transl_table=11
FT                   /gene="aHP1"
FT                   /locus_tag="EPYR_00169"
FT                   /product="putative peroxiredoxin/glutaredoxin family
FT                   protein"
FT                   /function="Peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="Hybrid peroxiredoxin hyPrx5 (Thioredoxin reductase),
FT                   Thioredoxin fold, Redoxin, GlrX-dom: Glutaredoxin-family
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00169"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72461"
FT                   /db_xref="GOA:D2TCM3"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011906"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCM3"
FT                   /protein_id="CAY72461.1"
FT                   /translation="MFASQEGKSIPQVTFHTRQGDSWIDVTTDELFKDKTVIVFSLPGA
FT                   FTPTCSSSHLPRYNELSDVFKQHGVDSILCISVNDTFVMNAWKADQRAEHITFIPDGNG
FT                   EFTRGMEMLVEKADLGFGPRSWRYSMLVRNGVVEKMFVEPNKPGDPFEVSDADTMLRYV
FT                   APEYKVQESVSLFTKPGCPFCAKAKQMLLDRGIQFEEIVLGQDATTVSLRAVSGRATVP
FT                   QVFIGGRHIGGSDDLEQYFSA"
FT   gene            181107..182030
FT                   /gene="oxyR"
FT                   /locus_tag="EPYR_00170"
FT   CDS_pept        181107..182030
FT                   /transl_table=11
FT                   /gene="oxyR"
FT                   /locus_tag="EPYR_00170"
FT                   /product="Hydrogen peroxide-inducible genes activator"
FT                   /function="Transcriptional regulator"
FT                   /note="Hydrogen peroxide-inducible genes activator
FT                   (Morphology and auto-aggregation control protein)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00170"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72462"
FT                   /db_xref="GOA:D2TCM4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCM4"
FT                   /protein_id="CAY72462.1"
FT                   /translation="MNIRDLEYLGALAEHRHFRRAADSCHVSQPTLSGQIRKLEDELGV
FT                   MLLERTSRKVLFTQAGLLLVDQARTILREVKVLKEMASQQGEAMSGPLHIGLIPTVGPY
FT                   LLPQIVPTLHQAFPKLEMYLHEAQTHQLLAQLDSGKLDCAILGLVKESEAFIEVPLFDE
FT                   PMRLAIYADHPWHERDRVAMSELAGEKLLMLEDGHCLRDQAMGFCFQAGADEDTHFRAT
FT                   SLETLRNMVAAGSGITLLPALAVPKERVRDGVCYLPCYKPEPQRTIALVYRPGSPLRGR
FT                   YEQLAEAVREHMQVVMENLKQPVQAI"
FT   gene            complement(182004..183404)
FT                   /gene="udhA"
FT                   /locus_tag="EPYR_00171"
FT   CDS_pept        complement(182004..183404)
FT                   /transl_table=11
FT                   /gene="udhA"
FT                   /locus_tag="EPYR_00171"
FT                   /product="soluble pyridine nucleotide transhydrogenase"
FT                   /function="Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex,dihydrolipoamide dehydrogenase (E3) component, and
FT                   related enzymes"
FT                   /EC_number="1.6.1.1"
FT                   /note="Soluble pyridine nucleotide transhydrogenase (STH)
FT                   (NAD(P)(+) transhydrogenase [B-specific])"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00171"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72463"
FT                   /db_xref="GOA:D2TCM5"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR022962"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCM5"
FT                   /protein_id="CAY72463.1"
FT                   /translation="MQKSYDYDAIVIGSGPGGEGAAMGLVKQGARIAVIERYHNIGGGC
FT                   THWGTIPSKALRHAVSRIIEFNQNPLYSDHTRLLRSSFADILNHTENVISQQTHMRQGF
FT                   YERNHCELYQGDARFVDANTIEIETHDGSIERLTAEKFVIACGSRPYHPPDVDFSHPRI
FT                   YDSDSILNLHHEPGHVIIYGAGVIGCEYASIFRGLAVKVDLINTRDRLLAFLDQEMSDS
FT                   LSYHFWNNGVVIRHNEEFEKIEGVTDGVIMHLKSGKKLKADCLLYANGRTGNTDSLSLE
FT                   NIGLEADGRGLLKVNSMYQTAQPHIYAVGDVIGYPSLASAAYDQGRIAAQAMIKGEATA
FT                   HLIEDIPTGIYTIPEISSVGKTEQQLTAMKVPYEVGRAQFKHLARAQIVGMDVGSLKIL
FT                   FHRETKEILGIHCFGERAAEIIHIGQAIMEQKNGGNTIEYFVNTTFNYPTMAEAYRVAA
FT                   LNGLNRLF"
FT   gene            183597..184253
FT                   /gene="yijC"
FT                   /locus_tag="EPYR_00172"
FT   CDS_pept        183597..184253
FT                   /transl_table=11
FT                   /gene="yijC"
FT                   /locus_tag="EPYR_00172"
FT                   /product="HTH-type transcriptional repressor fabR"
FT                   /function="Transcriptional regulator"
FT                   /note="Homeodomain-like"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00172"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72464"
FT                   /db_xref="GOA:D2TCM6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023764"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCM6"
FT                   /protein_id="CAY72464.1"
FT                   /translation="MGVRAQQKERTRRTLIEAAFSQLSAERSFASLSLREVSREAGIAP
FT                   TSFYRHFRDVDELGLTMVDESGLMLRQLMRQARQRIAKGGSVIRTSVSTFMEFIDNNPN
FT                   AFRLLLRERSGTSAAFRAAVAREIQHFIAELADYLEVENRVPRSFTEAQAEAMVIIVFN
FT                   AGAEALDIDGGQRRQLEERLVLQLRMISKGSYYWYRREQEKLAVILQPNDKKEKT"
FT   gene            184250..184603
FT                   /gene="yijD"
FT                   /locus_tag="EPYR_00173"
FT   CDS_pept        184250..184603
FT                   /transl_table=11
FT                   /gene="yijD"
FT                   /locus_tag="EPYR_00173"
FT                   /product="Inner membrane protein yijD"
FT                   /note="Protein of unknown function DUF1422, Protein of
FT                   unknown function (DUF1422)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00173"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72465"
FT                   /db_xref="GOA:D2TCM7"
FT                   /db_xref="InterPro:IPR009867"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCM7"
FT                   /protein_id="CAY72465.1"
FT                   /translation="MSLATGRDKGTLLLTFLTGLAINGSFAALFSSVVPFSIFPLIVLG
FT                   LSAWGLHQRYLNRAMPDGMPSLAAAFFLLGILVYSAIVRAEYPDIGSNFVPVIFMVIVV
FT                   FWIGLRLKRRSST"
FT   gene            complement(184703..185806)
FT                   /gene="trmA"
FT                   /locus_tag="EPYR_00174"
FT   CDS_pept        complement(184703..185806)
FT                   /transl_table=11
FT                   /gene="trmA"
FT                   /locus_tag="EPYR_00174"
FT                   /product="tRNA (uracil-5-)-methyltransferase"
FT                   /function="SAM-dependent methyltransferases related to tRNA
FT                   (uracil-5-)-methyltransferase"
FT                   /EC_number="2.1.1.35"
FT                   /note="tRNA (uracil-5-)-methyltransferase
FT                   (tRNA(M-5-U54)-methyltransferase)
FT                   (RUMT),(Uracil-5)-methyltransferase, tRNA
FT                   (Uracil-5-)-methyltransferase, trmA_only: tRNA
FT                   (uracil-5-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00174"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72466"
FT                   /db_xref="GOA:D2TCM8"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCM8"
FT                   /protein_id="CAY72466.1"
FT                   /translation="MTPEQLPIEQYEDQLTEKVTRLTSMMSAFNAPEVEVFRSAVSHYR
FT                   MRAEFRIWHEGDDLYHIIFDQQTRERIRVDNFPAASELINRLMPRLIDRIRDQRVLRFK
FT                   LFQIDYLSTVSGQMVVSMLYHRKLDEEWQQAAKALRDSLRAEGFDLHLIGRATKTKICL
FT                   DQDYVDERLTVDGHEITYRQVENSFTQPNAAVNVKMLEWALDSTRHARGDLLELYCGNG
FT                   NFSLALARNFNRVLATEIAKPSVASAQYNIAVNQIENVQIIRMAAEEFTQAMNGERRFK
FT                   RLEGIDLTSYQCETLFVDPPRSGLDDETVKMVQAYPRILYISCNPQTLCDNLATLSTTH
FT                   DITRLALFDQFPYTHHMECGVLLTRRS"
FT   gene            186008..186859
FT                   /gene="murI"
FT                   /locus_tag="EPYR_00175"
FT   CDS_pept        186008..186859
FT                   /transl_table=11
FT                   /gene="murI"
FT                   /locus_tag="EPYR_00175"
FT                   /function="Glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00175"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72467"
FT                   /db_xref="GOA:D2TCM9"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCM9"
FT                   /protein_id="CAY72467.1"
FT                   /translation="MAMKTLDGNITSEGVAPSVPRPTVLIFDSGVGGLSVYNEICALLP
FT                   DLHYLYAFDNVAFPYGEKSEEFIVERVMAIVTAVTRLYPLALVVIACNSASTVTLPALR
FT                   ARFAFPVVGVVPAIKPAARLTRNGIVGLLATRGTVKRPYTHELIARFAGECKTEMLGSG
FT                   ELVEIAEAKLHGQPVALEEVRRILQPWLRMPEPPDTVVLGCTHFPLISEELQQVLPEGT
FT                   RLIDSGAAIARRTVWLLENESPEALSADDNMALCLDITEQAVQLIPVLQRYGFKKLDKL
FT                   AL"
FT   gene            187276..188803
FT                   /locus_tag="EPYR_r004"
FT   rRNA            187276..188803
FT                   /locus_tag="EPYR_r004"
FT                   /product="16S ribosomal RNA"
FT   gene            188880..188955
FT                   /locus_tag="EPYR_t002"
FT   tRNA            188880..188955
FT                   /locus_tag="EPYR_t002"
FT                   /product="tRNA-Glu"
FT                   /anticodon="(pos:188914..188916,aa:Glu)"
FT   gene            189180..192174
FT                   /locus_tag="EPYR_r005"
FT   rRNA            189180..192174
FT                   /locus_tag="EPYR_r005"
FT                   /product="23S ribosomal RNA"
FT   gene            192388..192502
FT                   /locus_tag="EPYR_r006"
FT   rRNA            192388..192502
FT                   /locus_tag="EPYR_r006"
FT                   /product="5S RNA"
FT   gene            192602..192678
FT                   /locus_tag="EPYR_t003"
FT   tRNA            192602..192678
FT                   /locus_tag="EPYR_t003"
FT                   /product="tRNA-Asp"
FT                   /anticodon="(pos:192636..192638,aa:Asp)"
FT   gene            192686..192761
FT                   /locus_tag="EPYR_t004"
FT   tRNA            192686..192761
FT                   /locus_tag="EPYR_t004"
FT                   /product="tRNA-Trp"
FT                   /anticodon="(pos:192719..192721,aa:Trp)"
FT   gene            complement(192876..193703)
FT                   /gene="yifA"
FT                   /locus_tag="EPYR_00176"
FT   CDS_pept        complement(192876..193703)
FT                   /transl_table=11
FT                   /gene="yifA"
FT                   /locus_tag="EPYR_00176"
FT                   /product="probable RuBisCO transcriptional regulator"
FT                   /function="Transcriptional regulator"
FT                   /note="LysR, substrate-binding, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00176"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72468"
FT                   /db_xref="GOA:D2TCN0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR020890"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCN0"
FT                   /protein_id="CAY72468.1"
FT                   /translation="MDTELLKTFLEVSKTRHFGRAAEALYLTQSAVSFRIRQLENQLGV
FT                   GLFTRHRNNIRLTPAGERLLPYAENLMSTWLMAKKEVAHTQLHHELSIGASASLWETCL
FT                   TPWLQTLYEKHENLHIEARIAQRNLLVKQLHERQLDLLIATEAPKMDELASQKIGHIAL
FT                   SLFRSRNSNKNEKYPYIRMDWGADFHQHAGFLTGADDVPVLSTTSAHLTRQLLHTTGAC
FT                   AFLPQAWCQEYRDLMVVPDTAIAHRPLFAVWLESSDQQAHIRQLLRFPVNSQS"
FT   gene            193824..194162
FT                   /gene="yifE"
FT                   /locus_tag="EPYR_00177"
FT   CDS_pept        193824..194162
FT                   /transl_table=11
FT                   /gene="yifE"
FT                   /locus_tag="EPYR_00177"
FT                   /product="UPF0438 protein yifE"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="Protein of unknown function DUF413, Protein of
FT                   unknown function, DUF"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00177"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72469"
FT                   /db_xref="InterPro:IPR007335"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCN1"
FT                   /protein_id="CAY72469.1"
FT                   /translation="MAESFATTNRFFDNKHYPRGFSRHGDFTIKEAQLLEHYGHAFNEL
FT                   DLAKRQPITEEERLFIEVCRGVREPQTEAEKVWSKYMTRIKRPKRFHTLSGGKPQMEGV
FT                   EDYSDSDD"
FT   gene            complement(194197..195717)
FT                   /gene="yifB"
FT                   /locus_tag="EPYR_00178"
FT   CDS_pept        complement(194197..195717)
FT                   /transl_table=11
FT                   /gene="yifB"
FT                   /locus_tag="EPYR_00178"
FT                   /product="Uncharacterized protein yifB"
FT                   /function="Predicted ATPase with chaperone activity"
FT                   /note="Mg chelatase-related protein, Magnesium
FT                   chelatase,subunit ChlI, TIGR00368: Mg chelatase homolog"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00178"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72470"
FT                   /db_xref="GOA:D2TCN2"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCN2"
FT                   /protein_id="CAY72470.1"
FT                   /translation="MSLSVAYTRAAIGIQAPLVSVEVHLSNGLPALSLVGLPETTVKEA
FT                   RERVRSAILNSGFTFPAKRITVSLAPADLPKEGGRYDLPIAIAILAASEQVPAEKLIQY
FT                   EFLGELALTGALRGVQGAIPAALSALDAHRQLILSAENQHDVGLIRHGESLIATHLLEV
FT                   CAFLHGKSQLDAAHCEPEEYLPSSGDLNDIIGQQQAKRALEITAAGGHNLLLIGPPGTG
FT                   KTMLASRFSGLMPPLSDREALESASLASLISGSDFRRHWRQRPFRAPHHSASLYALVGG
FT                   GSLPKPGEISLAHNGVLFLDELPEFERRALDALREPLESGEISISRARAKITYPARFQL
FT                   IAAMNPSPTGHYRGPHNRSSPQQTLRYLSRLSGPFIDRFDISLEVPLLPAGMLSAQRGE
FT                   SESSQQVRERVLLARERQLARCNKMNATMNNQEIRACCRLTLEDAEWLEQVMTQLGLSV
FT                   RAWQRILKVARTIADMAGEQCIGRQHLTEAVSYRAIDRLLVHLQNSLD"
FT   gene            196291..197937
FT                   /gene="ilvG"
FT                   /locus_tag="EPYR_00179"
FT   CDS_pept        196291..197937
FT                   /transl_table=11
FT                   /gene="ilvG"
FT                   /locus_tag="EPYR_00179"
FT                   /product="acetolactate synthase large subunit"
FT                   /function="Thiamine pyrophosphate-requiring enzymes
FT                   [acetolactate synthase, pyruvate dehydrogenase
FT                   (cytochrome), glyoxylate carboligase, phosphonopyruvate
FT                   decarboxylase]"
FT                   /EC_number="2.2.1.6"
FT                   /note="Acetolactate synthase isozyme III large subunit
FT                   (AHAS-III) (Acetohydroxy-acid synthase III large subunit)
FT                   (ALS-III)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00179"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72471"
FT                   /db_xref="GOA:D2TCN3"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCN3"
FT                   /protein_id="CAY72471.1"
FT                   /translation="MNGAQWVVQSLHAQGIETVFGYPGGAIMPVYDALYDGGVEHLLCR
FT                   HEQGAAMAAIGFARATGKVGVCIATSGPGATNLITGLADAMLDSVPIVAITGQVSSAVM
FT                   GTDAFQEIDVLGLSLACTKHSFLVESLAELPSVMAEAFAIAKSGRPGPVLVDIPKDIQL
FT                   AEGELTAHLVPVEPEMAHPHTELQRARELLAQSEKPILYVGGGVGMADAVDALRAFASA
FT                   SGIPTVATLKGLGAPDADDACYLGMLGMHGTKAANLAVQRCDLLIAVGARFDDRVTGKL
FT                   DTFAPHASVIHLDIDPAELHKLRRAHVGLQGDINKLLPDLHQPADISAWREEVMALKAG
FT                   HGWRYDHPGEAIYAPLLLKQLSERKPQSAVVTTDVGQHQMWTAQHMRFSRPENFITSSG
FT                   LGTMGFGLPAAVGAQVARPNDTVICVSGDGSFMMNVQELGTIKRKQLPVKILLLDNQRL
FT                   GMVRQWQQLFFAERYSETNLSDNPDFLMLASAFGIKGQRITRKDQVDAALDALLHSEGP
FT                   YLLHVAIDEHENVWPLVPPGASNENMMERTA"
FT   gene            197934..198191
FT                   /gene="ilvM"
FT                   /locus_tag="EPYR_00180"
FT   CDS_pept        197934..198191
FT                   /transl_table=11
FT                   /gene="ilvM"
FT                   /locus_tag="EPYR_00180"
FT                   /product="acetolactate synthase small subunit"
FT                   /function="Acetolactate synthase, small (regulatory)
FT                   subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="Acetolactate synthase isozyme II small subunit
FT                   (AHAS-II) (Acetohydroxy-acid synthase II small subunit)
FT                   (ALS-II)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00180"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72472"
FT                   /db_xref="GOA:D2TCN4"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCN4"
FT                   /protein_id="CAY72472.1"
FT                   /translation="MKQHQLSIEARFRPEILERILRVVRHRGFQVCSMNMASLVNTSNI
FT                   NIEMTVASQRSVDLLSTQLSKLMDVACVHIQQQTTQQIRA"
FT   gene            198210..199136
FT                   /gene="ilvE"
FT                   /locus_tag="EPYR_00181"
FT   CDS_pept        198210..199136
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="EPYR_00181"
FT                   /product="branched-chain amino-acid aminotransferase"
FT                   /function="Branched-chain amino acid
FT                   aminotransferase/4-amino-4-deoxychorismate lyase"
FT                   /EC_number="2.6.1.42"
FT                   /note="Branched-chain-amino-acid aminotransferase
FT                   (Transaminase B) (BCAT), Aminotransferase, class IV"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00181"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72473"
FT                   /db_xref="GOA:D2TCN5"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCN5"
FT                   /protein_id="CAY72473.1"
FT                   /translation="MTKKADFIWFNGEMVKWEEAKVSVMSHALHYGTSVFEGVRCYDSH
FT                   KGPVVFRHREHMQRLRDSAKIYRFPVSLSVDELMEACRATLRKNNLKSAYIRPLVFVGD
FT                   VGLGVNPPDGYETDVIIAAFPWGAYLGAEALEQGIDAMVSSWNRVAPNTLPTAAKAGGN
FT                   YLSSLLVGSEARRHGYQEGIALDTQGYISEGAGENLFEVKDGILFTPPFTSSALPGITR
FT                   DAIIKLAQDMGIEVREQVLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGEGKRGPVT
FT                   ARIQSAFFGLFTGETEDKWGWLDPVNP"
FT   gene            199203..201053
FT                   /gene="ilvD"
FT                   /locus_tag="EPYR_00182"
FT   CDS_pept        199203..201053
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="EPYR_00182"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /function="Dihydroxyacid dehydratase/phosphogluconate
FT                   dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00182"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72474"
FT                   /db_xref="GOA:D2TCN6"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCN6"
FT                   /protein_id="CAY72474.1"
FT                   /translation="MPKYRSATTTHGRNMAGARALWRATGMTDDDFGKPIIAVVNSFTQ
FT                   FVPGHVHLRDLGKLVAEEIEASGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSV
FT                   EYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTKLSDKIIKLD
FT                   LVDAMIQGANPNVSDADSDQIERSACPTCGSCSGMFTANSMNCLTEALGLSQPGNGSLL
FT                   ATHADRRELFLNAGRRIVGLAKRYYEQDDESALPRSIASKAAFENAMTLDIAMGGSTNT
FT                   VLHLLAAAQEGEIDFDISDIDRLSRQVPHLCKVAPSTPKYHMEDVHRAGGVLGILGELD
FT                   RAGLMDNTVRNVLGLSLRETLDRYDIMLTQDEAVKKMFRAGPAGIRTTQAFSQDTRWET
FT                   LDDDRQQGCIRAREFAFSQDGGLAVLYGNLAENGCIVKTAGVDEGSLVFSGPAKVYESQ
FT                   DDAVAAILGGKVVAGDVVVIRYEGPKGGPGMQEMLYPTTYLKSMGLGKACALITDGRFS
FT                   GGTSGLSIGHASPEAASGGTIALVKDGDIINIDIPQRGIQLAVAENELAARRLEEDARG
FT                   EAAYTPHGRERQVSFALRAYATLATSADKGAVRDKSKLGG"
FT   gene            201059..202609
FT                   /gene="ilvA"
FT                   /locus_tag="EPYR_00183"
FT   CDS_pept        201059..202609
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="EPYR_00183"
FT                   /function="Threonine dehydratase"
FT                   /EC_number="4.3.1.19"
FT                   /note="threonine dehydratase biosynthetic (threonine
FT                   deaminase), Pyridoxal-phosphate dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00183"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72475"
FT                   /db_xref="GOA:D2TCN7"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCN7"
FT                   /protein_id="CAY72475.1"
FT                   /translation="MAESQPLSAQPSGAEYLRAVLRAPVYEAAQVTPLQKMEKISARLG
FT                   NTILVKREDRQPVHSFKLRGAYAMIAGLNEDQKAQGVVTASAGNHAQGVALSASKLGIK
FT                   SLIVMPVATADIKVDAVRAFGGEAYLFGANFDEAKAKALELAQQHGYTFVPPFDHPMVI
FT                   AGQGTLAMELLQQDAHLDRVFVPVGGGGLAAGVAVLIKQLMPQIKVIAVEAADSACLKA
FT                   ALDAGHPVDLPRVGLFAEGVAVKRIGSETFRLCQTYLDDIVTVDSDAICAAMKDLFDDV
FT                   RAVAEPSGALALAGMKKYIQQHQIQGERLAHVLSGANVNFHGLRYVSERCELGEQREAL
FT                   LAVTIPEQKGSFLRFCQLLGGRAVTEFNYRYADADADEACIFVGVRLTRGAEERQEILQ
FT                   LLIGGGYKVVDLSDDEMAKLHVRYMVGGRPSKPLRERLFSFEFPEAPGALLRFLQTLGA
FT                   HWNISLFHYRSHGTDYGRVLAAFELSDSEPQFEEHLAALGYDFHDESDNPSFRFFLAG"
FT   gene            complement(202606..203487)
FT                   /gene="ilvY"
FT                   /locus_tag="EPYR_00184"
FT   CDS_pept        complement(202606..203487)
FT                   /transl_table=11
FT                   /gene="ilvY"
FT                   /locus_tag="EPYR_00184"
FT                   /product="LysR-family transcriptional regulator"
FT                   /function="Transcriptional regulator"
FT                   /note="Positive regulator for IlvC (LysR-family
FT                   transcriptional regulatory protein)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00184"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72476"
FT                   /db_xref="GOA:D2TCN8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037404"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCN8"
FT                   /protein_id="CAY72476.1"
FT                   /translation="MDLRDLKLFLHLADSRHFGRSARAMHVSPSTLSRQIQRLEDDLGQ
FT                   TLFLRDNRTVTLTDAGERLRQFAQQTLLQYQQMCHALGQNGPSLSGELRLFCSVTAAYS
FT                   HLPPILDRFRAEHPLVEIKLTTGDAADAVEKVQSGDMDLAIAGQPETLPASVGFTPLGL
FT                   IPLVLIAPALPCPVRVQATQPTPDWSQIPFILPDQGPSRRRIDLWFRHRRIANPQIYAT
FT                   VSGHEAIVSMVAVGCGIALLPDVVLENSPESVRNRILELADVEMVDPLEIGVCVQKKRL
FT                   LEPLIDAFWKLL"
FT   gene            203653..205131
FT                   /gene="ilvC"
FT                   /locus_tag="EPYR_00185"
FT   CDS_pept        203653..205131
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="EPYR_00185"
FT                   /function="Ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="Ketol-acid reductoisomerase (Acetohydroxy-acid
FT                   isomeroreductase) (Alpha-keto-beta-hydroxylacil
FT                   reductoisomerase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00185"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72477"
FT                   /db_xref="GOA:D2TCN9"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCN9"
FT                   /protein_id="CAY72477.1"
FT                   /translation="MANYFNTLNLRNQLAQLGKCRFMAREEFADEASYLKGKKVVIVGC
FT                   GAQGLNQGLNMRDSGLDIAYALRAEAIAEKRASWRKATENGFKVGTYEELIPQADLVVN
FT                   LTPDKQHTSVVQAVQPLMKDGAALGYSHGFNIVEVGEQVRKDVTVVMVAPKCPGTEVRE
FT                   EYKRGFGVPTLIAVHPENDPKGEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQ
FT                   TILCGMLQAGSLLCFDKLVAEGTDAAYAEKLIQFGWETITEALKQGGITLMMDRLSNPA
FT                   KVRAYALSEQLKTIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLGWREETGKTAFE
FT                   TAAQFEGKIGEQDYFDQGVVMIAMVKAGVELAFETMVAAGIVEESAYYESLHELPLIAN
FT                   TIARKRLYEMNVVISDTAEYGNYLFSYAAVPLLKEFMTTLQAGDLGKQVNPSTSVDNAQ
FT                   LRDVNEAIRHHDIETVGRKLRGYMTDMKRIAVAG"
FT   gene            complement(205190..205471)
FT                   /gene="ppiC"
FT                   /locus_tag="EPYR_00186"
FT   CDS_pept        complement(205190..205471)
FT                   /transl_table=11
FT                   /gene="ppiC"
FT                   /locus_tag="EPYR_00186"
FT                   /product="peptidyl-prolyl cis-trans isomerase C"
FT                   /function="Parvulin-like peptidyl-prolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="Chaperone surA precursor (Peptidyl-prolyl cis-trans
FT                   isomerase surA) (PPIase surA) (Rotamase
FT                   surA),Peptidyl-prolyl cis-trans isomerase, PpiC-type,
FT                   PPIC-type PPIASE domain"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00186"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72478"
FT                   /db_xref="GOA:D2TCP0"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCP0"
FT                   /protein_id="CAY72478.1"
FT                   /translation="MAKNAAALHILVKEEKLALDLLEQLKQGADFEKLAKKHSTCPSGK
FT                   KGGHLGEFKQGAMVPAFDKVVFSCPLIEPQGPLHTQFGYHIIKVLYRN"
FT   gene            205488..207581
FT                   /gene="rep"
FT                   /locus_tag="EPYR_00187"
FT   CDS_pept        205488..207581
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="EPYR_00187"
FT                   /product="ATP-dependent DNA helicase RepA"
FT                   /function="Superfamily I DNA and RNA helicases"
FT                   /EC_number="3.6.1.-"
FT                   /note="DNA helicase, ATP-dependent, RepA type"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00187"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72479"
FT                   /db_xref="GOA:D2TCP1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCP1"
FT                   /protein_id="CAY72479.1"
FT                   /translation="MWIALAILPRCHSHPPAISQSNLSMRLNPGQQHAVEFVTGPCLVL
FT                   AGAGSGKTRVITNKIAYLIRECGYQARHIAAVTFTNKASREMKERVAQTLGRKEARGLM
FT                   ISTFHTLGLEIIKREYAALGMKSNFSLFDDQDQLALLKDLTEQWLENDKNLLQQLVSTI
FT                   SNWKNDLMDPPRAAAGALSERDKLFAHCYALYDKHLKSCNVLDFDDLILLPTLLLQRNV
FT                   DVRERWQQRIRYLLVDEYQDTNTSQYELVKLLVGARARFTVVGDDDQSIYSWRGARPQN
FT                   LVLLQEDFPALQVIKLEQNYRSSERILKAANILIANNPHVFEKRLFSELGYGAELKVVT
FT                   ANHEDHEAERVIGELIAHHFINKTQYKDYAILYRGNHQSRVFEKMLMQNRIPYHISGGT
FT                   SFFSRPEIKDLLAYLRVLTNADDDSAFMRIVNTPRREIGSATLQKLGEWAMQRNKSLFT
FT                   ASFDVGLGQTLAGRGLESLQRFTHWLQEIARLAEREPVAAVRDLIRGVDYESWLFETSA
FT                   SPKAAEMRMKNVNTLFQWMTEMLEGSDIDEPMTLTQVVTRFTLRDMMERGESDEESDQV
FT                   QLMTLHASKGLEFPYVFLVGMEEGLLPHQSSIDENNVEEERRLAYVGITRAQKELTFTL
FT                   CRERRQYGELVRPEPSRFLLELPQDDLQWESERKVVSAEERMQKGQGHLANIRAQLAKA
FT                   KGL"
FT   gene            207966..208358
FT                   /locus_tag="EPYR_00188"
FT   CDS_pept        207966..208358
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00188"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72480"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCP2"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72480.1"
FT                   /translation="MQDALNSKRSIQTIRDCTSIIATHSFNANLLQVRTLDNEAVPPEQ
FT                   LHFIVTFKHDVENARATVKPLAEAVFLNGRVRYIVKPAKQYPELERHMPMFSEVIETSI
FT                   REFLSSHVRIVRTNIANDSANKWLLH"
FT   gene            208343..209131
FT                   /locus_tag="EPYR_00189"
FT   CDS_pept        208343..209131
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00189"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72481"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCP3"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72481.1"
FT                   /translation="MAPTLIASSFFNKNIGEFAHQGETRFVRFGYMVAATSLFKLTELE
FT                   LIAPEDDIHTYITIEQVGGTYGNQTAVSEKILDLKDDGISEAEIIGHLLASELLDENAN
FT                   IHAGRIALRSSCFVEDGNEVSCNQVAGVGVEEAFQKKGISSRAYLFLLNWFEHLVCDDT
FT                   QTIPGAKIWAGTLIRACEVRIYNENGHVFEDVLGELGKGRNRGFLPWNKGMLTDVSTWQ
FT                   PNEVRPTAQKYIVLVISRDTSLTVGLLPSVKRQQSERVLT"
FT   gene            complement(209187..210671)
FT                   /gene="gppA"
FT                   /locus_tag="EPYR_00190"
FT   CDS_pept        complement(209187..210671)
FT                   /transl_table=11
FT                   /gene="gppA"
FT                   /locus_tag="EPYR_00190"
FT                   /product="guanosine pentaphosphatase"
FT                   /function="Exopolyphosphatase"
FT                   /EC_number="3.6.1.40"
FT                   /note="Guanosine-5'-triphosphate,3'-diphosphate
FT                   pyrophosphatase (Guanosine pentaphosphate phosphohydrolase)
FT                   (pppGpp-5'-phosphohydrolase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00190"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72482"
FT                   /db_xref="GOA:D2TCP4"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR023709"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCP4"
FT                   /protein_id="CAY72482.1"
FT                   /translation="MQSASSLYAAIDLGSNSFHMLVVREVAGSIQTVARIKRKVRLAAG
FT                   LDADNNLSDESMERGWQCLRLFSEQLQDIPSEHIRVVATATLRIAPNAGSFLVKAQEVL
FT                   GCPVNVISGEEEARLIYQGVAHTTGGSDKRLVVDIGGGSTELVTGKGAQTTTLVSLSMG
FT                   CVTWLERYFTDRQLGRANFEQAEQAARAMIRPIADSLKEQGWQMCVGASGTVQALQEIM
FT                   MAQGMDERITLSKLQQLKQRAIECGKLEELEIEGLTLERALVFPSGLSILIAIFNELDI
FT                   SSMTLAGGALREGLVYGMLHLPVDRDIRSRTLHDVQRRFAIDAEQAERVRQLAESFARQ
FT                   VSQRWKLDERSRELLASACLIHEIGLSVDFRQAPQHAAYLVRHLDLPGFTPAQKKLLAT
FT                   LLQNQVANIDLPLLSQQNALLPRIAERLARLLRLAIIFASRRRDDRLPAVRLQADDDNL
FT                   TLTLPSGWLEAHPLRAELLEQEARWQSYVHWSLIIL"
FT   gene            complement(210678..211970)
FT                   /gene="rhlB"
FT                   /locus_tag="EPYR_00191"
FT   CDS_pept        complement(210678..211970)
FT                   /transl_table=11
FT                   /gene="rhlB"
FT                   /locus_tag="EPYR_00191"
FT                   /product="putative ATP-dependent RNA helicase"
FT                   /function="Superfamily II DNA and RNA helicases"
FT                   /EC_number="3.6.1.-"
FT                   /note="DEAD-like helicase, N-terminal, DEAD/DEAH box
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00191"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72483"
FT                   /db_xref="GOA:D2TCP5"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCP5"
FT                   /protein_id="CAY72483.1"
FT                   /translation="MSKTHLTEQKFSDFALHPQVIEALETKGFHNCTPIQALALPFTLS
FT                   GRDVAGQAQTGTGKTMAFLTSTFHHLLSHPAPEGRQVNQPRALILAPTRELAVQIHADA
FT                   EPLAQISGLKIGLAYGGDGYDKQLKVLESGVDVLIATTGRLIDYAKQNHVNLGAIQVVV
FT                   LDEADRMFDLGFIKDIRWLFRRMPAANQRLNMLFSATLSFRVRELAFENMNNAEYVEVE
FT                   PDQKTGHRIKEELFYPSNEEKMRLLQTLIEEEWPDRTIIFANTKHRCEDIWGHLAADGH
FT                   RVGLLTGDVAQKKRLRILDDFTKGDVDILVATDVAARGLHIPAVTHVFNYDLPDDREDY
FT                   VHRIGRTGRAGANGHSISLACEEYALNLPAIEEYIGHSIPVSRYNSDALMGDLPPPKRL
FT                   TRNRSGNGPRRGGNNNRRSSAPRSPNRKRSG"
FT   gene            212100..212429
FT                   /gene="trxA"
FT                   /locus_tag="EPYR_00192"
FT   CDS_pept        212100..212429
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="EPYR_00192"
FT                   /product="Thioredoxin M-type, chloroplast precursor
FT                   (Trx-M)"
FT                   /function="Thiol-disulfide isomerase and thioredoxins"
FT                   /note="Thioredoxin-like fold, Thioredoxin, thioredoxin:
FT                   thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00192"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72484"
FT                   /db_xref="GOA:D2TCP6"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCP6"
FT                   /protein_id="CAY72484.1"
FT                   /translation="MSDKIVHLTDDSFETDVLKADGLTLVDFWAEWCGPCKMIAPILDE
FT                   VAAEYEGKLTVAKLNIDENPATAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFL
FT                   NANLG"
FT   gene            212798..214057
FT                   /gene="rho"
FT                   /locus_tag="EPYR_00193"
FT   CDS_pept        212798..214057
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="EPYR_00193"
FT                   /product="Transcription termination factor rho"
FT                   /function="Transcription termination factor"
FT                   /EC_number="3.6.1.-"
FT                   /note="Transcription termination factor rho (ATP-dependent
FT                   helicase rho), ATP synthase alpha/beta family,
FT                   nucleotide-binding"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00193"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72485"
FT                   /db_xref="GOA:D2TCP7"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCP7"
FT                   /protein_id="CAY72485.1"
FT                   /translation="MNLTELKNTPVSDLITLGENMGLENLARMRKQDIIFAILKQHAKS
FT                   GEDIFGDGVLEILQDGFGFLRSGDSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPP
FT                   KEGERYFALLKVNEVNYDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLD
FT                   LASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRL
FT                   VKGEVIASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPAS
FT                   GKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGN
FT                   MELHLARKIAEKRVFPAIDYNRSGTRKEELLTTSEELQKMWILRKIIHPMGEIDAMEFL
FT                   INKLAMTKTNDEFFDMMKRS"
FT   gene            214349..215455
FT                   /gene="wecA"
FT                   /locus_tag="EPYR_00194"
FT   CDS_pept        214349..215455
FT                   /transl_table=11
FT                   /gene="wecA"
FT                   /locus_tag="EPYR_00194"
FT                   /product="UDP-GlcNAc:undecaprenylphosphate
FT                   GlcNAc-1-phosphate transferase"
FT                   /function="UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase/UDP-N-acetylglucosamine-1-phosphate
FT                   transferase"
FT                   /EC_number="2.7.8.-"
FT                   /note="Undecaprenyl-phosphate alpha-N-acetylglucosaminyl
FT                   1-phosphatetransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00194"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72486"
FT                   /db_xref="GOA:D2TCP8"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR012750"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCP8"
FT                   /protein_id="CAY72486.1"
FT                   /translation="MNLLNTSTELALTFLFSLAFLFFARKAAKKIGLVDKPNYRKRHQG
FT                   AIPLVGGISVFAGSCFAFALTDFYIPHIWLYLGCAGSLVMVGALDDRYDISVKFRALVQ
FT                   AAVAVVMMMKAKIYLLSLGYIFGPWELIVGPFGYVLTLFAVWAAINAFNMVDGIDGLLG
FT                   GLSCVTFFAMGIILLFDGQNSLAMWCFIMISAIFPYILLNLGMLGRRYKVFMGDAGSTL
FT                   IGFTIIWILLETTQGQNHPITPVTALWLIAIPLMDMVAIMYRRLSKGMSPFSADRQHIH
FT                   HLIMRAGFTSRQAFVLITAAAALLALIGGLGEYLSFVPEWVMLVLFLLAFMLYGYCIKR
FT                   AWRVARMIKRLKRRLRNSNNGNKPSVDR"
FT   gene            215482..216510
FT                   /gene="wzzE"
FT                   /locus_tag="EPYR_00195"
FT   CDS_pept        215482..216510
FT                   /transl_table=11
FT                   /gene="wzzE"
FT                   /locus_tag="EPYR_00195"
FT                   /product="Lipopolysaccharide biosynthesis protein wzzE"
FT                   /function="Chain length determinant protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00195"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72487"
FT                   /db_xref="GOA:D2TCP9"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032895"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCP9"
FT                   /protein_id="CAY72487.1"
FT                   /translation="MNHPDAGDNELDIRGLCCALWCGKLWIIAGGVLFALLAWIYSLLV
FT                   TPQWSTIAIVDRPTVNALSGFYSQQQFLKNLDMPAGNLTVAPPTVNDEAYQEFIMQLFA
FT                   WDSRHDFWLHSSYYQKRKSGNARQDAALLDKLIADIQLQPADSAKNINDTVKIVAETAA
FT                   DANTLLRQYVAFANARATAHLNQELSAAWAARRIQLKAQIKRQEEVAKAIYDRQLNSVR
FT                   QALKLAQQHGFEQAKTQTPSEQLPDSELFLLGRSMLQARLENLLAGGPSYDLAYYQNRA
FT                   MMMTLNVGPTLVESFQTWRYLRTPEEPVKRESPRRALLMMMWGAVGVLVGAGTALIRRP
FT                   RR"
FT   gene            216447..217682
FT                   /gene="wecB"
FT                   /locus_tag="EPYR_00196"
FT   CDS_pept        216447..217682
FT                   /transl_table=11
FT                   /gene="wecB"
FT                   /locus_tag="EPYR_00196"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /function="UDP-N-acetylglucosamine 2-epimerase [Cell
FT                   envelope biogenesis, outer membrane]."
FT                   /EC_number="5.1.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00196"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72488"
FT                   /db_xref="GOA:D2TCQ0"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="InterPro:IPR032892"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCQ0"
FT                   /protein_id="CAY72488.1"
FT                   /translation="MGRSGRFGGRWHGVDSPSPSLSLPQTRAVKHIRIKRATVKVLTVF
FT                   GTRPEAIKMAPLVHALAQEDGIESRLCVTAQHREMLDQVLQLFAITPDYDLNIMQPGQG
FT                   LTEITSRILAGLKTVFADFTPDVVLVHGDTTTTLAASLAAFYHRIPVGHVEAGLRTGDL
FT                   WSPWPEEANRTLTGRLASYHFAPTASTQQNLLRENVPAERIFVTGNTVIDALFWVRDRV
FT                   LNDDALRNSLAVRYPFLCADKKMILVTGHRRESFGDGFERICNALADIARLHPQAQIVY
FT                   PVHLNPNVSEPVNRILHGIDNVILIEPQEYLPFVWLMNRAWLILTDSGGIQEEAPSLGK
FT                   PVLVMRDTTERPEAVTAGTVRLVGTDGAKIVSEVTRLLTDDEAWQSMSRAHNPYGDGLA
FT                   CQRIVQALKKIG"
FT   gene            217684..218949
FT                   /gene="wecC"
FT                   /locus_tag="EPYR_00197"
FT   CDS_pept        217684..218949
FT                   /transl_table=11
FT                   /gene="wecC"
FT                   /locus_tag="EPYR_00197"
FT                   /product="UDP-N-acetyl-D-mannosaminuronic acid
FT                   dehydrogenase"
FT                   /function="UDP-N-acetyl-D-mannosaminuronate dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00197"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72489"
FT                   /db_xref="GOA:D2TCQ1"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR032891"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCQ1"
FT                   /protein_id="CAY72489.1"
FT                   /translation="MMIFKTISVIGLGYIGLPTAAAFASCQRQVMGIDINAHAVATINR
FT                   GEVHFTEPDLDRVVKTAVEGGFLRAATQPQPADAFLIAVPTPFRGNHQPDMTYVQAAAE
FT                   SVATVLKKGDLVILESTSPVGSTEQMAQWLAAARPDLTFPQQAGEAADIQVAYCPERVL
FT                   PGRVMAELCKNDRVIGGMTATCSQRASDLYKLFVEGECVVTNSRTAEMCKLTENSFRDV
FT                   NIAFANELSLICTQQGINVWELIRLANRHPRVNILQPGPGVGGHCIAVDPWFIVAQNPE
FT                   LARLIRTAREVNDGKPHWVLEQVQKQVADCLMASNRRASELKIACLGLAFKPDIDDLRE
FT                   SPAVQVTSMIAAWHQGTTLVVEPNVQQLPASLQEKVTLVTLDEALQQADVLVMLVDHRQ
FT                   FKAIDPATLNQPWIVDTKGVWK"
FT   gene            218946..220013
FT                   /gene="rmlB"
FT                   /locus_tag="EPYR_00198"
FT   CDS_pept        218946..220013
FT                   /transl_table=11
FT                   /gene="rmlB"
FT                   /locus_tag="EPYR_00198"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /function="dTDP-D-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00198"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72490"
FT                   /db_xref="GOA:D2TCQ2"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCQ2"
FT                   /protein_id="CAY72490.1"
FT                   /translation="MRRILVTGGAGFIGSAVVRHILSSTPDRVLVLDKLSYAGNLASLA
FT                   PVAENPRFAFSKVDICDRAALDGAIAAFQPQLIMHLAAESHVDRSIDGPLAFVETNIVG
FT                   TYMMLEAARHYWTSLPAPERSAFIFHHISTDEVFGDLENDTDFFTETTPYAPSSPYSAT
FT                   KASSDHLVRAWHRTYGLPVIVTNCSNNYGPYHFPEKLIPLMIINALAGKPLPVYGDGGQ
FT                   IRDWLYVDDHARALYQVVTAGKVGETYNIGGHSERRNIDVVETLCALLEELAPEKPAGL
FT                   GHYRDLITRVADRPGHDRRYAIDAGKIERELGWRPQETFESGMRKTVSWFINNPAWWQR
FT                   VLDGSYRGERLGLSL"
FT   gene            220033..220914
FT                   /gene="rmlA"
FT                   /locus_tag="EPYR_00199"
FT   CDS_pept        220033..220914
FT                   /transl_table=11
FT                   /gene="rmlA"
FT                   /locus_tag="EPYR_00199"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /function="dTDP-glucose pyrophosphorylase"
FT                   /EC_number="2.7.7.24"
FT                   /note="Glucose-1-phosphate thymidylyltransferase
FT                   (dTDP-glucose synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00199"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72491"
FT                   /db_xref="GOA:D2TCQ3"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCQ3"
FT                   /protein_id="CAY72491.1"
FT                   /translation="MKGIVLAGGSGTRLHPITRGLSKQLLPVYDKPMIYYPLSVLMLAG
FT                   IRDVLIITTPEDKPHYQRLLGEGDEFGIRLTYAEQASPDGLAQAFIIGEAFIGGDSCCL
FT                   VLGDNIFFGQGFSPKLKQAVENPSGATVFGYQVMDPERFGVVEFDDNFRALSLEEKPSQ
FT                   PKSRWAVTGLYFYDNRVVEFAKQVRPSVRGELEITSINQMYLERGELNVQLLGRGFAWL
FT                   DTGTHDSLIEASTFVQTVEKRQGFKIACLEEIGWRNGWLSDDEVRRSAAALTKTGYGQY
FT                   LSDLLHVRPRQY"
FT   gene            220892..221593
FT                   /gene="wecD"
FT                   /locus_tag="EPYR_00200"
FT   CDS_pept        220892..221593
FT                   /transl_table=11
FT                   /gene="wecD"
FT                   /locus_tag="EPYR_00200"
FT                   /product="TDP-D-fucosamine acetyltransferase"
FT                   /function="Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /EC_number="2.3.1.-"
FT                   /note="Lipopolysaccharide biosynthesis protein
FT                   ),TDP-D-fucosamine acetyltransferase WecD"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00200"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72492"
FT                   /db_xref="GOA:D2TCQ4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012752"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCQ4"
FT                   /protein_id="CAY72492.1"
FT                   /translation="MSVLASIKPLEWESAFFGRRCALLELTGDSVLDAARLNDWDLVQV
FT                   KVMAQQSAELDALSALGFRLVEGEAECVSGISAGERPAGIRIARTEHIPLLRRAAEDAF
FT                   TYSRFRTPWFAAGDSGRFYAQWIENAVRGTFDHQCLLAVDETGATQGFVSLRELPEGTG
FT                   RIGLLAVLPEYQGLGIGQRLMDAANDWCRARRLTRLHVATQLGNLSALRLYLRCGGVFE
FT                   RTAYWLYREMT"
FT   gene            221590..222720
FT                   /gene="wecE"
FT                   /locus_tag="EPYR_00201"
FT   CDS_pept        221590..222720
FT                   /transl_table=11
FT                   /gene="wecE"
FT                   /locus_tag="EPYR_00201"
FT                   /product="TDP-4-keto-6-deoxy-D-glucose transaminase"
FT                   /function="Predicted pyridoxal phosphate-dependent enzyme
FT                   apparently involved in regulation of cell wall biogenesis"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00201"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72493"
FT                   /db_xref="GOA:D2TCQ5"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR012749"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR032894"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCQ5"
FT                   /protein_id="CAY72493.1"
FT                   /translation="MIPFNAPPVVGTEIEYMRSAMSSGKLCGDGGFTHRCQQWMEQHFG
FT                   SRKVLLTPSCTASLEMAAILLDIQPGDEVIMPSYTFVSTANAFVLRGATIVFVDVRPDT
FT                   MNIDENLIEAAITAKTKAIVPVHYAGVACEMDTIMALAKKHRLWVVEDAAQGVMSTYKG
FT                   RALGTIGHIGCFSFHETKNYTAGGEGGATLVNEVTLIERAEVIREKGTNRSQFFRGQVD
FT                   KYTWRDIGSSYLMADLQAAYLWAQLEVAEAVNQQRLRLWQNYHDALQPIAARGRITLPA
FT                   LPAGCEHNAHMFWLKLRDGCDRSALIAWLKEAEILAVFHYIPLHSSPAGQRFGRLCGED
FT                   RYTQQESDRLLRLPLFYNLSDSQQKTVISALLSYFS"
FT   gene            222722..223972
FT                   /gene="wzx"
FT                   /locus_tag="EPYR_00202"
FT   CDS_pept        222722..223972
FT                   /transl_table=11
FT                   /gene="wzx"
FT                   /locus_tag="EPYR_00202"
FT                   /product="O-antigen translocase in LPS biosynthesis"
FT                   /function="Uncharacterized membrane protein, putative
FT                   virulence factor"
FT                   /note="Polysaccharide biosynthesis protein, Flippase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00202"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72494"
FT                   /db_xref="GOA:D2TCQ6"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR032896"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCQ6"
FT                   /protein_id="CAY72494.1"
FT                   /translation="MSLAKASMWTAASTLVKIVAGLLVVKMLAVSYGPAGVGQAGNFRQ
FT                   LITVLGVLAGAGIFNGVTKYVAQYQQQPRQLRAVVGTASSMVLGFSLLLALVFLLFAAP
FT                   ISRALFGHDDYQQVIRIVAFLQMGIAWANLALALMKGFRDAAGNALALIIGSLSGVAAW
FT                   FVCYWLGGYSGALVGLAMVPALVVVPAFVLLARRDRLPMNYLLPGWQPECVRSLGKFTL
FT                   MALITAVTLPVAWMMMRNLLAQHAGWQQVGLWQGVSSISDAYLQFITASFSVWLLPTLA
FT                   RLQHKADITREILKALRFVLPVVAAASFAVWLLRDFAIWLLFSSEFHAMRDLFIWQLIG
FT                   DVLKVGCYVFGYLVIAKASLRFYLLTEVSQFALLSGFSRWLIPLHGAAGAAQAYMATYM
FT                   AYFALCAGVFIIYRRRV"
FT   gene            223969..225045
FT                   /gene="wecF"
FT                   /locus_tag="EPYR_00203"
FT   CDS_pept        223969..225045
FT                   /transl_table=11
FT                   /gene="wecF"
FT                   /locus_tag="EPYR_00203"
FT                   /product="4-alpha-L-fucosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /note="4-alpha-L-fucosyltransferase (TDP-Fuc4NAc:lipid II
FT                   Fuc4NAc transferase) (Fuc4NAc transferase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00203"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72495"
FT                   /db_xref="GOA:D2TCQ7"
FT                   /db_xref="InterPro:IPR009993"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCQ7"
FT                   /protein_id="CAY72495.1"
FT                   /translation="MTTVIHLLGSDIPHHNQTVLGFFNRTLYDEVPTAAARQFWLVSGQ
FT                   SEHINQFPRLNIRVFADKAALASAVINAGCQQRELRFFCHGQFNLRLWLALLSGKLRRN
FT                   QVYWHIWGADLYEDAAGLKFRLFYLMRRLAQKRVAHVFATRGDINRFHQRNPQIPASLL
FT                   YFPTRLAQHVAASEQPSVPLTILLGNSGDASNRHIEGLQEIHQQFGLGVKVVVPLGYPL
FT                   NNETYIQRVREAADDLFAPGTVQLITDKLAFSDYLQLLSHCHLGYFMFQRQQGIGTLCL
FT                   LMQANVPFVLSRKNPFWQDLVEQQVPVLFTSDSLDEATIGEARRQMQLLDKRHIAFFEP
FT                   GYLAGWRQALRLAEGDNP"
FT   gene            225042..226400
FT                   /gene="wzy"
FT                   /locus_tag="EPYR_00204"
FT   CDS_pept        225042..226400
FT                   /transl_table=11
FT                   /gene="wzy"
FT                   /locus_tag="EPYR_00204"
FT                   /product="putative ECA polymerase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00204"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72496"
FT                   /db_xref="GOA:D2TCQ8"
FT                   /db_xref="InterPro:IPR010691"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCQ8"
FT                   /protein_id="CAY72496.1"
FT                   /translation="MTLLPFSGLLLVWLMCCGFILTLTWREFRRVRFNFNVFFSMLFLL
FT                   TFFFGFPLTCLLVFVFDVEVVPAEYLLQALLSAGCFYAIYYVTYKTRLRARHRPPSRPA
FT                   FTINRIEAHLSWMIMALVASGTLSVFFLHNGFLLFKLHSYSQIFSADVSGVALKRFFYF
FT                   FIPAMLVVYFLKQDVRSWLLFLGGTLAFGLLTYTIVGGTRANIIIAFALFLFIGIIRGW
FT                   ITLWMLALAGAGAIVAMFWLALKRYNLDVSGSQAFYTFLYLTRDTFSPWENLGLLLQNY
FT                   DKIDFQGLAPVWRDFYVFIPGWLWHERPSVVLNSANYFTWEVLDNHSGLAISPTLIGSL
FT                   VVMGGALFILPGAVAVGLIIKWFDWLYEKGRQEQNRYKAAILQSFCFGAVFNMIVLARE
FT                   GLDAFASRVVFFCLIFAACVLMAKLLYWLLDSAGLVRARTMPSPLSTQSSTLS"
FT   gene            226413..227153
FT                   /gene="wecG"
FT                   /locus_tag="EPYR_00205"
FT   CDS_pept        226413..227153
FT                   /transl_table=11
FT                   /gene="wecG"
FT                   /locus_tag="EPYR_00205"
FT                   /product="probable UDP-N-acetyl-D-mannosaminuronic acid
FT                   transferase"
FT                   /function="Teichoic acid biosynthesis proteins"
FT                   /EC_number="2.4.1.-"
FT                   /note="probable UDP-N-acetyl-D-mannosaminuronic acid
FT                   transferase (UDP-ManNAcA transferase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00205"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72497"
FT                   /db_xref="GOA:D2TCQ9"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="InterPro:IPR023085"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCQ9"
FT                   /protein_id="CAY72497.1"
FT                   /translation="MSASVTVPKYQIRGLTLSGFADMAQFVDYLNQPGELKKGTLVAIN
FT                   AEKVLTAEADPEVYQLLNEAEYKYADGISIVRSIRKKYPQAKVSRIAGADLWEALMERA
FT                   GREGTPVFLVGGQPEILAQTADKLCKQWNVNIVGSQDGFFTPGEREALFVRIKASGARL
FT                   ITVAMGSPRQEILMKACRAVYPDALYMGVGGTYDVFTGQVKRAPRIWQNMGLEWLYRLI
FT                   LQPSRLKRQFSLLKYLNYHWRGDL"
FT   gene            227331..227407
FT                   /locus_tag="EPYR_t005"
FT   tRNA            227331..227407
FT                   /locus_tag="EPYR_t005"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:227365..227367,aa:Arg)"
FT   gene            227471..227546
FT                   /locus_tag="EPYR_t006"
FT   tRNA            227471..227546
FT                   /locus_tag="EPYR_t006"
FT                   /product="tRNA-His"
FT                   /anticodon="(pos:227504..227506,aa:His)"
FT   gene            227560..227646
FT                   /locus_tag="EPYR_t007"
FT   tRNA            227560..227646
FT                   /locus_tag="EPYR_t007"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:227594..227596,aa:Leu)"
FT   gene            227675..227751
FT                   /locus_tag="EPYR_t008"
FT   tRNA            227675..227751
FT                   /locus_tag="EPYR_t008"
FT                   /product="tRNA-Pro"
FT                   /anticodon="(pos:227709..227711,aa:Pro)"
FT   gene            complement(227792..227905)
FT                   /locus_tag="EPYR_00206"
FT   CDS_pept        complement(227792..227905)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00206"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72498"
FT                   /db_xref="GOA:D2TCR0"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCR0"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72498.1"
FT                   /translation="MRYQAALLAEYFFIATTFLFLRKPEGFKQKNPQQQIF"
FT   gene            227878..227954
FT                   /locus_tag="EPYR_t009"
FT   tRNA            227878..227954
FT                   /locus_tag="EPYR_t009"
FT                   /product="tRNA-Pro"
FT                   /anticodon="(pos:227912..227914,aa:Pro)"
FT   gene            complement(228396..229586)
FT                   /gene="hemY"
FT                   /locus_tag="EPYR_00207"
FT   CDS_pept        complement(228396..229586)
FT                   /transl_table=11
FT                   /gene="hemY"
FT                   /locus_tag="EPYR_00207"
FT                   /product="Protein hemY"
FT                   /function="Uncharacterized enzyme of heme biosynthesis"
FT                   /note="Protoheme IX biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00207"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72499"
FT                   /db_xref="GOA:D2TCR1"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCR1"
FT                   /protein_id="CAY72499.1"
FT                   /translation="MLKVLLLFLLLIAGVVIGPMIAGHQGYVLIQTNNWNIETSVTGMT
FT                   IVLLLSLVIILAVEWLLRRVFRTGARTRGWFTGRKRRSARKQTHAALVKLAEGDYKQVE
FT                   KLLSRHADHAEQPMVNYLLAAEAAQQRGDETRANQHLERASELNDDDPLPVEITRVRIQ
FT                   LARNEDHAARHGIDRLLEIAPRHPEVLRLAEQAYVRTQAWGALLNILPAMEKIQPGDAT
FT                   HRLELQQQCWLGLMSQAMADQGSDGLKRWWQNQSRKTRNETALQVAMADHLIVCDDHDT
FT                   AQKIVLEGLKRHFDERLVMLMPRLKTGNPEQLEKALRQQIKQHGATPLLHSTLGQLLMQ
FT                   HGEWELSSEAFRAALQQRPDAFDYAWLADTLDRQHKPEEAATMRRDGLLLTLKNNP"
FT   gene            complement(229589..230728)
FT                   /gene="hemX"
FT                   /locus_tag="EPYR_00208"
FT   CDS_pept        complement(229589..230728)
FT                   /transl_table=11
FT                   /gene="hemX"
FT                   /locus_tag="EPYR_00208"
FT                   /product="uroporphyrinogen III methylase"
FT                   /EC_number="2.1.1.107"
FT                   /note="putative uroporphyrinogen-III C-methyltransferase
FT                   (Urogen III methylase) (ORF X)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00208"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72500"
FT                   /db_xref="GOA:D2TCR2"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCR2"
FT                   /protein_id="CAY72500.1"
FT                   /translation="MTEHKASSAMVEETTPAVETSTNEPQPPPEARRSGMVPGVVAIAI
FT                   ALAVGAGLYMYGKHQAQRLTAANQTLAAQIAELQQQSISDKQSLVEKLTVQTSALDTAR
FT                   QQQSAMNQQLDELKRKVASISGSDAQTWMLAQADYLVKMAGRKLWSDRDVTSAAALLKS
FT                   ADASLADMNDPSLIGARRALAQDISTLSALSQVDYDGVILKLNQLSNGIDNLRLADNNS
FT                   DDEPMDADSGALSSSLREWRQNLVKSWHNFMDDFITIRRRDATAEPLLAPNQDVYLREN
FT                   IRSRLLIAAQAVPRHQDEIYKQSIDTVSAWIRAWYDTNDANTKAYLNQLDDLSEQSISM
FT                   DVPETLLSQPILDKLMQTRVRNLLAQPSAAVNTQPGQGD"
FT   gene            complement(230866..231615)
FT                   /gene="hemD"
FT                   /locus_tag="EPYR_00209"
FT   CDS_pept        complement(230866..231615)
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="EPYR_00209"
FT                   /product="uroporphyrinogen III synthase"
FT                   /function="Uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /note="Uroporphyrinogen-III synthase (UROS)
FT                   (Uroporphyrinogen-III cosynthetase) (Hydroxymethylbilane
FT                   hydrolyase [cyclizing]), Tetrapyrrole biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00209"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72501"
FT                   /db_xref="GOA:D2TCR3"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCR3"
FT                   /protein_id="CAY72501.1"
FT                   /translation="MSILVTRPSPAADELVSRLRQRGDVAWAFPLIEFAPGKQLDILPD
FT                   RLKALKAGDLVFILSQHVIHYARPTFTREDPPWPASLDYYAIGRSTGLAFHAASGHHVS
FT                   WPHEQETSEVLIQLPALQAVAGKRALILRGNGGRELLAETLLSRGAQVEFIECYQRRAK
FT                   HYHGAEEARRWRNQGIDTLVVTSGEMLQQLYSLFPDVDRDEWLLHCRLVVVSGRLATLA
FT                   RKLGWVNVDVAGGADNDALLRSLSLCP"
FT   gene            complement(231612..232553)
FT                   /gene="hemC"
FT                   /locus_tag="EPYR_00210"
FT   CDS_pept        complement(231612..232553)
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="EPYR_00210"
FT                   /function="Porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="Tetrapyrrole biosynthesis, hydroxymethylbilane
FT                   synthase, Porphobilinogen deaminase, dipyromethane cofactor
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00210"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72503"
FT                   /db_xref="GOA:D2TCR4"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCR4"
FT                   /protein_id="CAY72503.1"
FT                   /translation="MSDKILRIATRKSPLALWQAKYVQQRLIDCHPGLRVELVPMVTRG
FT                   DVILDTPLAKVGGKGLFVKELEQAMLSGSADIAVHSMKDVPVAFPQGLGLVAICERDDP
FT                   HDAFVSNRHASVDSLPQGAIVGTSSLRRQCQLSARRPDLVIHSLRGNVGTRLGKLDAGE
FT                   YDAIILAVAGLKRLGLSDRIRQVMPAEESLPAVGQGAVGIECRLEDMHTIGLLAALNHD
FT                   ETACRVSAERAMNTRLEGGCQVPIGSYALLEGDQLWLRGLVGSPDGSQMVRGERRGSRA
FT                   DAEKMGISLAEELLDNGARDILAAVYQGNPPA"
FT   gene            232739..235402
FT                   /gene="cyaA"
FT                   /locus_tag="EPYR_00211"
FT   CDS_pept        232739..235402
FT                   /transl_table=11
FT                   /gene="cyaA"
FT                   /locus_tag="EPYR_00211"
FT                   /function="Adenylate cyclase"
FT                   /EC_number="4.6.1.1"
FT                   /note="Adenylate cyclase (ATP pyrophosphate-lyase)
FT                   (Adenylyl cyclase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00211"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72504"
FT                   /db_xref="GOA:D2TCR5"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="InterPro:IPR024686"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCR5"
FT                   /protein_id="CAY72504.1"
FT                   /translation="MYHYFYSKRQISETELFYTRVGHQPGIGTGIIRRDVLYLYIETLK
FT                   QRLDAINQLRVDRALAAMGSAFQQVYSLLPTLLHYHHPLMPGYLEGNVPHGISFYTPDE
FT                   SQLSYLHGLEGQSGSDAAVPPHGEMPVTGVYSMGSTSSVGQNGTSDLDIWVCHQSWLDN
FT                   DERLSLQKKCILLQNWCVEMGVEVSFFLIDENRFRHNESGSLGGEDCGSTQHILLLDEF
FT                   YRTAVRMAGKRILWNMVPREEEEQYDDYVMSLYQRGVLTPNEWLDLGGLGTLSAEEYFG
FT                   ASLWQLYKSIDSPYKAVLKTLLLEAYSWEYPDTRLLAMDIKQRLHDGEIVSYGLDPYCM
FT                   MLERVTRYLIGIDDPARLDLVRRCFYLKVCEKLSLAAENSGWRREILSQLVQEWGWDKQ
FT                   RLAMLDSRAGWKIGQVREAHNELLDAMMQSYRNLIRFARRNNLSVSASPQDIGVLTRKL
FT                   YAAFEALPGKVTLLNPQISPDLSESDLTFIHVPNGRANRAGWYLYNQSPDMDSIISHQP
FT                   LEYNRYLNKLVAWAWFNGLLTSKTRLHIKGNESCDLARLQELVADVTHHFPVRLAAPTA
FT                   KALYSPCEIRHLAIIINLEVDPTAAFRNQVVHFDFRKLDVFSFGQQQQCLVGSVDLLYR
FT                   NSWNEVRTLHFNGEQSMIEALKTILGKMHQDASPPDSVDVFCYSQHLRGLIRTRVQQLV
FT                   SECVELRLSSTRQEPGRFKALRVAGQTWGLFFERLSVSVQKLENAVEFYGAISNNKLHG
FT                   LSLKVESDQARLPAVVNGYASEGIIQFFFEDTRNDHGFNIYILDETNRVEVYHHCEGSK
FT                   EELVRDVSRFYSSSHDRFTYGSSFINFNLPQFYQIVQVEERCEVIPFRSQAMTQLCATL
FT                   PESAAVEDSAQRYQMH"
FT   gene            235465..235707
FT                   /locus_tag="EPYR_00212"
FT   CDS_pept        235465..235707
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00212"
FT                   /product="Uncharacterized lipoprotein yifL precursor"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00212"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72505"
FT                   /db_xref="InterPro:IPR032831"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCR6"
FT                   /protein_id="CAY72505.1"
FT                   /translation="MIGGMYRLKMSRIRMKNRICQLALIMTAASLAGCGLKGPLYFPNH
FT                   EQAGPKTTQAAPSTQSGSNAQQSATAKEQSAQPIQ"
FT   gene            235735..236559
FT                   /gene="dapF"
FT                   /locus_tag="EPYR_00213"
FT   CDS_pept        235735..236559
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="EPYR_00213"
FT                   /function="Diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="Diaminopimelate epimerase (DAP epimerase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00213"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72506"
FT                   /db_xref="GOA:D2TCR7"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCR7"
FT                   /protein_id="CAY72506.1"
FT                   /translation="MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHLGIGFDQL
FT                   LIVEPPYDPDLDFHYRIFNADGSEVAQCGNGARCFARFVRLKGLTNKSEIRVSTQSGRM
FT                   ILSVTQDERVCVNMGEPNFEPQQIPFRANKAENIYLMRAVEQTVMCGVVSMGNPHCVLQ
FT                   VDNVKTAAVETLGPVLESHERFPERVNVGFMEVVHREHIRLRVYERGAGETQACGSGAC
FT                   AAVAVGIQQALLAEKVRVDLPGGSLNIAWKGPGHPLFMTGPATHVYDGFIHL"
FT   gene            236556..237266
FT                   /gene="yigA"
FT                   /locus_tag="EPYR_00214"
FT   CDS_pept        236556..237266
FT                   /transl_table=11
FT                   /gene="yigA"
FT                   /locus_tag="EPYR_00214"
FT                   /product="Uncharacterized protein yigA"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="Protein of unknown function DUF484, Protein of
FT                   unknown function, DUF484"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00214"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72507"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCR8"
FT                   /protein_id="CAY72507.1"
FT                   /translation="MKQVGEKAQDAETALLNDSIVSDFLRQNPDFFMRNARQVEQMLIP
FT                   HPVRGTVSLVEWQLKRQRHHIQQLEEEITLLMEQASANQQLFERLLALQGRLASASSLH
FT                   DMLNRLHRWAREFGLAGANIRLFSEKWRIGAPSDFTQLALSRQEFEPLRIQRLGKQNHY
FT                   LGSLNGPELLLLLPQAKAIGSVAVSLLGEEGDLGVLIFSSRDSQHYQAGMGTVLLQHLS
FT                   LMLPQLLSRWIERV"
FT   gene            237263..238171
FT                   /gene="xerC"
FT                   /locus_tag="EPYR_00215"
FT   CDS_pept        237263..238171
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="EPYR_00215"
FT                   /product="Tyrosine recombinase xerC"
FT                   /function="Site-specific recombinase XerC"
FT                   /note="Tyrosine recombinase XerC, Phage integrase
FT                   family,recomb_XerC: tyrosine recombinase XerC"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00215"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72508"
FT                   /db_xref="GOA:D2TCR9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCR9"
FT                   /protein_id="CAY72508.1"
FT                   /translation="MNSESPLLAGVEGFLRFLKVERQLSPLTQIGYRRQLSAIIVLLDE
FT                   LKVVEWARLDAALVRALAARSTRSGLKPASLALRLSALRSFLDWLVSQGAIKANPAKGV
FT                   ATPRAARHLPKNIDVDEVNRLLDIDLNDPLAVRDRAMLEVMYGAGLRLSELVGIDLGHL
FT                   DLASGEVWVVGKGSKERRLPMGRTAVHWIENWLEMRELFEPQDNALFLSNKGKRISTRN
FT                   VQKRFAEWGVKQGMSSHIHPHKLRHSFATHLLESSGDLRAVQELLGHANLTTTQIYTHL
FT                   DFQHLASVYDAAHPRAKRGKS"
FT   gene            238171..238887
FT                   /gene="yigB"
FT                   /locus_tag="EPYR_00216"
FT   CDS_pept        238171..238887
FT                   /transl_table=11
FT                   /gene="yigB"
FT                   /locus_tag="EPYR_00216"
FT                   /product="Uncharacterized HAD-hydrolase MTH_209"
FT                   /function="Predicted hydrolase (HAD superfamily)"
FT                   /EC_number="3.-.-.-"
FT                   /note="Uncharacterized HAD-hydrolase MTH_209 ), Haloacid
FT                   dehalogenase-like hydrolase, haloacid dehalogenase-like
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00216"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72509"
FT                   /db_xref="GOA:D2TCS0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCS0"
FT                   /protein_id="CAY72509.1"
FT                   /translation="MHFYRSLRPIAAMTFDLDDTLYDNHPVIRRTTQASHAALQAHHPA
FT                   LQGFSVQQYQQVRERLLAAEPEIYHDVSEWRRRAVEQSMLDVGIPAAQAVSGARDVMDV
FT                   FAYWRSQIDVPAETHSTLAALAARIPLVAITNGNAEPHLCGLDKYFQFILRAGPDGRAK
FT                   PYQDMYHRAAERLKLRPEQILHIGDDLTTDVAGAVRSGMQACWINLHEGNLMHIDDSRL
FT                   LPTLEISRLASLTALI"
FT   gene            238936..241107
FT                   /gene="uvrD"
FT                   /locus_tag="EPYR_00217"
FT   CDS_pept        238936..241107
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="EPYR_00217"
FT                   /product="DNA helicase II"
FT                   /function="Superfamily I DNA and RNA helicases"
FT                   /EC_number="3.6.1.-"
FT                   /note="DNA helicase, ATP-dependent, UvrD type"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00217"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72510"
FT                   /db_xref="GOA:D2TCS1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005753"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCS1"
FT                   /protein_id="CAY72510.1"
FT                   /translation="MVPMDVSDLLDSLNDKQREAVAAPRSNLLVLAGAGSGKTRVLVHR
FT                   IAWLMGVENCSPHSIMAVTFTNKAAAEMRHRIEQLIGTSQGGMWIGTFHGLAHRLLRAH
FT                   HLDANLPQDFQILDSEDQLRLLKRLIKAMNLDEKQWPARQGMWYINGKKDEGLRLKHIE
FT                   SYGNPIEQTWLRIYQAYQEACDRAGLVDFAELLLRAHELWLNKPHILNHYRERFTNILV
FT                   DEFQDTNNIQYAWIRMLAGDTGKVIIVGDDDQSIYGWRGAQVENIQRFLQDFPAAETIR
FT                   LEQNYRSTNNILKAANTLIANNNGRLGKELWTEDSDGEPIAIYCAFNELDEARFVVNRI
FT                   KVWMEKGGALNDCAILYRSNAQSRVLEEALLQTSMPYRIYGGMRFFERQEIKDSLAYLR
FT                   LISNRNDDAAFERVVNTPTRGIGDRTLDVVRQTARERQLTLWQTARALLQEKALAGRAA
FT                   SALQRFTELVDSLAHETSDMPLHVQTDRVIKDSGLWLMYEQEKGEKGQARIENLEELVN
FT                   ATRQYSYQDEDEDLMPLQAFLSHAALEAGEGQADKWQDAVQLMTMHAAKGLEFMQVFIV
FT                   GMEEGMFPSQMSLEEGGRLEEERRLAYVGVTRAMQKLTLTYAETRRLYGKEVYHRPSRF
FT                   IGELPVECVEEVRLRASISRPVSHQRMGAPVAKNDSGFTLGQRVHHAKFGEGTIVNLEG
FT                   SGEHSRLQVAFQGQGIKWLVAAYAKLEAM"
FT   gene            241408..242367
FT                   /gene="pldA"
FT                   /locus_tag="EPYR_00218"
FT   CDS_pept        241408..242367
FT                   /transl_table=11
FT                   /gene="pldA"
FT                   /locus_tag="EPYR_00218"
FT                   /function="Outer membrane phospholipase A"
FT                   /EC_number="3.1.1.32"
FT                   /note="Phospholipase A1 precursor (Detergent-resistant
FT                   phospholipase A) (DR-phospholipase A) (Phosphatidylcholine
FT                   1-acylhydrolase) (OM PLA) (OMPLA)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00218"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72511"
FT                   /db_xref="GOA:D2TCS2"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCS2"
FT                   /protein_id="CAY72511.1"
FT                   /translation="MLSAFKLEKNRLTRLELDDTDARDDLSESVWVDLIEPEEAERARV
FT                   QDELGQVLATSPELEDIEASARFFEDEDGLHIHSFFFYEDAEDHAGNSTVAFTIREGRL
FT                   YTLRERELPAFRLYRMRARSQTLIDGNAYELLLDLFETKIEQLADEIETVYSDLEKLSR
FT                   VIMEGKQGDEFDDALSTLAGQEDVGWKVRLCLMDTQRALNFLVRKARLPGNQLEQAREV
FT                   LRDIESLLPHNESLFQKVNFLMQAAMGFINIEQSRIIKIFSVVSVVFLPPTLVASSYGM
FT                   NFEFMPELKWSLGYPGAIVLMILAGLAPYAYFKRKNWL"
FT   gene            complement(242387..242857)
FT                   /gene="yigI"
FT                   /locus_tag="EPYR_00219"
FT   CDS_pept        complement(242387..242857)
FT                   /transl_table=11
FT                   /gene="yigI"
FT                   /locus_tag="EPYR_00219"
FT                   /product="Uncharacterized protein yigI"
FT                   /function="Uncharacterized protein, possibly involved in
FT                   aromatic compounds catabolism"
FT                   /note="Phenylacetic acid degradation-related
FT                   protein,Thioesterase superfamily, unchar_dom_1:
FT                   uncharacterized domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00219"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72512"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCS3"
FT                   /protein_id="CAY72512.1"
FT                   /translation="MSALTLEPAAVRRLISKIFVYDMPFNRALGLELERLESDFAQLSL
FT                   VNRPRLVGNAAQAILHGGVIASVLDVAAGLVCVSGALTRVQAIDEDELRQRMSRMGTID
FT                   LRVDYLRPGRGERFIASSSLLRGGNKISVARVELHNDAGVHIASASATYLVG"
FT   gene            243030..243908
FT                   /gene="pldA"
FT                   /locus_tag="EPYR_00220"
FT   CDS_pept        243030..243908
FT                   /transl_table=11
FT                   /gene="pldA"
FT                   /locus_tag="EPYR_00220"
FT                   /function="Outer membrane phospholipase A"
FT                   /EC_number="3.1.1.32"
FT                   /note="Phospholipase A1 precursor (Detergent-resistant
FT                   phospholipase A) (DR-phospholipase A) (Phosphatidylcholine
FT                   1-acylhydrolase) (OM PLA) (OMPLA),Phospholipase A1,
FT                   Phospholipase A1"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00220"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72513"
FT                   /db_xref="GOA:D2TCS4"
FT                   /db_xref="InterPro:IPR003187"
FT                   /db_xref="InterPro:IPR036541"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCS4"
FT                   /protein_id="CAY72513.1"
FT                   /translation="MALPKGLSATALLLPTLVMAQEASIKEVHDNTAVPGSIIANLLEK
FT                   HDNPFVMYPYESNYLLYTDTSNLNKEAIRSYSWSDKAKHDEVKFQLSLAFPLWRGIAGD
FT                   SSVLAASYTQKSWWQLSNRGASSPFRESDYEPQIFLGWATDYRFAGWTLRDVETGFNHQ
FT                   SNGRSEPTSRSWNRVYARLMAENGNWLVEVKPWYRLPESENNDDNPDITKYMGYYRLTV
FT                   GYQWGDSIFSLKGNYNWNSGYGGAELGWSYPLTEHVRFYTQVFSGYGESLIDYNLRQTR
FT                   VGVGVTLNDLF"
FT   gene            243971..245803
FT                   /gene="recQ"
FT                   /locus_tag="EPYR_00221"
FT   CDS_pept        243971..245803
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /locus_tag="EPYR_00221"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /function="Superfamily II DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00221"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72514"
FT                   /db_xref="GOA:D2TCS5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCS5"
FT                   /protein_id="CAY72514.1"
FT                   /translation="MSTAAVINNEALAGQVLRDTFGYQQFRPGQQTIIQESLNGRDCLV
FT                   VMPTGGGKSLCYQIPALVRQGLTLVVSPLISLMKDQVDQLLANGVAAACLNSTQNREEQ
FT                   QNVMAGCRSGTVRLLYIAPERLMMDNFLEQLTHCNPAMLAVDEAHCISQWGHDFRPEYG
FT                   ALGQLRQRLPDVPVMALTATADETTRNDIARLLQLNDPLIQISSFDRPNIRYTLVEKFK
FT                   PTEQLLRYVQDQRGKCGIIYCNSRAKVEDTAARLQSRGLSVGAYHAGMDNAHRAHVQEA
FT                   FQRDDLQIVVATVAFGMGINKPNVRFVVHFDIPRNIESYYQETGRAGRDGLPAEALLLY
FT                   DPADMAWLRRCLEEKTQGPLQDIERHKLNAMGAFAEAQTCRRLVLLNYFGEGRQQACDN
FT                   CDICLDPPRRYDGLLEAQKALSCIYRVGQRFGMGYIVEILRGANNQRIRDMQHDKLPVY
FT                   GIGRDLSHEHWTSVLRQLIHLGLVTQNIAMYSALQLTEAARPVLRGDVSLLLAVPRLVS
FT                   VKTRSSSQKSFGGNYDRKLFAKLRKLRKAIADEDNLPPYVVFNDATLIEMAEQMPITAS
FT                   EMLSVNGVGHKKLERFGKPFLLMIKEHIDGGDEE"
FT   gene            complement(245862..246485)
FT                   /gene="rhtB"
FT                   /locus_tag="EPYR_00222"
FT   CDS_pept        complement(245862..246485)
FT                   /transl_table=11
FT                   /gene="rhtB"
FT                   /locus_tag="EPYR_00222"
FT                   /product="putative RhtB family transporter"
FT                   /function="Putative threonine efflux protein"
FT                   /note="Homoserine/homoserine
FT                   lactone/β-hydroxynorvaline efflux permease, TC
FT                   2.A.76.-.-The Resistance to Homoserine/Threonine Family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00222"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72515"
FT                   /db_xref="GOA:D2TCS6"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCS6"
FT                   /protein_id="CAY72515.1"
FT                   /translation="MTTEWWLAYLLTTLILSLSPGSGAINTMSTGISHGYRGAVASIAG
FT                   LQVGLSLHIVLVGIGLGALFSQSLLAFEILKWAGAAYLVWLGIQQWRSAGAIDLNALAA
FT                   AMPRRQLFKRAVMVNLTNPKSIVFLAALFPQFILPHQPQAMQYLVLGVTTVVVDIIVMM
FT                   GYATLARRISAWIKGPHQMRLLNRIFGGLFMAVGALLASARRIA"
FT   gene            246597..247589
FT                   /gene="pldB"
FT                   /locus_tag="EPYR_00223"
FT   CDS_pept        246597..247589
FT                   /transl_table=11
FT                   /gene="pldB"
FT                   /locus_tag="EPYR_00223"
FT                   /product="lysophospholipase L(2)"
FT                   /function="Lysophospholipase"
FT                   /EC_number="3.1.1.5"
FT                   /note="Alpha/beta hydrolase fold-1, alpha/beta hydrolase
FT                   fold"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00223"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72516"
FT                   /db_xref="GOA:D2TCS7"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCS7"
FT                   /protein_id="CAY72516.1"
FT                   /translation="MELHQKSWLTREKAFAAFATGPLLDFWKQREEGEFAGVADVPIRY
FT                   VRFISPQHDKVILLCPGRIESYVKYPELAYDLFHSGYDIFIIDHRGQGRSGRLLKDSHR
FT                   GHVVAFEDYVDDLETLFLQQIVTRDYRHRYALAHSMGGAILALMLVRQPAAFAAVALAS
FT                   PMFGLFLPMPLWMARRILNWAEKRPTVRDDYALGTGKWRARPFAVNDLTHSRERYRRNV
FT                   RFYADDPGIRVGGPTYHWVREGVRAGQSVLRQAEQIATPLLLLQAADDKVVDNRAQDLF
FT                   CQTMLAAGRPCEGGKPMIIEGAHHEILFEKDRMRAVALEAVLAFFARHA"
FT   gene            247650..248450
FT                   /gene="yigL"
FT                   /locus_tag="EPYR_00224"
FT   CDS_pept        247650..248450
FT                   /transl_table=11
FT                   /gene="yigL"
FT                   /locus_tag="EPYR_00224"
FT                   /product="putative hydrolase M6_Spy0533"
FT                   /function="Predicted hydrolases of the HAD superfamily"
FT                   /EC_number="3.-.-.-"
FT                   /note="Cof protein, haloacid dehalogenase-like
FT                   hydrolase,Cof-subfamily: Cof-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00224"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72517"
FT                   /db_xref="GOA:D2TCS8"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCS8"
FT                   /protein_id="CAY72517.1"
FT                   /translation="MYRIVASDLDGTLLLPNHTLSPYARETLQLLTAKGFHFIFATGRH
FT                   YIDVAQMRDSLGIDAWMITSNGARVHNTAGERVFSHNLDEDIAHELFTMQHHHADIYTN
FT                   VYRDEEWFLNRHRPDEMDFFQESDFAYQIYQPGQLAADGISKVFFTCAIPELLMPLEQA
FT                   LLARWGDRVNVSFSLPTCLEVMAGGVSKGHALDAVAKSLGYSLRECIAFGDGMNDKEML
FT                   SMAGKGYIMSNAHQRLKDVLPELEVIGSNGEQAVPHTLRRLFDV"
FT   gene            complement(248549..249895)
FT                   /gene="glpT"
FT                   /locus_tag="EPYR_00225"
FT   CDS_pept        complement(248549..249895)
FT                   /transl_table=11
FT                   /gene="glpT"
FT                   /locus_tag="EPYR_00225"
FT                   /product="Glycerol-3-phosphate transporter"
FT                   /function="Sugar phosphate permease"
FT                   /note="Glycerol-3-phosphate transporter (G-3-P transporter)
FT                   (G-3-P permease), Major Facilitator Superfamily, TC
FT                   2.A.1.4.3 Glycerol-3-phosphate transporter (G-3-P
FT                   transporter) (G-3-P permease)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00225"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72518"
FT                   /db_xref="GOA:D2TCS9"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCS9"
FT                   /protein_id="CAY72518.1"
FT                   /translation="MLSIFKPAAHQPRVDGSRVDPLYRKLRWQIFLGIFFGYAAYYLVR
FT                   KNFALAMPYLIEQGFSRGDLGFALSGISVAYGFSKFIMGSVSDRSNPRVFLPAGLILAA
FT                   VVMLFMGFVPWATSSIMVMFVMLFLCGWFQGMGWPPCGRTMVHWWSQKERGRIVSVWNC
FT                   AHNVGGGIPPLLFLLGMAWFNDWKAALYMPAFGAIVVAIFAFALMRDTPQSCGLPPIEE
FT                   YKNDYPPDYDEKHEEELTAKQIFKQYILPNKLLWYIALANVFIYLLRYGILDWSPTYLK
FT                   EVKHFTLDKSSWAYFFYEYAGIPGTLLCGWMSDKVFKSNRGATGVFFMVLVTIATVVYW
FT                   MNPAGNPGVDMACMMIIGFLIYGPVMLIGLHALELAPKKAAGTAAGFTGLFGYLGGSVA
FT                   ASAIVGYTVDGFGWNGGFIIMVGGCVLAVILLILTMLSEKKHKEHLRAI"
FT   gene            complement(250266..250787)
FT                   /locus_tag="EPYR_00226"
FT   CDS_pept        complement(250266..250787)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00226"
FT                   /product="Uncharacterized protein yehS"
FT                   /note="Protein of unknown function DUF1456, Protein of
FT                   unknown function (DUF1456)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00226"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72519"
FT                   /db_xref="InterPro:IPR009921"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCT0"
FT                   /protein_id="CAY72519.1"
FT                   /translation="MKGYTARTATVSLKRVFMTNNDVLRSVRYMLNLSDAKVVSILALA
FT                   ESEVTEAEVHSFLKKEDEPDYRPCPDVIMGYFLNGLIFERRGRSEDAPAPSIERKMTNN
FT                   IMMKKLRVAFNLKTTDIIELLKSADFAVGQSEIGAIFRKPGHKNYRECGDQILRNFLKG
FT                   LTMKIRPAKK"
FT   gene            complement(250840..251778)
FT                   /gene="metR"
FT                   /locus_tag="EPYR_00227"
FT   CDS_pept        complement(250840..251778)
FT                   /transl_table=11
FT                   /gene="metR"
FT                   /locus_tag="EPYR_00227"
FT                   /product="HTH-type transcriptional regulator metR"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00227"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72520"
FT                   /db_xref="GOA:D2TCT1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037406"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCT1"
FT                   /protein_id="CAY72520.1"
FT                   /translation="MIELKHLRTLQALQNTGSLAAAAAQLHQTQSALSHQFSDLEQRLG
FT                   FRLFVRKSQPLRLTPQGEVLLQLAEQVLPQIQQALQACHEPHQTTLRLAIECHSCIQWL
FT                   TPALNEFRQSWPQVVMDFKSGVTFDPQPALQQGELDVVLTSDILPRSGLFYSPMFDFEV
FT                   RLVLAPDHPLAQKATISPEDLASEVLMIYPVQRQRLDIWRHFLQPAGVSPALKSVDNTL
FT                   LLIQMVSAGMGIAALPHWVVESFEHQGLVVTKALGDGLWSRLYAAVRDGEQRQPVIEAF
FT                   TRSARQHACDNLPRVRNASRPGTPLPSDHRV"
FT   gene            251929..254202
FT                   /gene="metE"
FT                   /locus_tag="EPYR_00228"
FT   CDS_pept        251929..254202
FT                   /transl_table=11
FT                   /gene="metE"
FT                   /locus_tag="EPYR_00228"
FT                   /product="5-methyltetrahydropteroyltriglutamate-homocysteine
FT                   methyltransferase"
FT                   /function="Methionine synthase II (cobalamin-independent)"
FT                   /EC_number="2.1.1.14"
FT                   /note="5-methyltetrahydropteroyltriglutamate-homocysteine
FT                   methyltransferase (Methionine synthase, vitamin-B12
FT                   independent isozyme) (Cobalamin-independent methionine
FT                   synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00228"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72521"
FT                   /db_xref="GOA:D2TCT2"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCT2"
FT                   /protein_id="CAY72521.1"
FT                   /translation="MTILNHTLGFPRVGLQRELKKAQESYWAGNSTQEELLAVGRELRA
FT                   RHWQQQQGAGVNLLPVGDFAWYDHVLTTSLLLGNVPARHQNKDGSVDLDTLFRLGRGRA
FT                   PSGEPAAAAEMTKWFNTNYHYMVPEFVQGQQFKLTWTQLLDEVDEALALGHKVKPVLLG
FT                   PVTYLWLGKVKGDQFDRLSLLQDILPVYQQVLAELAKRDIEWVQIDEPALALELPAEWL
FT                   AAFKPAYDALQGETKLLLTTYFDSIGQNLDTISALPVQGLHVDLVHGKDDISLLNGKVP
FT                   ADWLLSVGVINGRNVWRADLSSWFERLQPLVAQRKQLWIGSSCSLLHSPIDLSVETRLD
FT                   EEVKSWFAFALQKCSELALLSNALNNNDPASLEAWSAPVRARQHSTRVHNAAVGQRLAA
FT                   ISPQDSLRKNSYQVRAEAQRQRFQLPAWPTTTIGSFPQTTEIRGLRLDFKQGRLDGTRY
FT                   RTGIAEHIKQAIVEQERLGLDVLVHGEAERNDMVEYFGEHLDGFIFTQNGWVQSYGSRC
FT                   VKPPVIIGDVSRPEAITVEWAKYAQSLTDKPVKGMLTGPVTILCWSFPREDVSRETIAK
FT                   QIALALRDEVEDLEKAGIGIIQIDEPALREGLPLHQSDWAAYLEWAVDAFRLNAAVAQD
FT                   DTQIHTHMCYCEFNDIMDSIAALDADVITIETSRSDMELLESFEEFEYPNEIGPGVYDI
FT                   HSPNVPSVEWMEELLLKAAQRIPTERLWVNPDCGLKTRGWTETRQALANMVKAAQNLRN
FT                   AQEA"
FT   gene            complement(254262..255098)
FT                   /gene="dlhH"
FT                   /locus_tag="EPYR_00229"
FT   CDS_pept        complement(254262..255098)
FT                   /transl_table=11
FT                   /gene="dlhH"
FT                   /locus_tag="EPYR_00229"
FT                   /product="putative dienelactone hydrolase family"
FT                   /function="Dienelactone hydrolase and related enzymes"
FT                   /EC_number="3.1.1.45"
FT                   /note="putative carboxymethylenebutenolidase (Dienelactone
FT                   hydrolase) (DLH), Dienelactone hydrolase,Dienelactone
FT                   hydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00229"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72522"
FT                   /db_xref="GOA:D2TCT3"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCT3"
FT                   /protein_id="CAY72522.1"
FT                   /translation="MKTEDNMTQKLSNKGFAPAVVPAAASTIITDSADILSGETSIPTQ
FT                   GENMPAFHAKPRHAHGPLPVVLVVQEIFGVHEHIRDICRRLALEGYLAVAPELYFRQGD
FT                   PADYTDIPTLFKELVSKIPDSQVLADLDHVANWASRHGGDIRRLAVTGFCWGGRITWLY
FT                   AAHNPQLKAAVAWYGKLVGDKTMKQPKQPVDVAVDLDAPVLGLYGGKDDGIPPDSVETM
FT                   RHALRAANANAEIIVYPDAGHAFNADYRPSYEAGSAKDGWQRMLAWFRQYGVTSEA"
FT   gene            255387..256151
FT                   /gene="udp"
FT                   /locus_tag="EPYR_00230"
FT   CDS_pept        255387..256151
FT                   /transl_table=11
FT                   /gene="udp"
FT                   /locus_tag="EPYR_00230"
FT                   /function="Uridine phosphorylase"
FT                   /EC_number="2.4.2.3"
FT                   /note="Purine nucleoside phosphorylase deoD-type (PNP)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00230"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72523"
FT                   /db_xref="GOA:D2TCT4"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010058"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCT4"
FT                   /protein_id="CAY72523.1"
FT                   /translation="MPQSDVFHLGLTKADLQGATLAIAPGDPERVKKIAALMDNPVHLA
FT                   SHREFTSWRAEIAGKAVIVCSTGIGGPSTSIAVEELAQLGVRTFLRVGTTGAIQPHINV
FT                   GDVLVTTGSVRLDGASLHFAPLEFPAVADFTCTTALVDAAKAQGARTHIGITASSDTFY
FT                   PGQERYDTFSGRVVSRFQNSMQEWQQMGVLNYEMESATLLTMCASQGLRAGMVAGVIVN
FT                   RTQQEIPDAETMKRTESDAVKIVVEAARRLLE"
FT   gene            256326..257861
FT                   /gene="yigN"
FT                   /locus_tag="EPYR_00231"
FT   CDS_pept        256326..257861
FT                   /transl_table=11
FT                   /gene="yigN"
FT                   /locus_tag="EPYR_00231"
FT                   /product="DNA recombination protein rmuC homolog"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="RmuC, RmuC family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00231"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72524"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCT5"
FT                   /protein_id="CAY72524.1"
FT                   /translation="MDVTIMYGAGFALAGILAGWLLASLRCQQQLAKGETERQLLMQSA
FT                   EQAQHERQRLQQQLDGHLLMQKQNEHEQRQLHGSLAAAEEKLHHLEHWRSETEQLTREL
FT                   RTQLEINSAQEAELREVTIRLEETRMAAEEKQRLLVNSEQRLNAQFENLANRIFENSGR
FT                   RVDEQNRQSLHGLITPLREQLEGFRRQVQDGFGQEARERHTLAHEIRNLQQLNARMAQE
FT                   AINLTKALKGDNKTQGNWGEVVLSRVLEASGLREGHEYETQVNIQLEQNGRMQPDVIVR
FT                   LPQGKDVVIDAKMTLVAYERYFNGEDEAQREAAVSEHIAAIRGHLRQLSRKDYQQLPGL
FT                   RSLDYVLMFIPVEPAFLLAIDRQPELINEALNQNIMLVSPTTLLVALRTINNLWRYEHQ
FT                   SRHAQRIADRAARLYDKMRLFVDDMSAIGQSLDKAQDSYRQAMKKLSEGRGNLIAQSEG
FT                   FRQLGVEIKRPINPRLVEQALPEEAEEAQDNAREQGPENIDYASRSMSHGINE"
FT   gene            257936..258691
FT                   /gene="ubiE"
FT                   /locus_tag="EPYR_00232"
FT   CDS_pept        257936..258691
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="EPYR_00232"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /function="Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /EC_number="2.1.1.-"
FT                   /note="Ubiquinone/menaquinone biosynthesis
FT                   methyltransferase ubiE, ubiE/COQ5 methyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00232"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72525"
FT                   /db_xref="GOA:D2TCT6"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCT6"
FT                   /protein_id="CAY72525.1"
FT                   /translation="MADESKDTTHFGYSTVAKDEKAGMVADVFHSVAAKYDLMNDLMSL
FT                   GIHRIWKRFTIDCSGVRRGQRVLDLAGGTGDLTAKFSRLVGETGEVVLADINSSMLKVG
FT                   REKLRNKGIIGNVNYVQANAEALPFPDNYFDCITIAFGLRNVTDKDKALASMFRVLKPG
FT                   GRLLVLEFSKPQFEPLNKAYDAYSFHILPRIGEIVAKDAGSYRYLAESIRMHPCQETLK
FT                   QMMMDVGFENTTYHNLTGGIVALHRGFKF"
FT   gene            258704..259309
FT                   /gene="yigP"
FT                   /locus_tag="EPYR_00233"
FT   CDS_pept        258704..259309
FT                   /transl_table=11
FT                   /gene="yigP"
FT                   /locus_tag="EPYR_00233"
FT                   /product="Uncharacterized protein yigP"
FT                   /note="Protein of unknown function DUF1243, SCP-2 sterol
FT                   transfer family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00233"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72526"
FT                   /db_xref="GOA:D2TCT7"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCT7"
FT                   /protein_id="CAY72526.1"
FT                   /translation="MTLMPLLTASLETALNRVLYRDRGLKLARQRLNGRSLAIVLAELK
FT                   QPVTFIFSEQQVDVIGHWSDIPDCTVKTRLATLPKLRDRQQLTTLIRSGELEVEGDLQL
FT                   VQQFSALLDLAELDPAEYLSPWVGDIAAQGMTRFFLRGFHAVRRDVQRKQGYLAQTLTE
FT                   EWRLAPGPLELAWFAEEVDALSRSLNALDARINRLEKK"
FT   gene            259306..260943
FT                   /gene="aarF"
FT                   /locus_tag="EPYR_00234"
FT   CDS_pept        259306..260943
FT                   /transl_table=11
FT                   /gene="aarF"
FT                   /locus_tag="EPYR_00234"
FT                   /product="probable ubiquinone biosynthesis protein ubiB"
FT                   /function="Predicted unusual protein kinase"
FT                   /note="2-polyprenylphenol 6-hydroxylase, ABC1 family,UbiB:
FT                   2-polyprenylphenol 6-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00234"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72527"
FT                   /db_xref="GOA:D2TCT8"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCT8"
FT                   /protein_id="CAY72527.1"
FT                   /translation="MTFGELRRLYLIIRVFLSYGLDELIPKTRLALPLLLWRKCLFWMP
FT                   NIHKDQPLGARLRLALEQLGPVWIKFGQMMSTRRDLFPPHIADQLAMLQDRVPPFDGAQ
FT                   ALKLIEQSLGAPVESQFDNFNIVPLASASIAQVHTATLKENGREVVIKVIRPDILPVIK
FT                   ADMKLIYRLARWVPRLLPDGRRLRPQEVVADYEKTLLDELNLLREAANAIQLRRNFDQS
FT                   RMLYVPEIFSDYCSENMLVMERIYGIPISDVATLEQHGVNLKLLAERGVQVFFTQVFRD
FT                   SFFHADMHPGNIFVSYEHPEDPQYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVA
FT                   ELHVDSGWVPADTNVEDFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQP
FT                   QLVLLQKTLLYVEGVGRQLYPQLDLWKTAKPFLENWIKDQIGIPAIVRALKEKAPFWAE
FT                   KLPELPELFYDSLRQHKHLQHSVDRLTTDLKGERVRQHQSQYLFGIGATLLLSGTAVLL
FT                   SRPAWDMLSAALMAAGFVSWLVGWRRTS"
FT   gene            261063..261320
FT                   /gene="tatA"
FT                   /locus_tag="EPYR_00235"
FT   CDS_pept        261063..261320
FT                   /transl_table=11
FT                   /gene="tatA"
FT                   /locus_tag="EPYR_00235"
FT                   /product="Sec-independent protein translocase protein tatA
FT                   homolog"
FT                   /note="tatA: twin arginine-targeting protein
FT                   translocase,TatA/E family, TC 2.A.64.1.1 Sec-independent
FT                   protein translocase protein tatA"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00235"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72528"
FT                   /db_xref="GOA:D2TCT9"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCT9"
FT                   /protein_id="CAY72528.1"
FT                   /translation="MGGITLPHLLIIAVLVVLLFGTKKLRSLGSDLGSSIKGFKKAMSD
FT                   EDDKEKEKEKANAEDADFNAKLADKQHTEVKKEDVKNDKV"
FT   gene            261324..261863
FT                   /gene="tatB"
FT                   /locus_tag="EPYR_00236"
FT   CDS_pept        261324..261863
FT                   /transl_table=11
FT                   /gene="tatB"
FT                   /locus_tag="EPYR_00236"
FT                   /product="Sec-independent protein translocase protein tatB"
FT                   /function="Sec-independent protein secretion pathway
FT                   components"
FT                   /note="Twin-arginine translocation protein TatB, TC
FT                   2.A.64.1.1 Sec-independent protein translocase protein
FT                   tatB"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00236"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72529"
FT                   /db_xref="GOA:D2TCU0"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCU0"
FT                   /protein_id="CAY72529.1"
FT                   /translation="MFDIGFSELVLVFIIGLVVLGPQRLPVAVRTVMGWIRALRSLATS
FT                   VQNELAQELKFQELQDGLKKIEQVSKDNLSPELKASVEELKQTANSMKRSYLSENEKAD
FT                   DEAHTIRNPLQKDAQEAHDGVTPAQADLQADAPAQAPVTVTQKASSEPQPDIKQEPPAP
FT                   VAPRASVTSTPPSDER"
FT   gene            261866..262627
FT                   /gene="tatC"
FT                   /locus_tag="EPYR_00237"
FT   CDS_pept        261866..262627
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="EPYR_00237"
FT                   /product="Sec-independent protein translocase protein tatC"
FT                   /function="Sec-independent protein secretion pathway
FT                   component TatC"
FT                   /note="Sec-independent protein translocase protein, TC
FT                   2.A.64.1.1 Sec-independent protein translocase protein
FT                   tatC"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00237"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72530"
FT                   /db_xref="GOA:D2TCU1"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCU1"
FT                   /protein_id="CAY72530.1"
FT                   /translation="MAVEDTQPLISHLIELRKRLLHCIIAVLAIFLCLAYFSNDIYQLV
FT                   SAPLIKQMPAGASMIATDVASPFFTPIKLTIIVSLFLAVPVILYQVWAFVAPALYRHER
FT                   KLVMPLLFSSSFLFYLGMAFAYFIVFPLAFGFFAKTAPQGVQIATDINNYLDFVMTLFM
FT                   AFGVSFEVPIAIVLLCWTGVTTPEDLKAKRPYVLVGAFVVGMLLTPPDIFSQTLLAIPM
FT                   YCLFEVGVFVSRFYVGKHRRDEEQDDESEQG"
FT   gene            262691..263482
FT                   /gene="tatD"
FT                   /locus_tag="EPYR_00238"
FT   CDS_pept        262691..263482
FT                   /transl_table=11
FT                   /gene="tatD"
FT                   /locus_tag="EPYR_00238"
FT                   /product="cytoplasmic Dnase"
FT                   /function="Mg-dependent DNase"
FT                   /EC_number="3.1.21.-"
FT                   /note="Deoxyribonuclease, TatD Mg-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00238"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72531"
FT                   /db_xref="GOA:D2TCU2"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR024918"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCU2"
FT                   /protein_id="CAY72531.1"
FT                   /translation="MEGIMFDIGVNLTSTQFAKDRDKVVKRAREAGVSGMLITGTNALE
FT                   SQQALSLARQHADYCWSTAGVHPHHASEWSAETAATLRRLSESPHVVAIGECGLDFNRN
FT                   FSEPEQQAWAFNAQLALAAELSMPVFLHCREAHERFISILKPWLPRLKAAVLHCFTGTR
FT                   AELESCLAEGLSIGITGWICDERRGQELRELVPLIPVDRLLLETDAPWLLPRDMRPRPP
FT                   SRRNEPCFLPHIVQQVALLRGDDVDELAAQTALNARTLFSL"
FT   gene            complement(263511..264011)
FT                   /gene="rfaH"
FT                   /locus_tag="EPYR_00239"
FT   CDS_pept        complement(263511..264011)
FT                   /transl_table=11
FT                   /gene="rfaH"
FT                   /locus_tag="EPYR_00239"
FT                   /product="Transcriptional activator RfaH"
FT                   /function="Transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00239"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72532"
FT                   /db_xref="GOA:D2TCU3"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR010215"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCU3"
FT                   /protein_id="CAY72532.1"
FT                   /translation="MESWYLLYCKRGQLLRAQEHLERQAVHCLSPMVALEKIVRGKPTQ
FT                   VSEPLFPNYLFVEFDPESIHTTTISATRGVSHFVRFGNQPATVPQGVINALQVGPALPL
FT                   DDGELPQPGDTVMITEGAFEGLKAIFTEPDGEARSMLLLNLLNKQVVRSIANQQFRCCK
FT                   PAP"
FT   gene            264260..265744
FT                   /gene="ubiD"
FT                   /locus_tag="EPYR_00240"
FT   CDS_pept        264260..265744
FT                   /transl_table=11
FT                   /gene="ubiD"
FT                   /locus_tag="EPYR_00240"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase
FT                   UbiD"
FT                   /function="3-polyprenyl-4-hydroxybenzoate decarboxylase and
FT                   related decarboxylases"
FT                   /EC_number="4.1.1.-"
FT                   /note="3-octaprenyl-4-hydroxybenzoate carboxy-lyase
FT                   (Polyprenyl p-hydroxybenzoate decarboxylase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00240"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72533"
FT                   /db_xref="GOA:D2TCU4"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCU4"
FT                   /protein_id="CAY72533.1"
FT                   /translation="MKYHDLRDFISLLEQRGELKRIKQQIDPDLEMTEIADRTLRAGGP
FT                   ALLFENPKGYSMPVLCNLFGTPDRVAMGMGQEDVKALRDVGRLLAFLKEPEPPRGFRDF
FT                   FDKIPQWKQVLNMPTKRLRNAPCQQQIWQGDDVDLSRIPVMKCWPGDAAPLVTWGLTVT
FT                   RGPQKERQNLGIYRQQVIGKNKLIMRWLSHRGGALDYQEWCQQHPGERFPVSVALGADP
FT                   ATILGAVTPVPDTLSEYAFAGLLRGTKTEVVKCVSNDLEVPASAEIVLEGYIDPGEMAP
FT                   EGPYGDHTGYYNEVDDFPVFTLTHITQRRDAIYHSTYTGRPPDEPAVLGVALNEVFVPI
FT                   LQKQFPEIVDFYLPPEGCSYRLAVVTIKKQYAGHAKRVMMGVWSFLRQFMYTKFVIVCD
FT                   DDVNARDWNDVIWAITTRMDPARDTVLVENTPIDYLDFASPVSGLGSKMGMDATNKWPG
FT                   ETQREWGTPIRKDPAVVARIDAIWDELGILSDTPAR"
FT   gene            265789..266490
FT                   /gene="ubiB"
FT                   /locus_tag="EPYR_00241"
FT   CDS_pept        265789..266490
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /locus_tag="EPYR_00241"
FT                   /product="NAD(P)H-flavin reductase"
FT                   /function="2-polyprenylphenol hydroxylase and related
FT                   flavodoxin oxidoreductases"
FT                   /EC_number="1.5.1.29"
FT                   /note="NAD(P)H-flavin reductase (NAD(P)H:flavin
FT                   oxidoreductase), UbiB, 2-polyprenylphenol hydroxylase and
FT                   related flavodoxin oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00241"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72534"
FT                   /db_xref="GOA:D2TCU5"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCU5"
FT                   /protein_id="CAY72534.1"
FT                   /translation="MTTLSCKVTSVEAITDTVYRVRLIPEADFSFRAGQYLMVVMDEND
FT                   KRPFSLASTPMEKDIIELHIGASELNLYAMAVMERIHQQRQITVDIPHGDAWLREEGDR
FT                   PLLLIAGGTGFSYARSILLTALAQQPDRHIAIYWGGRELKHLYDLDELNALAVRHPNLK
FT                   VVPVVEQPEEGFTGRNGTVLTAVMQDYGSLSGHDIYIAGRFEMAKIARERFCAERGAQE
FT                   AHMFGDAFAFI"
FT   gene            complement(266595..267758)
FT                   /gene="fadA"
FT                   /locus_tag="EPYR_00242"
FT   CDS_pept        complement(266595..267758)
FT                   /transl_table=11
FT                   /gene="fadA"
FT                   /locus_tag="EPYR_00242"
FT                   /product="small (beta) subunit of the fatty acid-oxidizing
FT                   multienzyme complex"
FT                   /function="Acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="3-ketoacyl-CoA thiolase (Fatty acid oxidation
FT                   complex beta subunit) (Beta-ketothiolase) (Acetyl-CoA
FT                   acyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00242"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72535"
FT                   /db_xref="GOA:D2TCU6"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCU6"
FT                   /protein_id="CAY72535.1"
FT                   /translation="MEKVVIVDAIRTPMGRSKGGAFRHVRAEDLSASLMKSLLSRNPSV
FT                   DPATLDDIYWGCVQQTLEQGFNIARNAALLAEIPHSVPATTVNRLCGSSMQALHDAARA
FT                   IMVGDAHTCLIGGVEHMGHVPMSHGVDFHPGLSRSVAKAAAMMGLTAEMLARMHGISRE
FT                   MQDRFAARSHQRAAAATQAGHFAAEIVAVCGHDADGVLKRYDADEVIRPETTVESLAAL
FT                   RPAFDPINGTVTAGSSSALSDGAAAMLIMSESQARQRGLKARARIRSMAVVGCDPSMMG
FT                   YGPVPASRLALKRAGLSTADIGVFELNEAFAAQTLPCIKDLGLMDRLDEKVNLNGGAIA
FT                   LGHPLGCSGARISTTLLHLIERRDEQFGLATMCIGLGQGIATVFERL"
FT   gene            complement(267769..269955)
FT                   /gene="fadB"
FT                   /locus_tag="EPYR_00243"
FT   CDS_pept        complement(267769..269955)
FT                   /transl_table=11
FT                   /gene="fadB"
FT                   /locus_tag="EPYR_00243"
FT                   /product="Fatty acid oxidation complex subunit alpha FadB"
FT                   /function="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="5.1.2.3"
FT                   /note="enoyl-CoA hydratase / dodecenoyl-CoA delta-isomerase
FT                   / 3-hydroxyacyl-CoA dehydrogenase / 3-hydroxybutyryl-CoA
FT                   epimerase [includes: enoyl-CoA hydratase;
FT                   delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase; 3-hydroxybutyryl-CoA
FT                   epimerase] 4.2.1.17 5.3.3.8 5.1.2.3] [KO:K00022 K01692
FT                   K01782 K01825], Fatty acid oxidation complex subunit alpha
FT                   [Includes: Enoyl-CoA
FT                   hydratase/Delta(3)-cis-Delta(2)-trans-enoyl-CoA
FT                   isomerase/3-hydroxybutyryl-CoA epimerase ;
FT                   3-hydroxyacyl-CoA dehydrogenase ]"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00243"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72536"
FT                   /db_xref="GOA:D2TCU7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCU7"
FT                   /protein_id="CAY72536.1"
FT                   /translation="MLYQGETLSLNWLEDGIAELVFDAPGSVNKLDTQTVASLGEAISV
FT                   LEQQPRLRGVLLSSRKSAFIVGADIMEFLSLFAAPAEQLAQWLAFANGVFNQMEDLPVP
FT                   TVSAINGYALGGGCECVLATDYRIASTDARIGLPETRLGIMPGFGGSVRMPRLLGADSA
FT                   LEMIAAGKDIDAMQALKVGLVDAVVSVDKLHAAAVSVLKEAIAGQLAWRERRQIKLEPL
FT                   KLSKIEAAMSFSTAKAVVLQTAGKHYPAPLTVVKTIEAAAKLRRDEALKLETAAFVPLA
FT                   RSDGARALVGIFLNDQAVKAKAKKLAKGVDAPERAAVLGAGIMGGGIAYQSACKGIPII
FT                   MKDISEKALKLGVSEAAKLLNKQLIRGKIDGLKLAGIMSTIQPVLHYAGFEQVDVVVEA
FT                   VVENPQVKATVLAETERHIRPDAILASNTSTIPISQLAEALTRPENFCGMHFFNPVPRM
FT                   PLVEVIRGSKTADATIAKVVAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSLLLRDG
FT                   ADFRQIDKVMEKQFGWPMGPSWLLDVVGIDTAHHAQGVMAAGFPARMEKDYRDAIDVLF
FT                   AANRYGQKNQQGFWRWETDSKGKLKKVSDDEADRLLQSVCQPKRVFSDEDIVDRMMIPM
FT                   INEVVRCLDEGVIASPAEADMALVYGLGFPPFHGGAFRYLDTISNDSYIARAAPFSALG
FT                   ALYQVPERIHEKAAKGVSWYSPATPLDNTTLRTA"
FT   gene            270141..271472
FT                   /gene="pepQ"
FT                   /locus_tag="EPYR_00244"
FT   CDS_pept        270141..271472
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="EPYR_00244"
FT                   /product="proline dipeptidase"
FT                   /function="Xaa-Pro aminopeptidase"
FT                   /EC_number="3.4.13.9"
FT                   /note="metallopeptidase family M24"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00244"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72537"
FT                   /db_xref="GOA:D2TCU8"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCU8"
FT                   /protein_id="CAY72537.1"
FT                   /translation="MESLVTLYQEHIKTLQQRAQQVLARHNLDAMLIHSGELLTVFLDD
FT                   HTYPFKVNPQFKAWVPVTQVPNCWLWIDGVSKPKLWFYSPVDYWHDVEPLPNSFWTGEI
FT                   DIVPLKNADDIARLLPAQRQNVACIGPVAARATQLGFNTDAINPQGVIDFLHYYRAYKT
FT                   GYELYCLRQAQMIAVTGHRAAKEAFKARLSEFDINVAYLSATGHRDTDVPYGNIIALNE
FT                   HAAILHYTKLDQQLPEKRRSFLIDAGAEYNGYAADITRSYAASEGSEYAQLIKDMNKEE
FT                   LELIATMKAGVRYTEYHQQMHYRIASLLLKHQLVNGLSAEAMVKEDLTGPFMPHGIGHL
FT                   LGLQVHDVAGFMQDDRGTHLAAPQQYPYLRCTRVLEPGMVLTIEPGIYFIASLLAPWRA
FT                   GKFSKYFDWAKIDALRAYGGIRIEDNVVIHKNSVENMTRDLHLA"
FT   gene            271472..272083
FT                   /gene="yigZ"
FT                   /locus_tag="EPYR_00245"
FT   CDS_pept        271472..272083
FT                   /transl_table=11
FT                   /gene="yigZ"
FT                   /locus_tag="EPYR_00245"
FT                   /product="UPF0029 protein yvyE"
FT                   /function="Uncharacterized conserved protein"
FT                   /note="Protein of unknown function UPF0029,Uncharacterized
FT                   protein family UPF0029, TIGR00257: conserved hypothetical
FT                   protein TIGR00257"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00245"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72538"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCU9"
FT                   /protein_id="CAY72538.1"
FT                   /translation="MDAYDIPAEPWSFSEEIKKSRFITLLAHTDGVDEARAFVQQIKQQ
FT                   HPAARHHCWAFVAGAPDDSQQLGFSDDGEPSGTAGKPILAQLMGSHIGEITAVVVRYYG
FT                   GIMLGTGGLVKAYGGGVQQALRLLPRRVKVPMLTFSLICNYAQLSEIERLVARFDGQVL
FT                   NSEFLEKITLTLALPHARVAGFRQNLSDFSRGTLQLVSLK"
FT   gene            272112..273563
FT                   /gene="trkH"
FT                   /locus_tag="EPYR_00246"
FT   CDS_pept        272112..273563
FT                   /transl_table=11
FT                   /gene="trkH"
FT                   /locus_tag="EPYR_00246"
FT                   /product="Trk system potassium uptake protein trkH"
FT                   /function="Trk-type K+ transport systems, membrane
FT                   components"
FT                   /note="K+ transporter Trk, TC 2.A.38.1.1 Trk system
FT                   potassium uptake protein trkH"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00246"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72539"
FT                   /db_xref="GOA:D2TCV0"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCV0"
FT                   /protein_id="CAY72539.1"
FT                   /translation="MHFRAITRIVGLLVILFSGTMIVPGLVALIYRDGAGRAFTQTFFM
FT                   ALMIGTLLWWPNRKKKSELKPREGFLIVVLFWTVLGSVGAMPFIFTEQPHLKLTDAFFE
FT                   SFSALTTTGATTLTGLDTLPKAILFYRQMLQWLGGMGIIVLAVAILPILGVGGMQLYRA
FT                   EMPGPLKDNKMRPRIAETAKTLWLIYVLLTVACALALWLAGMSLFDAIGHSFSTIAIGG
FT                   FSTHDASIGYFNSPTINTIIAVFLLISGCNYGLHFSLLSGRNLRVYWRDPEFRMFIGVQ
FT                   ITLVVICTLVLWFHDVYQSGMQTLNQAFFQVVSMATTAGFTTDSIARWPLFLPVLLLCS
FT                   AFIGGCAGSTGGGLKVIRILLLFKQGTRELKRLVHPNAVYTIKLGNRALPERILEAVWG
FT                   FFSAYALVFILSMLAIIATGVDDFSAFAAVAATLNNLGPGLGVVADNFTSMNDTAKWIL
FT                   ILTMLFGRLEVFTLLVLFTPTFWRE"
FT   gene            273578..274114
FT                   /gene="hemG"
FT                   /locus_tag="EPYR_00247"
FT   CDS_pept        273578..274114
FT                   /transl_table=11
FT                   /gene="hemG"
FT                   /locus_tag="EPYR_00247"
FT                   /product="protoporphyrinogen oxidase"
FT                   /function="Flavodoxin"
FT                   /EC_number="1.3.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00247"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72540"
FT                   /db_xref="GOA:D2TCV1"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCV1"
FT                   /protein_id="CAY72540.1"
FT                   /translation="MKALILFSSRDGQTRQIAFYIANLLKEQRECDVFNIQHVDDIDWA
FT                   QYDRVLIGASIRYGHFQPVVAKFVKSNLNALQQRASGFFSVNLTARKPEKRTPQTNAYT
FT                   RKFLLQSPWEPDCCAVFAGALRYPLYGFFDRTMIQLIMRMTKGETDTSKEVEYTDWQQV
FT                   SRFAHEFAELSSKLQ"
FT   gene            274544..276071
FT                   /locus_tag="EPYR_r007"
FT   rRNA            274544..276071
FT                   /locus_tag="EPYR_r007"
FT                   /product="16S ribosomal RNA"
FT   gene            276150..276226
FT                   /locus_tag="EPYR_t010"
FT   tRNA            276150..276226
FT                   /locus_tag="EPYR_t010"
FT                   /product="tRNA-Ile"
FT                   /anticodon="(pos:276184..276186,aa:Ile)"
FT   gene            276378..276453
FT                   /locus_tag="EPYR_t011"
FT   tRNA            276378..276453
FT                   /locus_tag="EPYR_t011"
FT                   /product="tRNA-Ala"
FT                   /anticodon="(pos:276411..276413,aa:Ala)"
FT   gene            276662..279657
FT                   /locus_tag="EPYR_r008"
FT   rRNA            276662..279657
FT                   /locus_tag="EPYR_r008"
FT                   /product="23S ribosomal RNA"
FT   gene            279894..280008
FT                   /locus_tag="EPYR_r009"
FT   rRNA            279894..280008
FT                   /locus_tag="EPYR_r009"
FT                   /product="5S RNA"
FT   gene            280266..281303
FT                   /gene="murB"
FT                   /locus_tag="EPYR_00248"
FT   CDS_pept        280266..281303
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="EPYR_00248"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /function="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number="1.1.1.158"
FT                   /note="UDP-N-acetylenolpyruvoylglucosamine reductase
FT                   (UDP-N-acetylmuramate dehydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00248"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72541"
FT                   /db_xref="GOA:D2TCV2"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCV2"
FT                   /protein_id="CAY72541.1"
FT                   /translation="MSRQQNSLKPWNTFGIDAYANKISVADSIEALCQCWQQSVHQKEP
FT                   VLLLGEGSNVLFLNDFHGQILINRIKGISITETTDAWLLHAGAGENWHQLVETTLDKGL
FT                   AGLENLALIPGCVGSAPIQNIGAYGVELEQVCEYVDIVSLDDGVCQRLSAAECQFGYRD
FT                   SVFKHHYREGYAIVAVGFKLNKSWRPVLSYGDLRNLDPLAVTPKQIFDAVCQMRRSKLP
FT                   DPDITGNAGSFFKNPLVSAAIAAELHTRYPDIPQYPQKSGEVKLAAGWLIDRCSLKGFR
FT                   VGGAAVHEKQALVLINTGTATGQDIVDLARTVRQRVAEKFNVWLEPEVRFIASQGETDA
FT                   VKAMS"
FT   gene            281300..282262
FT                   /gene="birA"
FT                   /locus_tag="EPYR_00249"
FT   CDS_pept        281300..282262
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="EPYR_00249"
FT                   /product="biotin-protein ligase"
FT                   /function="Biotin-(acetyl-CoA carboxylase) ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="Bifunctional protein birA [Includes: Biotin operon
FT                   repressor; Biotin-[acetyl-CoA-carboxylase] synthetase
FT                   (Biotin-protein ligase)]"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00249"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72542"
FT                   /db_xref="GOA:D2TCV3"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR004409"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCV3"
FT                   /protein_id="CAY72542.1"
FT                   /translation="MKDNTVPLKLIHILADGQFHSGEQLGEQMGMSRAAINKHVHTLKE
FT                   WGIDVFTVTGKGYSLPFTMQMLDEKAINAELEDGRLAVIPVIDSTNQYLLDRMASLQSG
FT                   DACVAEYQQAGRGRRGRQWFSPFGSNLYLSMYWRLEQGPAAAMGLSLVIGIVIAEALQQ
FT                   QGAPDIRVKWPNDIYLHERKLAGILVELTGKTGDAAQIVIGAGINLAMRAPAQDVINQG
FT                   WINLHETGCNVDRNALSALIVNKMRTALAQFEQDGLTPFIQRWAALDNFINRPVKLLIG
FT                   DREINGIARGIDQQGGLILEQDGVTKSWVGGEISLRPQS"
FT   gene            complement(282289..283428)
FT                   /gene="coaA"
FT                   /locus_tag="EPYR_00250"
FT   CDS_pept        complement(282289..283428)
FT                   /transl_table=11
FT                   /gene="coaA"
FT                   /locus_tag="EPYR_00250"
FT                   /product="pantothenate kinase"
FT                   /function="Panthothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="Pantothenate kinase (Pantothenic acid kinase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00250"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72543"
FT                   /db_xref="GOA:D2TCV4"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCV4"
FT                   /protein_id="CAY72543.1"
FT                   /translation="MRARLRLQLPRIFFLLFSARLVVTSAHCFMNFPFVALLGGKQILL
FT                   LHRALTFSKGKIADRSRHMSKKDSLLTTPYLQFNRTQWAALRDSVPMTLSEEEIARLKG
FT                   INEDLSIEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTDGQKIPYIISIAGSVAVG
FT                   KSTTARVLQALLSRWPEHRRVELITTDGFLHPNSVLKERGLMKKKGFPLSYDMHRLVNF
FT                   VSDLKSGAAQVTAPVYSHLIYDVIPAGDKIVQQPDILILEGLNVLQSGMDYPHDPHHVF
FT                   VSDFVDFSIYVDAPEDLLEHWYINRFLKFRQGAFTDPDSYFHHYAQLPEEEAVAIASQL
FT                   WNEINYRNLKENILPTRERASLIMTKSSDHAVDLVRLRK"
FT   gene            283727..283802
FT                   /locus_tag="EPYR_t012"
FT   tRNA            283727..283802
FT                   /locus_tag="EPYR_t012"
FT                   /product="tRNA-Thr"
FT                   /anticodon="(pos:283760..283762,aa:Thr)"
FT   gene            283815..283899
FT                   /locus_tag="EPYR_t013"
FT   tRNA            283815..283899
FT                   /locus_tag="EPYR_t013"
FT                   /product="tRNA-Tyr"
FT                   /anticodon="(pos:283849..283851,aa:Tyr)"
FT   gene            284116..284190
FT                   /locus_tag="EPYR_t014"
FT   tRNA            284116..284190
FT                   /locus_tag="EPYR_t014"
FT                   /product="tRNA-Gly"
FT                   /anticodon="(pos:284149..284151,aa:Gly)"
FT   gene            284197..284272
FT                   /locus_tag="EPYR_t015"
FT   tRNA            284197..284272
FT                   /locus_tag="EPYR_t015"
FT                   /product="tRNA-Thr"
FT                   /anticodon="(pos:284230..284232,aa:Thr)"
FT   gene            284384..285568
FT                   /gene="tufA"
FT                   /locus_tag="EPYR_00251"
FT   CDS_pept        284384..285568
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /locus_tag="EPYR_00251"
FT                   /product="protein chain elongation factor EF-Tu"
FT                   /function="GTPases - translation elongation factors"
FT                   /EC_number="3.6.5.3"
FT                   /note="Translation elongation factor EFTu/EF1A,bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00251"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72544"
FT                   /db_xref="GOA:D2TCV5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCV5"
FT                   /protein_id="CAY72544.1"
FT                   /translation="MSKEKFERSKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAAR
FT                   AFDQXDNAPEEKARGITINTSHVEYDTQSRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGVPFIIVFLNKCDMVDDEELLELVEMEVRDLLTQYDF
FT                   PGDDTPIVRGSALKALQGEAEWEAKIIELAGHLDNYIPEPERAIDKPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIVKVGEEVEIVGIKDTVKSTCTGVEMFRKLLDEGRAGENCGILLRG
FT                   IKREDIQRGQVLAKPGTIKPHTKFESEVYILSKXEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNIQMVVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIA"
FT   gene            285838..286221
FT                   /gene="secE"
FT                   /locus_tag="EPYR_00252"
FT   CDS_pept        285838..286221
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="EPYR_00252"
FT                   /function="Preprotein translocase subunit SecE"
FT                   /note="preprotein translocase, SecE subunit, TC 3.A.5.1.1
FT                   Preprotein translocase subunit secE"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00252"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72545"
FT                   /db_xref="GOA:D2TCV6"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCV6"
FT                   /protein_id="CAY72545.1"
FT                   /translation="MSANTQAQGNGRGLEVLKWLGVVVLLVAAVAGNSWYRDVTLPLRA
FT                   LAVVVLMAAAAGLALLTVKGKATLAFAREARTEVRKVVWPTRQETLHTTLIVAAVTAVM
FT                   SLILWGLDGILVRLVSFITGLRF"
FT   gene            286223..286768
FT                   /gene="nusG"
FT                   /locus_tag="EPYR_00253"
FT   CDS_pept        286223..286768
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="EPYR_00253"
FT                   /product="Transcription antitermination protein nusG"
FT                   /function="Transcription antiterminator"
FT                   /note="Transcription antitermination protein, NusG"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00253"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72546"
FT                   /db_xref="GOA:D2TCV7"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCV7"
FT                   /protein_id="CAY72546.1"
FT                   /translation="MSEAPKKRWYVVQAFSGFEGRVAQSLREHIKLHNMEELFGDVMVP
FT                   TEEVVEIRGGQRRKSERKFFPGYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRPAPIS
FT                   DKEVDAIMNRLQQVGDKPRPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKVSVS
FT                   IFGRATPVELDFGQVEKG"
FT   gene            286952..287380
FT                   /gene="rplK"
FT                   /locus_tag="EPYR_00254"
FT   CDS_pept        286952..287380
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="EPYR_00254"
FT                   /product="50S ribosomal protein L11"
FT                   /function="Ribosomal protein L11"
FT                   /note="Ribosomal protein L11, bacterial-type"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00254"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72547"
FT                   /db_xref="GOA:D2TCV8"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCV8"
FT                   /protein_id="CAY72547.1"
FT                   /translation="MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAK
FT                   TESLEKGLPTPVVITVYSDRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRA
FT                   QVREIAETKAADMTGADIEAMTRSIEGTARSMGLVVED"
FT   gene            287384..288088
FT                   /gene="rplA"
FT                   /locus_tag="EPYR_00255"
FT   CDS_pept        287384..288088
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="EPYR_00255"
FT                   /product="50S ribosomal protein L1"
FT                   /function="Ribosomal protein L1"
FT                   /note="Ribosomal protein L1, bacterial-type"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00255"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72548"
FT                   /db_xref="GOA:D2TCV9"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCV9"
FT                   /protein_id="CAY72548.1"
FT                   /translation="MAKLTKRMRVIRDKVDATKQYDINEAVALLKELATAKFVESVDVA
FT                   VNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFAQGANAEAAKAAGAELVGMEDLADQI
FT                   KKGEMNFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVRY
FT                   RNDKNGIIHTTIGKVDFDTDKLKENLESLLVALKKAKPSQAKGVFIKKVSISTTMGAGV
FT                   AVDQAGLNASAA"
FT   gene            288448..288951
FT                   /gene="rplJ"
FT                   /locus_tag="EPYR_00256"
FT   CDS_pept        288448..288951
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="EPYR_00256"
FT                   /product="50S ribosomal protein L10"
FT                   /function="Ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00256"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72549"
FT                   /db_xref="GOA:D2TCW0"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCW0"
FT                   /protein_id="CAY72549.1"
FT                   /translation="MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAG
FT                   REAGVYMRVVRNTLLRRVVEGTQFECLKDTLTGPTLIAYSMEHPGAAARLFKEFAKANA
FT                   KFEVKAAAFEGELISAAQIDRLATLPTYDEAIARLMATMKEAAAGKLVRTLAAVRDQKE
FT                   ATAA"
FT   gene            289019..289384
FT                   /gene="rplL"
FT                   /locus_tag="EPYR_00257"
FT   CDS_pept        289019..289384
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="EPYR_00257"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /function="Ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00257"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72550"
FT                   /db_xref="GOA:D2TCW1"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCW1"
FT                   /protein_id="CAY72550.1"
FT                   /translation="MSITKDQIIEGVAALSVMEIVELISAMEEKFGVSAAAAVAGPAAA
FT                   AEAVEEKTEFDVVLKAIGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGISKDDA
FT                   EALKKVLEEAGAEVEVK"
FT   gene            289719..293747
FT                   /gene="rpoB"
FT                   /locus_tag="EPYR_00258"
FT   CDS_pept        289719..293747
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="EPYR_00258"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /function="DNA-directed RNA polymerase, beta subunit/140 kD
FT                   subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="DNA-directed RNA polymerase beta chain (RNAP beta
FT                   subunit) (Transcriptase beta chain) (RNA polymerase subunit
FT                   beta)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00258"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72551"
FT                   /db_xref="GOA:D2TCW2"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCW2"
FT                   /protein_id="CAY72551.1"
FT                   /translation="MVYSYTEKKRIRKDFGKRPQVLDIPYLLSIQLDSFQKFIEQDPEG
FT                   QHGLEAAFRSVFPIQSYSGNSELQYVSYRLGEPVFDVKECQIRGVTFSAPLRVKLRLVI
FT                   YEREAPEGTVKDIKEQEVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGK
FT                   THSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTEQILD
FT                   LFFEKVVYQIRDNKLQMELVPERLRGETASFDIESNGTVYVEKGRRITARHIRQLEKDA
FT                   VAHIEVPVEYIAGKVVAKDYIDESTGELLIAANMELSLDLLAKLSQSGHKRIETLFTND
FT                   LDHGPYISETVRVDPTSDRLSALVEIYRMMRPGEPPTREAAENLFENLFFSEDRYDLSA
FT                   VGRMKFNRSLLRDEIEGSGILSKDDIIQVMKKLIGIRNGIGEVDDIDHLGNRRIRSVGE
FT                   MAENQFRVGLVRVERAVKERLSLGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQ
FT                   NNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLS
FT                   VYAQTNEYGFLETPYRRVRDGVVTDEIHYLSAIEEGNYVIAQANTNLDDEGHFVDDLVT
FT                   CRSKGESSLFSRDQVDYMDVSTQQVVSVGASLIPFLEHDDANRALMGANMQRQAVPTLR
FT                   ADKPLVGTGMERAVAVDSGVTAVAKRGGTVQYVDASRIVIKVNEDEMYPGEAGIDIYNL
FT                   TKYTRSNQNTCINQMPCVNLGEPIERGDVLADGPSTDLGELALGQNMRVAFMPWNGYNF
FT                   EDSILVSERVVQEDRFTTIHIQELACVSRDTKLGPEEITADIPNVGEAALSKLDESGIV
FT                   YIGAEVTGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNGVSGTVID
FT                   VQVFTRDGVEKDKRALEIEEMQLKQAKKDLSEELQILEAGLFSRINYLLVSGGIEAEKL
FT                   DKLPRERWLELGLTDEDKQNQLEQLAEQYDELKHEFEKKLDAKRRKITQGDDLAPGVLK
FT                   IVKVYLAVKRQIQPGDKMAGRHGNKGVISKINPIEDMPYDENGTPVDIVLNPLGVPSRM
FT                   NIGQILETHLGMAAKGIGEKINAMLKKQEDVSRLREFIQRAYDLGTDVRQKVDLNTFTD
FT                   DEVLRLAENLKKGMPIATPVFDGAKESEIKELLQLGGLPSSGQITLFDGRTGEQFERQV
FT                   TVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAA
FT                   YTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMPESFNVLLKEIRSLGINIELEDE"
FT   gene            293833..298056
FT                   /gene="rpoC"
FT                   /locus_tag="EPYR_00259"
FT   CDS_pept        293833..298056
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="EPYR_00259"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /function="DNA-directed RNA polymerase, beta' subunit/160
FT                   kD subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="DNA-directed RNA polymerase beta' chain (RNAP beta'
FT                   subunit) (Transcriptase beta' chain) (RNA polymerase beta'
FT                   subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00259"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72553"
FT                   /db_xref="GOA:D2TCW3"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCW3"
FT                   /protein_id="CAY72553.1"
FT                   /translation="MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGH
FT                   IELASPTAHIWFLKSLPSRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLEKRQILTEE
FT                   QYLDALEEFGDEFDAKMGAEAIQALLKNMDLEQECEQLREELNETNSETKRKKLTKRIK
FT                   LLEAFVQSGNKPEWMILTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPYLRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKK
FT                   MVEREESVVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDC
FT                   VNAKGEGMVLTGPKEAERVYRAGLASLHARVKVRITEHEKNEQDEWVARTSIVDTTIGR
FT                   AILWMIVPKGLPYSIVNQALGKKAISRMLNTCYRILGLKPTVIFADQTMYTGFAYAARS
FT                   GASVGIDDMVIPEKKVEIITEAEAEVAEIQQQFQSGLVTAGERYNKVIDIWAAANERVA
FT                   KAMMENLSTEVVINRDGVEERQVSFNSIFMMADSGARGSAAQIRQLAGMRGLMAKPDGS
FT                   IIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVTED
FT                   DCGTHEGIMMTPVIEGGDVKEPLRERVLGRVTAEDVLKPGTADILLPRNTLLHEQQCDL
FT                   LEEHSVDSLKVRSVVSCETDFGVCAHCYGRDLARGHIINKGEAIGVIAAQSIGEPGTQL
FT                   TMRTFHIGGAASRAAAESSIQVKNKGTLKLINAKSVTNSAGKLVITSRNVELKMIDEFG
FT                   RTKESYKVPYGSTMAKGDGEQVAAGETVANWDPHTMPVITEVSGFIRFTDMIDGQTITR
FT                   QTDDLTGLSSLVILDSAERTAGGKDLRPALKIVDANGNDVMIPGSDMPAQYFLPGKAIV
FT                   QLEDGIKISSGDTLARVPQESGGTKDITGGLPRVADLFEARRPKEPAILAEISGIISFG
FT                   KETKGKRRLVITPIDGSDHYEEMIPKWRQLNVFEGERVERGDVVSDGPESPHDILRLRG
FT                   VHAVTRYITNEVQEVYRLQGVKINDKHIEVIVRQMLRKATIESAGSSDFLDGEQVEFSR
FT                   VKISNRDLESNGKIAATFARDLLGITKASLATESFISAASFQETTRVLTEAAVAGKRDE
FT                   LRGLKENVIVGRLIPAGTGYAYHQDRMRRKAAGEAPVVPQVTADEASASLAELLNAGLG
FT                   GRDND"
FT   gene            complement(298259..298858)
FT                   /gene="mcbG"
FT                   /locus_tag="EPYR_00260"
FT   CDS_pept        complement(298259..298858)
FT                   /transl_table=11
FT                   /gene="mcbG"
FT                   /locus_tag="EPYR_00260"
FT                   /product="Protein mcbG"
FT                   /function="Uncharacterized low-complexity proteins"
FT                   /note="Pentapeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00260"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72554"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCW4"
FT                   /protein_id="CAY72554.1"
FT                   /translation="MTQLISDKEFLAKAFKKLDLPSFCIENSVFEECVFDHCNLTSAHF
FT                   LHCKFTECDFRYCNLSLMEISASRFHQVSFHECKLSGVDWTRAYWPTFNLDPGLHFNKS
FT                   ILTDASFFGLKLPGVKMNECKLHEVDFRECDLAGAEITECDLYGSLFNHTDLSAVDLTD
FT                   SWDFRIDVLNNSVAGAKFSRQEAVTLLESLGIELVD"
FT   gene            299792..300346
FT                   /locus_tag="EPYR_00261"
FT   CDS_pept        299792..300346
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00261"
FT                   /product="K88 fimbrial protein A precursor"
FT                   /note="Adhesion, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00261"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72556"
FT                   /db_xref="InterPro:IPR016372"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCW5"
FT                   /protein_id="CAY72556.1"
FT                   /translation="MKKTITFIVLLMAGAGEACAIAPGTMVQRTLFSADVVSSACHVVV
FT                   EAVGGRGSHLLFDTYRKSIAASVPPRDFIVRLYETGATVQGCSAFMSGKIAFLDFGNPG
FT                   QLDAGGVVTRGAGDGIRVEVRALDAQADFREHLTQEKHRVNYPVDFAAKGQFSFRAQPV
FT                   IPHEVKSGEYSGSLSFVVIYQ"
FT   gene            300358..302784
FT                   /gene="yraJ"
FT                   /locus_tag="EPYR_00262"
FT   CDS_pept        300358..302784
FT                   /transl_table=11
FT                   /gene="yraJ"
FT                   /locus_tag="EPYR_00262"
FT                   /product="Outer membrane usher protein fimD precursor"
FT                   /function="P pilus assembly protein, porin PapC"
FT                   /note="Fimbrial biogenesis outer membrane usher
FT                   protein,Fimbrial Usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00262"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72557"
FT                   /db_xref="GOA:D2TCW6"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCW6"
FT                   /protein_id="CAY72557.1"
FT                   /translation="MMPVVKKDMRFNGAFCLTLAIATAMGCGAARAEDRLDMSFIQGGA
FT                   GIDREAWAALNGTYVPGRYLVDVSLNSKDVGKQILDVSPQETEALCIAQSWLEKSGIYL
FT                   NRDYFREEYDVSRQCYVLSKAPSVQVDFDISTQSLSLAIPQKGLTKIPENVEWDYGSSA
FT                   FRVNYNANANTGRSNTSAFGSADLKANIGRWVVNSTATASGGDSGVSATSIDMFTATRA
FT                   IRSLSADLAVGKTQTGNSLLGSTGTYGVSFSRNNGMKPGNLGYAPVFSGIANGPSRVTL
FT                   TQNGRTLYSEMVPAGPFSVANVPLYNSGDVTMKIAGENGREQTQVFPLSVIGGQLSPGQ
FT                   HEFNIAAGLPDANSHFNGGVFAASYGYGFNGLTLQAGGVLNQRWHGGSVGAVVGLGHLG
FT                   AISADGASVVAKYKNQPIHSGNKVQLAWTKQLEMTHTGLRLSWSRQDEAFEMMSSFEPM
FT                   KLLLEGNTGRRVKDEWNGGISQPIGGMFSLSMSGWQRSYYPQSGRYSNAENDGRETGVT
FT                   ATLGTQIKGASLNIGTSGSRNSKGENNWALSASISIPFTLSERKYSSSTSISSSRGGGA
FT                   GISSGVSGSLSDRFSYGLGGGRDSDGGSRSYLNASYAGERAWMSGALNHSASGGTSGSV
FT                   SANGSVMGMPAAGGFVLSRTTGDTVAVVNVKDTPGVKVTSANGETDSNGNLVVALSSYD
FT                   WNTVTVEAGTLPLNTELNTTSQKVVPSDKAVVWMPFEALKVRRYLLQVKQKDGAFVAGG
FT                   TWARDSKTTPLGFVANNGVLMINAVDVPGDIMLGQCRIPAAKLQETEKLQEVTCE"
FT   gene            302777..303547
FT                   /gene="pefD"
FT                   /locus_tag="EPYR_00263"
FT   CDS_pept        302777..303547
FT                   /transl_table=11
FT                   /gene="pefD"
FT                   /locus_tag="EPYR_00263"
FT                   /product="Chaperone protein clpE precursor"
FT                   /function="P pilus assembly protein, chaperone PapD"
FT                   /note="PapD-like, Gram-negative pili assembly
FT                   chaperone,N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00263"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72559"
FT                   /db_xref="GOA:D2TCW7"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCW7"
FT                   /protein_id="CAY72559.1"
FT                   /translation="MNKYGAVLKQLFCDKRVNALGLTLALAMTTHSALASLATDQTRYI
FT                   FRGDRDSLSITIMNNDKKRMFGGQAWVDNIVEKDTRPTFVATPSFFKVKPNGQQALRII
FT                   MASDHLPRDKESIYWLNLQDIPPALEGSGIAIALRTKLKLFYRPKALLEGRKGAEEGIS
FT                   LQRQPDGKTMLVNTTPYIYAIGSLQDAAGKTLDVNSDTAQKLLMFMPGDKVAVNVNVVK
FT                   VNSLNDYGELQSWTINQKQPVKTAEKAEEKMAGA"
FT   gene            303559..304071
FT                   /locus_tag="EPYR_00264"
FT   CDS_pept        303559..304071
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00264"
FT                   /product="K88 minor fimbrial subunit faeF precursor"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00264"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72560"
FT                   /db_xref="InterPro:IPR035191"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCW8"
FT                   /protein_id="CAY72560.1"
FT                   /translation="MEDKIARFTLMVLVVLSTAPSAQANRDKEKEMYLGVLNGQVQGNS
FT                   VVKVTRTLPEPILFRAESSDRLPDSLIISNAEGRPASGGTVWVTIKQLQPESGQEARIT
FT                   LKALLVVDGKKVPFSVTQRGVDVVIALPAAAESVELRTDTPAELEVPANFRGNLQVALQ
FT                   VEGERAS"
FT   gene            304267..305046
FT                   /locus_tag="EPYR_00265"
FT   CDS_pept        304267..305046
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00265"
FT                   /product="K88 fimbrial protein AC precursor"
FT                   /note="K88 fimbrial protein AC precursor (K88 pilin) (K88
FT                   antigen), Fimbrial, major/minor subunit, Fimbrial, major
FT                   and minor subunit"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00265"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72562"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCW9"
FT                   /protein_id="CAY72562.1"
FT                   /translation="MKKTLMTLALAATVASGSAMAWTASGAGGHIELSGKFKPAVKKTP
FT                   WEVMAGSGSANLIGEVQNGQKVTEIEITKAIPILGIRTKSTDLFTGGAGFNPQIDFNGD
FT                   VGTDKVSKGVGELTLAVTGMDGNKIGTLKAPFTMIGVGYRKPRDGAGSVSALASYSSGK
FT                   GFFGGLPKSMQHTYPIDKIEATANMLIPGVSSNFSHSGAEITGYASMDFTASEYDYSAY
FT                   YVSGITSDSKIQFELNALLPSGEVEWKASLPIVVTYS"
FT   gene            305446..306240
FT                   /locus_tag="EPYR_00266"
FT   CDS_pept        305446..306240
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00266"
FT                   /product="K88 fimbrial protein AC precursor"
FT                   /note="K88 fimbrial protein AC precursor (K88 pilin) (K88
FT                   antigen), Fimbrial, major/minor subunit, Fimbrial, major
FT                   and minor subunit"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00266"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72564"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCX0"
FT                   /protein_id="CAY72564.1"
FT                   /translation="MIVMKRTLISLALAATVASGSAMAWTANGSGGNFELGGSLNPFTP
FT                   ETPWEVKVGDAITGLDAEVQKGQKMVEIKLNNAIPILGIRTKVKKAFAGKSGYSPQIDF
FT                   GDAIDMGDLISGDLKLTLAVKGLDGAKIGTMTAPFFAAGFMSWKNTNSENGGSAGMYAS
FT                   SPGDGFFGGLRTIDDQSNPADNVRAAIKLMPDIADKLDPQGFTLEKEMDKVSFNVSKLL
FT                   YSGFYASGIEAGKAVRIALESPASADVPVQWKASLPVTVVYM"
FT   gene            306485..307273
FT                   /locus_tag="EPYR_00267"
FT   CDS_pept        306485..307273
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00267"
FT                   /product="K88 minor fimbrial subunit faeH precursor"
FT                   /note="Fimbrial, major/minor subunit, Fimbrial, major and
FT                   minor subunit"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00267"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72565"
FT                   /db_xref="GOA:D2TCX1"
FT                   /db_xref="InterPro:IPR003467"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCX1"
FT                   /protein_id="CAY72565.1"
FT                   /translation="MSNKRYFISSLFILALFFSVLSQAEILDGGEIQFQGFVTDEAPKW
FT                   TWQVASPDQSWAVDTADARYENGQLVFDLHDKGPLPFLEGHLHEVAERGGPGLTPLITF
FT                   SSGGQPLLIVKGDSTRSQRFRAAVPVRDPDSDNTVGQLSFNLDQALAVSTGYQEEGVML
FT                   PAGMSLVSGESVTAVQTATLPQGVMSRLPALLLMNSGFSHGMSTASNGQVVSQSVLADG
FT                   RVMDLAAAYASAVSGFELRLPAEGTPARWHAGLNVTVTVQ"
FT   gene            307298..308059
FT                   /locus_tag="EPYR_00268"
FT   CDS_pept        307298..308059
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00268"
FT                   /product="K88 minor fimbrial subunit faeI precursor"
FT                   /note="Fimbrial, major/minor subunit, Fimbrial, major and
FT                   minor subunit"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00268"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72567"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCX2"
FT                   /protein_id="CAY72567.1"
FT                   /translation="MKKLTCLLLTASLLPTVAPAWNTPGQNFSGELNLAGIVTSTRNPW
FT                   EWQLSERSEDLDVKTLASRGHEQVITVAIPALKILLGKTTRSTPTGREGLVPRVIFGRG
FT                   AEGFSLTWEEPGIAQVILPVTGEGNLQAGLFSFRMTAAALLRNSSGGQAVVAGVYDDLK
FT                   GNGLPEQALVVGPEQTGRLLSTMFAGDGPAWLQGAAASDTIGLSQFANAELRQIDGVYG
FT                   AQVVAGSGELRLKGELPRHWHVSLPVSIEYQ"
FT   gene            complement(308209..309150)
FT                   /gene="ompT"
FT                   /locus_tag="EPYR_00269"
FT   CDS_pept        complement(308209..309150)
FT                   /transl_table=11
FT                   /gene="ompT"
FT                   /locus_tag="EPYR_00269"
FT                   /product="outer membrane protease precursor"
FT                   /EC_number="3.4.23.-"
FT                   /note="Outer membrane protease precursor"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00269"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72568"
FT                   /db_xref="GOA:D2TCX3"
FT                   /db_xref="InterPro:IPR000036"
FT                   /db_xref="InterPro:IPR020080"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCX3"
FT                   /protein_id="CAY72568.1"
FT                   /translation="MRFKLLALVLSSLQAYTAIADTANNFFTLDKVSAEMASGALSGKT
FT                   KVRVYDSQSADKMSQLNWNYSNAAVVTGSLYWDLTPWVSLGASGWTTIGSRGGYMDDTD
FT                   WLNGSSQGWTHQSQHPDTRLNFANEFDLNIKEWLLNEPDYRLGVMAGYQENRYSLKSTG
FT                   GSYNYTDEETGSPVIGSFPAGTTGIGYKQRFNMPYIGLTGRYRYERFEFGGTFKFSGWV
FT                   SAFDNDEHYLRNTTFKVNTANQNFYSLAADIGYYMTPNAKIYLNGIWSRTTNKKGNMSV
FT                   NDHDEGNVVNLADAGGIENYNYMTSVGLKYAF"
FT   gene            309238..309339
FT                   /locus_tag="EPYR_00270"
FT   CDS_pept        309238..309339
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00270"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72569"
FT                   /db_xref="GOA:D2TCX4"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCX4"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72569.1"
FT                   /translation="MFIYGSGLNKDQERINTRLTLFISWLFIGYFNI"
FT   gene            complement(309937..310581)
FT                   /gene="thiE"
FT                   /locus_tag="EPYR_00271"
FT   CDS_pept        complement(309937..310581)
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="EPYR_00271"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /function="Thiamine monophosphate synthase"
FT                   /EC_number="2.5.1.3"
FT                   /note="Thiamine-phosphate pyrophosphorylase (TMP
FT                   pyrophosphorylase) (TMP-PPase) (Thiamine-phosphate
FT                   synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00271"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72570"
FT                   /db_xref="GOA:D2TCX5"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCX5"
FT                   /protein_id="CAY72570.1"
FT                   /translation="MSRGAFPTTAARLGLYPVVDNVQWIARLLDTGVRTLQLRIKDRAE
FT                   QQVEQQVAEAIALGKRYQARLFINDYWRLAVKHQAYGVHLGQQDLDIADLDSIHAAGLR
FT                   LGLSTHDDAELDRALVERPSYIALGHVFPTQTKYMPSEPQGLAALTRYVKRLSGIPTVA
FT                   IGGISLARAPAVLATGVGSIAVVSAITQASDWQAATRQLLALAEAQRPARV"
FT   gene            complement(310578..312512)
FT                   /gene="thiC"
FT                   /locus_tag="EPYR_00272"
FT   CDS_pept        complement(310578..312512)
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="EPYR_00272"
FT                   /function="Thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00272"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72571"
FT                   /db_xref="GOA:D2TCX6"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCX6"
FT                   /protein_id="CAY72571.1"
FT                   /translation="MSIVEKKTTRREQRAQAQKFIDSLQGSAFPNSKRIWLTGSQPDIR
FT                   VPMREIQLSPTVTGGRKDNPTLVENEPVPVYDTAGPYGDPEASIDVHAGLAKLRRDWIV
FT                   KRNDTEQIAELSSAYTQERLADEGLDHLRFDNLPRPRSARAGRCVTQMHYARLGVITPE
FT                   MEFIAIRENMGRERIRGEVLLQQHPGNSFGASLPENITPEFVRQEVAEGRAIIPANINH
FT                   PESEPMIIGRNFLVKINANIGNSAVSSSIEEEVEKLVWSARWGADTVMDLSTGRYIHET
FT                   REWILRNSPVPIGTVPIYQALEKVNGIAEDLNWEIFRDTLLEQAEQGVDYFTIHAGVLL
FT                   RYVPMTAKRLTGIVSRGGSIMAKWCLSHHQESFLYLHFREICEICAAYDVSLSLGDGLR
FT                   PGSIQDANDEAQFAELRTLGELTKIAWEYDVQVMIEGPGHVPMQMIRTNMTEQLQHCHE
FT                   APFYTLGPLTTDIAPGYDHFTSGIGAAMIGWFGCAMLCYVTPKEHLGLPNKEDVKQGLI
FT                   TYKIAAHAADLAKGHPGAQIRDNAMSKARFEFRWEDQFNLALDPHTARAYHDETLPQES
FT                   GKVAHFCSMCGPKFCSMKITQEVREYAARQEAEAKPVEIGMAQMSHEFRRRGGELYHRA
FT                   DSLKPEEKV"
FT   gene            complement(312827..313333)
FT                   /gene="yjaE"
FT                   /locus_tag="EPYR_00273"
FT   CDS_pept        complement(312827..313333)
FT                   /transl_table=11
FT                   /gene="yjaE"
FT                   /locus_tag="EPYR_00273"
FT                   /product="Regulator of sigma D"
FT                   /note="Regulator of RNA polymerase sigma(70)
FT                   subunit,Rsd/AlgQ, Regulator of RNA polymerase sigma(70)
FT                   subunit,Rsd/AlgQ"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00273"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72572"
FT                   /db_xref="GOA:D2TCX7"
FT                   /db_xref="InterPro:IPR007448"
FT                   /db_xref="InterPro:IPR023785"
FT                   /db_xref="InterPro:IPR038309"
FT                   /db_xref="UniProtKB/TrEMBL:D2TCX7"
FT                   /protein_id="CAY72572.1"
FT                   /translation="MLNQLEVLTARFGGCSELVDFCLLSRRQLLVAYYQMVGIKPNKES
FT                   LTALDENALDAFCQNLVDYLSNGHFTIYERFIKELEGTELLAKAALIYPSLQENTAQIM
FT                   QLYDTHFEAAIDHGNDLHFQHALSVVGEALEARFTLEDKFIQLALKKNAGLQTAANDPS
FT                   LARPA"
FT   gene            313406..314179
FT                   /gene="yjaD"
FT                   /locus_tag="EPYR_00274"
FT   CDS_pept        313406..314179
FT                   /transl_table=11
FT                   /gene="yjaD"
FT                   /locus_tag="EPYR_00274"
FT                   /product="NADH pyrophosphatase"
FT                   /function="NTP pyrophosphohydrolases containing a
FT                   Zn-finger, probably nucleic-acid-binding"
FT                   /EC_number="3.6.1.-"
FT                   /note="NUDIX, NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00274"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72573"
FT                   /db_xref="GOA:D2TDB2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR022925"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDB2"
FT                   /protein_id="CAY72573.1"
FT                   /translation="MVREIQSIDEGWWVVSEEHKIWLPGGELPHGDAASLGLTGSSGSR
FT                   IGEWQGEAVWLIRGARSEGMGSLRQLLDRDSGLFQLAGRGIQLAEFFRSHQWCGYCGHK
FT                   MHSSKTEWACLCHHCRQRYYPQIAPCIIVAIRRGPEILLAQHTRHRNGIYTVLAGFVEV
FT                   GETLEQAVAREVMEESSIQVKNLRYVTSQPWPFPQSLMVAFMADYADGEINIDQKELLD
FT                   AGWYRYDALPLLPPYGTVARRLIEDTVALCRANEE"
FT   gene            314398..315468
FT                   /gene="hemE"
FT                   /locus_tag="EPYR_00275"
FT   CDS_pept        314398..315468
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="EPYR_00275"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /function="Uroporphyrinogen-III decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="Uroporphyrinogen decarboxylase (URO-D) (UPD)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00275"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72574"
FT                   /db_xref="GOA:D2TDB3"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDB3"
FT                   /protein_id="CAY72574.1"
FT                   /translation="MMSELKNDRYLRALLRQPVDVTPVWMMRQAGRYLPEYKATRAVAG
FT                   DFMSLCKNAELACEVTLQPLRRYALDAAILFSDILTIPDAMGLGLYFETGEGPRFSCPV
FT                   TCRADVEKLPIPDPEQELGYVMNAVRTIRKNLNGEVPLIGFSGSPWTLATYMVEGGSSK
FT                   AFTKLKKMMYAEPQTLHLMLDKLADSVTLYLNAQIRAGAQSVMIFDTWGGVLTGRDYLE
FT                   FSLHYMHKIVDGLLHENEGRRVPVTLFTKGGGQWLEAMAATGCDALGLDWTTDMADARR
FT                   RVGDRVALQGNMDPSMLYASPARIVQEVAGILAGYGHGNGHVFNLGHGIHLDVPPEHAG
FT                   VFVEAVHRLSRPYHLG"
FT   gene            315505..316170
FT                   /gene="nfi"
FT                   /locus_tag="EPYR_00276"
FT   CDS_pept        315505..316170
FT                   /transl_table=11
FT                   /gene="nfi"
FT                   /locus_tag="EPYR_00276"
FT                   /product="endonuclease V (deoxyinosine 3'endoduclease)"
FT                   /function="Deoxyinosine 3'endonuclease (endonuclease V)"
FT                   /EC_number="3.1.21.7"
FT                   /note="Endonuclease V (Deoxyinosine 3'endonuclease)
FT                   (Deoxyribonuclease V) (DNase V)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00276"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72575"
FT                   /db_xref="GOA:D2TDB4"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDB4"
FT                   /protein_id="CAY72575.1"
FT                   /translation="MDLAALRDQQRQHAAEIVTEDDFDVMPPRFIGGADVGFEQGGEVT
FT                   RAALVVLEYPSLQLIEHQVARIATAMPYIPGFLSFREVPALEAAWQQLAQRPDLLLVDG
FT                   HGIAHPRRLGVASHFGLLVDVPTIGVAKKRLCGQFTPPDADPGSCQPLMDKEQQLGWVL
FT                   RSKARCNPLFISPGHRVSQATVRDWVRKCLHGYRLPEPTRWADAVASRRPASAPLLRG"
FT   gene            316237..316827
FT                   /gene="yjaG"
FT                   /locus_tag="EPYR_00277"
FT   CDS_pept        316237..316827
FT                   /transl_table=11
FT                   /gene="yjaG"
FT                   /locus_tag="EPYR_00277"
FT                   /product="Uncharacterized protein yjaG"
FT                   /note="Protein of unknown function DUF416, Protein of
FT                   unknown function, DUF"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00277"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72576"
FT                   /db_xref="InterPro:IPR007338"
FT                   /db_xref="InterPro:IPR023381"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDB5"
FT                   /protein_id="CAY72576.1"
FT                   /translation="MLRNPIHLRLEKLESWQHVTFMACLCERMVPNYREFCQKTGFGDG
FT                   QIYRRILDLLWETLVVKDAKVNFDSQLEKLEEAIPSADNYDLYGVYPAIDACVALSELL
FT                   HSRLSGETLAHAIAVSETSITTVAMLEMTQAGREMTEEELKVNPAVEEEWDIQWEIFRL
FT                   LAACEERDVELIKGLRSDLRESGISNIGINFRQ"
FT   gene            317016..317288
FT                   /gene="hupA"
FT                   /locus_tag="EPYR_00278"
FT   CDS_pept        317016..317288
FT                   /transl_table=11
FT                   /gene="hupA"
FT                   /locus_tag="EPYR_00278"
FT                   /product="DNA-binding protein HU-alpha"
FT                   /function="Bacterial nucleoid DNA-binding protein"
FT                   /note="Histone-like bacterial DNA-binding
FT                   protein,DNA-binding protein HU-alpha"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00278"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72577"
FT                   /db_xref="GOA:D2TDB6"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDB6"
FT                   /protein_id="CAY72577.1"
FT                   /translation="MNKTQLIDIIADKADLSKTQAKAALESTLTAITESLKEGDAVQLV
FT                   GFGTFKVNQRAGRIGRNPKTGNEIQIAASTVPAFTSGKALKEAVK"
FT   gene            317422..318090
FT                   /gene="yjaH"
FT                   /locus_tag="EPYR_00279"
FT   CDS_pept        317422..318090
FT                   /transl_table=11
FT                   /gene="yjaH"
FT                   /locus_tag="EPYR_00279"
FT                   /product="Alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="Alanyl-tRNA synthetase (Alanine-tRNA ligase)
FT                   (AlaRS), Protein of unknown function DUF1481, Protein of
FT                   unknown function (DUF1481)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00279"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72578"
FT                   /db_xref="GOA:D2TDB7"
FT                   /db_xref="InterPro:IPR010858"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDB7"
FT                   /protein_id="CAY72578.1"
FT                   /translation="MMTLTSFTPIISFALLMLLAGCSTRSDLPDLTASGYLADGGAVRI
FT                   WRKNHQQQVVRLMTEYTPFSGAAVETSDYLWQQGKLMSIERRVIGGQPDNVTLRFDQDG
FT                   NISFMQRQLVGRREALSADAVALYQFDGQRMLKISDDLLSGRVLLKQGKWQPDGTVASC
FT                   KGGRVRPQLDSTELGRIARHQRDVSGLPDIAWLEAPAGTELLMITATDLCQNEPKEDGF
FT                   "
FT   gene            complement(318166..319446)
FT                   /gene="purD"
FT                   /locus_tag="EPYR_00280"
FT   CDS_pept        complement(318166..319446)
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="EPYR_00280"
FT                   /product="phosphoribosylamine-glycine ligase"
FT                   /function="Phosphoribosylamine-glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="Phosphoribosylamine-glycine ligase (GARS)
FT                   (Glycinamide ribonucleotide synthetase)
FT                   (Phosphoribosylglycinamide synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00280"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72579"
FT                   /db_xref="GOA:D2TDB8"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDB8"
FT                   /protein_id="CAY72579.1"
FT                   /translation="MKILVIGNGGREHALAWKAAQSPLADRVFVAPGNAGTALEPALQN
FT                   VAISPTDIQGLLNFALNEKIDLTIVGPEAPLVIGVVDAFRSAGLKIFGPTQAAAQLEGS
FT                   KAFTKDFLARHQIPTAEYQNFTEVEPALAYVRKKGAPIVIKADGLAAGKGVIVAMTLQE
FT                   AEDAIQDMLAGNAFGDAGHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGD
FT                   TGPNTGGMGAYSPAPVVTDEIHQRVMDEVIWPTVRGMAAEGNVYTGFLYAGLMINKSGQ
FT                   PKVIEFNCRFGDPETQPIMLRLQSDLVDLCLAAVNGNLDQKDSVWDPRHSLGVVLAAGG
FT                   YPGDYVNGQPIQGLPSEEVADGKVFHAGTTLQDDRVVTSGGRVLCVTALGEDVAAAQQR
FT                   AYQLAKPISWHGSFCRTDIGYRAIDRK"
FT   gene            complement(319461..321050)
FT                   /gene="purH"
FT                   /locus_tag="EPYR_00281"
FT   CDS_pept        complement(319461..321050)
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="EPYR_00281"
FT                   /product="phosphoribosylaminoimidazolecarboxamideformyltr
FT                   ansferase"
FT                   /function="AICAR transformylase/IMP cyclohydrolase PurH
FT                   (only IMP cyclohydrolase domain in Aful)"
FT                   /EC_number="3.5.4.10"
FT                   /note="Bifunctional purine biosynthesis protein purH
FT                   [Includes: Phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase (AICAR transformylase); IMP
FT                   cyclohydrolase (Inosinicase) (IMP synthetase)
FT                   (ATIC)],AICARFT/IMPCHase bienzyme"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00281"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72580"
FT                   /db_xref="GOA:D2TDB9"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDB9"
FT                   /protein_id="CAY72580.1"
FT                   /translation="MQQHRPVRRALLSVSDKAGILEFAQALSQRGVELLSTGGTARLLA
FT                   DAGLLVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRGQDDDIMAEHGISPVDMVVVN
FT                   LYPFAQTVARADCSLEDAVENIDIGGPTMVRSAAKNHKDVAVVVKSNDYQAIIAELDAN
FT                   DNSLTLATRFDLAIKAFEHTAAYDSTIANYFGSMVPAYHGETTEPAGRFPRTLNLNFLK
FT                   KQDMRYGENSHQQAAFYIEDNVSEASVATAQQVQGKALSYNNIADTDAALECVKEFDQP
FT                   ACVIVKHANPCGVATGSSILEAYERAYLTDPTSAFGGIVAFNRELDEATAREIISRQFV
FT                   EVIIAPCASDAALKVTAAKQNVRVLTCGQWQQRQTGLDFKRVSGGLLVQDRDLGMVNNS
FT                   QLHVVSKRQPNEQELRDALFCWKVAKFVKSNAIVYARDNMTIGIGAGQMSRVYSAKIAG
FT                   IKAADEGLEVKGSAMASDAFFPFRDGIDAAAAVGITCVIQPGGSIRDDEVIAAADEHGI
FT                   AMIFTGMRHFRH"
FT   gene            321692..323219
FT                   /locus_tag="EPYR_r010"
FT   rRNA            321692..323219
FT                   /locus_tag="EPYR_r010"
FT                   /product="16S ribosomal RNA"
FT   gene            323298..323374
FT                   /locus_tag="EPYR_t016"
FT   tRNA            323298..323374
FT                   /locus_tag="EPYR_t016"
FT                   /product="tRNA-Ile"
FT                   /anticodon="(pos:323332..323334,aa:Ile)"
FT   gene            323526..323601
FT                   /locus_tag="EPYR_t017"
FT   tRNA            323526..323601
FT                   /locus_tag="EPYR_t017"
FT                   /product="tRNA-Ala"
FT                   /anticodon="(pos:323559..323561,aa:Ala)"
FT   gene            323810..326803
FT                   /locus_tag="EPYR_r011"
FT   rRNA            323810..326803
FT                   /locus_tag="EPYR_r011"
FT                   /product="23S ribosomal RNA"
FT   gene            327039..327153
FT                   /locus_tag="EPYR_r012"
FT   rRNA            327039..327153
FT                   /locus_tag="EPYR_r012"
FT                   /product="5S RNA"
FT   gene            327201..327276
FT                   /locus_tag="EPYR_t018"
FT   tRNA            327201..327276
FT                   /locus_tag="EPYR_t018"
FT                   /product="tRNA-Thr"
FT                   /anticodon="(pos:327234..327236,aa:Thr)"
FT   gene            327314..327428
FT                   /locus_tag="EPYR_r013"
FT   rRNA            327314..327428
FT                   /locus_tag="EPYR_r013"
FT                   /product="5S RNA"
FT   gene            complement(327608..328369)
FT                   /gene="yhdZ"
FT                   /locus_tag="EPYR_00282"
FT   CDS_pept        complement(327608..328369)
FT                   /transl_table=11
FT                   /gene="yhdZ"
FT                   /locus_tag="EPYR_00282"
FT                   /product="putative ABC transport system, ATP-binding
FT                   component"
FT                   /function="ABC-type polar amino acid transport
FT                   system,ATPase component"
FT                   /EC_number="3.6.3.-"
FT                   /note="ABC transporter, ATP-binding component, TC
FT                   3.A.1.3.-The Polar Amino Acid Uptake Transporter (PAAT)
FT                   Family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00282"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72581"
FT                   /db_xref="GOA:D2TDC0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDC0"
FT                   /protein_id="CAY72581.1"
FT                   /translation="MTKMMSQTNDAMMITLENVNKWYGQFHVLKNINLQVKPRERIVLC
FT                   GPSGSGKSTTIRCINHLEEHQQGRIVVDGTLLNDDLRNIERVRTEVGMVFQHFNLFPHL
FT                   SVLQNCTLAPVWVRKTPKKEAEELAMHYLERVRIAEHAHKFPGQLSGGQQQRVAIARSL
FT                   CMKPKIMLFDEPTSALDPEMVKEVLDTMIGLAEDGMTMLCVTHEMGFARTIADRVIFMD
FT                   RGEIVEQAPPQQFFANPESERTRAFLSQVIH"
FT   gene            complement(328381..329481)
FT                   /gene="yhdY"
FT                   /locus_tag="EPYR_00283"
FT   CDS_pept        complement(328381..329481)
FT                   /transl_table=11
FT                   /gene="yhdY"
FT                   /locus_tag="EPYR_00283"
FT                   /product="putative ABC transport system, inner membrane
FT                   component"
FT                   /function="ABC-type amino acid transport system, permease
FT                   component"
FT                   /note="Binding-protein-dependent transport systems inner
FT                   membrane component, TC 3.A.1.3.-The Polar Amino Acid Uptake
FT                   Transporter (PAAT) Family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00283"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72582"
FT                   /db_xref="GOA:D2TDC1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDC1"
FT                   /protein_id="CAY72582.1"
FT                   /translation="MTVIIDETPATKTHAFSRSVAWARKNLFSGVGNSLLTLLCLWIMW
FT                   EAIPPALNWLIFQANWTGDTRADCTKEGACWVFIHARFGQLMYGLYPHELRWRINLALV
FT                   IGLLSIVPMLVKSLPRRGSYLVGWAVVYPLLVWLLMYGGWLGLEQVETRQWGGLTLTLI
FT                   IAAVGIAGALPAGILLALGRRSRMPVVRTLCVLFIEFWRGVPLITVLFMSSVMLPLFMA
FT                   EGSSIDKLIRALVGVILFQSAYVAEVVRGGLQALPKGQYEGAESLALGYWKTQGLVILP
FT                   QALKLVIPGLVNTIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLGMSTEGYVFAALI
FT                   YWIFCFSMSRYSQHLEKRFHTGRTPH"
FT   gene            complement(329495..330673)
FT                   /gene="yhdX"
FT                   /locus_tag="EPYR_00284"
FT   CDS_pept        complement(329495..330673)
FT                   /transl_table=11
FT                   /gene="yhdX"
FT                   /locus_tag="EPYR_00284"
FT                   /product="putative ABC transport system, inner membrane
FT                   component"
FT                   /function="ABC-type amino acid transport system, permease
FT                   component"
FT                   /note="Binding-protein-dependent transport systems inner
FT                   membrane component, TC 3.A.1.3.-The Polar Amino Acid Uptake
FT                   Transporter (PAAT) Family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00284"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72584"
FT                   /db_xref="GOA:D2TDC2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDC2"
FT                   /protein_id="CAY72584.1"
FT                   /translation="MSPRPAVKRDFSFSHPAVRAWLFQIVAVVAVLIVAGYLIHNTTNN
FT                   LASRGITSGFSFLERNAGFGIVQHLIDYSEGDSYARVFLVGLTNTLLVSALCIVFASLL
FT                   GFFVGLARLSDNWLLRKLSTVYVETFRNIPPLLQIFFWYFAVLRNLPGPRQALHAFDLA
FT                   FVSNRGLYIPWPEYSAGTVPFLLALLLATAISTALFRYNKQHQLKTGRLRRTWPATVAM
FT                   LALFPLAAILLAGSPMHWDIPQLRGFNFRGGFVLIPELAALTLALSIYTSTFIAEVIRS
FT                   GIQSVPYGQHEAASSLGLPHTVTLHQVIIPQALRVIIPPLTSQYLNIVKNSSLAAAIGY
FT                   PDMVSLFAGTVLNQTGQAIETIAITMGVYLIISLSISLLMNIYNRKIALIER"
FT   gene            complement(330741..331766)
FT                   /gene="yhdW"
FT                   /locus_tag="EPYR_00285"
FT   CDS_pept        complement(330741..331766)
FT                   /transl_table=11
FT                   /gene="yhdW"
FT                   /locus_tag="EPYR_00285"
FT                   /product="putative ABC transport system, periplasmic
FT                   component"
FT                   /function="ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain"
FT                   /note="Bacterial extracellular solute-binding
FT                   protein,family, TC 3.A.1.3.-The Polar Amino Acid Uptake
FT                   Transporter (PAAT) Family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00285"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72585"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDC3"
FT                   /protein_id="CAY72585.1"
FT                   /translation="MKKMMLSTLVTAAALFTLANQAHAGTTLDAIKKKGFIQCGISDGL
FT                   PGFSYADASGKFSGIDVDVCRAAAAAVLGDAGKVKYTPLTAKERFTALQSGEVDILSRN
FT                   TTWTSARDGGMGFIFAGVNYYDGIGFLTHQKAGLKSAKELDGATVCIQAGTDTELNVAD
FT                   YFKANKMQYTPVTFDRSDESAKALDSGRCDTLASDQSQLYALRIKLGKPDDFIVLPEVI
FT                   SKEPLGPVVRRDDDDWFTIVKWSLFAMLNAEEMGITSKNVDSMSAKPSNPDMAHLLGAE
FT                   GDFGKDLKLGNKWAYNIIKQVGNYQEVFDRNVGKDSQLKIARGQNALWNNGGIQYAPPV
FT                   R"
FT   gene            complement(332108..333028)
FT                   /gene="ddg"
FT                   /locus_tag="EPYR_00286"
FT   CDS_pept        complement(332108..333028)
FT                   /transl_table=11
FT                   /gene="ddg"
FT                   /locus_tag="EPYR_00286"
FT                   /product="Lipid A biosynthesis lauroyl acyltransferase"
FT                   /function="Lauroyl/myristoyl acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="Lipid A biosynthesis lauroyl (or palmitoleoyl)
FT                   acyltransferase (Heat shock protein B)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00286"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72587"
FT                   /db_xref="GOA:D2TDC4"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR011920"
FT                   /db_xref="InterPro:IPR030857"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDC4"
FT                   /protein_id="CAY72587.1"
FT                   /translation="MKQSQNFHRGFLRPRYWLTWFGVGILFLLVQLPYPLLHKLGTWMG
FT                   RTSMRFMKRRVSIARRNLELCFPEMEKDHLERCIIGNFESLGMGLLETGMAWFWSDRRV
FT                   KRWFSVKGLHNLQAAQANGRGALIIGVHFMSLELGGRTMGLCQPMMAMYRPHNNKLMEW
FT                   VQTKGRMRSNKAMINRRDLRGMVQALKQGEAVWFAPDQDYGPKGSVFAPLFAVPQAATT
FT                   SGTWMLARMAKPALITVVLVRKENGSGYELVIQPELKDYPIEDEQQAAEYMNRVIEREI
FT                   MRAPNQYMWLHRRFKTRPTGASSLY"
FT   gene            complement(333419..333715)
FT                   /gene="fis"
FT                   /locus_tag="EPYR_00287"
FT   CDS_pept        complement(333419..333715)
FT                   /transl_table=11
FT                   /gene="fis"
FT                   /locus_tag="EPYR_00287"
FT                   /product="DNA-binding protein fis"
FT                   /function="Factor for inversion stimulation
FT                   Fis,transcriptional activator"
FT                   /note="DNA-binding protein Fis, Bacterial regulatory
FT                   protein, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00287"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72589"
FT                   /db_xref="GOA:D2TDC5"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDC5"
FT                   /protein_id="CAY72589.1"
FT                   /translation="MFEQRVNSDVLTVSTVNSQDQVTQKPLRDSVKQALKNYFAQLNGQ
FT                   DVNDLYELVLAEVEQPLLDMVMQYTRGNQTRAALMMGINRGTLRKKLKKYGMN"
FT   gene            complement(333741..334601)
FT                   /gene="yhdG"
FT                   /locus_tag="EPYR_00288"
FT   CDS_pept        complement(333741..334601)
FT                   /transl_table=11
FT                   /gene="yhdG"
FT                   /locus_tag="EPYR_00288"
FT                   /product="putative dehydrogenase"
FT                   /function="tRNA-dihydrouridine synthase"
FT                   /EC_number="1.-.-.-"
FT                   /note="Dihydrouridine synthase, DuS, Dihydrouridine
FT                   synthase (Dus), nifR3_yhdG: putative TIM-barrel
FT                   protein,nifR3 family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00288"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72590"
FT                   /db_xref="GOA:D2TDC6"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDC6"
FT                   /protein_id="CAY72590.1"
FT                   /translation="MTVSEMLSSNPEVWASDKSRLRMVHSDEPGIRTVQIAGCDPQEMA
FT                   EAARINAASGAQVIDINMGCPAKKVNRKMAGSALLQHPELVKSILSAVVNAVDVPVTLK
FT                   IRTGWDSDNRNCVEIAQLAERCGIQALTIHGRTRACLFNGDAEYDSIRTVKQNVSIPVI
FT                   ANGDITDPHKARAVLDYTGADALMIGRAAQGRPWIFREIQHYLDTGELLAPMPLAEVKR
FT                   LLIGHLRELHGFYGQRKGYRIARKHVSWYLQENAPNDQFRRTFNAIEDASEQLEALEAY
FT                   FENLA"
FT   gene            334684..334875
FT                   /locus_tag="EPYR_00289"
FT   CDS_pept        334684..334875
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00289"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72591"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDC7"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72591.1"
FT                   /translation="MISYAHEKKVTIVCPQGGVYYAFFQEDERPNFEQYTLTGQVNIEV
FT                   VLFFCYMFINNSELIKNN"
FT   gene            complement(335008..335889)
FT                   /gene="prmA"
FT                   /locus_tag="EPYR_00290"
FT   CDS_pept        complement(335008..335889)
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="EPYR_00290"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /function="Ribosomal protein L11 methylase"
FT                   /EC_number="2.1.1.-"
FT                   /note="Ribosomal protein L11 methyltransferase ) (L11
FT                   Mtase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00290"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72592"
FT                   /db_xref="GOA:D2TDC8"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDC8"
FT                   /protein_id="CAY72592.1"
FT                   /translation="MPWIQMKINTIGAQAEELGDALIENGAVSVTFQDTHDNPVFEPLP
FT                   GETRLWGDTDVIGLFDAEIDMTEVIAGLEQHPQLGHGFLHKIEQIEDKDWEREWMTNFH
FT                   PMRFGQRLWICPSWRDVPDPDAVNVMLDPGLAFGTGTHPTTALCLAWLDGLDLTGKTII
FT                   DFGCGSGILAIAALKLGAAAAIGIDIDPQAIQASRDNAERNGVSDRLSLYLPHQQPGNL
FT                   VADVVVANILAGPLRELAPLISVLPKQGGHLGLSGVLSSQATAVCEAYADLFQLDAVAE
FT                   KEEWCRITGVRR"
FT   gene            complement(335901..337355)
FT                   /gene="panF"
FT                   /locus_tag="EPYR_00291"
FT   CDS_pept        complement(335901..337355)
FT                   /transl_table=11
FT                   /gene="panF"
FT                   /locus_tag="EPYR_00291"
FT                   /product="Sodium/pantothenate symporter"
FT                   /function="Na+/panthothenate symporter"
FT                   /note="Sodium/pantothenate symporter (Pantothenate
FT                   permease), TC 2.A.21.1.1 Sodium/pantothenate symporter
FT                   (Pantothenate permease)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00291"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72593"
FT                   /db_xref="GOA:D2TDC9"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011849"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDC9"
FT                   /protein_id="CAY72593.1"
FT                   /translation="MKLEVILPLAGYLLLVAGLSVWAMRKRREGNFLTEYFLGSRSMGG
FT                   FVLAMTLTTTYISASSFIGGPGAAYKYGLGWVLLSMVQVPAVWLSLGVLGKKFAILARR
FT                   YNAVTLNDMLYARYRSPLLVWLASLSLLTAFIGAMTVQFVGGARLLETAAGIPYDSGLL
FT                   IFGGTIALYTAFGGFRASVLNDAMQGLVMLAGTILLLVAVIHAAGGLHNAVHTLQQIDP
FT                   QLVSPSGVGDILTPTFLASFSVLVCFGVIGLPHTAVRCISYKDSKAVHLAILLGTVVVA
FT                   VLMLGMHLAGALGRAVIPDLQTPDTVIPTLMIAVLPPLAAGIFLAAPMAAIMSTVNAQL
FT                   LQSSATIVKDLYLRACPHQTDNEARLKRLSSLVTLVLGLLLLLAAWHPPQMIIWLNLLA
FT                   FGGLEAVFLWPLVLGLYWEKANAAGALSSMICGAACYSLLASLSLHPWGFHPIVPALLL
FT                   SLLAFIIGNRFGRPVVATTSASTLFE"
FT   gene            complement(337345..337587)
FT                   /gene="yhdT"
FT                   /locus_tag="EPYR_00292"
FT   CDS_pept        complement(337345..337587)
FT                   /transl_table=11
FT                   /gene="yhdT"
FT                   /locus_tag="EPYR_00292"
FT                   /product="Uncharacterized protein yhdT"
FT                   /function="Predicted membrane protein"
FT                   /note="Protein of unknown function DUF997, Protein of
FT                   unknown function (DUF997)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00292"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72594"
FT                   /db_xref="GOA:D2TDD0"
FT                   /db_xref="InterPro:IPR010398"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDD0"
FT                   /protein_id="CAY72594.1"
FT                   /translation="METRFLQAHREARWSFALALAYLACWALSAWLLDDQQGLTGLPHW
FT                   FEMACLLVPLLFIFLCWLMVRVIFRNIPLEDHREA"
FT   gene            complement(337670..339019)
FT                   /gene="accC"
FT                   /locus_tag="EPYR_00293"
FT   CDS_pept        complement(337670..339019)
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="EPYR_00293"
FT                   /product="acetyl-CoA carboxylase biotin carboxylase
FT                   subunit"
FT                   /function="Biotin carboxylase"
FT                   /EC_number="6.4.1.2"
FT                   /note="Acetyl-CoA carboxylase subunit A (ACC)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00293"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72595"
FT                   /db_xref="GOA:D2TDD1"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDD1"
FT                   /protein_id="CAY72595.1"
FT                   /translation="MLDKIVIANRGEIALRILRACKELGIKTVAVHSTADRDLKHVLLA
FT                   DETVCIGPPPSVKSYLNIPALISAAEITGAVAIHPGYGFLSENADFAEQVERSGFIFIG
FT                   PKADTIRLMGDKVSAITAMKKAGVPTVPGSDGPLTEDMDKNRAFAKRIGYPVIIKASGG
FT                   GGGRGMRVVRSDKELEQSINMTKAEAKAAFNNDMVYMEKYLENPRHIEIQVLADGQGNA
FT                   IYLAERDCSMQRRHQKVVEEAPAPGITEEMRRYIGERCSKACIDIGYRGAGTFEFLYEN
FT                   GEFYFIEMNTRIQVEHPVTEMITGVDLIKEQLRIAAGQPLSIKQEEVVIRGHAVECRIN
FT                   AEDANTFLPSPGKITRFHAPGGFGVRWESHIYAGYTVPPYYDSMIGKLITFGENRDVAI
FT                   SRMKNALAELIIDGIKTNVELQMKIMSDENFQHGGTNIHYLEKKLGLQEK"
FT   gene            complement(339031..339501)
FT                   /gene="accB"
FT                   /locus_tag="EPYR_00294"
FT   CDS_pept        complement(339031..339501)
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="EPYR_00294"
FT                   /product="Biotin carboxyl carrier protein of acetyl-CoA
FT                   carboxylase"
FT                   /function="Biotin carboxyl carrier protein"
FT                   /note="Biotin carboxyl carrier protein of acetyl-CoA
FT                   carboxylase (BCCP), Acetyl-CoA biotin carboxyl carrier"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00294"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72596"
FT                   /db_xref="GOA:D2TDD2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDD2"
FT                   /protein_id="CAY72596.1"
FT                   /translation="MDIRKIKKLIELVEESGIAELEISEGEESVRISRAPVNTGYPMMQ
FT                   QAYAAPMMQQPALAAAVASATAPAMEAPAAAEIGGHIVRSPMVGTFYRTPSPDAKAFVE
FT                   IGQKVNAGDTLCIVEAMKMMNQIEADKSGIVKAILVESGQPVEFDEPLVVIE"
FT   gene            complement(339523..339975)
FT                   /gene="aroQ"
FT                   /locus_tag="EPYR_00295"
FT   CDS_pept        complement(339523..339975)
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /locus_tag="EPYR_00295"
FT                   /product="putative class II dehydroquinase"
FT                   /function="3-dehydroquinate dehydratase II"
FT                   /EC_number="4.2.1.10"
FT                   /note="3-dehydroquinate dehydratase (3-dehydroquinase)
FT                   (Type II DHQase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00295"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72597"
FT                   /db_xref="GOA:D2TDD3"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDD3"
FT                   /protein_id="CAY72597.1"
FT                   /translation="MSGKLHVLLLNGPNLNLLGTREPEKYGHTSLEEIVSGLTLQANAL
FT                   GVTLSHLQSNAEHALIDRIHQAKGNVDYIVINPAAFTHTSVALRDALLAVSIPFIEVHL
FT                   SNVHAREPFRHHSYLSDISAGVICGLGVDGYSWALQTAVKRLSPSH"
FT   gene            complement(340198..340803)
FT                   /gene="yedZ"
FT                   /locus_tag="EPYR_00296"
FT   CDS_pept        complement(340198..340803)
FT                   /transl_table=11
FT                   /gene="yedZ"
FT                   /locus_tag="EPYR_00296"
FT                   /product="UPF0191 membrane protein yedZ"
FT                   /function="Predicted membrane protein"
FT                   /note="Ferric reductase-like transmembrane
FT                   component,N-terminal, Ferric reductase like transmembrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00296"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72598"
FT                   /db_xref="GOA:D2TDD4"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR022837"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDD4"
FT                   /protein_id="CAY72598.1"
FT                   /translation="MVRLTLIQITWLKVLLHLAGFLPLLWLLLTLNQGGFSADPAKDIQ
FT                   HLTGRMALKFLLATLAVTPLARYGKQPLLIRVRRLLGLWSFAWATLHLVSYSLLELGIN
FT                   HLGLLGSELVSRPYLTLGIVSWMMLLSLALTSFQRAQRKLGKRWQTLHNAIYLVAILAP
FT                   VHYLWSVKTYSPQPWIYALSAAILLAWRYKKLRKWLAR"
FT   gene            complement(340805..341809)
FT                   /gene="yedY"
FT                   /locus_tag="EPYR_00297"
FT   CDS_pept        complement(340805..341809)
FT                   /transl_table=11
FT                   /gene="yedY"
FT                   /locus_tag="EPYR_00297"
FT                   /product="UPF0190 protein YPTB3568 precursor"
FT                   /function="Sulfite oxidase and related enzymes"
FT                   /note="Oxidoreductase, molybdopterin binding,Oxidoreductase
FT                   molybdopterin binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00297"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72599"
FT                   /db_xref="GOA:D2TDD5"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR022867"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDD5"
FT                   /protein_id="CAY72599.1"
FT                   /translation="MKAVNQLTENDVTPENLFHARRRTVLKILGLSAAALSLPGAAHAD
FT                   LLSWFKGNERPRMASGRPLDFSQPPQFQANLPLTPEDKVTGYNNFYEFGLDKADPAAHA
FT                   GTLKTADWTLEIEGEVAKPLTLNMDDIFKRFAQEQRIYRMRCVEGWSMVVPWVGFALGK
FT                   LLQAAEPSSNARFVAFHTLYAPDQMPGQQDRFIGGGLDYPYVEGLRLDEAMHPLTMLTT
FT                   GVYGKALPPQNGAPIRLTVPWKYGFKGIKSIVKISLVKEMPPTTWNLSAPHEYGFYANV
FT                   NPHVDHPRWSQATERFIGSGGILDVQRQPTLLFNGYADRVAALYRGLDLRENF"
FT   gene            complement(341861..342838)
FT                   /gene="yhdH"
FT                   /locus_tag="EPYR_00298"
FT   CDS_pept        complement(341861..342838)
FT                   /transl_table=11
FT                   /gene="yhdH"
FT                   /locus_tag="EPYR_00298"
FT                   /product="Alcohol dehydrogenase III, mitochondrial
FT                   precursor"
FT                   /function="NADPH:quinone reductase and related Zn-dependent
FT                   oxidoreductases"
FT                   /EC_number="1.1.1.1"
FT                   /note="Alcohol dehydrogenase III, mitochondrial precursor,
FT                   Quinone oxidoreductase putative, YhdH/YhfP,Zinc-binding
FT                   dehydrogenase, oxido_YhdH: putative quinone oxidoreductase,
FT                   YhdH/YhfP family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00298"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72600"
FT                   /db_xref="GOA:D2TDD6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDD6"
FT                   /protein_id="CAY72600.1"
FT                   /translation="MQALVLEQPADKTTAAIKHLPDDSLPQGDVTVDIDWSGINYKDAL
FT                   AITGKGKIIRQFPMVPGIDFAGKVHSSSDARFHHGQPVLLTGWGVGENHWGGLAERARV
FT                   KADWLVPMPQGMDGRQAMIIGTAGFTAMLCVMALEEGGVTPDDGDVLVTGASGGVGSTA
FT                   VALLNALGYRVVAVSGRESTHDYLHQLGASEVLPRSAFSERSRPLEKQRWAGAIDTSGG
FT                   EVLATVLAQIHYNGVVAACGLAGGAALPTSVMPFILRNVRLQGVDSVMTPVARRHLAWQ
FT                   RLQQVLPATFYQQATSEVALTEAVAAAEKLLNNQMTGRTLVRIR"
FT   gene            343063..345012
FT                   /gene="yhdA"
FT                   /locus_tag="EPYR_00299"
FT   CDS_pept        343063..345012
FT                   /transl_table=11
FT                   /gene="yhdA"
FT                   /locus_tag="EPYR_00299"
FT                   /product="Uncharacterized protein yhdA"
FT                   /function="Predicted signal transduction protein containing
FT                   a membrane domain, an EAL and a GGDEF domain"
FT                   /note="EAL, EAL domain, GGDEF: diguanylate cyclase (GGDEF)
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00299"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72601"
FT                   /db_xref="GOA:D2TDD7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033423"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDD7"
FT                   /protein_id="CAY72601.1"
FT                   /translation="MRLTTKLSAIVTLLSSLAMLLMLVGCVLSFFYLSNQRAEYRVQLM
FT                   ADEVDSALFAQTPAQIESWLRQVMNPLRIEHIELSQDNRPLLKVTRHQRPLLQDEPNRY
FT                   RQTVLPLTQHTDMALRIQWVDSTRTWFTSLIGASSLSAIIGVVVIMMLLLLQAHRWLYR
FT                   QLQGMERLEARAGAVINGDRATVRPGSVHEWPPKASSAIDLLLSDLKEAGEQHNRIDTL
FT                   IRAFAAQDARTGLNNRLFFDNQLTTLLEDPEAVGTHGMVMMIRLPDFDTLRERWGHAEV
FT                   QEYLFALVNMLSTFVLRYPGALLARYFRSDFAVLLPHRSVKDADSIASQLITAVDSLPS
FT                   TRMVDRDDIIYIGISGWHSGQSTQQVMENVELATRQAMLQGGNNWSVGEGGQQDLTRGS
FT                   VKWRTLLENTVNQGGPRLYQKPAVNGLGEVHHREILPRIYDGEKELLSAEYLPMVQQLG
FT                   LAERYDRLLVKRVVTLTEWWPEETLAIPLTLDSLLQRSFLRWLRDSLLQCTQSQRKRIL
FT                   FELAEADVCQHINRLAPVFRLLYGFGCSVAVNQAGLTVVSTAYIKQFQIRLIKLHPGLV
FT                   RSIDKRTENQLFVQSLLESCRQTGAEVFAAGVHSREEWQTLAELGVTGGQGDFFAASQS
FT                   VNTSVKKYSQRYRV"
FT   gene            345327..346370
FT                   /gene="mreB"
FT                   /locus_tag="EPYR_00300"
FT   CDS_pept        345327..346370
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="EPYR_00300"
FT                   /product="Rod shape-determining protein mreB"
FT                   /function="Actin-like ATPase involved in cell
FT                   morphogenesis"
FT                   /note="Cell shape determining protein MreB/Mrl"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00300"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72602"
FT                   /db_xref="GOA:D2TDD8"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDD8"
FT                   /protein_id="CAY72602.1"
FT                   /translation="MFKKFRGMFSNDLSIDLGTANTLIYVKGQGIVLNEPSVVAIRQDR
FT                   AGSPKSVAAVGHDAKQMLGRTPGNIAAIRPMKDGVIADFFVTEKMLQHFIKQVHSNSFM
FT                   RPSPRVLVCVPVGATQVERRAIRESAQGAGAREVFLIEEPMAAAIGAGLPVSEATGSMV
FT                   VDIGGGTTEVAVISLNGVVYSSSVRIGGDRFDEAIINYVRRNYGSLIGEATAERIKHGI
FT                   GSAYPGDEVREIEVRGRNLAEGVPRGFTLNSNEILEALQEPLTGIVSAVMVALEQCPPE
FT                   LASDISERGMVLTGGGALLRNLDRLLMEETGIPVVVAEDPLTCVARGGGKALEMIDMHG
FT                   GDLFSEE"
FT   gene            346440..347462
FT                   /gene="mreC"
FT                   /locus_tag="EPYR_00301"
FT   CDS_pept        346440..347462
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="EPYR_00301"
FT                   /product="Rod shape-determining protein mreC"
FT                   /function="Cell shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00301"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72603"
FT                   /db_xref="GOA:D2TDD9"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDD9"
FT                   /protein_id="CAY72603.1"
FT                   /translation="MKPMFSRRSSLQLRLFLAIIVAIGVMIADSRMGAFSQIRTYMDTA
FT                   VSPFYFLANGPRQILDHVSETLASRQQLELENNALQRELMLKNSELLLMGQFRQENARL
FT                   RELLGSPLRQDEHKMVTQVISTGTDPYTDQVVIDKGSVNGVYEGQPVISDKGVVGQVVG
FT                   VGKVTSRVLLICDASHALPIQVLRNDIRVIAAGNGCTEELQLEHLPGNTDIRAGDVLVT
FT                   SGLGGRFPEGYPVAVVSSVKVDTQRAYTVIQARPTAGLQRLRYLLLLWGADRNGTMPMA
FT                   PNEVHRVANERLMQMMPQVLPQASEVAGPPAPDAAGNAPAAQKTDATRVRTPAVQGAQP
FT                   "
FT   gene            347459..347947
FT                   /gene="mreD"
FT                   /locus_tag="EPYR_00302"
FT   CDS_pept        347459..347947
FT                   /transl_table=11
FT                   /gene="mreD"
FT                   /locus_tag="EPYR_00302"
FT                   /product="Rod shape-determining protein mreD"
FT                   /function="Cell shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00302"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72604"
FT                   /db_xref="GOA:D2TDE0"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDE0"
FT                   /protein_id="CAY72604.1"
FT                   /translation="MSRYRSHGRWVIWLSFLVALMLQIMPWPEQLLLFRPSWLLLIIIY
FT                   WVLALPHRVNIGTGFMMGSIMDLISGSTLGVRALALSIIAYLVAFKFQLLRNLALWQQA
FT                   LLVMVLSLAMDVIVFWSEFLVINVSFRPEIFWSSVIDGVLWPWLFLLMRKIRRQFAVQ"
FT   gene            347957..348538
FT                   /gene="yhdE"
FT                   /locus_tag="EPYR_00303"
FT   CDS_pept        347957..348538
FT                   /transl_table=11
FT                   /gene="yhdE"
FT                   /locus_tag="EPYR_00303"
FT                   /product="putative inhibitor of septum formation"
FT                   /function="Nucleotide-binding protein implicated in
FT                   inhibition of septum formation"
FT                   /note="Maf-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00303"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72605"
FT                   /db_xref="GOA:D2TDE1"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDE1"
FT                   /protein_id="CAY72605.1"
FT                   /translation="MLSLYLASASPRRRELLTQLGLSFERLTLDVAEQRSEGETAERYV
FT                   KRLARDKAQAGVAVAPTDLPVLGADTLVVLNHEVLEKPTDAAAAAAMLAKLSGQTHQVM
FT                   TAVALADRHQMLDCLVVTEVTFRLLTPEDINGYIASGEPMDKAGSYGIQGFGGNFVRKI
FT                   NGSYHAVVGLPLVETAELWRHFQALREVRG"
FT   gene            348540..350009
FT                   /gene="cafA"
FT                   /locus_tag="EPYR_00304"
FT   CDS_pept        348540..350009
FT                   /transl_table=11
FT                   /gene="cafA"
FT                   /locus_tag="EPYR_00304"
FT                   /product="ribonuclease G"
FT                   /function="Ribonucleases G and E"
FT                   /EC_number="3.1.4.-"
FT                   /note="Ribonuclease G (RNase G)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00304"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72606"
FT                   /db_xref="GOA:D2TDE2"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDE2"
FT                   /protein_id="CAY72606.1"
FT                   /translation="MTAELLVNITPSETRVAYIDGGILQEIHIEREARRGIVGNIYKGR
FT                   VSRVLPGMQAAFVDIGLEKAAFLHASDIMPHTECVAGDEKKNFIVRDISELVRQGQDLM
FT                   VQVVKDPLGTKGARLTTDITLPSRYLVFMPGASHVGVSQRIDSEAERNRLKEVVAAYCD
FT                   ELGGYIIRTAAEGVGEDELASDAAFLKRLWTKVIERKKRNQTRCRLYGEVALSQRILRD
FT                   FAGAALDRIRIDSRLSFEHLLEFTSEYIPEMTAKLELYTGKQPIFDLFDVENEIQRSLD
FT                   RKVELKSGGYLIIDQTEAMTTVDINTGAFVGHRNLEETIFNTNIEATQAIARQLRLRNL
FT                   GGIIIIDFIDMNDEDHRRRVLHSLEQALSKDRVKTGVNGFSQLGLVEMTRKRTRESIEH
FT                   VLCQDCPVCKGRGTLKTVETVCYEIMREIVRVHHAYDSDRFLVYVSPSVGEALKSDESH
FT                   ALAEVEIFVGKQVKVQVEPLYTQEQFDVVMM"
FT   gene            350078..353872
FT                   /gene="yhdP"
FT                   /locus_tag="EPYR_00305"
FT   CDS_pept        350078..353872
FT                   /transl_table=11
FT                   /gene="yhdP"
FT                   /locus_tag="EPYR_00305"
FT                   /product="Uncharacterized protein yhdP precursor"
FT                   /function="Predicted membrane protein"
FT                   /note="Conserved hypothetical protein CHP02099,TIGR02099:
FT                   conserved hypothetical protein TIGR02099"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00305"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72607"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDE3"
FT                   /protein_id="CAY72607.1"
FT                   /translation="MRQLPRILLLTCATLVVVTALAISGLRLLMPHMNSWRTPILERVS
FT                   AATGVTVQASALQGSWENVGPRLEIADIQAGLADGGSMQIQRVTLALDIWQSLLHLRWQ
FT                   FRDLTFWHLRLATNTPLSFGDGHRSAVAAERLNDLFLHQFDHFDLRDSEISFLTPSGQR
FT                   DSLAIPQLTWMNEKERHRAEGLVSLSSITGQHGVVQVRLDLSDSNGYLDTGRVWMQADD
FT                   VDIKPWLGQWMRDNTSLQSARFSLAAWMEVKNGDIHTGDIWLKEGGASWQGDAQTHRFS
FT                   VDNLTAHISRFKGSWSLKVPQTRFIIDDQPWPHGQLSLLWQPQNKQLPGPDGQPELRLR
FT                   ATDLDLQHLEPLIPLFARLSPKLLANWQTLQPRGQLSALALDIPLQKPEQTRFQAKWHG
FT                   LSWRQWQLLPGMENLDGTLAGGVADGRITFQLQKASLPYGDMFRAPLEIERASGALRWQ
FT                   YGQDGLTLSGQQLDVKARSLWARGDFRYQQQDQAPHLAILAGINLTNAGDAWRYFPEPL
FT                   MGKSLTDYLSGAIKGGEVHNATLLFAGDPHQFPFAHHEGMFEVAVPLRQATYEFQPGWP
FT                   ALENLDINLDFANNGLWMQAPEVKLGEVNGHNISAAIPDYLQQKLIIDGDIRGDGSQIR
FT                   GYFNRSPLKSSLGAALEELQIGGDVSGRLHLDIPLNGQEVQATGDVNLKQNSLLIKPLG
FT                   TRFEQLTGRFVYDNGNLKSDAMSARWFGQPLGVRFTTQEGEKDYRIGVDLDADWRPGQM
FT                   PPLPSAVRQQLAGNLPWQARVQIALPHRGGAEYQIGIEGDLKNVSSHLPSPLNKASGEA
FT                   LPIILAVKGDLKRFDLSGALGDSQRFNSRWLLGKQLRAERGVWQNNVSRTPALPDSHGM
FT                   LLNLPPLDGEAWLGLLGGGMGAGGKAGGAVLPGDIRLHTPALSLAGQQWQDLTATLSQG
FT                   AAGEMKVAAEGKDIHGSLAIKQGSPWAVNLKYLYYNPQWDSKERAVPLPSHATTVNFSR
FT                   WPALRLNCDECWLGGQNMGRMQAELQPSGDTLTLKNGLIDSGSARLTASGEWVNRTGEQ
FT                   RTALKGVLSGKNIDRAINWFGVTSPLRDAPFKFEYDLHWRAAPWQPSSETLSGVLKSYL
FT                   GSGHIADISTGRTGQLLRLVSFDALLRKLRLDFSDTFSQGFYFDSINATAWIENGVMHT
FT                   DNLLLDGLEADIAMNGDIDLVQRRVNLQATVAPEISASVGVATAFVINPIVGAAVFAAS
FT                   KVLGPLWNKISVLRYHISGPIDKPQIDEVLRKPREVSEK"
FT   gene            353981..355426
FT                   /gene="tldD"
FT                   /locus_tag="EPYR_00306"
FT   CDS_pept        353981..355426
FT                   /transl_table=11
FT                   /gene="tldD"
FT                   /locus_tag="EPYR_00306"
FT                   /product="Protease tldD"
FT                   /function="Predicted Zn-dependent proteases and their
FT                   inactivated homologs"
FT                   /note="Peptidase U62"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00306"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72608"
FT                   /db_xref="GOA:D2TDE4"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDE4"
FT                   /protein_id="CAY72608.1"
FT                   /translation="MSLNLVSEQLLTANNVSQSDLFSVLGQLSERRLDYADLYFQSSFH
FT                   ESWVLEDRIIKDGSYNIDQGVGVRAISGEKTGFAYADQITLNALHQSATAARSIVREQG
FT                   NGQSRTLAAVVNRALYPALDPLQSLTREEKIALLHRVDSAARAADKRVQEVSASLTGVY
FT                   EQVLVAATDGTLAADVRPLVRLSVSVQVEDNGKRERGSSGGGGRFGYEFFLADEAGEVR
FT                   AEAWAREAVRMALVNLEAVAAPAGSIPVVLGAGWPGVLLHEAVGHGLEGDFNRRGTSVF
FT                   SGQMGQLVASELCTVVDDGTIDGLRGSLAIDDEGVPGQYNVLIGNGILKGYMQDKLNAR
FT                   LMGVAPTGNGRRESYAHLPMPRMTNTYMLAGQSTPQEIIESVEYGLYAPNFGGGQVDIT
FT                   SGKFVFSTSEAYLIENGKVTKPVKGATLIGSGIEAMQQISMVGNDLALDKGVGVCGKEG
FT                   QSLPVGVGQPTLKLDKLTVGGTA"
FT   gene            complement(355707..356213)
FT                   /locus_tag="EPYR_00307"
FT   CDS_pept        complement(355707..356213)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00307"
FT                   /product="putative membrane protein"
FT                   /note="Protein of unknown function DUF943,enterobacteria,
FT                   Enterobacterial putative membrane protein (DUF943)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00307"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72609"
FT                   /db_xref="InterPro:IPR010351"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDE5"
FT                   /protein_id="CAY72609.1"
FT                   /translation="MLIPRCRSGVWPISCCSYRPSSRCRSAAASLDFRHLQISITFFFR
FT                   STERQPPIIDYFTKNNKKNPFTDSGKIEWWLKNRDMLKEKYDTPEPESDGSFTVVFWLF
FT                   GEGYKEEGKSDRQCFEDRKTQKKCIDKNSLILVKNSKNSGMYFILDSGTYRINDAGEIR
FT                   KNKSD"
FT   gene            complement(356259..356546)
FT                   /locus_tag="EPYR_00308"
FT   CDS_pept        complement(356259..356546)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00308"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72610"
FT                   /db_xref="GOA:D2TDE6"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDE6"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72610.1"
FT                   /translation="MKKLIRIIFIIFYLLCMIVIYLSTIDKYGVVYDMDPTLPQGSLSN
FT                   SSNNGKVFAGLILLIIFISQIVFFYFERSRNWKWATGIMTALAFLFFFIR"
FT   gene            complement(356559..357323)
FT                   /locus_tag="EPYR_00309"
FT   CDS_pept        complement(356559..357323)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00309"
FT                   /product="hypothetical protein"
FT                   /note="UBA-like"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00309"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72611"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDE7"
FT                   /protein_id="CAY72611.1"
FT                   /translation="MRNYRFTARSKPLNTGFRFTERQTSIKGDFQMDMRNFEQCRVMTK
FT                   SPSWTLLDVFRWKVLPEKFGGGRLYARGFKDAWVKKHSSLIRLAALRYNLPPELLAGVC
FT                   WIEVGGDPNIIDRFAFEIRAIDWSGPACIDSNFTVTSPPAKTSFGFVSMQLRTAAKTMG
FT                   LNADQMSISELRALSQCLEKDTYNINLAAMHLRQLADYDKLPAQLSMDDVKIIGARYNR
FT                   GTNPSLESIKKDTRYGDFIVRNWQHFNILLWR"
FT   gene            complement(357327..357515)
FT                   /locus_tag="EPYR_00310"
FT   CDS_pept        complement(357327..357515)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00310"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72612"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDE8"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72612.1"
FT                   /translation="MARLKGMSVFINVVEPGSVRNLGLIPADKIYFQRCCNRMWLKHNR
FT                   CIVHCQHSTMVVTLTGY"
FT   gene            357772..357975
FT                   /gene="yhcR"
FT                   /locus_tag="EPYR_00311"
FT   CDS_pept        357772..357975
FT                   /transl_table=11
FT                   /gene="yhcR"
FT                   /locus_tag="EPYR_00311"
FT                   /product="hypothetical protein"
FT                   /note="Protein of unknown function DUF1656, Protein of
FT                   unknown function (DUF1656)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00311"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72613"
FT                   /db_xref="GOA:D2TDE9"
FT                   /db_xref="InterPro:IPR012451"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDE9"
FT                   /protein_id="CAY72613.1"
FT                   /translation="MSVLPVVVVFGMSFPPIFIEIIVSLMLFWLIRRVITPTGLYDLVW
FT                   HPALFNTALYCCLFYVVSRMFV"
FT   gene            357983..358915
FT                   /gene="aaeA"
FT                   /locus_tag="EPYR_00312"
FT   CDS_pept        357983..358915
FT                   /transl_table=11
FT                   /gene="aaeA"
FT                   /locus_tag="EPYR_00312"
FT                   /product="p-hydroxybenzoic acid efflux pump subunit aaeA"
FT                   /function="Multidrug resistance efflux pump"
FT                   /note="p-hydroxybenzoic acid efflux pump subunit aaeA (pHBA
FT                   efflux pump protein A), TC 8.A.1.7.1 p-hydroxybenzoic acid
FT                   efflux pump subunit aaeA"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00312"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72614"
FT                   /db_xref="GOA:D2TDF0"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR022871"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDF0"
FT                   /protein_id="CAY72614.1"
FT                   /translation="MKTLIRKISRTAITLLLAIVAMVLIFRVWVFYTESPWTRDARFTA
FT                   DVVAIAPDVSGLISEVRVRDNQLVQKDQVLFTIDQPRYQKALDEAQADVAYYQAVMSEK
FT                   RREAGRRNQLGVSAMSREAIEQANNDYQTTEHQLARAVASRDLAKLDLERTVIKAPSAG
FT                   WVTNLNVYTGEFITRGSTSVALVKQNSFYVLAYLEETKLEGIRPGYRVEITPLGSNQVL
FT                   RGWVDSIAAGVTNSSSTVDSKGMATIDSNLEWVRLAQRVPVRIHLDRQPGNLYPAGTTA
FT                   TVVVTGAQDRQDKDMPPLMKLMHRLREFG"
FT   gene            358929..360887
FT                   /gene="aaeB"
FT                   /locus_tag="EPYR_00313"
FT   CDS_pept        358929..360887
FT                   /transl_table=11
FT                   /gene="aaeB"
FT                   /locus_tag="EPYR_00313"
FT                   /product="p-hydroxybenzoic acid efflux pump subunit aaeB"
FT                   /function="Predicted membrane protein"
FT                   /note="p-hydroxybenzoic acid efflux pump subunit aaeB (pHBA
FT                   efflux pump protein B), TC 2.A.85.1.2 p-hydroxybenzoate
FT                   efflux carrier, AaeB"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00313"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72615"
FT                   /db_xref="GOA:D2TDF1"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="InterPro:IPR023706"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDF1"
FT                   /protein_id="CAY72615.1"
FT                   /translation="MQWYRLRFPVKLTFAILLALFVGFEFNLETPRWAVMTAAIVAGGT
FT                   AFAAGGDPFSGALRHRGMLRIIGTFIGCIAALVIMIATIRAPVVMLLLCCIWAGVCVWV
FT                   SSLIKVENSYALGLAGYTALIIVVSLNANGSLLLAPQFAVERCSEIIIGIVCAILADML
FT                   FSPRSIKQDIDREIDALLVEQYRLMQLCVEHADKEEVDKCWAGLVRRTTALNGMRTHLM
FT                   MEAGRWHKIDPRLQVLNTLSLTLITQACETFLIQNNHPEYVPPQFQLLFRKPTANVADI
FT                   HQRMKTMRRVITASGTKNTPTTIGSWVGAASRYLLLLKGIHTNSSIGHREEEMLNVDPV
FT                   VKMRSAETRHALVNGIRTFVATAVGSLFWLWTGWTSGSGAMVILAVITSLAMRMPNPLM
FT                   VAKDFLYGMIVAIPLGSLYYMVVMPNTQQSMLLLCIALGLIAFISGLLIQRRQIGALGA
FT                   LVGTINILTLDNPMQFEVSPFLDNALGQAIGCFVALLVILLIRDTSKARVGRILLNRFM
FT                   YAAVSAMTTNTVRRKENHLPALYQQLFMLMNSFPGDINKYRLALTLIIAHQRLRAADVP
FT                   INPDLSAFHQQLRHTADRVISAGSDANRRDYFERLLAEFDVYQQKLQRYQAAQSVTEPV
FT                   ARLAMVLKKYQQTLIEV"
FT   gene            complement(361095..361364)
FT                   /gene="yhcN"
FT                   /locus_tag="EPYR_00314"
FT   CDS_pept        complement(361095..361364)
FT                   /transl_table=11
FT                   /gene="yhcN"
FT                   /locus_tag="EPYR_00314"
FT                   /product="UPF0379 protein ybiM"
FT                   /note="Protein of unknown function DUF1471, Protein of
FT                   unknown function (DUF1471)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00314"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72616"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDF2"
FT                   /protein_id="CAY72616.1"
FT                   /translation="MKTTFAIAALSLASVLSFAAGAADLVTSEQVISQNLQPVGSVSVS
FT                   GIDGTPMEIRHQLSQKADRQGATSYRVVEARNDGNYHATAELYK"
FT   gene            complement(361476..361739)
FT                   /gene="yhcN"
FT                   /locus_tag="EPYR_00315"
FT   CDS_pept        complement(361476..361739)
FT                   /transl_table=11
FT                   /gene="yhcN"
FT                   /locus_tag="EPYR_00315"
FT                   /product="UPF0379 protein ybiM"
FT                   /note="Protein of unknown function DUF1471, Protein of
FT                   unknown function (DUF1471)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00315"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72617"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDF3"
FT                   /protein_id="CAY72617.1"
FT                   /translation="MNIKTTIAALGMLSTLSFSAFAAQSVNTDQIKGLQPIGVVSVSGV
FT                   SGSSMDIRQALNDKAREKGASAYRVIENYQNGNWHATAELYK"
FT   gene            complement(362235..362705)
FT                   /gene="argR"
FT                   /locus_tag="EPYR_00316"
FT   CDS_pept        complement(362235..362705)
FT                   /transl_table=11
FT                   /gene="argR"
FT                   /locus_tag="EPYR_00316"
FT                   /function="Arginine repressor"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00316"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72618"
FT                   /db_xref="GOA:D2TDF4"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDF4"
FT                   /protein_id="CAY72618.1"
FT                   /translation="MRNSSRQEDLIKAFKALLKEEKFSSQGEIVIALQDEGFDNINQSK
FT                   VSRMLTKFGAVRTRNAKMEMVYCLPAELGVPTTTSPLKNLVLDIDYNDALVVIHTSPGA
FT                   AQLIARLLDSLGKAEGILGTIAGDDTIFITPARSFTVKQLHDAILVLFEQEL"
FT   gene            362772..362915
FT                   /locus_tag="EPYR_00317"
FT   CDS_pept        362772..362915
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00317"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72619"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDF5"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72619.1"
FT                   /translation="MNFYANSKYGIGSLTYRAAAQSNKFFREKEFVDSVLWRAESERIV
FT                   IM"
FT   gene            363147..364082
FT                   /gene="mdh"
FT                   /locus_tag="EPYR_00318"
FT   CDS_pept        363147..364082
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="EPYR_00318"
FT                   /product="malate dehydrogenase"
FT                   /function="Malate/lactate dehydrogenases"
FT                   /EC_number="1.1.1.37"
FT                   /note="L-lactate/malate dehydrogenase, NAD-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00318"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72620"
FT                   /db_xref="GOA:D2TDF6"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR023958"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDF6"
FT                   /protein_id="CAY72620.1"
FT                   /translation="MKVAVLGAAGGIGQALALLLKTQLPAGSELSLYDIAPVTPGVAVD
FT                   LSHIPTSVKIEGFSGEDATPALKGADVVLISAGVARKPGMDRSDLFNVNAGIVRNLIEQ
FT                   VAATSPKALIGIITNPVNTTVAIAAEVLKKAGVYDRNKLFGITTLDIIRANTFVAALKG
FT                   QQPEELNVPVIGGHSGVTILPLLSQIPGISLSEQEVSDLTKRIQNAGTEVVEAKAGGGS
FT                   ATLSMGQAAARFGLSLVRALKGESNVVECAYVEGDGEHARFFSQPLLLGKNGIVERRPV
FT                   GELSAFEQHALTHMLDTLKKDITLGEEFVK"
FT   gene            complement(364121..365221)
FT                   /gene="degS"
FT                   /locus_tag="EPYR_00319"
FT   CDS_pept        complement(364121..365221)
FT                   /transl_table=11
FT                   /gene="degS"
FT                   /locus_tag="EPYR_00319"
FT                   /product="serine protease"
FT                   /function="Trypsin-like serine proteases, typically
FT                   periplasmic, contain C-terminal PDZ domain"
FT                   /EC_number="3.4.21.-"
FT                   /note="probable serine protease do-like precursor,Peptidase
FT                   S1C, DegS"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00319"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72621"
FT                   /db_xref="GOA:D2TDF7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011783"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDF7"
FT                   /protein_id="CAY72621.1"
FT                   /translation="MLFCPHLHLSFKSMLPKLIRSAIFGLIIAAILLLAVPGLRLGGYL
FT                   LSPTDDISGQQPVSYNAAVRRAAPAVVYVYNHSANGASDILGSGVIMDPHGYILTNKHV
FT                   INDASQIVVNLQDGRSFEALLVGSDYLTDLAVLKINAASLPVIPINPQRIAHIGDLVMA
FT                   IGNPYNIGQTVTQGIIGATGRVGLSPSRHQDFLQTDASINRGNSGGALINSLGELMGIN
FT                   TLSFDKSSNGETPEGLGFAIPTKLASKVMEKLIRDGRVIRGYIGITGQEFRRFSGPDND
FT                   MEHPQGQGIVVTEIKQGGPAFTAGMQVNDVITRVNGTAAVSPLETMDQVAEIRPGTVIN
FT                   VEISRNEQKITLPVTVQEYPEENQSR"
FT   gene            complement(365261..366667)
FT                   /gene="degQ"
FT                   /locus_tag="EPYR_00320"
FT   CDS_pept        complement(365261..366667)
FT                   /transl_table=11
FT                   /gene="degQ"
FT                   /locus_tag="EPYR_00320"
FT                   /product="serine protease"
FT                   /function="Trypsin-like serine proteases, typically
FT                   periplasmic, contain C-terminal PDZ domain"
FT                   /EC_number="3.4.21.-"
FT                   /note="probable serine protease do-like precursor,Peptidase
FT                   S1C, Do"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00320"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72622"
FT                   /db_xref="GOA:D2TDF8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDF8"
FT                   /protein_id="CAY72622.1"
FT                   /translation="MRELSPMNKKSYLLSALALSISLHLNVASATGASLPTQVQGQQLP
FT                   SLAPMLEKVLPAVVSVHVEGKESASQQQQIPDPLKRFFDQNGQGGADGDNRSPEFEGLA
FT                   SGVIIDAAKGYVLTNNHVVKGADNISVQLSDGREFTAKPIGRDEQTDIALIQLIGATNL
FT                   TQVKIADSDQLKVGDFAVAIGNPFGLGQTATSGIVSALGRSGLNLEGLENFIQTDAAIN
FT                   QGNSGGALVNLNGELIGLNTAILASSGGNIGIGFAIPGNMAMVLAQQLIQFGEVKRGQL
FT                   GIKGTEMTADMAKAFNVDVQHGAFVNEVLPQSAAAKAGIKAGDIITRIDDKQIASFAEL
FT                   RVKIGTTPPGQEVKVGLVRGDKPLTVSVKLDNSLQTSMNVELMTPALQGATLSDGAAKS
FT                   GTKKGVTVDDVEKAATAAQSGLQKGDVIVGINRTPVRNLAELRKILAAKPPLLALSVMR
FT                   GDENIYLLLQ"
FT   gene            complement(366763..367161)
FT                   /gene="yhcB"
FT                   /locus_tag="EPYR_00321"
FT   CDS_pept        complement(366763..367161)
FT                   /transl_table=11
FT                   /gene="yhcB"
FT                   /locus_tag="EPYR_00321"
FT                   /product="putative cytochrome d ubiquinol oxidase subunit
FT                   III"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /EC_number="1.10.3.-"
FT                   /note="putative cytochrome d ubiquinol oxidase subunit III
FT                   (Cytochrome bd-I oxidase subunit III), Protein of unknown
FT                   function DUF1043, Protein of unknown function (DUF1043)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00321"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72623"
FT                   /db_xref="GOA:D2TDF9"
FT                   /db_xref="InterPro:IPR009386"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDF9"
FT                   /protein_id="CAY72623.1"
FT                   /translation="MTWEYALIGLVVGIIIGALAMRFGNRKLREQHSLQYELEKTKAEL
FT                   ADYHEELSNHFAHSAELLDNMARDYRQLYQHMAKGSNDLLPNLPGERNPFAYQLTESEA
FT                   DNDQVPVQMPRDYPDSASGLLRGDRAVK"
FT   gene            367339..368466
FT                   /gene="yhcM"
FT                   /locus_tag="EPYR_00322"
FT   CDS_pept        367339..368466
FT                   /transl_table=11
FT                   /gene="yhcM"
FT                   /locus_tag="EPYR_00322"
FT                   /product="Uncharacterized protein yhcM"
FT                   /function="Predicted ATPase"
FT                   /note="AFG1-like ATPase, AFG1-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00322"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72624"
FT                   /db_xref="GOA:D2TDG0"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030870"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDG0"
FT                   /protein_id="CAY72624.1"
FT                   /translation="MQTMSPLALYQQALDNGEYQPDDVQHAAIIRLDGIYQALSHARPP
FT                   SAPAGTGLFGKLHKLLAKSKTDIQTPARGLYMWGGVGRGKTWLMDMFFRAIPGERKQRL
FT                   HFHRFMLHVHQQLAELQGHSDPLQIVADRFKAETDLLCFDEFFVSDITDAMLLGTLMEA
FT                   LFSRGITLVATSNIPPDDLYRNGLQRARFLPAIEMIKQHCDIMNVDAGIDYRLRTLTSA
FT                   HLWMTPLGAETSQEMGRMFIALAGKPPQVYQPLEINHRQLPTLGMAEGVVAMNFLALCG
FT                   EGRSQHDYIELSRRFHSVLLYDVPVMIYNTEDQARRFLALVDEFYERHVKLVVSAETSL
FT                   FKIYQGARLKFEYQRCISRLQEMQSEEYLRLAHLP"
FT   gene            368711..369139
FT                   /gene="rplM"
FT                   /locus_tag="EPYR_00323"
FT   CDS_pept        368711..369139
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="EPYR_00323"
FT                   /product="50S ribosomal protein L13"
FT                   /function="Ribosomal protein L13"
FT                   /note="Ribosomal protein L13, bacterial-type"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00323"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72625"
FT                   /db_xref="GOA:D2TDG1"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDG1"
FT                   /protein_id="CAY72625.1"
FT                   /translation="MKTFTAKPESVQRDWYVVDATGKTLGRLATELARRLRGKHKAEYT
FT                   PHVDTGDYIIVLNAEKVAVTGNKRSDKIYYHHTGHIGGIKQATFEEMIARRPERVIEIA
FT                   VKGMLPKGPLGRAMYRKLKVYAGNEHNHAAQQPQVLDI"
FT   gene            369155..369547
FT                   /gene="rpsI"
FT                   /locus_tag="EPYR_00324"
FT   CDS_pept        369155..369547
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="EPYR_00324"
FT                   /product="30S ribosomal protein S9"
FT                   /function="Ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00324"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72626"
FT                   /db_xref="GOA:D2TDG2"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDG2"
FT                   /protein_id="CAY72626.1"
FT                   /translation="MAENQNYGTGRRKSSSARVFIKPGSGNIVINQRSLEQYFGRETAR
FT                   MVVRQPLELLDMVGKFDLYITVKGGGISGQAGAIRHGITRALMEYDESLRGELRKAGFV
FT                   TRDARQVERKKVGLRKARRRPQFSKR"
FT   gene            369856..370497
FT                   /gene="sspA"
FT                   /locus_tag="EPYR_00325"
FT   CDS_pept        369856..370497
FT                   /transl_table=11
FT                   /gene="sspA"
FT                   /locus_tag="EPYR_00325"
FT                   /product="Stringent starvation protein A homolog"
FT                   /function="Glutathione S-transferase"
FT                   /note="Glutathione S-transferase,
FT                   C-terminal-like,Glutathione S-transferase, N-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00325"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72627"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034341"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDG3"
FT                   /protein_id="CAY72627.1"
FT                   /translation="MAVAANKRSVMTLFSGPTDIFSHQVRIVLAEKGVSVEIEQVETDN
FT                   LPQDLIDLNPYRTVPTLVDRELTLYESRIIMEYLDERFPHPPLMPVYPVARGESRLMMH
FT                   RVEQDWYSLMRKVENGTAQEAEAARKQLREELLAIAPLFSRTPFFMSEEFSLVDCYLAP
FT                   LLWRLPQMGIELLGAGSKELKGYMTRVFERDSFLASLTEAEREMRLHTRG"
FT   gene            370502..370999
FT                   /gene="sspB"
FT                   /locus_tag="EPYR_00326"
FT   CDS_pept        370502..370999
FT                   /transl_table=11
FT                   /gene="sspB"
FT                   /locus_tag="EPYR_00326"
FT                   /function="Stringent starvation protein B"
FT                   /note="Stringent starvation protein B, Stringent starvation
FT                   protein B"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00326"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72628"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDG4"
FT                   /protein_id="CAY72628.1"
FT                   /translation="MEMSQLTARRPYLLRAFYDWLLDNDLTPHLVVDINLPDVMVPLEY
FT                   ARDGQIVLNIAPRAVGGLELGNDEVRFSARFGGVPRQVSVPLAAVLAIYARENGAGTMF
FT                   EPEPVYDGSGEFQASNGENEAPETLMSVIDGDRPDDSVADDDGPDDEPPPRGGRPALRV
FT                   VK"
FT   gene            371473..371619
FT                   /locus_tag="EPYR_00327"
FT   CDS_pept        371473..371619
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00327"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72629"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDG5"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72629.1"
FT                   /translation="MFNHLCQALPEDVTRFIEVLIWNPEMHIDRLSIHLINNFLFNDKL
FT                   INK"
FT   gene            371834..371995
FT                   /locus_tag="EPYR_00328"
FT   CDS_pept        371834..371995
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00328"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72630"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDG6"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72630.1"
FT                   /translation="MNNIKVARNDRFIAGNKFSAGYGFDFGQRKGVLTSFIVVLRRAGA
FT                   MNNRAVRD"
FT   gene            372105..375389
FT                   /locus_tag="EPYR_00329"
FT   CDS_pept        372105..375389
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00329"
FT                   /product="putative insecticial toxin"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00329"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72631"
FT                   /db_xref="InterPro:IPR018003"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDG7"
FT                   /protein_id="CAY72631.1"
FT                   /translation="MLEKYEVFMSEFYSLPESAPDILAKMPKAGHKSVFDIIKVSRAEF
FT                   IKTIPDVDQSRADKVYRDAHQRAATLKSYFRSWQLRQEPVISGLKKLTSTPSDALHNTL
FT                   VRNISGDGDFSDLMARSSEYADAASIQSLFSPGRYVTALYAVAKKLYDETSALAIDKRR
FT                   PDLHKLVLSEISMSQEVSSLDVLLDVLLGQNGSALSSMSKRYFPMTLPYDDDLHQISAS
FT                   LGAQGRSLNGIWEKLTDTQRHSLTPSAYTGSAFQRVMSQRTDTSNSGKTFYLKANNSMV
FT                   WLSDPVKTGSVFTAHMVLGEPDARDKGVAPLRFTVISTGSAEAMRLGLEGEVVFSLGTL
FT                   KNAWLTGSAGQQNAKDDRFAALSDKTSGQELSIAITVNYDDSVMLRTSKGWIGIDENGG
FT                   NTNRSQSLVLNASKDNALKFTLCEDQKGIRRVPPALRLPAKAPNPPTRTMLSLTPLCYQ
FT                   LLLNNHLQENDIQVHYGLSSATQLTAGQLATQLNHIPTFCQKTGLTFNQLLELTAQKNY
FT                   KVGAGSPESRYLPESCYQRAQYPYGMVKVYIYGAAFLNATVYAKDAKTVLWVQPEVRDS
FT                   SGKVTTPAALNFRDDTVITLAGNVEKLIRLRNTTGLSFEMLDWIIVNVSRAAGYKTPSL
FT                   DANTLQTLAAYVGLTKRYGINANTFCSFIGAVNPYAPQQQKSEYERLFTSLDGTFTQPI
FT                   QGRDAIIIGYSTREEKKQRALFCKAAGVTDDELTRILKYCDLKYNDKFDEYVAGRISRF
FT                   GAIPRMLGLTFAEAECLWILLDGIPALYRLGSVNGLYALDLISRSEQLIAWMAENSLSL
FT                   IQLQAMVSRQHSDTATPEMFTFLQNIYNSVNDETPASRSAAQDIALRQKLLRALAGGFG
FT                   MKTNVTGLLTDWLAAIADFTLSAYWVDISQFFADESHVSVDLLQRNFSGLVMHTHRLSQ
FT                   LVVIIRWLDLSEQDLTLLTATPTQLDATLTRTPEPDLPLLLLLSRFKRWQSQVTVTSHE
FT                   ALRLLPLLAAAHTTAKEAAAKIATLHNLSENSVQSLGKLLFGKRGYPADFAQLRQLLNW
FT                   MHTGQMLNVGSATLKDLLTMTHGDEQAEQSDLIARVAQSLTAGLTR"
FT   gene            375431..379063
FT                   /gene="tcbA"
FT                   /locus_tag="EPYR_00330"
FT   CDS_pept        375431..379063
FT                   /transl_table=11
FT                   /gene="tcbA"
FT                   /locus_tag="EPYR_00330"
FT                   /product="putative toxin subunit"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00330"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72632"
FT                   /db_xref="InterPro:IPR040840"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDG8"
FT                   /protein_id="CAY72632.1"
FT                   /translation="MSVTLFNKNLKEARRDALVSHYLATRDFSSLPKGSSVKNADDLYE
FT                   YLLLDTKVSDAVTTSRLAEATSSLQLFIHRALEGYDGELAKGASALLAQDAFLDNWDKY
FT                   NKRYSTWAGKEKLRFYAANYVDPTLRSNKTELFKQLEEHLSQGKFSETQVVQAFNSYLS
FT                   DYHRYANVTYLSVGNGHEEKVKYISAKANGKYYWRMVTLGEGYKPIKWGEWQPLPTAID
FT                   KALNDDVVVAWHENKITCGWNSIESIRLSDGKAQDAVFNHIWKMNCDNTWVYFSHAEKR
FT                   FDTTPRTGMTTGHCRLEFRWEEAVNGLYEKVNGVLIYDLERNRVTLTIDDAHIIFHPDV
FT                   QVFINNLSMSYESKKTIPWTGEVKIELKKRAGGKVLEAFTATLSPLSDGFYGYIKEGFV
FT                   TRNSLREFSVTSSTATTNEYFSGQYPLSDLFTLECQSLFAKAGCWYYQNAAGKIITGGD
FT                   AFSGPYCQYLWEIFFHIPFLIAARFATERRFDDAERWYKYIFNSAGYRDRNGKLLTNEK
FT                   KNTRYWNCLPLEQDIVWDSFAAVPASTDPDVIASADPMHYKLAVFMGTLDLLIARGDAA
FT                   YRTLERDTLTEAKMYYVQAQQLLGPRPDIRITSSWDNPMLYIAARDIAPPATRTAEPQT
FT                   FSRWLKAGDSSEMGDGNFLPPCNDVLLAYWDKLDIRLWNLRHNLSLDGQPLNLPLFTTP
FT                   ADPAGLHRQQQGGDGAKYEVRPSDKSTTGWRYPLLADHARSAASLLTQFGNSLLSALER
FT                   RDAEQLTLLLQTQQIAVLAQQQGIAGKNLDSLRASLESLRLSRASAELRKTHYGNLVNG
FT                   DLSPAEQSGLTLRSNARTLQLLSQVPALAGGLLSALPNTFGLANGGGDLGAPFHAQAQI
FT                   LQAMAGASDQSAVINDITAGYQRRAEEWGLQRDIADREIGQLDAQIDSLKAQIAMQQKQ
FT                   IALTETESAHAQQLYKLQSSRFTSQALYNWMVSRLSTLYYQMYDATIPVCMQARTALIR
FT                   ELGEDKVHGLFRSAVWSDLYQGLLAGEGLTTELQKLNNVWLQYGALGLEATRTVSLAAL
FT                   RGEETGSLSAAVAKVLSNQNDSAENGVLKLENQIFSAQLDMSKLKLEQDYGATSNNKKL
FT                   HIKSIAVTLPTLLGPYQDIAATLSVGNETATLSHGLQDSGRFITNLEDSRFQPFEGLDV
FT                   TSVKAPLTLSIFSVKEADDDAAANQRAIVENLSDIIFHIRYIMR"
FT   gene            379118..383188
FT                   /gene="vsdC"
FT                   /locus_tag="EPYR_00331"
FT   CDS_pept        379118..383188
FT                   /transl_table=11
FT                   /gene="vsdC"
FT                   /locus_tag="EPYR_00331"
FT                   /product="65 kDa virulence protein"
FT                   /function="Rhs family protein"
FT                   /note="Salmonella virulence plasmid 65kDa B
FT                   protein,Salmonella virulence plasmid 65kDa B protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00331"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72633"
FT                   /db_xref="GOA:D2TDG9"
FT                   /db_xref="InterPro:IPR003284"
FT                   /db_xref="InterPro:IPR022044"
FT                   /db_xref="InterPro:IPR022045"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDG9"
FT                   /protein_id="CAY72633.1"
FT                   /translation="MQNSDSLALKAPSLPKGGGAVSGLKGDVAAAGPDGAATLSVPLPV
FT                   SRGRGYAPALALSYHSRGGNGPFGMGWDVNLSAIRRRTNKGIPTYGPNDEFTGPDGEVL
FT                   VPLLTADGTPETRSASALLNVDAGGNYHVRAYRSRTESDFSRLEYWVADSNSAEAFWLL
FT                   YRPDGQLFLLGRNAQARISNPHNARQTAAWLIESSVSVSGEQIYYQYRAEDDTECADAE
FT                   KAAHHAATAQRYLIAVWYGNRTASRTLPAFTSAPSAEDWLFTLVLDYGERDTDPAQAPD
FT                   WLPPGKEDWPCRPDRFSSWHYGFELRTRRLCRQALMYHAVTALAGEEKPGDQPQLVARL
FT                   CLDYQQTPSVSMLKSVRQNAYEADGRVLSLPPLTFGWHTFTPPQAATWQQREDMGNLNP
FT                   LQPYQLVDLNGEGLAGILYQDDGGWWYRAPVRQTGGSADEVTWDKAAPLPIMPALHAGG
FT                   ALLDLNGDGYLEWLVTAPGLAGHYGRTAERQWRNFTPLTALPVEYGHPRARLVDLTGSG
FT                   LADLALIGPKSVRLYSGSGEGWQKVQTVMQADSVTLPLSPTMDASMLIAFSDMAGSGQQ
FT                   HLVQVTASGVRYWPSLGHGRFGQPLDLPGFSQPPDRFNPQQLFLADIDGSGTTDLIYTL
FT                   GDSLLIYLNQSGNAFAAPFSLPLPEGARYDRTCSLQLADIQGQGVASLILTTPHPTPRH
FT                   WVCHLSEQKPWLLNAMNNHMGASHSLYYRSSAQFWLDEKAEAAQAGKPQPACYLPFALH
FT                   TVQRTEVTDEITGNRLVSSVRYRHGAWDGREREFRGFGLVEVSDTDTRASRGSAAEISM
FT                   PAISRSWYATGLVQVDEQLPRQYWQGDSAAFGGFVPRFTIGSGDDEQAYVPDDSTRFWL
FT                   NRGVKGLLLRSELYGADDSVLATTPYSVSETRPQVRLVETRGVYPVTWSVSVETRTYLY
FT                   ERFSSDPQCSQQVLLSSDRYGQPLRQVNISYPRRSQPTKSPYPPTLPPTLFASSYDRQQ
FT                   QELRLVLQQSRWHTLSDSAAGVWLAGLSDATRSDIFTYSATSVPAQGLTLEQLSASGNL
FT                   TGEDRPATFAGQQQVWYLDTQGEAVTATPAIPPRLAFSESAVLDEPLIASLAQDISAET
FT                   VTQAGYSLSGYLFARRGESGKLLWTVRQGYSTYGSAEHFWLPESTRDTLLTGAITVTRD
FT                   RYNCVITQLRDAAGLTTSAQYDWRFLTPVSVTDANDNRHTVTLDALGRVSVMRFSGTEN
FT                   GNATGYSANAIDPPQTAEQALALSAPLPVHQMLVYITDSWMTQRAEKQPPHVVVLTTDR
FT                   YDSDPQQQIRQQVVFSDGFGRVLQTSVRQTDGGAWQRSAAGALVSASNGAPQLATTTSR
FT                   WAVSGRTEYDNKG"
FT   gene            383309..383413
FT                   /locus_tag="EPYR_00332"
FT   CDS_pept        383309..383413
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00332"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72634"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDH0"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72634.1"
FT                   /translation="MKTAKGWLRRSLFTPWFVVSEDENNTAAEAEAGI"
FT   gene            383475..386123
FT                   /gene="rhsB"
FT                   /locus_tag="EPYR_00333"
FT   CDS_pept        383475..386123
FT                   /transl_table=11
FT                   /gene="rhsB"
FT                   /locus_tag="EPYR_00333"
FT                   /function="Rhs family protein"
FT                   /note="Rhs family protein, putative insecticidal toxin
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00333"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72635"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR041508"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDH1"
FT                   /protein_id="CAY72635.1"
FT                   /translation="MRSNTLYRATPSVTVLDNRGQSVRDIVYHRHPDVPESIDERITRH
FT                   RYNERGFLAQSADPRLHDAGLANFSYLTDLAGHVLRTQSADAGITVALNDAAGRPFMTV
FT                   THIAAGENGLHDRSQAVIRTFRYEQASLPGRPLSTTEQGANGVPRISERFVYAGNTQRE
FT                   KELNLAGQCVGHYDTAGLVQTDSIALSGVPLSVTRRLLKDAHNTDVVADWRGEDAAAWN
FT                   GLLAAGAFTTRSTADAVAAVLTTTDATGHMQRVAYDVAGLLRGSWLTLKGGKEQVIVKS
FT                   LSWSAAGQKLREEHGNGVVTTYTYEQETQRLTGVRTERPAGHAVVAKVLQDLRYEYDPV
FT                   GNVLMVRNNAEETRFWRNQKVVPESACAYDSLYQLVSASGREMASGGEQGTNLPLLPSF
FT                   DSATFTNYTRTYTYDRSGNLTQIRHGAPASGNNYTTRITISNRSNRGVLSTLTENPSEV
FT                   DALFSAAGQQMQLLPGQRLSWTARGELLQVTPVVRDGAAADGESYRYDGSSQRVLKVGV
FT                   QKTANGTQNQRVLYLPGVELRTRAGGGTETESLQVITVGEAGRAQVRALHWKSGKPTAV
FT                   SNNQLRFSYDNLVGSSTLEVDGGGNLISMEEYYPYGGTALWTARSQAEADYKTVRYSGK
FT                   ERDATGLYYYGYRYYQPWAGRWLSVDPAGTVDGLNLFRMVRNNPVTLKDEEGLAPSYLM
FT                   ALPKIVNTYTENNHGEAARIISLPDNNQGRILPSLPTREELGLLDAEVSAVKIYTSYTY
FT                   KHINSYARGTLGSKEAKQLKEALEQNKFLKKGFIGGEKLSKGIAKFNATLESARKKHPS
FT                   NESFGSIVTRGIGFDYIGGSEDEINYTTIGSVVEQKSYTSTTVSRPFLNTHLLTLHAHP
FT                   EADGRWIEVVY"
FT   gene            complement(386956..388713)
FT                   /gene="cysI"
FT                   /locus_tag="EPYR_00334"
FT   CDS_pept        complement(386956..388713)
FT                   /transl_table=11
FT                   /gene="cysI"
FT                   /locus_tag="EPYR_00334"
FT                   /product="sulfite reductase (NADPH) flavoprotein
FT                   alpha-component"
FT                   /function="Sulfite reductase, alpha subunit (flavoprotein)"
FT                   /EC_number="1.8.1.2"
FT                   /note="Sulfite reductase [NADPH] flavoprotein
FT                   alpha-component (SIR-FP)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00334"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72636"
FT                   /db_xref="GOA:D2TDH2"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010199"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDH2"
FT                   /protein_id="CAY72636.1"
FT                   /translation="MKIPYIPEDAPFNGEQKFWLAGFLAGLHSRLLVLENQPQAAGAAA
FT                   SAATTQLHILFGSQTGNAEALAQSAARVARAKGLVPVVQSLDEVDIDVFATMRHVLVIT
FT                   STYGEGEMPDNAQLFWQAISASTAPRLEQMHFAVLAIGDTGYDGFCQAGKFIDMRLEQL
FT                   GAKRVYERIDCDIDFEEPSNAWLDQSMPQFAASAGSSGNVLDSAPEAPVIPGSNRNNPY
FT                   AATLVTNKRLSGEDSGKDIRHFEFDLSDSGLKYEAGDALGVIPVNEPALVNLLLTQLKS
FT                   DYDTPVPGFERSLGDLLTYQFEISEPSRKLIEWVGQNTRNQELRHVLQHDDKDALGVWL
FT                   WGKDTLDLLQLDATRSLSIPEFVALLRPLQHRAYSISSSQKAHPNQVHLTIASVRYHSG
FT                   GRARSGVCSTYLAERVKRGEKPAIFISPNKGFRLPANNDAPLIMIGPGTGIAPFRAFLE
FT                   EREALGAKGKNWLFFGDQHQEHDYIYRHELAKWQENGLLTRLDLAFSRDQADKIYVQDR
FT                   MLEQGAELFAWLQEGGCFYVCGDASRMAKDVDKALYLIVSQFGGMSSERAADYIDQLKK
FT                   EKRYLRDVY"
FT   gene            complement(388765..394299)
FT                   /gene="gltB"
FT                   /locus_tag="EPYR_00335"
FT   CDS_pept        complement(388765..394299)
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="EPYR_00335"
FT                   /product="glutamate synthase (NADPH)"
FT                   /function="Glutamate synthase domain 2"
FT                   /EC_number="1.4.1.13"
FT                   /note="glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00335"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72637"
FT                   /db_xref="GOA:D2TDH3"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDH3"
FT                   /protein_id="CAY72637.1"
FT                   /translation="MSNSKPFPYGLYDPSKDSDSCGVGFITRKDGAQTHQVLEMAHGAL
FT                   CTVPHRGGMSAEGVGDGAGINVDLSLHFFRKITGQALKAGRFGVGNFFVPKDSALRANA
FT                   ERLVEDTLLSCNLKIIARRDIPLDNSVLRPAAIPFQLPIAQWIFAAPDDITSQIDFEKR
FT                   IYRALLQIEARAFSESEFGGLYPLSLSSRTQVLKARLNSNEVIPYFKDLTDPDHQVRGL
FT                   FFHTRFSTNTDPHTTMAQPFRLMAHNGELNTDRKNRIAEAALALARGKKIVRPKGQSDS
FT                   SRLDQSIHSRLMEDNLDLITAVVSMMPPAWENDPSLSADVRAMLEYFSLYEEKNDGPAA
FT                   LIFGNGEVIGARLDRLGLRPLRSVETAEYIGAMSEAGQIAFPPESVLRRGRIEAGGMLY
FT                   YDHREKRSYTTLEALEKLAAVADYPALLAQSRVLLQDLPVIPAEQQGSPLRYGGDLKTW
FT                   QRFVAYYYNQESFKFMMDPMLATGAEKISAMGYGNAINALSDHEGGMAHYFSQRFAQVT
FT                   NPPLDSIREADGMTLRVALGARPHLGRSKGQQIVVPTPILTHLDMLQLREQTVAPYARF
FT                   EMLYTPVIGSDTASRAANADALERAIDDLAQQVVDFAREQGGIAVITDRHLSTTRAAIP
FT                   MLLVVSAINQRLVQEGLRLDVSLVVESGQSISSHHIAAALGFGASAIYPLGVQMRAEEK
FT                   YGEGEGGNKAFKRYAKAAEKALMKTMGKVGLCTVESYSCGEFFEPNFLDTEDRVLKKYF
FT                   PNIKTPVGGAGFASIAQMAVDWHQSALRVQGENDVPLLGLFKERAEGAGHSYGTIAVRT
FT                   FIDMTEQPVRFADKPREEDNFIRLMTLAKLDNAFHIKTKSFADSSFERIPDEVIDNFTI
FT                   TADYRQFSSLMQEERKRRPAALRDILAFPADLTHVDSEAEFTRKLGRYSLVNNGFAVRG
FT                   LVCEAVAECEGQFRLRLTDEVSGLKSEQERLTTLCGVLAKRFGEEISRAEVTADALLLT
FT                   ASGTAADYLARIFTIAPALPLSEVQPAHEITRTFASGAMSHGALVAPAHEAVAHGTNMV
FT                   GGMSNCGEGGEHYSRHGTLRASRIKQLASGRFGVWAAYLTDPMLEELEIKIGQGAKPGE
FT                   GGQLPSAKVTVEIAAARGGTPGVELVSPPPHHDTYSIEDLAQLIHDCKAARVRVIVKLV
FT                   SSEGIGTIAVGVAKAGADVINVAGNTGGTGAASVTSLKYTGRVAEIGIAEVHQALCANG
FT                   LREKVLLRCSGAQQTGSDVVKSALLGGDSFEFGTTALMMLKCVMAKNCNVKCPAGLTTN
FT                   AEAFDGDPRQLAQYFINVAHEVREMLARLGLRSLREARGRSDLLHLMDHPLEVGKLDLR
FT                   AMLTVVPEVKISHPVYLEKDFVLDNGWIARLQEQLVAEGSRKIVLGNGITLNNRHKSVG
FT                   GQLAIDIERLLNHQLNAEHVARIPAALQDDRGRRYLAPVTVTIVTSGSAGQSYGVFCND
FT                   GMRLQHQGTCNDGVGKGQCGGEIIVMSPGGGSQDAEGNVLIGNFALFGATGGRLFAQGQ
FT                   AGDRFAVRNSGATAVVEGVGDFCCEYMTNGAVLNLGTYGTGFGNGMSGGFAYQYDPYGT
FT                   LAGSAAADSVMLGAIGDDNEMARVHQQAVLTMLNWHLEATGSPRARWLLDHWETESQHF
FT                   VYVMPRSLLLYQDGAEILKAKARKDLLEELSASLAGHQVAKFKAAWRAGKPIANGSVPV
FT                   YGAMDTPEMLVLLNNYTVLSCAQQLALSRLPKGTAVQDLAVEKAVRNLLMTEDFTLIGK
FT                   LQRHGRAAIESYSDEQLACLIGAKRMADYKAALTQRNIRSMDSLATYGWILYQDACNRE
FT                   VLGRLPDFEELFARAALPELAAAVGKLAG"
FT   gene            395283..397622
FT                   /gene="arcB"
FT                   /locus_tag="EPYR_00336"
FT   CDS_pept        395283..397622
FT                   /transl_table=11
FT                   /gene="arcB"
FT                   /locus_tag="EPYR_00336"
FT                   /product="aerobic respiration sensor-response protein"
FT                   /function="Signal transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="Aerobic respiration control hybrid signal
FT                   transduction histidine kinase ArcB, Histidine kinase-,DNA
FT                   gyrase B-, and HSP90-like ATPase, sensory_box: PAS domain
FT                   S-box"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00336"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72638"
FT                   /db_xref="GOA:D2TDH4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014409"
FT                   /db_xref="InterPro:IPR027460"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR040642"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDH4"
FT                   /protein_id="CAY72638.1"
FT                   /translation="MKQIRLLAQYYVDLMMKLGLIRFSLLLASALVVLAMIVQMAVTMV
FT                   LHGRVESIDMVRSVFFGLLITPWAVYFLSVVVEQLEESRQRLVRLVDKLEEMRKRDLEL
FT                   NQQMQGNITRLNQEIADRIKAEEERLQVMARLKDEMSRREEAQIELEQQSSFLRSFLDA
FT                   SPDLVFYRNSDRQFSGCNRAMELLTGKSEKQLIGLSPKEVYDDDAATKVLETDEKVFHH
FT                   NVSLTYEQWLQYPDGRKACFEIRKVPYYDRVGKRSGLMGFGRDITERKRYQDALENASR
FT                   EKTTFISTISHELRTPLNGIVGLSRILLDTHLDQEQLKYLKTIHVSAITLGNIFNDVIE
FT                   MDKMERRKVQLDTQPMDFTGFLADLENISGLLVEPKGLKFVLETQPPLPHKILADGTRL
FT                   RQILWNLIGNAVKFTRQGEIVVRVGYQSEECLRFDVQDSGIGIPQDEQDKIFAMYYQVK
FT                   DRRGGKPATGTGIGLAVSRRLAQSMGGDISVSGAPGKGSCFTLTLNAPRVAEVSQDERA
FT                   EDELPLPALHVLLVEDIELNVVVARSVLEKLGNSVEVAMTGQAALEMFDPDEFDLVLLD
FT                   IQLPDMTGLDVARAIHLRYATARLPPLVALTANVLKDKQEYLDAGMDDVLSKPLAVSAL
FT                   TAMIKRYWDYQAEDLTTTPERSMGEKELALLDLPMLEQYMELVGPGLIHQSLAMFEQMM
FT                   PGYLAALDSNMMARDQKGIAEEGHKIKGAAGSVGLMHLQQVAKQIQSPELPAWWDNVQE
FT                   WIDELKLEWRNDMEVLRQWVTDAEKK"
FT   gene            398412..399137
FT                   /gene="mtgA"
FT                   /locus_tag="EPYR_00337"
FT   CDS_pept        398412..399137
FT                   /transl_table=11
FT                   /gene="mtgA"
FT                   /locus_tag="EPYR_00337"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /function="Membrane carboxypeptidase (penicillin-binding
FT                   protein)"
FT                   /EC_number="2.4.2.-"
FT                   /note="Monofunctional biosynthetic peptidoglycan
FT                   transglycosylase (Monofunctional TGase), Monofunctional
FT                   biosynthetic peptidoglycan
FT                   transglycosylase,Transglycosylase, mono_pep_trsgly:
FT                   monofunctional biosynthetic peptidoglycan transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00337"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72639"
FT                   /db_xref="GOA:D2TDH5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDH5"
FT                   /protein_id="CAY72639.1"
FT                   /translation="MSRGQNSRLTRIRYWIIRLVLGITALWLSGLVIFAFVPVLFSAVM
FT                   VERQLGAWFSGDFSYVAHSDWVDMPDISPWMALAVIASEDQKFPTHWGFDVAAIQSVLD
FT                   SDGEKKAMRGASTLSQQTAKNVFLWDGRSWLRKGLEAGLTVGIESVWTKRRILTVYLNV
FT                   AEMGKGVFGVEEASQRYFHKPASRLTRSEAALLAAVLPDPLHFRANAPSAYLRQRQQWI
FT                   LRQMRQLGGENFLLEHKLR"
FT   gene            complement(399212..399484)
FT                   /gene="ptsO"
FT                   /locus_tag="EPYR_00338"
FT   CDS_pept        complement(399212..399484)
FT                   /transl_table=11
FT                   /gene="ptsO"
FT                   /locus_tag="EPYR_00338"
FT                   /product="Phosphocarrier protein NPr (Nitrogen-related
FT                   HPr)"
FT                   /function="Phosphotransferase system, HPr-related proteins"
FT                   /note="Phosphotransferase system, phosphocarrier HPr
FT                   protein, PTS HPr component phosphorylation
FT                   site,PTS_HPr_family: phosphocarrier, HPr family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00338"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72640"
FT                   /db_xref="GOA:D2TDH6"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDH6"
FT                   /protein_id="CAY72640.1"
FT                   /translation="MSIKQTVEIKNKLGMHARPAMKLFELVQSFDAEVLLRNESGTEAE
FT                   ASSVIALLMLDSAKGGHIEVEASGPEEEKALAAVIDLFDAGFDED"
FT   gene            complement(399481..400335)
FT                   /gene="yhbJ"
FT                   /locus_tag="EPYR_00339"
FT   CDS_pept        complement(399481..400335)
FT                   /transl_table=11
FT                   /gene="yhbJ"
FT                   /locus_tag="EPYR_00339"
FT                   /product="UPF0042 protein LSA0526"
FT                   /function="ATPase involved in DNA replication"
FT                   /note="P-loop ATPase protein, P-loop ATPase protein family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00339"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72641"
FT                   /db_xref="GOA:D2TDH7"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDH7"
FT                   /protein_id="CAY72641.1"
FT                   /translation="MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVVLLPDLANSLA
FT                   ERNMSAAVSIDVRNMPETPEVFEHALTSLPDSFSPQLLFLDADRNTLIRRYSDTRRLHP
FT                   LSSKNLSLESAIDEENVLLEPLRSRADLIIDTSEMSVHELAEMLRTRLLGKRERELTMV
FT                   FESFGFKHGIPIDADYVFDVRFLPNPHWDPKLRPMTGLDRPVAAFLDRHTEVHNFIYQT
FT                   RSYLELWLPMLETNNRSYLTVAIGCTGGKHRSVYIAEQLADYFRSRGKNVQSRHRTLEK
FT                   RKT"
FT   gene            complement(400530..401012)
FT                   /gene="ptsN"
FT                   /locus_tag="EPYR_00340"
FT   CDS_pept        complement(400530..401012)
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /locus_tag="EPYR_00340"
FT                   /product="phosphotransferase system enzyme IIA"
FT                   /function="Phosphotransferase system
FT                   mannitol/fructose-specific IIA domain (Ntr-type)"
FT                   /EC_number="2.7.1.69"
FT                   /note="Nitrogen regulatory protein (Enzyme IIA-NTR)
FT                   [Includes: Phosphotransferase enzyme IIA component (PTS
FT                   system EIIA component)], Phosphotransferase
FT                   system,phosphoenolpyruvate-dependent sugar EIIA
FT                   2,Phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2, nitro_reg_IIA: PTS IIA-like
FT                   nitrogen-regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00340"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72642"
FT                   /db_xref="GOA:D2TDH8"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDH8"
FT                   /protein_id="CAY72642.1"
FT                   /translation="MMNNDLKLELDSVLSVACTRNDVHCQSKKRALEIISELAAKQLNL
FT                   PQQIIFDAILTRERMGSTGIGNGIAIPHGKLEEDTLRAVGVFIRLENPIAFDAIDNQPV
FT                   DLLFALLVPADQCKTHLHTLSLVAKRLADKTVLRRLRAAQSDEELYQIITEDHHRI"
FT   gene            complement(401191..401478)
FT                   /gene="yhbH"
FT                   /locus_tag="EPYR_00341"
FT   CDS_pept        complement(401191..401478)
FT                   /transl_table=11
FT                   /gene="yhbH"
FT                   /locus_tag="EPYR_00341"
FT                   /product="probable sigma(54) modulation protein"
FT                   /function="Ribosome-associated protein Y (PSrp-1)"
FT                   /note="Ribosomal protein S30Ae/sigma 54 modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00341"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72643"
FT                   /db_xref="GOA:D2TDH9"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDH9"
FT                   /protein_id="CAY72643.1"
FT                   /translation="MQLNITGQHVEITEPLREFVTAKFAKLEHYFDRINQVYIVLKVEK
FT                   VTQIADATLHVNGGELHATSEDKDMYAAIDGLIDKLTRQLNKHKEKLKQH"
FT   gene            complement(401501..402934)
FT                   /gene="rpoN"
FT                   /locus_tag="EPYR_00342"
FT   CDS_pept        complement(401501..402934)
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="EPYR_00342"
FT                   /product="RNA polymerase sigma-54 factor"
FT                   /function="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma54 homolog"
FT                   /note="RNA polymerase sigma factor 54"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00342"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72644"
FT                   /db_xref="GOA:D2TDI0"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDI0"
FT                   /protein_id="CAY72644.1"
FT                   /translation="MKQGLQLRLSQQLAMTPQLQQAIRLLQLSTLELQQEIQLALESNP
FT                   LLEQTDIHEEVDSREYQETEALDTREALEQKDMPEELPLDATWDEIYTAGTPSGTGTDY
FT                   HDDELPVYQGETTQTLQDYLMWQVELTPFSDTDRAIATSIVDAVDSTGYLTVSLEEILD
FT                   SMGNDELAPEEIEAVLKRVQRFDPVGVCARDLRDCLLVQLSQFAQEYPFLKEARLIVSE
FT                   HLDLLANHDFRSLMRVTRLKEEVLKSAMLLIQTLDPRPGQSINTQEPEYVIPDVLVRKI
FT                   SHRWAVELNADSLPRLKINQHYVSLGSNSRSDSDSQFIRSHLQEAKWLIKSLESRNDTL
FT                   LKVTRCIVDRQQAFFEQGEEFMRPMVLADIASAVDMHESTISRVTTQKYLHSPRGIFEL
FT                   KYFFSSHVNTEGGGEASSTAIRALVKKLVSAENPAKPLSDSKLTSMLSEQGIMVARRTV
FT                   AKYRESLSIPPSNQRKQLV"
FT   gene            complement(402983..403708)
FT                   /gene="yhbG"
FT                   /locus_tag="EPYR_00343"
FT   CDS_pept        complement(402983..403708)
FT                   /transl_table=11
FT                   /gene="yhbG"
FT                   /locus_tag="EPYR_00343"
FT                   /product="LPS export porin complex, cytoplasmic ABC-type
FT                   ATPase subunit"
FT                   /EC_number="3.6.3.-"
FT                   /note="LPS export porin complex, cytoplasmic ABC-type
FT                   ATPase subunit, TC 1.B.42.1.2 Uncharacterized ABC
FT                   transporter ATP-binding protein yhbG"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00343"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72645"
FT                   /db_xref="GOA:D2TDI1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDI1"
FT                   /protein_id="CAY72645.1"
FT                   /translation="MATLIAENLAKAYKGRRVVEDVSLQVKSGEIVGLLGPNGAGKTTT
FT                   FYMVVGIVPRDAGRIVIDEEDISILPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLQ
FT                   IRDDLTSEQREDRANELLAEFHIAHLRDSLGQALSGGERRRVEIARALAANPKFILLDE
FT                   PFAGVDPISVIDIKKIIEHLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPE
FT                   AILADEQVKRVYLGEEFRL"
FT   gene            complement(403714..404265)
FT                   /gene="yhbN"
FT                   /locus_tag="EPYR_00344"
FT   CDS_pept        complement(403714..404265)
FT                   /transl_table=11
FT                   /gene="yhbN"
FT                   /locus_tag="EPYR_00344"
FT                   /product="LPS export porin complex, periplasmic chaparone
FT                   precursor"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="LPS export porin complex, periplasmic chaparone
FT                   precursor, TC 1.B.42.1.2 Protein yhbN"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00344"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72646"
FT                   /db_xref="GOA:D2TDI2"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDI2"
FT                   /protein_id="CAY72646.1"
FT                   /translation="MKFKMNNKSLKLLTASLLLAISVPAFALTGDSNKPVNIDSENQAL
FT                   DMQGNVATFTGNVVVTQGSIKITADKVVVTRPGGDSKKTIVDAYGNLATFYQMQDNGKP
FT                   VQGHAQKMHYELASDLVELTGNAYLEQLDSNVKGDRITYLVKEQKMQAFGNTGRRVTTV
FT                   LVPSQLQDKDPSSNGQKKSN"
FT   gene            complement(404243..404812)
FT                   /gene="yrbK"
FT                   /locus_tag="EPYR_00345"
FT   CDS_pept        complement(404243..404812)
FT                   /transl_table=11
FT                   /gene="yrbK"
FT                   /locus_tag="EPYR_00345"
FT                   /product="LPS export porin complex, LptC subunit"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="LPS export porin complex, LptC subunit, TC
FT                   1.B.42.1.2 Uncharacterized protein yrbK"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00345"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72647"
FT                   /db_xref="GOA:D2TDI3"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDI3"
FT                   /protein_id="CAY72647.1"
FT                   /translation="MSKTRRWITLILATIAIVLIGWNLTDSDNSEGAVTSNDTEPTYMS
FT                   DNSRTLVYSPTGAMSYKLVSDKATYYATDAVSWFDNPVMTTYDDNKTPSWTVRADKARL
FT                   TNDRMLYLYGHVQVDSLTQDAQLERIKTDNAQVNLTTQDVTSEDRVNLYGRSFNSTGMK
FT                   MRGNLRNKTAELIEKVKTSYEIQNEQ"
FT   gene            complement(404809..405375)
FT                   /gene="yrbI"
FT                   /locus_tag="EPYR_00346"
FT   CDS_pept        complement(404809..405375)
FT                   /transl_table=11
FT                   /gene="yrbI"
FT                   /locus_tag="EPYR_00346"
FT                   /product="putative 3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase"
FT                   /function="Low specificity phosphatase (HAD superfamily)"
FT                   /EC_number="3.1.3.45"
FT                   /note="3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
FT                   (KDO 8-P phosphatase), YrbI family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00346"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72648"
FT                   /db_xref="GOA:D2TDI4"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDI4"
FT                   /protein_id="CAY72648.1"
FT                   /translation="MSHPATTVETCYGPVSQQVITKAQHIKLLICDVDGVMSDGVVYQG
FT                   NNGEELKGFNVRDGYGIRCLLTSAIEVAIITGRKAKLLEDRCTTLGIHHLYQGQSDKVL
FT                   AFRELLDKLALGAHQVAYIGDDLIDWPVMAQVGLSVTVADAHPILLPRADYVTRLAGGR
FT                   GAVREICDLILIAQGKFATAIGQSV"
FT   gene            complement(405392..406378)
FT                   /gene="yrbH"
FT                   /locus_tag="EPYR_00347"
FT   CDS_pept        complement(405392..406378)
FT                   /transl_table=11
FT                   /gene="yrbH"
FT                   /locus_tag="EPYR_00347"
FT                   /product="putative isomerase"
FT                   /function="Predicted sugar phosphate isomerase involved in
FT                   capsule formation"
FT                   /EC_number="5.3.1.13"
FT                   /note="KpsF/GutQ, SIS domain, kpsF: sugar
FT                   isomerase,KpsF/GutQ family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00347"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72649"
FT                   /db_xref="GOA:D2TDI5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDI5"
FT                   /protein_id="CAY72649.1"
FT                   /translation="MAHITAENDFDFQQAGKEVLQIEREGLEQLDRYINDDFTHTCDLI
FT                   YRCRGKVVVMGMGKSGHIGKKIAATFASTGTPAFFVHPAEASHGDLGMVTSDDVVIAIS
FT                   NSGESSEILALIPVLKRLHVTLICITSRPESAMGRAADIHLCVKVPQEACPLGLAPTTS
FT                   TTATLVMGDALAVALLKARGFTQEDFALSHPGGALGRKLLLRVDDIMHCGNAMPHVSRD
FT                   ASLRDALLEITQKNMGMTVICDASMQIEGIFTDGDLRRVFDMGIDIQHASIESVMTPGG
FT                   IRVRPGTLAVDALNLMQTRNITCVMVADNDRLIGVIHMHDMLRAGVV"
FT   gene            complement(406394..407374)
FT                   /gene="yrbG"
FT                   /locus_tag="EPYR_00348"
FT   CDS_pept        complement(406394..407374)
FT                   /transl_table=11
FT                   /gene="yrbG"
FT                   /locus_tag="EPYR_00348"
FT                   /product="putative cation/proton exchanger"
FT                   /function="Ca2+/Na+ antiporter"
FT                   /note="Ca(2+)/H(+) exchanger, TC 2.A.19.5.1 putative
FT                   Ca2+:H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00348"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72650"
FT                   /db_xref="GOA:D2TDI6"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDI6"
FT                   /protein_id="CAY72650.1"
FT                   /translation="MLVATALLIIGLVLLVYGADRLVFSAAILCRSLGIPPLIIGMTVV
FT                   GIGTSLPEMIVSFSAAARGQMDIAIGTAMGSNIANILLILGAAALLHPLTVHSNLIRRE
FT                   LPLMLLVTLLCSVMLFDNQLSRVDGLTLMAIAAVYLLFIIRIARRAERENNDSLPREQL
FT                   AELPRDDTGNTVAFLWLAVALIVLPMSTNMVIDNATVIADYFGVSELVIGLTIISVGTS
FT                   LPELATVIAGALKGEDDIAIGNLIGSNIYNLAIVLGIPALLHPGAFDAAAFARDYWVML
FT                   GVSALFTLVCLQRSRRIGRLAGALLLCGFICWVGMLYQFPSVAFW"
FT   gene            407598..408410
FT                   /gene="yrbF"
FT                   /locus_tag="EPYR_00349"
FT   CDS_pept        407598..408410
FT                   /transl_table=11
FT                   /gene="yrbF"
FT                   /locus_tag="EPYR_00349"
FT                   /product="putative ABC transport system, ATP-binding
FT                   component"
FT                   /function="ABC-type transport system involved in resistance
FT                   to organic solvents, ATPase component"
FT                   /note="ABC transporter related, TC 3.A.1.-.-The ATP-binding
FT                   Cassette (ABC) Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00349"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72651"
FT                   /db_xref="GOA:D2TDI7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDI7"
FT                   /protein_id="CAY72651.1"
FT                   /translation="MSQTETNLVDVRGVSFSRGNRPIFDNISLTVPKGKVTAIMGPSGI
FT                   GKTTLLRLIGGQLPPDSGEIWFNGENIPALSRSRLYEARKKMSMLFQSGALFTDLSVFD
FT                   NVAWPLREHSHLPAPLLRSTVMMKLEAVGLRGAANLKPSELSGGMARRVALARAIALEP
FT                   DLIMFDEPFVGQDPITMGVLVKLIDELNHSLGVTCIVVSHDVPEVLSIADYAYIVAGQK
FT                   VIAQGTAPDLRKNDDARVRQFIDGIADGPVPFRFPAGDYLQDLVGSGS"
FT   gene            408418..409200
FT                   /gene="yrbE"
FT                   /locus_tag="EPYR_00350"
FT   CDS_pept        408418..409200
FT                   /transl_table=11
FT                   /gene="yrbE"
FT                   /locus_tag="EPYR_00350"
FT                   /product="UPF0393 inner membrane protein yrbE"
FT                   /function="ABC-type transport system involved in resistance
FT                   to organic solvents, permease component"
FT                   /note="Protein of unknown function DUF140, Domain of
FT                   unknown function DUF140, TIGR00056: conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00350"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72652"
FT                   /db_xref="GOA:D2TDI8"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDI8"
FT                   /protein_id="CAY72652.1"
FT                   /translation="MFLQALASLGRQGINFCASLGRAGLMLFHALFGIPRFRKHAPLLV
FT                   KQLYNIGVLSLLIVVVSGLFIGMVLGLQGYLILKTYGAEASLGMMVALSLLRELGPVVS
FT                   ALLFAGRAGSALTAEIGLMKATEQLSSMEMMAVDPLRRIISPRFWAGFISMPLLTLIFV
FT                   AVGILGGALVGVSWKGIDSGFFWSAMQNAVDLQTDIINCTIKSAVFAVTVTWIALFNGY
FT                   DAIPTSEGISRATTRTVVHASLAVLGLDFVLTALMFGN"
FT   gene            409205..409753
FT                   /gene="yrbD"
FT                   /locus_tag="EPYR_00351"
FT   CDS_pept        409205..409753
FT                   /transl_table=11
FT                   /gene="yrbD"
FT                   /locus_tag="EPYR_00351"
FT                   /product="Uncharacterized protein yrbD precursor"
FT                   /function="ABC-type transport system involved in resistance
FT                   to organic solvents, periplasmic component"
FT                   /note="Mammalian cell entry related, mce related protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00351"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72653"
FT                   /db_xref="GOA:D2TDI9"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDI9"
FT                   /protein_id="CAY72653.1"
FT                   /translation="MQTKKSEIWVGAFLLLALCAIIFLCLRVTDLKSLGNVSTWKLHAT
FT                   FDNVGGLKPGSPVKIGGVVIGRVSDIVLDPKTYSPKVSMDIEDQYNNIPDTSSLAVRTS
FT                   GLLGEQYLALNIGFDDPEMGTAILKNGGTVQDTKSAMVLEDLIGQFLYKSGNADEKSSP
FT                   AAGGKGAQGQVAPAAANNP"
FT   gene            409765..410400
FT                   /gene="yrbC"
FT                   /locus_tag="EPYR_00352"
FT   CDS_pept        409765..410400
FT                   /transl_table=11
FT                   /gene="yrbC"
FT                   /locus_tag="EPYR_00352"
FT                   /product="Protein yrbC precursor"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00352"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72654"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="InterPro:IPR042245"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDJ0"
FT                   /protein_id="CAY72654.1"
FT                   /translation="MLKRLLMVAMLAIAPLAAHAEADQTNPYKLMDEAAAKTFSRLKNE
FT                   QPAIKKDPDYLRQIVREELLPYVQVKYAGALVLGRYYKDATPAQRDAYFKAFGDYLAQA
FT                   YGQALAMYNGQTYQIAPEQPTGGANIIAIRVTIVDPNGRPPVRLDFQWRKNSVNGHWQA
FT                   FDMIAEGVSMITTKQNEWSDVLRQKGIDGLTERLKSYAQQPVTLNKSS"
FT   gene            410400..410696
FT                   /gene="yrbB"
FT                   /locus_tag="EPYR_00353"
FT   CDS_pept        410400..410696
FT                   /transl_table=11
FT                   /gene="yrbB"
FT                   /locus_tag="EPYR_00353"
FT                   /product="Uncharacterized protein yrbB"
FT                   /function="Predicted NTP binding protein (contains STAS
FT                   domain)"
FT                   /note="Sulphate transporter/antisigma-factor antagonist
FT                   STAS"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00353"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72655"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDJ1"
FT                   /protein_id="CAY72655.1"
FT                   /translation="MNEQLRWEIEAGQLRLIGELERETLLPLWQQREAVMERVETIDVS
FT                   ALERVDSGGLALLVHLRQIAIDNGRKPRFSGVTDKLNSLITLYNLQKIIICCD"
FT   gene            410923..411177
FT                   /gene="yrbA"
FT                   /locus_tag="EPYR_00354"
FT   CDS_pept        410923..411177
FT                   /transl_table=11
FT                   /gene="yrbA"
FT                   /locus_tag="EPYR_00354"
FT                   /product="Uncharacterized protein yrbA"
FT                   /note="BolA-like protein, BolA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00354"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72656"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDJ2"
FT                   /protein_id="CAY72656.1"
FT                   /translation="MENSEIQSVLMSALPLQEVHVTGEGSHFQVIAVGELFGELSRVKK
FT                   QQTVYAPLMAYIADNRIHAVSIKTYTPEEWARDRKLNGF"
FT   gene            411254..412516
FT                   /gene="murA"
FT                   /locus_tag="EPYR_00355"
FT   CDS_pept        411254..412516
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="EPYR_00355"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /function="UDP-N-acetylglucosamine enolpyruvyl transferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="UDP-N-acetylglucosamine 1-carboxyvinyltransferase
FT                   (Enoylpyruvate transferase) (EPT)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00355"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72657"
FT                   /db_xref="GOA:D2TDJ3"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDJ3"
FT                   /protein_id="CAY72657.1"
FT                   /translation="MDKFRVQGPTRLSGEVTISGAKNAALPILFAALLAEEPVEIQNVP
FT                   KLKDIDTTMKLLGQLGVKAERNGSVYLDASNVDIYCAPYELVKTMRASIWALGPLVARF
FT                   GQGQVSLPGGCAIGARPVDLHITGLEQLGAEIKLEEGYVKASVAGRLKGAHIVMDKVSV
FT                   GATVTIMSAATLATGTTVIENAAREPEIVDTAHFLNTLGAKITGAGSDRITIEGVDRLG
FT                   GGVYRVLPDRIETGTFLVAGAISGGKVICRAAQPDTLDAVLAKLREAGADIEVGEDWIS
FT                   LDMHGKRPKAVNLRTAPHPGFPTDMQAQFSLLNLVAEGTGVITETIFENRFMHVPELVR
FT                   MGAHAEIESHTLICHGVEKLSSAQVMATDLRASASLVLAGCIAEGTTLVDRIYHIDRGY
FT                   EHIEDKLIALGANIQRVSGED"
FT   gene            complement(412567..412827)
FT                   /gene="nlp"
FT                   /locus_tag="EPYR_00356"
FT   CDS_pept        complement(412567..412827)
FT                   /transl_table=11
FT                   /gene="nlp"
FT                   /locus_tag="EPYR_00356"
FT                   /product="Sugar fermentation stimulation protein B"
FT                   /note="Sugar fermentation stimulation protein B (Ner-like
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00356"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72658"
FT                   /db_xref="GOA:D2TDJ4"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR038722"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDJ4"
FT                   /protein_id="CAY72658.1"
FT                   /translation="MTHNPQDWHPADIIAALRKKGTTLAAQSRLAGLSSSTLANALCRP
FT                   WPKGEWIIATALNIHPSKIWPSRYFDVKTRCLIDRQQRIRR"
FT   gene            complement(413138..414112)
FT                   /gene="ispB"
FT                   /locus_tag="EPYR_00357"
FT   CDS_pept        complement(413138..414112)
FT                   /transl_table=11
FT                   /gene="ispB"
FT                   /locus_tag="EPYR_00357"
FT                   /product="octaprenyl diphosphate synthase"
FT                   /function="Geranylgeranyl pyrophosphate synthase"
FT                   /EC_number="2.5.1.-"
FT                   /note="Octaprenyl-diphosphate synthase (Octaprenyl
FT                   pyrophosphate synthetase) (OPP synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00357"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72659"
FT                   /db_xref="GOA:D2TDJ5"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDJ5"
FT                   /protein_id="CAY72659.1"
FT                   /translation="MNLEQINELTAQDMADVNATILDQLNSDVSLINQLGYYIINGGGK
FT                   RIRPMIAVLAARAINDYAGKQHITVAALIEFIHTATLLHDDVVDESDMRRGKATANAAF
FT                   GNAASVLVGDFIYTRAFQMMTSLGSLKVLALMSEAVNVIAEGEVLQLMNCNDPDITEES
FT                   YMRVIYSKTARLFEAAAQSSAILAGASEAEEQALQDYGRYIGTAFQLIDDLLDYSADGE
FT                   TLGKNVGDDLSEGKPTLPLLHAMRNGTPEQASMIRSAIEEGNGRHLLESVLETMNQCGS
FT                   LGWTRNAAEKEADKAIAALEVLPKSPWRTALEALAHMSVQRTF"
FT   gene            414370..414681
FT                   /gene="rplU"
FT                   /locus_tag="EPYR_00358"
FT   CDS_pept        414370..414681
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="EPYR_00358"
FT                   /product="50S ribosomal protein L21"
FT                   /function="Ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00358"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72660"
FT                   /db_xref="GOA:D2TDJ6"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDJ6"
FT                   /protein_id="CAY72660.1"
FT                   /translation="MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETIEFDQVLMIANGE
FT                   DVKIGAPLVSGGVIKAEIVAHGRGDKIKIVKFRRRKHYRKQQGHRQWFTDVKITGISA"
FT   gene            414697..414954
FT                   /gene="rpmA"
FT                   /locus_tag="EPYR_00359"
FT   CDS_pept        414697..414954
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="EPYR_00359"
FT                   /product="50S ribosomal protein L27"
FT                   /function="Ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00359"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72661"
FT                   /db_xref="GOA:D2TDJ7"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDJ7"
FT                   /protein_id="CAY72661.1"
FT                   /translation="MAHKKAGGSTRNGRDSNAKRLGVKRFGGESVLAGSIIVRQRGTKF
FT                   HAGTNVGCGRDHTLFATANGKVLFEVKGPNNRKYISIVAE"
FT   gene            415434..415457
FT                   /locus_tag="EPYR_00360"
FT   CDS_pept        415434..415457
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00360"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72662"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72662.1"
FT                   /translation="MGYGALA"
FT   gene            415726..416904
FT                   /gene="yhbZ"
FT                   /locus_tag="EPYR_00361"
FT   CDS_pept        415726..416904
FT                   /transl_table=11
FT                   /gene="yhbZ"
FT                   /locus_tag="EPYR_00361"
FT                   /product="Uncharacterized GTP-binding protein BU389"
FT                   /function="Predicted GTPase"
FT                   /note="GTP-binding protein Obg/CgtA, GTP1/OBG, Obg_CgtA:
FT                   GTP-binding protein Obg/CgtA"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00361"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72663"
FT                   /db_xref="GOA:D2TDJ9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDJ9"
FT                   /protein_id="CAY72663.1"
FT                   /translation="MKFVDEATILVVAGDGGNGCVSFRREKYIPRGGPDGGDGGDGGDV
FT                   YMQADENLNTLIDYRFEKSFRAERGQNGQSRDCTGKRGNDILIKVPVGTRIIDQGTGET
FT                   LGDMTHHQQKMMVAKGGWHGLGNTRFKSSVNRTPRQKTMGTPGEKRDLQLELMLLADVG
FT                   MLGLPNAGKSTFIRAVSAAKPKVADYPFTTLVPSLGVVRMDSEQSFVVADIPGLIEGAS
FT                   DGAGLGIRFLKHLERCRVLLHTIDLAPIDESDPVENARIILGELEKYSDKLFQKPRWLV
FT                   FNKVDLLDEEEAESRAKTIAQALGWTDKYYLISAANRTGVNALCWDVMAFIKANPKEAE
FT                   LAAKQPEKVEFMWDDYHRQQLEEAQPEVEEDDDWDDDWDEDDEEGVETIYQR"
FT   gene            complement(417050..417349)
FT                   /gene="basR"
FT                   /locus_tag="EPYR_00362"
FT   CDS_pept        complement(417050..417349)
FT                   /transl_table=11
FT                   /gene="basR"
FT                   /locus_tag="EPYR_00362"
FT                   /product="probable transcriptional regulator ycf27"
FT                   /function="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /note="probable transcriptional regulator ycf27 (OmpR-like
FT                   protein), CheY-like, Response regulator receiver domain,
FT                   cztR_silR_copR: heavy metal response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00362"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72664"
FT                   /db_xref="GOA:D2TDK0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDK0"
FT                   /protein_id="CAY72664.1"
FT                   /translation="MLILTARDDLSDRVKGLDAGADHYLVKPFALAELKARVRALIRRY
FT                   QVRSDNLLQHGDITLNLSSQQVAVDLQPAEMTPKEFALLTRLLMRIGQTVHRET"
FT   gene            complement(417343..417600)
FT                   /gene="basR"
FT                   /locus_tag="EPYR_00363"
FT   CDS_pept        complement(417343..417600)
FT                   /transl_table=11
FT                   /gene="basR"
FT                   /locus_tag="EPYR_00363"
FT                   /product="probable transcriptional regulator ycf27"
FT                   /function="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /note="probable transcriptional regulator ycf27 (OmpR-like
FT                   protein), CheY-like, Response regulator receiver domain,
FT                   cztR_silR_copR: heavy metal response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00363"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72665"
FT                   /db_xref="GOA:D2TDK1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDK1"
FT                   /protein_id="CAY72665.1"
FT                   /translation="MFTGITEPMKIRIVEDDALLPEGLPCSDGGXGESYAVDCAVNAAQ
FT                   GAAFLHSARYSLVVLDLGLPDRDGADLLRQWRKENRICPC"
FT   gene            complement(417581..419014)
FT                   /gene="dacB"
FT                   /locus_tag="EPYR_00364"
FT   CDS_pept        complement(417581..419014)
FT                   /transl_table=11
FT                   /gene="dacB"
FT                   /locus_tag="EPYR_00364"
FT                   /product="penicillin-binding protein"
FT                   /function="D-alanyl-D-alanine carboxypeptidase (penicillin-
FT                   binding protein 4)"
FT                   /EC_number="3.4.16.4"
FT                   /note="Penicillin-binding protein 4 precursor (PBP-4)
FT                   [Includes: D-alanyl-D-alanine carboxypeptidase
FT                   (DD-peptidase) (DD-carboxypeptidase);
FT                   D-alanyl-D-alanine-endopeptidase
FT                   (DD-endopeptidase)],Beta-lactamase-type transpeptidase
FT                   fold, D-Ala-D-Ala carboxypeptidase 3 (S13) family, PBP4:
FT                   D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00364"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72666"
FT                   /db_xref="GOA:D2TDK2"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDK2"
FT                   /protein_id="CAY72666.1"
FT                   /translation="MRFSRIVTGITCAFMLQAQAAPVEEYSEYLPDGANLALMVQKIGA
FT                   AAPSIDYHSQQMALPASTMKVITALAALLQLGPDYRFHTQLESKGSLSGNTLRGDLVAR
FT                   FGGDPTLTRQDLRNMVNALKKQGVQHIEGNLVIDTSVFASHDKAPGWPWNDMTQCFSAP
FT                   PGAAIVDRNCFSVSLYSAPNPGDKAFIRVASYYPVNMFSEVRTLAKGSPDAQYCELDVV
FT                   PGELNRFTLTGCLTQRAEPLPLAFAIQDGASYAGALLKAELQNAGIDYNGHLVRQTLLT
FT                   QPATILAETRSAPLHDLLRIMLKKSDNMIADTIFRTIGRERFGVPGTWRAGSDAVRQIL
FT                   RQKANIDLGNSIQVDGSGLSRHDLISPATMMQVLQYIAQNDSQLDYISMLPLAGHDGTL
FT                   LYRGGLHEAGVDGKVSAKTGSLQGVYNLAGFMTTASGQRVAFVQFLSGYAVPPQDQRQR
FT                   RIPLVRFESRLYKDVYRNN"
FT   gene            419264..419746
FT                   /gene="greA"
FT                   /locus_tag="EPYR_00365"
FT   CDS_pept        419264..419746
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="EPYR_00365"
FT                   /product="Transcription elongation factor greA"
FT                   /function="Transcription elongation factor"
FT                   /note="Transcription elongation factor greA (Transcript
FT                   cleavage factor greA)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00365"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72667"
FT                   /db_xref="GOA:D2TDK3"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDK3"
FT                   /protein_id="CAY72667.1"
FT                   /translation="MNQIPMTLRGADKLREELEELKTVKRPRIIASIADAREHGDLKEN
FT                   AEYHAAREEQGFCEGRIQEIEAKLSNAQVIDVTKMAGNANGRVIFGATVTVLNVETDEE
FT                   STYRIVGDDEADFKQNLISVNSPMARGLVGKVADDVTVIKTPGGDVEYDIIKVEYL"
FT   gene            complement(420071..420364)
FT                   /gene="yhbY"
FT                   /locus_tag="EPYR_00366"
FT   CDS_pept        complement(420071..420364)
FT                   /transl_table=11
FT                   /gene="yhbY"
FT                   /locus_tag="EPYR_00366"
FT                   /product="CRS2-associated factor 1, mitochondrial
FT                   precursor"
FT                   /function="Predicted RNA-binding protein containing KH
FT                   domain, possibly ribosomal protein"
FT                   /note="CRS1/YhbY, CRS1 / YhbY domain, TIGR00253: conserved
FT                   hypothetical protein TIGR00253"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00366"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72668"
FT                   /db_xref="GOA:D2TDK4"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDK4"
FT                   /protein_id="CAY72668.1"
FT                   /translation="MNLSTKQKQHLKGLAHPLKPVVMLGNNGLTEGVLAEIEQALEHHE
FT                   LIKVKIATEDRETKALIVEAIVRETRAVNVQVIGKTLVLYRPTKERKISIPR"
FT   gene            420492..421121
FT                   /gene="ftsJ"
FT                   /locus_tag="EPYR_00367"
FT   CDS_pept        420492..421121
FT                   /transl_table=11
FT                   /gene="ftsJ"
FT                   /locus_tag="EPYR_00367"
FT                   /product="cell division protein"
FT                   /function="23S rRNA methylase"
FT                   /EC_number="2.1.1.-"
FT                   /note="Ribosomal RNA large subunit methyltransferase J
FT                   (rRNA (uridine-2'-O-)-methyltransferase) (23S rRNA m2U2552
FT                   methyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00367"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72669"
FT                   /db_xref="GOA:D2TDK5"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR004512"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDK5"
FT                   /protein_id="CAY72669.1"
FT                   /translation="MTGKKRSASSSRWLQEHFSDKYVLQAQKKGLRSRAWFKLDEIQQG
FT                   DKLFKHGMTVVDLGAAPGGWSQYVVTQIGSKGRVIACDILPMDPIVGVDFLQGDFREEL
FT                   VLKALLERVGDTQVQVVMSDMAPNMTGTPAVDIPRSMYLCELALEMCRDVLAPGGSFLV
FT                   KVFQGDGFEEYLREIRSLFTKVKIRKPDASRSRSREVYIVATGRKL"
FT   gene            421236..423170
FT                   /gene="ftsH"
FT                   /locus_tag="EPYR_00368"
FT   CDS_pept        421236..423170
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="EPYR_00368"
FT                   /product="cell division protein FtsH"
FT                   /function="ATP-dependent Zn proteases"
FT                   /EC_number="3.4.24.-"
FT                   /note="Peptidase M41, FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00368"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72670"
FT                   /db_xref="GOA:D2TDK6"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDK6"
FT                   /protein_id="CAY72670.1"
FT                   /translation="MAKNLILWLVIAVVLMSVFQSFGPSESNGRRVDYSTFLSEVNQDQ
FT                   VREARINGREINVTKKDSNRYTTYIPVNDPKLLDNLLTKNVKVVGEPPEEPSLLASIFI
FT                   SWFPMLLLIGVWIFFMRQMQGGGGKGAMSFGKSKARMLTEDQIKTTFADVAGCDEAKEE
FT                   VSELVEYLREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFV
FT                   EMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVE
FT                   MDGFEGNEGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPL
FT                   SPDVDAAIIARGTPGFSGADLANLVNEAALFAARGNKRVVSMVEFEKAKDKIMMGAERR
FT                   SMVMTEAQKESTAYHEAGHAIIGRLVPEHDPVHKVTIIPRGRALGVTFFLPEGDAISAS
FT                   RRKLESQISTLYGGRLAEEIIYGVEHVSTGASNDIKVATSIARNMVTQWGFSEKLGPLL
FT                   YADEEGEVFLGRSVAKAKHMSDETARIIDQEVKSLVEINYKRAREILGKNMDILHAMKD
FT                   ALMKYETIDAPQIDDLMARREVRPPAGWEDPGSTNNSDGNGTPQAPRPVDEPNTPNPGN
FT                   TLSEQSGDK"
FT   gene            423256..424092
FT                   /gene="folP"
FT                   /locus_tag="EPYR_00369"
FT   CDS_pept        423256..424092
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="EPYR_00369"
FT                   /product="7,8-dihydropteroate synthase"
FT                   /function="Dihydropteroate synthase and related enzymes"
FT                   /EC_number="2.5.1.15"
FT                   /note="Dihydropteroate synthase (DHPS) (Dihydropteroate
FT                   pyrophosphorylase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00369"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72671"
FT                   /db_xref="GOA:D2TDK7"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDK7"
FT                   /protein_id="CAY72671.1"
FT                   /translation="MKLFARDAVLDLSHPHVMGILNVTPDSFSDGGKHNELIQALTHAN
FT                   EMINAGATIIDVGGESTRPGAAEVSTEQELDRVIPVVEAIAQRFEVWISVDTSKPEVIR
FT                   EAACAGAHIINDIRSLQAPGALAAAAQTGLPVCLMHMQGEPKTMQQSPRYQDVLHDVKT
FT                   FFVENIARCEAAGIKKSQLLLDPGFGFGKNLSHNYQLLAHLADLHHFGLPLLVGMSRKS
FT                   MIGQLLNVGPSQRLTGSLACAVIAAMQGVHILRVHDVKETVEAMRVVEATQSAREK"
FT   gene            424097..425431
FT                   /gene="mrsA"
FT                   /locus_tag="EPYR_00370"
FT   CDS_pept        424097..425431
FT                   /transl_table=11
FT                   /gene="mrsA"
FT                   /locus_tag="EPYR_00370"
FT                   /product="Phosphoglucosamine mutase"
FT                   /function="Phosphomannomutase"
FT                   /EC_number="5.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00370"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72672"
FT                   /db_xref="GOA:D2TDK8"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDK8"
FT                   /protein_id="CAY72672.1"
FT                   /translation="MSERKYFGTDGIRGKVGESPITPDFVLKLGFAAGKVLARHGSKQV
FT                   IIGKDTRISGYMLESALEAGLAAAGLSAAFTGPMPTPAVAYLTRTFRAEAGIVISASHN
FT                   PFDDNGIKFFSTEGTKLPDEVEAAIEAEMEKPITCVESAALGRASRIVDAAGRYIEFCK
FT                   GTFPSQLSLNGLKIVVDCANGATYHIAPNVLRELGATVIAIGDQPDGMNINKGCGATDL
FT                   QLLQTRVLAEKADVGLAYDGDGDRIMMVDHMGHKVDGDQILYLIAREGLRQGELRGGVV
FT                   GTLMSNIGLELALKQLGIPFARAKVGDRYVLEKLKEKGWRLGAENSGHVILLDKTTTGD
FT                   GIVAGLQVLTAMVRNHMSLHDLCSGMKLLPQILVNVRFNGVNDPLEDAQVKSVTAEAET
FT                   ELKGRGRVLLRKSGTEPLIRVMVEGENEAQVSALAHRIADAVKAV"
FT   gene            425741..426073
FT                   /gene="secG"
FT                   /locus_tag="EPYR_00371"
FT   CDS_pept        425741..426073
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="EPYR_00371"
FT                   /product="Protein-export membrane protein secG"
FT                   /function="Preprotein translocase subunit SecG"
FT                   /note="Protein-export membrane protein secG (Preprotein
FT                   translocase band 1 subunit) (P12), TC 3.A.5.1.1
FT                   Protein-export membrane protein secG"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00371"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72673"
FT                   /db_xref="GOA:D2TDK9"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDK9"
FT                   /protein_id="CAY72673.1"
FT                   /translation="MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASGTLFGS
FT                   NGSGNFMTRMTAVLATLFFIISLILGNINSNKTQKGSEWENLTQPAQSQQTQPAKPAAP
FT                   GSDIPQ"
FT   gene            426131..426217
FT                   /locus_tag="EPYR_t019"
FT   tRNA            426131..426217
FT                   /locus_tag="EPYR_t019"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:426165..426167,aa:Leu)"
FT   gene            426554..427006
FT                   /gene="yhbC"
FT                   /locus_tag="EPYR_00372"
FT   CDS_pept        426554..427006
FT                   /transl_table=11
FT                   /gene="yhbC"
FT                   /locus_tag="EPYR_00372"
FT                   /product="UPF0090 protein yhbC"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="Protein of unknown function DUF150,Uncharacterised
FT                   BCR, YhbC family COG0779"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00372"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72674"
FT                   /db_xref="GOA:D2TDL0"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDL0"
FT                   /protein_id="CAY72674.1"
FT                   /translation="MSTLEQKLTELISAPVEALGYELVGIEFVRGRTSTLRIYIDSEDG
FT                   INVDDCADVSHQVSAVMDVEDPITVAYNLEVSSPGLDRPMFTAEHYDRFTGEEVSLVLR
FT                   MAVQNRRKWQGIIKSVEGEMITVAVEGNDEVFALSNIQKANLVPHF"
FT   gene            427031..428536
FT                   /gene="nusA"
FT                   /locus_tag="EPYR_00373"
FT   CDS_pept        427031..428536
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="EPYR_00373"
FT                   /product="Transcription elongation protein nusA"
FT                   /function="Transcription elongation factor"
FT                   /note="Transcription elongation protein nusA (N utilization
FT                   substance protein A) (L factor)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00373"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72675"
FT                   /db_xref="GOA:D2TDL1"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDL1"
FT                   /protein_id="CAY72675.1"
FT                   /translation="MNKEILAVVEAVSNEKSLPREKIFEALESALATATKKKYEQEIDV
FT                   RVSIDRKSGDFDTFRRWLIVDEVTQPTREITLEAAIYEDESLSLGGFVEDQIESVTFDR
FT                   ITTQTAKQVIVQKVREAERAMVVDQFREQEGEIITGVVKKVNRDNISLEVRPNDGSNTN
FT                   AEAVIIREDMLPRENFRPGDRIRGVLYAVRPEARGAQLFVSRSKPEMLIELFRIEVPEI
FT                   AEEVLEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSSELGGERIDIVL
FT                   WDDNPAQFVINAMAPADVASIVVDEDNHTMDIAVEAGNLAQAIGRNGQNVRLASQLSGW
FT                   DLNVMTVDDLQAKHQAEAHAAIDVFTKHLDIDEDFATLLVEEGFSSLEELAYVPIKELL
FT                   EIDGLDEETVEALRDRAKNALTTLALAKEESLGDTQPAEDLLSLEGLERELAFKLAAKG
FT                   VCTLEDLAEQGVDDLSDIDGLSDERAGELIMAARNICWFGDDA"
FT   gene            428561..431251
FT                   /gene="infB"
FT                   /locus_tag="EPYR_00374"
FT   CDS_pept        428561..431251
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="EPYR_00374"
FT                   /product="Translation initiation factor IF-2"
FT                   /function="Translation initiation factor 2 (IF-2; GTPase)"
FT                   /note="Initiation factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00374"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72676"
FT                   /db_xref="GOA:D2TDL2"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDL2"
FT                   /protein_id="CAY72676.1"
FT                   /translation="MTTDVNVKTLAAEIQTPVERLVQQFADAGIQKSETDSVTQHEKET
FT                   LLAHLNRDHGSGSGKLTLQRKTRSTLNVPGTGGKSKAVQIEVRKKRTYVKGDPANAEQA
FT                   EAEAQAEREAEELARREAEEIAQREAQDKAKREAEEQAKREAAEKAKREAAERDKVSNQ
FT                   YTDETTRATQSDKARREAEAAELKRKAEEEAHRKIEEEAKRVAEEARKMAEEKGEEWAV
FT                   VKEVEDTSDYHVTTSTHARAAEDENDAQVEGDRRTRAVRPAKAPVRKKGNKHSEAKTDR
FT                   EEARAQVRGGKGGKRKPSTLQQSFNKPAQAVNRDVIIGETITVAELANKMAVKGSQVIK
FT                   AMMKLGAMATINQVIDQETAQLVAEEMGHKVTLRRENELEEAVMSDRDTDAVLESRAPV
FT                   VTIMGHVDHGKTSLLDYIRSTKVASGEAGGITQHIGAYHVETDNGMVTFLDTPGHAAFT
FT                   AMRARGAQATDIVILVVAADDGVMPQTIEAIQHAKAAKVPVVVAVNKCDKPEADPDRVK
FT                   NELTQYGIIPEEWGGENMFVNVSAKAGTGIDDLLNAILLQAEVLELSAVRQGMASGVVI
FT                   ESFLDKGRGPVATVLVREGTLNKGDIVLCGFEYGRVRAMRDELGREVLTAGPSIPVEIL
FT                   GMSGVPAAGDEATVVRDEKKAREVALYRQGKFREVKLARQQKSKLENMFANMTEGEVSE
FT                   LNIVLKADVQGSVEAISDSLMKLSTDEVKVKIVGSGVGGITETDATLAAASNAILVGFN
FT                   VRADASARRVIDTESLDLRYYSVIYNLIDEVKAAMSGMLAPEYKQQIIGLAAVRDVFKS
FT                   PKFGAIAGCMVTEGNIKRHNPIRVLRDNVVIYEGELESLRRFKDDVNEVRNGMECGIGV
FT                   KNYNDVRVGDMIEVFEIIEIQRTID"
FT   gene            431432..431845
FT                   /gene="rbfA"
FT                   /locus_tag="EPYR_00375"
FT   CDS_pept        431432..431845
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="EPYR_00375"
FT                   /function="Ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00375"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72677"
FT                   /db_xref="GOA:D2TDL3"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDL3"
FT                   /protein_id="CAY72677.1"
FT                   /translation="MAKEFGRPQRVSQELQKEIAIILQREIKDPRLGMMVTVSGVDVSR
FT                   DLAYAKVFVTFLNDKDEAAIKAGLRALGDASGYIRTLLGKAMRLRIVPELTFFYDNSLV
FT                   EGMRMSNLVTNVVRNDEERRGPAEENPEEGKAE"
FT   gene            431845..432789
FT                   /gene="truB"
FT                   /locus_tag="EPYR_00376"
FT   CDS_pept        431845..432789
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="EPYR_00376"
FT                   /product="tRNA pseudouridine 5S synthase"
FT                   /function="Pseudouridine synthase"
FT                   /EC_number="4.2.1.70"
FT                   /note="tRNA pseudouridine synthase B (tRNA pseudouridine 55
FT                   synthase) (Psi55 synthase) (tRNA-uridine isomerase) (tRNA
FT                   pseudouridylate synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00376"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72678"
FT                   /db_xref="GOA:D2TDL4"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDL4"
FT                   /protein_id="CAY72678.1"
FT                   /translation="MSRPRRRGRDIHGVLLLDKPQGLSSNDALQKVKRLYNANRAGHTG
FT                   ALDPLATGMLPICLGEATKFSQYLLDSDKRYRVIARLGLRTDTSDAEGVVVSERPVTFS
FT                   AEALDQALDSFRGETQQIPSMYSALKYQGRKLYEYAREGIEVPRESRSIVVYELLFIRH
FT                   QGNELELEIHVSKGTYIRTIIDDLGEKLGCGAHVTNLRRLQVARYPIERMVTLEQLNAL
FT                   SEEAHRTGISPADLLDPLLMPMDSPVSEYPVVNLLSSVAAYFKQGMPVQVAGAPESGLV
FT                   RVTEGEQQKFIGMAEIADDGRVAPRRLVVEYSD"
FT   gene            432897..433166
FT                   /gene="rpsO"
FT                   /locus_tag="EPYR_00377"
FT   CDS_pept        432897..433166
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="EPYR_00377"
FT                   /product="30S ribosomal protein S15"
FT                   /function="Ribosomal protein S15P/S13E"
FT                   /note="Ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00377"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72679"
FT                   /db_xref="GOA:D2TDL5"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDL5"
FT                   /protein_id="CAY72679.1"
FT                   /translation="MSLSNETKAKIVADFGRDANDSGSTEVQVALLTAQINHLQGHFSE
FT                   HKKDHHSRRGLLRMVSQRRKLLDYLKRKDVARYTSLIERLGLRR"
FT   gene            433385..435601
FT                   /gene="pnp"
FT                   /locus_tag="EPYR_00378"
FT   CDS_pept        433385..435601
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /locus_tag="EPYR_00378"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /function="Polyribonucleotide nucleotidyltransferase
FT                   (polynucleotide phosphorylase)"
FT                   /EC_number="2.7.7.8"
FT                   /note="Polyribonucleotide nucleotidyltransferase
FT                   (Polynucleotide phosphorylase) (PNPase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00378"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72680"
FT                   /db_xref="GOA:D2TDL6"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDL6"
FT                   /protein_id="CAY72680.1"
FT                   /translation="MSLVARMQNEDLKPTAGKNTRPDVKELTLLNPIVKKFQYGQHTVT
FT                   LETGMMARQATAAVMVSMDDTAVFVTVVGQKKSKPGQDFFPLTVNYQERTYAAGRIPGS
FT                   FFRREGRPSEGETLTSRLIDRPIRPLFPEGFVNEVQVIATVVSVNPQVNPDIVAMIGAS
FT                   AALALSGLPFNGPIGAARVGYLNDQYVLNPTSDELKESKLDLVVAGTKGAVLMVESEAE
FT                   LLSEEQMLGAVVFGHDQQQIVIDNINALVAEAGKPRWDWQPEAVNEALRSRIAALAESR
FT                   LSDAYRITEKQERYAQVDVIKSETTAALLAEDEALDAGEISDLLHALEKDVVRSRILRG
FT                   EPRIDGREKDMIRGLDVRTGVLPRTHGSALFTRGETQALVTATLGTARDAQNLDELMGE
FT                   RTDNFLFHYNFPPYSVGETGMVGSPKRREIGHGRLAKRGVLAVMPKGDAFPYTVRVVSE
FT                   ITESNGSSSMASVCGASLALMDAGVPIKAAVAGIAMGLVKDDNNFVVLSDILGDEDHLG
FT                   DMDFKVAGSREGITALQMDIKIEGITREIMQVALNQAKGARLHILSVMEQAISGPRGDI
FT                   SQFAPRIHTIKISVDKIKDVIGKGGSVIRALTEETGTTIEIEDDGTVKIAATDGEKAKF
FT                   AIRRIEEITAEIEVGRIYNGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVEKVTDYL
FT                   QMGQEVPVKVLEVDRQGRVRLSIKEAGEQAQPEAEAAPATPEAE"
FT   gene            435730..436614
FT                   /gene="yhbM"
FT                   /locus_tag="EPYR_00379"
FT   CDS_pept        435730..436614
FT                   /transl_table=11
FT                   /gene="yhbM"
FT                   /locus_tag="EPYR_00379"
FT                   /product="Glucose repression mediator protein CYC8"
FT                   /function="Lipoprotein NlpI, contains TPR repeats"
FT                   /note="Tetratricopeptide-like helical"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00379"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72681"
FT                   /db_xref="GOA:D2TDL7"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023605"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDL7"
FT                   /protein_id="CAY72681.1"
FT                   /translation="MKPFLRWCFLATALSLAGCSNTDWRKNEVLAVPLQPTLQQEVILA
FT                   RMEQILASRSLTDDERAQLLYERGVLYDSLGLRALARNDFSQALSIRPDMPEVFNYLGI
FT                   YLTQAGNFDAAYEAFDSVLELDPTYNYARLNRGIALYYGGRFKLAQDDLLAFYQDDPND
FT                   PFRSLWLYLTQREMNAEQAKVSLKQRYNKAVKEQWGWNIVEFYLGNISEKTLTERLQAD
FT                   ATDNTSLAEHLSETNFYLGKYYLSLGEKDNAEALFKLTVANNVHNFVEHRYALLELALL
FT                   GQTQDDLSESDQQ"
FT   gene            436791..438707
FT                   /gene="deaD"
FT                   /locus_tag="EPYR_00380"
FT   CDS_pept        436791..438707
FT                   /transl_table=11
FT                   /gene="deaD"
FT                   /locus_tag="EPYR_00380"
FT                   /product="Cold-shock DEAD box protein A"
FT                   /function="Superfamily II DNA and RNA helicases"
FT                   /EC_number="3.6.1.-"
FT                   /note="Cold-shock DEAD box protein A (ATP-dependent RNA
FT                   helicase deaD)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00380"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72682"
FT                   /db_xref="GOA:D2TDL8"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028618"
FT                   /db_xref="InterPro:IPR034415"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDL8"
FT                   /protein_id="CAY72682.1"
FT                   /translation="MTDIQTTFAELGLNADLLESLNGMGYVKPSPIQAECIPHLLAGRD
FT                   VLGMAQTGSGKTAAFSLPLLHNIDPTVKAPQILVLAPTRELAVQVAEAVTDFSKHMRGL
FT                   NVVALYGGQRYDVQLRALRQGPQVVVGTPGRLLDHLKRGTLDLSNLRGLVLDEADEMLR
FT                   MGFIEDVETIMAQIPDGHQTALFSATMPEAIRRITKRFMKDPQEVRIQSSLTTRPDISQ
FT                   SYWTAYGRKTDALTRFLEAEDFDAAIIFVRTKNATLEVAEALERNGYNSAALNGDMNQA
FT                   LREQTLERLKDGRLDILIATDVAARGLDVERISLVVNYDIPMDAESYVHRIGRTGRAGR
FT                   AGRALLFVENRERRLLRNIERTMKLTIPEVELPNAELLGQRRLAKFAAKVQQQLESSDL
FT                   EQYRALLSKMQPEDELDIETLAAALLKMAQGERPLIVPADAPQRPRREFRDRDDRRDDR
FT                   RGDRPDRGPREARGEARDGDRPRRERRDVGDMEVYRIEVGRDDGVEVRHIVGAIANEGD
FT                   ISSRYIGNIKLFGTHSTIELPKGMPGDVLQHFTRTRILNKPMNMQLIGDAQPRSNVGGG
FT                   ERRPGGPARGGFGAGAGREGGRGGEAGGRRFSSERGGERRPAGNRGPRREEGGSAPARR
FT                   RDA"
FT   gene            complement(438784..439791)
FT                   /gene="yhbW"
FT                   /locus_tag="EPYR_00381"
FT   CDS_pept        complement(438784..439791)
FT                   /transl_table=11
FT                   /gene="yhbW"
FT                   /locus_tag="EPYR_00381"
FT                   /product="Alkanal monooxygenase alpha chain"
FT                   /function="Coenzyme F420-dependent N5,N10-methylene
FT                   tetrahydromethanopterin reductase and related
FT                   flavin-dependent oxidoreductases"
FT                   /EC_number="1.14.14.3"
FT                   /note="Alkanal monooxygenase alpha chain (Bacterial
FT                   luciferase alpha chain), Bacterial
FT                   luciferase-like,Luciferase-like monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00381"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72683"
FT                   /db_xref="GOA:D2TDL9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDL9"
FT                   /protein_id="CAY72683.1"
FT                   /translation="MSEKQTVPLSLLDLAPIPLGATASDAFRTSLALAQQAEKLGYHRY
FT                   WLAEHHNMTGIASAATSVLIGYLAANTQRLRLGSGGVMLPNHAPLVIAEQFGTLESLYP
FT                   GRIDLGLGRAPGSDQQTMMALRRHNNVREDNFPADVAQLINWFDAAGEVSPPVQPVPGK
FT                   GLSIPVWLLGSSLYSAQLAAQLGLPFAFASHFAPEMLLQALRVYREKFKPSVRLEKPYA
FT                   VVCVNVVAADSESEARFLFTSMQQQFINLRRGRPGPLPAPVASMDHLWSSAEQYGVQQA
FT                   LSMSIVGDKEKVRHGLAALIRETAADEIMVNGQIFDRTARLSSFELAMQARNML"
FT   gene            440086..440193
FT                   /locus_tag="EPYR_00382"
FT   CDS_pept        440086..440193
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00382"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72684"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDM0"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72684.1"
FT                   /translation="MAIGSVILPTATTEFESVPMQLRIGLIQPADINEA"
FT   gene            440236..440739
FT                   /gene="yhbS"
FT                   /locus_tag="EPYR_00383"
FT   CDS_pept        440236..440739
FT                   /transl_table=11
FT                   /gene="yhbS"
FT                   /locus_tag="EPYR_00383"
FT                   /product="putative acetyltransferase"
FT                   /function="Predicted acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="Uncharacterized acetyltransferase yhbS,GCN5-related
FT                   N-acetyltransferase, Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00383"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72685"
FT                   /db_xref="GOA:D2TDM1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDM1"
FT                   /protein_id="CAY72685.1"
FT                   /translation="MLIRTEIGIDAASIDALLRRSFPTSAEAELVRQLREGGLLTLGVV
FT                   ATDDEGQVLGYAAFSPVTLNGEDRQWVGLAPLAVDESVRKQGLGSRLIYEGLDTLNEFG
FT                   YAAVVVLGDSAYYGRCGFKTAAHCQLHCRREGTEQAFQVYKLADDVCNGIAGNIEYSAP
FT                   FNRL"
FT   gene            440736..440834
FT                   /locus_tag="EPYR_00384"
FT   CDS_pept        440736..440834
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00384"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72686"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDM2"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72686.1"
FT                   /translation="MIAKPLHERYRLLFSQPQLMLPFKLFDAVFQL"
FT   gene            441155..441553
FT                   /gene="yjfL"
FT                   /locus_tag="EPYR_00385"
FT   CDS_pept        441155..441553
FT                   /transl_table=11
FT                   /gene="yjfL"
FT                   /locus_tag="EPYR_00385"
FT                   /product="Inner membrane protein yjfL"
FT                   /function="Predicted membrane protein"
FT                   /note="Protein of unknown function DUF350, Domain of
FT                   Unknown Function (DUF350)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00385"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72687"
FT                   /db_xref="GOA:D2TDM3"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDM3"
FT                   /protein_id="CAY72687.1"
FT                   /translation="MATLPLVLAFASYFFTSCAMVLVFLLIYMRITPHNEWCLIKENNL
FT                   AATYGFIGALLGYIIPLASVAVNSVNLLDYLLWGAIALAVQLLVFTAVRLFIHDISSRI
FT                   EQNQRAVGLFLGAVSLGVGILNAACMTY"
FT   gene            complement(441566..442030)
FT                   /gene="nrdG"
FT                   /locus_tag="EPYR_00386"
FT   CDS_pept        complement(441566..442030)
FT                   /transl_table=11
FT                   /gene="nrdG"
FT                   /locus_tag="EPYR_00386"
FT                   /product="anaerobic ribonucleotide reductase activating
FT                   protein"
FT                   /function="Organic radical activating enzymes"
FT                   /EC_number="1.97.1.4"
FT                   /note="Anaerobic ribonucleoside-triphosphate
FT                   reductase-activating protein (Class III anaerobic
FT                   ribonucleotide reductase small component)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00386"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72688"
FT                   /db_xref="GOA:D2TDM4"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDM4"
FT                   /protein_id="CAY72688.1"
FT                   /translation="MNIHQYYAVDVMNGPGTRCTLFVAGCAHHCRGCYNQSTWRVDSGT
FT                   PFTPQMEEQLIADLNETRIIRQGLSLSGGDPLHPANLADVQRLLHRVRRECQDKDIWMW
FT                   TGYRLQELSISQLRVIDLVNVLIDGKFIQALKDPALPWRGSSNQVIHQLR"
FT   gene            complement(442027..444165)
FT                   /gene="nrdD"
FT                   /locus_tag="EPYR_00387"
FT   CDS_pept        complement(442027..444165)
FT                   /transl_table=11
FT                   /gene="nrdD"
FT                   /locus_tag="EPYR_00387"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /function="Oxygen-sensitive ribonucleoside-triphosphate
FT                   reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="Anaerobic ribonucleoside-triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00387"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72689"
FT                   /db_xref="GOA:D2TDM5"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDM5"
FT                   /protein_id="CAY72689.1"
FT                   /translation="MANQVIKRDGCQVAFDQARIEAAIRAAAKAAKIDDDDYCARTASR
FT                   VSALLGGRQQVEVAEVQQVVENLLMSGRYPPLAHRYIEYRHDRDVARERQRRLNREIRG
FT                   LIEQSQPALLNENANKDSKVIPTQRDLLAGIVARHYACQHLLPRDVVEAHERGEIHYHD
FT                   LDYAPFFPMFNCMLIDLHGMLTRGFNMGNAGIETPKSIATATAVTAQIIAQVASHIYGG
FT                   TTINRIDEVLAPFVDASLARHRAIAHQWQIAESEAYARSRTEKECFDAFQSLEYEVNTL
FT                   HTANGQTPFVTFGFGLGTSWAARLIQQSILRNRLAGLGKNHKTAVFPKLVFAIKTGLNR
FT                   HTGEPNYDIKQLALECASKRMYPDILNYEQVVAVTGSFKTPMGCRSFLGVYEQDGKPIH
FT                   DGRCNIGVITLNLPRIALEAHGDEGRFWALLDQRLLLAKTALMTRITRLEKVKARVAPI
FT                   LYMEGACGVRLQADEPVAAIFKYGRASISLGYIGIHETLNALSGGRVHPYDDAQLRAKG
FT                   LEIVARLRAAVDQWKRETGYGFSLYSTPSENLCDRFCRLDAAGFGVVPGVTDKGYYTNS
FT                   FHLDVEKKVNPYDKIDFEAAYPPLANGGFICYGEYPNMQHNLKALEDVWDYSYSRVPYY
FT                   GTNTPIDQCYQCGFHGEFTCTSKGFTCPTCANHDSSRLSVTRRVCGYLGSPDARPFNAG
FT                   KQEEVKRRVKHLRGGQAG"
FT   gene            444235..444387
FT                   /locus_tag="EPYR_00388"
FT   CDS_pept        444235..444387
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00388"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72690"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDM6"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72690.1"
FT                   /translation="MRHFSGGFIDLKQSQGSGVGKISEGESATGIQLPCDIFCPLACGG
FT                   GCIRP"
FT   gene            444458..447016
FT                   /locus_tag="EPYR_00389"
FT   CDS_pept        444458..447016
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00389"
FT                   /product="SWI/SNF-related matrix-associated actin-dependent
FT                   regulator of chromatin subfamily A member 5"
FT                   /function="Superfamily II DNA/RNA helicases, SNF2 family"
FT                   /EC_number="3.6.1.-"
FT                   /note="SWI/SNF-related matrix-associated actin-dependent
FT                   regulator of chromatin subfamily A member 5 (Sucrose
FT                   nonfermenting protein 2 homolog) (mSnf2h),
FT                   SNF2-related,SNF2 family N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00389"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72692"
FT                   /db_xref="GOA:D2TDM7"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDM7"
FT                   /protein_id="CAY72692.1"
FT                   /translation="MSSVAYNEKQVIRWLGARAVARARDLIASVQHIQWQNTLLTGEVP
FT                   GRKAEPYSVMVHFSRPQGKLHASGECSCAVKNNCKHVAALMLANLQPRQPQSAVAIDTI
FT                   RAVPVPVLQLQSWAKFISGYGHYGHRQKRLDFATVSFDYAGVKVDAGSQAESFADRSGQ
FT                   RYHVQRHMDDEHSWLAQIGGAGLHTIPSGHIYTPAPLPAAIFAPSSPSQWREFIKTGLP
FT                   ALRKRGWYINMDDDFTWNITEVEKIEGRVVKGEEGWFDLELAMKIGRRRVRLEPLLARL
FT                   FARDRRWMSGNLLQIDDDEQIELRDERQQRLVFRASQLKPLVGDLADLFDRDEAQPLRL
FT                   AAWDIGRLSQADDRRWVFDGEDAVYQLAQRLSGQAGVQAVAPPVGLQATLRDYQQQGVN
FT                   WMQFLRQHQLAGVLADDMGLGKTIQTLAHLLLEKEAGRLDRPALIVVPTTLVHNWCCEA
FT                   ARFAPGLRVLALTGPQRKDFYQRLEQYDVVITTYSLLWRDQPQLVAHHYHLLILDEAQY
FT                   VKNSSSRAALVIRTLKTRHRLCLTGTPLENHLGELWSQFDFLLPGFLGSERDFTQRWRI
FT                   PVERQGDKVRRDLLAKRVRPFMLRRRKQEVAKELPPKNTIVRSVALDGAQRELYDQVRK
FT                   AMQDRVQLAVQQQGAGRSHLLVLDALLKLRQICCDPRLLADARAEKVRHSAKLALLREM
FT                   LHDLLAEDRRILIFSQFTTMLTIIAGELQKARIPFVTLTGATRDRNEPVRSFQQGEVPV
FT                   FLISLKAGGVGLNLTAADTVIHYDPWWNPAAENQATDRAWRLGQDKPVFVYKLIAAGTI
FT                   EEKIVALQQQKAELAGEILDDELSEPASFSQQDLSDLFAP"
FT   gene            447110..449482
FT                   /gene="nahA"
FT                   /locus_tag="EPYR_00390"
FT   CDS_pept        447110..449482
FT                   /transl_table=11
FT                   /gene="nahA"
FT                   /locus_tag="EPYR_00390"
FT                   /product="beta-hexosaminidase"
FT                   /function="N-acetyl-beta-hexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /note="Beta-hexosaminidase beta chain precursor
FT                   (N-acetyl-beta-glucosaminidase)
FT                   (Beta-N-acetylhexosaminidase) (Hexosaminidase B),Glycoside
FT                   hydrolase, catalytic core, Glycosyl hydrolase family 20,
FT                   catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00390"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72694"
FT                   /db_xref="GOA:D2TDM8"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:D2TDM8"
FT                   /protein_id="CAY72694.1"
FT                   /translation="MLWSPCRILLAFSVILPLCAAAVPAGDLPLMPWPQKVELAADAAS
FT                   LTLIIPLDIQVKGDDLQEAVPRWQRRLARQTGKAYYPLPASATPLQIHIANRVAPVPQP
FT                   DSDESYRLVVSRDGVHLDSATRFGAMRGMETLLQLVQNGALPLVTIDDRPRFPWRGMMI
FT                   DSVRHFMPLETLKRQIDGIAAARMNVFHWHLTDDQGWRFASSRFPQLQAKASDGLWYSE
FT                   QQMREIVSYATDRGVRVVPEIDLPGHVPALAVAMPQLLAIPGRYQPERGWGVFKPLLDP
FT                   TNEQVYRFIDLLVGEVAAIFPDPYLHIGGDEVDDTQWRKSERISQFMQRQGLKDGHALQ
FT                   AYFNQRVEKILAKHQRRTIGWDEIYHPDLPRSILIQSSRGANALGEIAKNNYRGILSAG
FT                   FYLDQAQPAAFHYRNEVWPQALNGADRVRAGETAQSWQFSLPRLKGDPLNGSFTLIDSA
FT                   GGWRGFIDFAGRSRRMVQNMRWLSPTQLTFSVDSWMGNLQPVLTLAGDSLNGYWRIGNV
FT                   RYSTTGSMLAQIPQGIKPALPDEAQLRENLLGGEAVLWSEIVDENIIDIRLWPRAFAVA
FT                   ERLWSAADVTDEKNMYQRLAAVDNWSALSVGLQQHTQMQLQMMRLANGNDIAPLHIFAE
FT                   ALEPAQYYTRQHLKHRAGHSTLAEPLNQLADILPTESSKVRELDRQVDALIANRGDRQA
FT                   ALAIRRQLELWQFNILQVEPLLASNPQLRPLLTVAEQVGAISKVGLSLVDAMENERIFG
FT                   AREVAKMQQLLDSEALRQDELVIALLYPIEKLLWADK"
FT   gene            complement(449572..449958)
FT                   /gene="yjgF"
FT                   /locus_tag="EPYR_00391"
FT   CDS_pept        complement(449572..449958)
FT                   /transl_table=11
FT                   /gene="yjgF"
FT                   /locus_tag="EPYR_00391"
FT                   /product="Protein tdcF"
FT                   /function="Putative translation initiation inhibitor,yjgF
FT                   family"
FT                   /note="Endoribonuclease L-PSP/chorismate
FT                   mutase-like,Endoribonuclease L-PSP, TIGR00004:
FT                   endoribonuclease L-PSP, putative"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00391"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72695"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2N2"
FT                   /protein_id="CAY72695.1"
FT                   /translation="MSREINTEKAPAAIGPYVQGVDLGSMIMTSGQIPVDARTGTIADD
FT                   IAAQTRQSLENVQAIVEAAGLRVGDIVKTTVFVKDLNDFATVNATYEAFFSERQASFPA
FT                   RSCVEVARLPKDVKIEIEAIAVRR"
FT   gene            complement(450033..450563)
FT                   /gene="pyrI"
FT                   /locus_tag="EPYR_00392"
FT   CDS_pept        complement(450033..450563)
FT                   /transl_table=11
FT                   /gene="pyrI"
FT                   /locus_tag="EPYR_00392"
FT                   /product="aspartate carbamoyltransferase regulatory
FT                   subunit"
FT                   /function="Aspartate carbamoyltransferase, regulatory
FT                   subunit"
FT                   /EC_number="2.1.3.2"
FT                   /note="Aspartate transcarbamylase regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00392"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72697"
FT                   /db_xref="GOA:D2T2N3"
FT                   /db_xref="InterPro:IPR002801"
FT                   /db_xref="InterPro:IPR020542"
FT                   /db_xref="InterPro:IPR020545"
FT                   /db_xref="InterPro:IPR036792"
FT                   /db_xref="InterPro:IPR036793"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2N3"
FT                   /protein_id="CAY72697.1"
FT                   /translation="MKQDNKLQVEAIKRGTVIDHIPAHVGFKLLALFRLTETDQRITIG
FT                   LNLPSGEGGRKDLIKIENTFLTDDQVNQLAVYAPHATVNRIDDYNVVAKMSPTLPERID
FT                   RVLTCPNSNCISRTEPVDSSFAVKQRQDELHLKCKYCEKEFTHQVVMANDRSLPFAIHA
FT                   NGGQDVGAPRQPA"
FT   gene            complement(450576..451511)
FT                   /gene="pyrB"
FT                   /locus_tag="EPYR_00393"
FT   CDS_pept        complement(450576..451511)
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="EPYR_00393"
FT                   /product="aspartate carbamoyltransferase catalytic subunit"
FT                   /function="Aspartate carbamoyltransferase, catalytic chain"
FT                   /EC_number="2.1.3.2"
FT                   /note="Aspartate carbamoyltransferase (Aspartate
FT                   transcarbamylase) (ATCase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00393"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72699"
FT                   /db_xref="GOA:D2T2N4"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2N4"
FT                   /protein_id="CAY72699.1"
FT                   /translation="MANPLYRKHIISINDLNRTELERVLHTAASLKANPQPELLKHNVI
FT                   ASCFFEASTRTRLSFETAMHRLGASVVGFADGGNTSLGKKGETLADTISVISTYVDAIV
FT                   MRHPQEGAARLATEFSGGVPVLNAGDGANQHPTQTLLDLFTIQETQGRLNNLQVAMVGD
FT                   LKYGRTVHSLAQALAKFDDNRFWFIAPDALAMPTYITDMLDEKGITWSRHDSIEEVVPQ
FT                   VDILYMTRVQKERLDPSEYANVKAQFVLRAADLNGARDNMKVLHPLPRVDEIDNDVDST
FT                   PHAWYFQQAGNGIYARQALLALVLNSDPAL"
FT   gene            complement(451622..451753)
FT                   /locus_tag="EPYR_00394"
FT   CDS_pept        complement(451622..451753)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00394"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72700"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2N5"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72700.1"
FT                   /translation="MNAYNAPRLPGGCMKLNRVTITSPTRHFAGGLRRFSASGITDR"
FT   gene            complement(451806..452816)
FT                   /gene="argI"
FT                   /locus_tag="EPYR_00395"
FT   CDS_pept        complement(451806..452816)
FT                   /transl_table=11
FT                   /gene="argI"
FT                   /locus_tag="EPYR_00395"
FT                   /product="ornithine carbamoyltransferase 1"
FT                   /function="Ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="Ornithine carbamoyltransferase (OTCase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00395"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72702"
FT                   /db_xref="GOA:D2T2N6"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2N6"
FT                   /protein_id="CAY72702.1"
FT                   /translation="MSQLYQRHFLRLLDFSPSEINGLLALASRLKFAKKKGEEIQYLTG
FT                   KNIALIFEKDSTRTRCSFEVAAFDQGANVTWLGPSGSQIGHKESIKDTARVLGRIYHAI
FT                   QYRGHGQQLVESLAEHAGVPVWNGLTNEFHPTQLLADLLTMQEHLPEKAFNQMTLTYVG
FT                   DTQNNMGNTLLEAAALVGLDLRLVAPKSCWPDAALVAECRDVAQQNGGKITLTDDIATG
FT                   VQGADFIYTDVWVSMGEPKEVWHERIALLRPYQVNMALLQATGNPQVKFLHCLPAFHDD
FT                   QTLLGQQMAQQYDLHGGMEVTDDVFESAHSVVFDQAENRLHTIKAVMVATLSKQG"
FT   gene            452973..453395
FT                   /gene="yjgD"
FT                   /locus_tag="EPYR_00396"
FT   CDS_pept        452973..453395
FT                   /transl_table=11
FT                   /gene="yjgD"
FT                   /locus_tag="EPYR_00396"
FT                   /product="Uncharacterized protein yjgD"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="Protein of unknown function DUF1260, Protein of
FT                   unknown function (DUF1260)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00396"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72703"
FT                   /db_xref="GOA:D2T2N7"
FT                   /db_xref="InterPro:IPR009671"
FT                   /db_xref="InterPro:IPR016716"
FT                   /db_xref="InterPro:IPR036701"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2N7"
FT                   /protein_id="CAY72703.1"
FT                   /translation="MANETLLQEQREETRLIIEELLDDGSDPDALYTIEHHFSCDSFDA
FT                   LEKAAVEAFKLGYEVTEPEELDLEDGTKVMCCDILSEGALNAELIDAQVEQLVDIAGKF
FT                   NVDYDGWGTYFEDPDAQDEDDENDEHPDGEDNGVRH"
FT   gene            453468..453659
FT                   /locus_tag="EPYR_00397"
FT   CDS_pept        453468..453659
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00397"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72705"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2N8"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72705.1"
FT                   /translation="MPHSPFSAKPHPASLAPRLDTSLAAFYRSLLRSEADCETGQRMAF
FT                   SQRRAVFELMLRITAFSA"
FT   gene            complement(453640..454143)
FT                   /gene="yjgM"
FT                   /locus_tag="EPYR_00398"
FT   CDS_pept        complement(453640..454143)
FT                   /transl_table=11
FT                   /gene="yjgM"
FT                   /locus_tag="EPYR_00398"
FT                   /product="putative acetyltransferase"
FT                   /function="Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /EC_number="2.3.1.-"
FT                   /note="Uncharacterized acetyltransferase yjgM,GCN5-related
FT                   N-acetyltransferase, Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00398"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72707"
FT                   /db_xref="GOA:D2T2N9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2N9"
FT                   /protein_id="CAY72707.1"
FT                   /translation="MTSPIQTTLRVRPIARADNPHIAAVIRAVSAEFGLTADKGYTVSD
FT                   PNLDHLYELYSEDNSAYWVVEMAGKVVGGGGVAPLTGSDDDVCELQKMYFLPDVRGLGL
FT                   AHRLATQAMNYGRQCGFKRCYLETTASLTRAIRLYEQLGFSHIDEPMGATGHVDCEVIM
FT                   LKTL"
FT   gene            complement(454358..457213)
FT                   /gene="valS"
FT                   /locus_tag="EPYR_00399"
FT   CDS_pept        complement(454358..457213)
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="EPYR_00399"
FT                   /product="valyl-tRNA synthetase"
FT                   /function="Isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /note="Valyl-tRNA synthetase (Valine-tRNA ligase) (ValRS)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00399"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72709"
FT                   /db_xref="GOA:D2T2P0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2P0"
FT                   /protein_id="CAY72709.1"
FT                   /translation="MEKTYNPQDIEQPLYEHWEQQGYFKPHGDTSQESFCIMIPPPNVT
FT                   GSLHMGHAFQQTIMDTLIRYQRMQGKNTLWQAGTDHAGIATQMVVERKIAAEEGKTRQD
FT                   YGRDAFIEKIWQWKAESGGTITRQMRRLGNSVDWERERFTMDDGLSNAVKEVFVRLHKE
FT                   NLIYRGKRLVNWDPKLRTAISDLEVENRESKGSMWHIRYPLADGVKTADGKDYLVVATT
FT                   RPETVLGDTGVAVNPEDPRYKDLIGKFLVLPLVNRRIPIVGDEHADMEKGTGCVKITPA
FT                   HDFNDYEVGRRHRLPMINILTFDGDIRDSPQVYDTNGEESDACDPTIPAEFRGLERFAA
FT                   RKAVVAAIDAFGLLDEIKPHDLTIPYGDRGGVVIEPMLTDQWYVRTAPLAKVAVEAVEQ
FT                   GDIQFVPKQYENMYFSWMRDIQDWCISRQLWWGHRIPAWYDAAGNVYVARSEEEARAEN
FT                   NLGADVVLTQDEDVLDTWFSSGLWTFSTLGWPENTAALRTFHPTSVLVSGFDIIFFWIA
FT                   RMIMLTMHFIKDEDGKPQVPFKTVYMTGLIRDDEGQKMSKSKGNVIDPLDMVDGISLQD
FT                   LLEKRTGNMMQPQLAEKIRKRTEKQFPNGIEPHGTDALRFTLAALASTGRDINWDMKRL
FT                   EGYRNFCNKLWNASRFVLMNTEEHDCGFNGGELALSLADRWILAEFNRTVKAYREALDC
FT                   YRFDIAANILYEFTWNQFCDWYLELAKPVMNGGNEAQLRGTRNTLVNVLEALLRLAHPI
FT                   IPFITETIWQRVKVLKNISDDTIMLQPMPEFSASKVDDVAMSDTEWLKQAIVAVRNIRN
FT                   EMNISPAKPLDVLLRGASDEVIRRVNDNHNFLKTLARLTTLELLPAGERGPVAVTKLVD
FT                   GAELLIPMADLVDKTAELERLAKEVVKLEVEMEKINAKLGNEGFVARAPEAVVAKERER
FT                   LNDFALAKAKLIEQQAVIAAL"
FT   gene            complement(457219..457674)
FT                   /gene="holC"
FT                   /locus_tag="EPYR_00400"
FT   CDS_pept        complement(457219..457674)
FT                   /transl_table=11
FT                   /gene="holC"
FT                   /locus_tag="EPYR_00400"
FT                   /function="DNA polymerase III, chi subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="DNA polymerase III chi subunit, HolC"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00400"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72711"
FT                   /db_xref="GOA:D2T2P1"
FT                   /db_xref="InterPro:IPR007459"
FT                   /db_xref="InterPro:IPR036768"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2P1"
FT                   /protein_id="CAY72711.1"
FT                   /translation="MKNATFYLLETDIPVDGLSAHEALVCSLAEARWREGKRVLIACED
FT                   EAQAIRLDEALWQRPASAFVPHNLAGEGPKYGAPVELAWPQRRGNAPRDLLISLLPQFA
FT                   DFATAFYEVIDFVPYEASLKQLARDRYKAYRSVGFHLNTATPPLPKT"
FT   gene            complement(457797..459308)
FT                   /gene="pepA"
FT                   /locus_tag="EPYR_00401"
FT   CDS_pept        complement(457797..459308)
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="EPYR_00401"
FT                   /product="aminopeptidase A/I"
FT                   /function="Leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="probable cytosol aminopeptidase (Leucine
FT                   aminopeptidase) (LAP), Peptidase M17, leucyl
FT                   aminopeptidase, Cytosol aminopeptidase family, catalytic
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00401"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72712"
FT                   /db_xref="GOA:D2T2P2"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2P2"
FT                   /protein_id="CAY72712.1"
FT                   /translation="MEFSVKSGSPEKQRSACIVVGVFEPRRLSPIAEQLDKISDGYISA
FT                   LLRRGELEGKVGQTLLLHHVPNIFSERILLIGCGKERELDERQYKQVVQKTINTLNDTG
FT                   SMEAVCFLTELHVKGRNTYWKVRQAVETSKEALYSFDQLKSNKVEPRRPLRKLVFNVPT
FT                   RRELPSGERAIQHGLAVAAGVKAAKDLGNMPPNICNAAYLASQARQLADAYSKNITTRV
FT                   IGEQQMKELGMNAYLAVGQGSQNESLMSVIEYKGNPDADARPIVLVGKGVTFDTGGISL
FT                   KPGEAMDEMKYDMCGAASVYGVMRMVAELNLPLNVVGVLAGCENMPGGRAYRPGDVLTT
FT                   MSGQTVEVLNTDAEGRLVLCDALTYVERFDPEVVIDVATLTGACVIALGHHISGLLSNH
FT                   NPLAHELIGASEQAGDRAWRLPMADEYQEQLDSNFADMANIGGRPGGAITAACFLARFT
FT                   RKYNWAHLDVAGTAWRSGKAKGATGRPVALLSQFLLNRAGLNGDD"
FT   gene            459563..460663
FT                   /gene="yjgP"
FT                   /locus_tag="EPYR_00402"
FT   CDS_pept        459563..460663
FT                   /transl_table=11
FT                   /gene="yjgP"
FT                   /locus_tag="EPYR_00402"
FT                   /product="Inner membrane protein yjgP"
FT                   /function="Predicted permeases"
FT                   /note="Predicted permease YjgP, TC 9.B.93.1.1 Inner
FT                   membrane protein yjgP"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00402"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72714"
FT                   /db_xref="GOA:D2T2P3"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030922"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2P3"
FT                   /protein_id="CAY72714.1"
FT                   /translation="MIIIRYLVRETLKSQLAILFILLLIFFCQKLVRILGAAVDGEIPT
FT                   NLVLTLLGLGVPEMAQLILPLSLFLAILMTLGRLYTESEITVMHACGLGKSVLVKAAMI
FT                   LMLFTALLAAVNVGWLGPWSSRYQNEVMQNAKANPGAAALAAGQFQQSGDGQSVLFIEN
FT                   VKGNTFSNVFLAQLRPKGNARPSVVVAQQGHMEQRVDGSQIVTLDSGTRFEGTALLRDF
FT                   RITDFKNYQAIIGHQAVTLDPNDSEQMSLDTLWHSDKPDFRSELHWRLTLVFSVLIMAL
FT                   MVVPLSVVNPRQGRVLSMLPAMLLYLVFFLLQSSMRSSGSKGRIDPAIAMWAVNLAYLA
FT                   LAVLLNAWDTVPMRRLRARFIRGGSV"
FT   gene            460663..461739
FT                   /gene="ampH"
FT                   /locus_tag="EPYR_00403"
FT   CDS_pept        460663..461739
FT                   /transl_table=11
FT                   /gene="ampH"
FT                   /locus_tag="EPYR_00403"
FT                   /product="beta-lactamase/D-alanine carboxypeptidase ampH"
FT                   /function="Beta-lactamase class C and other penicillin
FT                   binding proteins"
FT                   /note="beta-lactamase/D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00403"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72716"
FT                   /db_xref="GOA:D2T2P4"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030923"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2P4"
FT                   /protein_id="CAY72716.1"
FT                   /translation="MFGVLDRYIGKTIFNTIMATLFMLVSLSGIIKFVDQLRKTGQGEY
FT                   TVLGAGLYTLLSVPKDIEIFFPMAALLGALLGLGALAQRSELVVMQASGFTRMQIAASV
FT                   MKTAIPLVLLTMAIGEFVAPQGEQMARNYRAQQLMGGSLLSTQSGLWAKDGDNFIFIER
FT                   IRDGNQLSGISIYNFDHERRLKTVRYAASAKYNADKKLWELAQVDQSDLSDAQQIKGSQ
FT                   TLSGEWNTTLTPDKLGVVALDPGALSISGLYSYSKYLKQSGQMAGRYQLNMWSKIFQPL
FT                   SVAVMMLMALSFIFGPLRSVSMGMRVVTGISFGFLFYVLDQIFGPLSLVYNIPPILGAL
FT                   LPSAAFFAISLAMLVKRR"
FT   gene            complement(461905..462036)
FT                   /locus_tag="EPYR_00404"
FT   CDS_pept        complement(461905..462036)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00404"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72718"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2P5"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72718.1"
FT                   /translation="MALSEFTPELALDLAFDLQAALSSAEARLISSMSRQDVGERAC"
FT   gene            complement(462125..463537)
FT                   /gene="yjiN"
FT                   /locus_tag="EPYR_00405"
FT   CDS_pept        complement(462125..463537)
FT                   /transl_table=11
FT                   /gene="yjiN"
FT                   /locus_tag="EPYR_00405"
FT                   /product="Uncharacterized protein yjiN"
FT                   /function="Predicted membrane protein"
FT                   /note="Protein of unknown function DUF445,
FT                   transmembrane,Protein of unknown function (DUF445)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00405"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72719"
FT                   /db_xref="GOA:D2T2P6"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2P6"
FT                   /protein_id="CAY72719.1"
FT                   /translation="MAAPGRAAASAMAWCKTWQKAPPDRLASKLCVACWAVLWAAVKSN
FT                   MDKETELRQAKRLPLLLLGMAALLFIFTVLWPRYAPLNLWISALKAVAEASMVGALADW
FT                   FAVSALFRHVPIPLAARHTAIIPRNKHRIADNLAIFVQDKFLNSEALLALIRRHDPAQL
FT                   IARWLSARENATRLSGYLLKMMRGFLDLADDQRIQALMRRAIHRAIDKVDLSQSMAVIL
FT                   ESLTKNNRHQQLLDDALAQLLQLVNKPATHEFIAQQVVRWLKREHPLKEKMLPTEWLGE
FT                   KSAALAADAVQSILNDIENDDRHQLRQGFNRAVQRQIDRLRNDPEMLAKAEEVKTYLKQ
FT                   DEALNGYISQLWGDLRGWLKEDLNREDSLLHAKVSAAGQWFGDTLMQDESLRASLNQHM
FT                   EEAASSVAPEFSIFLSDHISHTVKSWDAKEMSRQIELNIGKELQYIRISGTLVGATIGL
FT                   ILYLLSLLPLVL"
FT   gene            complement(463404..464903)
FT                   /gene="yjgR"
FT                   /locus_tag="EPYR_00406"
FT   CDS_pept        complement(463404..464903)
FT                   /transl_table=11
FT                   /gene="yjgR"
FT                   /locus_tag="EPYR_00406"
FT                   /product="Uncharacterized protein yjgR"
FT                   /function="Predicted ATPase"
FT                   /note="Protein of unknown function DUF853, NPT hydrolase
FT                   putative, Bacterial protein of unknown function (DUF853)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00406"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72720"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2P7"
FT                   /protein_id="CAY72720.1"
FT                   /translation="MTEPLPIAQTPEHSLHLLPAMANRHGLITGATGTGKTVTLQKLAE
FT                   SFSNIGVPVFMADVKGDLTGIAKEGVASEQLLARLAQNGIKDWEAQANPVVLWDIFGER
FT                   GHPVRATVSDLGPLLLARLLNLNEVQSGVLQIIFRVADDQGLLLLDFKDLRATTQYIGE
FT                   NGKSFQNQYGNISSASVGAIQRGLLALEQQGAEYFFGEPMLDINDWMRTDANGKGIINI
FT                   LAAEKLYQMPKLYATSLLWLLSELYEQLPEAGDLDKPKLVFFFDEAHLLFADAPAVLLD
FT                   KTEQVIRLIRSKGVGVYFVSQNPADIPDAVLGQLGNRVQHALRAFTPKDQKAVKVAAQT
FT                   MRANPAFDTVSAIQQLGTGEALVSFLDEKGSPSVVQRASVIAPGSRMGPVSDDERNGLI
FT                   NHSPLSGKYEEAVDRESAYERLQHGVQAASERAGAPATKGDAALDSGILGGLKEILFGS
FT                   TGPRGGKRDGVVQNVAKSAARQIGQQIVRGVLGSIMGGRKK"
FT   gene            complement(465076..465585)
FT                   /gene="yjjA"
FT                   /locus_tag="EPYR_00407"
FT   CDS_pept        complement(465076..465585)
FT                   /transl_table=11
FT                   /gene="yjjA"
FT                   /locus_tag="EPYR_00407"
FT                   /product="Uncharacterized protein yjjA precursor"
FT                   /note="Uncharacterized protein yjjA precursor (Protein
FT                   P-18)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00407"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72721"
FT                   /db_xref="InterPro:IPR019637"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2P8"
FT                   /protein_id="CAY72721.1"
FT                   /translation="MKAATKMILALSISGTLFSGVANAVSWQDQLSSAANALGQNANSN
FT                   ATPASGSQGGTSLGALTGLLNGGNKSLSANSMSNAAGVLQYCMKNNIVDNNVSSVKEQL
FT                   LGKLGLADTQKQQQSTDYKQGLMGLLNTGNNQQVNLKSLGDTEMGKKVKTKACDLVLKQ
FT                   GKQFIS"
FT   gene            465753..465866
FT                   /locus_tag="EPYR_00408"
FT   CDS_pept        465753..465866
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00408"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72723"
FT                   /db_xref="GOA:D2T2P9"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2P9"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72723.1"
FT                   /translation="MLYRRGGRQCRGWCILVMQVAAGIWGSVGVFSSFSRR"
FT   gene            465935..466019
FT                   /locus_tag="EPYR_t020"
FT   tRNA            465935..466019
FT                   /locus_tag="EPYR_t020"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:465969..465971,aa:Leu)"
FT   gene            complement(466507..467154)
FT                   /locus_tag="EPYR_00409"
FT   CDS_pept        complement(466507..467154)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00409"
FT                   /product="Uncharacterized protein ylbG"
FT                   /note="Homeodomain-like"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00409"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72724"
FT                   /db_xref="GOA:D2T2Q0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2Q0"
FT                   /protein_id="CAY72724.1"
FT                   /translation="MLHTNNPVIKHKTGLLNLAEXLSNVSKACKIMXASRDTFYRYREL
FT                   XDEGGVDALINRSRRAPNIKNRTDDATEQAVVDYAIAFPAHGQHRSNNELRKQGVFISG
FT                   SGVRSVWLRHSLENFKKRLKALQEKVAHDGIELTEAQIVALERKASDDQACGEIETAHP
FT                   GYLGSQDTFYVGNLKGVGRIYQQTFVDTYSKVAHCKLYVTISDYMRYASLSL"
FT   gene            complement(467502..467942)
FT                   /locus_tag="EPYR_00410"
FT   CDS_pept        complement(467502..467942)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00410"
FT                   /product="Histone acetyltransferase HPA2"
FT                   /function="Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /EC_number="2.3.1.48"
FT                   /note="GCN5-related N-acetyltransferase,Acetyltransferase
FT                   (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00410"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72725"
FT                   /db_xref="GOA:D2T2Q1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032962"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2Q1"
FT                   /protein_id="CAY72725.1"
FT                   /translation="MLVKVRKAEAEDYEAWLKLWKGYLNFYESDLDESVTLSTWHRALS
FT                   SESCLVCRIAEIDYKIVGFALCVLHEGTWVTQPICYLEDLFVTDDMRGMGVGTALIEAI
FT                   YDESREKSWSKVYWVTRTDNPARKLYDKLAVLDDFVRYSIKI"
FT   gene            complement(468102..469409)
FT                   /locus_tag="EPYR_00411"
FT   CDS_pept        complement(468102..469409)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00411"
FT                   /product="putative biotin carboxylase"
FT                   /function="Biotin carboxylase"
FT                   /EC_number="6.3.2.28"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00411"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72726"
FT                   /db_xref="GOA:D2T2Q2"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2Q2"
FT                   /protein_id="CAY72726.1"
FT                   /translation="MQNETFFIWHKVPFYCVRYDEILNHTNNTIIYIGTQAALADIPAE
FT                   LNCEKLIWQEQDGVHVLIEKMSLKTPAPRNFIALSEYQVDVAARIRAHFGIPGPSIAEA
FT                   ELSRNKLMMKAAVASSGLATPTCYSLNDTLQNPRILEAISSAKLVLKPLDGASSENVQI
FT                   YSSHRALLMALNNNNTHIDDIDLRKNTARYQIEEFIEGDIWHVDGFVRSGEIALCVSSR
FT                   YIGNCLDFAKGLPLGSLQCELPATLLAFSRQVVAAVDIQHGCFHLEVFQNASGWVFLEI
FT                   GHRAGGASVVRAFELHTGVNLHHVHLSAQLGWMPDFATKTSANEDYYGWFVFPGHHLPE
FT                   GYACIDNAGDFSSSACIHEWHQLPPDKKLCPALTYLETIAPVAGMLRTTSFREGQQFVL
FT                   DMFENITVTSTTEAERSASCDDDPRGLSRLVNDFPA"
FT   gene            complement(469475..470755)
FT                   /locus_tag="EPYR_00412"
FT   CDS_pept        complement(469475..470755)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00412"
FT                   /product="conserved hypothetical protein"
FT                   /function="Biotin carboxylase"
FT                   /note="ATP-grasp fold"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00412"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72727"
FT                   /db_xref="GOA:D2T2Q3"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2Q3"
FT                   /protein_id="CAY72727.1"
FT                   /translation="MPNVINSETINMENKGIVIIVDAYSPTRRLAPEFIRQGYRCARVQ
FT                   STPEIPDIYKGSFSLDDYCENIIHQGDLAVTLQKVASLNPVAIIAGGEIGVELADILSE
FT                   NLGLASNGTALSAARRHKYTMIERLRSVGLPATRQCLPANGDALRLWHQKTGGRIVVKP
FT                   ARSAAGEGVHFCDTPEASNAALQAIIGKKNIFSEINQEVVAQEYLCGTEYVVNTVSCQG
FT                   KHRVTDIWRTTRVSVNGFLDMGDSIHIMPRHGEIQETLVSYALQVLNAMNIQYGPGHME
FT                   IKMCDDGPCLVEIGARIAGGDMPYYAELATGQSQLNWTQLAYTDPEKFHALYDIPYTLN
FT                   YYFSSVAMLSPCEGILEAYPYKKQISQLESLLEIREYVKPGDRIYHTIDDTTYPMLVLL
FT                   KHKTEEVVLRDWGTLRYLDGHAFYKVH"
FT   gene            complement(470783..471583)
FT                   /locus_tag="EPYR_00413"
FT   CDS_pept        complement(470783..471583)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00413"
FT                   /product="conserved hypothetical protein"
FT                   /function="ABC-type branched-chain amino acid transport
FT                   systems, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00413"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72728"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2Q4"
FT                   /protein_id="CAY72728.1"
FT                   /translation="MPVRVCIAGPLTGPRACYGDLIREAISDSPQREGLSIHFFDDKAN
FT                   PQVVKLHLAEIIKKSDVVIGHFNSDCAQAAIPAYRMAGIPLLLPASTAAHLGEGESVFQ
FT                   LCSTEAEQVKEMIAVADSQYPDSMRYYWADGSAYSHRLLKWLQAHHGYPIPEIGTSSKG
FT                   GHGAGGVTFYLGAHFSILARMHQEGALWLGAAICCDDCDITEFTQRARPETWVCSSTPG
FT                   YSELLQRAVDIVWRVMYRKSNNWADYFDERGMYLPTSWQSYCIK"
FT   gene            complement(471633..473150)
FT                   /gene="BBE1"
FT                   /locus_tag="EPYR_00414"
FT   CDS_pept        complement(471633..473150)
FT                   /transl_table=11
FT                   /gene="BBE1"
FT                   /locus_tag="EPYR_00414"
FT                   /product="Reticuline oxidase; Berberine bridge-forming
FT                   enzyme; BBE; Tetrahydroprotoberberine synthase; Flags:
FT                   Precursor"
FT                   /function="FAD/FMN-containing dehydrogenases"
FT                   /EC_number="1.21.3.3"
FT                   /note="FAD linked oxidase, N-terminal, Berberine and
FT                   berberine like"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00414"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72729"
FT                   /db_xref="GOA:D2T2Q5"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2Q5"
FT                   /protein_id="CAY72729.1"
FT                   /translation="MTIIEPHDSRYLSYITGMNQRWRASPAKILLPGNTPEAVQCIQEA
FT                   VQQGQRISVRAGGNCYQDFTCHAGVEVLIDVSDMDDIAFDPDMQAIAVGAGATLSRTYE
FT                   VLYRRWNVTLPGGPASGVGMGGHICGGGFGLLSRRYGLTVDHLHAIEIITVDESGKALA
FT                   IIARRDPDCPNHDLWWAHAGGGGGQLGIVTKFWFRSPQALGNEPVQILPTPPSEVYLCV
FT                   KVIPWEKLGKDDFIRLMRNYGRWYETHQHADRPESSLAGYLVMYQQAQGFVALLTQMDA
FT                   SVSNATAILGQYHRDIFEGIDGVAGFQGLSHMETPRKLPWLKSVRLLGTNSPSLADPML
FT                   RGAYKSAYMRQNFPVEQAETLYQHLSADGFSNKNAMVMVLPYGGAVNKVNADETAVSHR
FT                   DSIMKILYQSLWADEQDDQKNLSWIRQIYHSTYAKTGGVPVSNEITDGCFINYPDSDLN
FT                   NPELNTSGVTWAQLYFKHHYPRLQKIKSQWDPLNIFRHSQSVKLPAT"
FT   gene            complement(473191..474378)
FT                   /locus_tag="EPYR_00415"
FT   CDS_pept        complement(473191..474378)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00415"
FT                   /product="Multi-drug resistance efflux pump pmrA"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /note="Major facilitator superfamily MFS-1, Major
FT                   Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00415"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72730"
FT                   /db_xref="GOA:D2T2Q6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2Q6"
FT                   /protein_id="CAY72730.1"
FT                   /translation="MKWGTYAELLKNAQARNIILLGLFAKIPIVAIPATLTLLVVVGLN
FT                   AGFTWAGIINAAWMAGAAVGSPWQGRYMGRHGVRKLLRFILIIQLMFWSSAAFLPLPLL
FT                   AIAAFFGGVFCFAAFTIGRMAIAELSVTENRHSAFALDAITTELAYMSGPPLAVVVSAS
FT                   LSPQAAVVISGAIIMALIIYYFIANPRVVSKATNNTPDQRIAWGAFFKSRLSTSLLLTI
FT                   MATFVIASYEVLGLAALKHFGHITWAAWFYIACGVASLIGGVVYGGFNKPPATVLICGL
FT                   LAISTGMIGFSQNALAVCLLIIPAALLCSPVFSATANDISRYAAPEMSGLAMGTYGSAL
FT                   TAGNAIGFPLAGLMVDNFGFNIAFFSVGGLAFAVVVIAFGINTLFISERSEVAAE"
FT   gene            complement(474993..476831)
FT                   /gene="asnB"
FT                   /locus_tag="EPYR_00416"
FT   CDS_pept        complement(474993..476831)
FT                   /transl_table=11
FT                   /gene="asnB"
FT                   /locus_tag="EPYR_00416"
FT                   /product="asparagine synthase B"
FT                   /function="Asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="Asparagine synthetase [glutamine-hydrolyzing] (AS)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00416"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72731"
FT                   /db_xref="GOA:D2T2Q7"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2Q7"
FT                   /protein_id="CAY72731.1"
FT                   /translation="MCGIAGWATFSRDFHASRRELEAMAATMALRGPDASGFWMDRHAG
FT                   LSHRRLAIVDLEGGVQPMTANLPTGSISLSYSGEVYNFKELRQELTQAGHSFSTQSDTE
FT                   VVLKGYLQWGNGVCEKLNGMFGFAIWDARREVLLLARDRFGVKPLYYYPDGQSVLFGSE
FT                   PKAILAHSQISGVLTTDSLREALGWTKTPGHGTWEGLKEVKPGTFVQFGRDGVREDVYW
FT                   QLQSRPHHDSLKDTIENVHILLSDTVRRQMVSDVPLCSLLSGGLDSSAIAALASQQLNG
FT                   ERQLKTFAVDFETHTEQFVPDVFRNESDAPYARKVAEKIGSLHTNLVLGYQQIGSEETR
FT                   RAVIAARDLPTGFGDADNSIYLLFNAIRNEATVALSGESADEVFGGYRWFHQPGILQGN
FT                   TFPWADHTFVTSFKTGLDAFAPDLLASLELPDYVRSRYQEALAEVPRLAGEESHEAKMR
FT                   EVLYLHLTRYMRILLDRKDRLSMAAGLEVRVPFCDHRLVEYVFNTPWKMKTFDGREKSL
FT                   LRAAMGDLLPQEVLQRKKAPYPAIQNAHYSAVLQRQAADLVANTNHPARDLLNIRWLNS
FT                   ILHIDPAAMSREIRHGLERALDFATWIELRKPILKL"
FT   gene            complement(476889..477614)
FT                   /locus_tag="EPYR_00417"
FT   CDS_pept        complement(476889..477614)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00417"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /function="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /EC_number="1.1.1.-"
FT                   /note="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00417"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72732"
FT                   /db_xref="GOA:D2T2Q8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2Q8"
FT                   /protein_id="CAY72732.1"
FT                   /translation="MSNANLRVVITGAGREMGRSLAIRYAKSGAEVLLSARNIEAAEKV
FT                   RYELQARGFDRVYAFACDLSDPASIRSFAQSVENKFGHVDVLINNGSPWAEGKELDAAS
FT                   DEEITHVIMSCTAGTILAIKHFLPLLRQSARPDIVNIISSSAHSLTHDCEGHTAFYAAK
FT                   AGQGRMAETLSQRLREEGIRVISLYPPKFNNSDPLVGDGQVSRTSKDQLTSESLIDCIQ
FT                   FAVNMPRDCFIRRFDFESI"
FT   gene            complement(477667..479643)
FT                   /gene="metG"
FT                   /locus_tag="EPYR_00418"
FT   CDS_pept        complement(477667..479643)
FT                   /transl_table=11
FT                   /gene="metG"
FT                   /locus_tag="EPYR_00418"
FT                   /function="Methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="Methionyl-tRNA synthetase (Methionine--tRNA ligase)
FT                   (MetRS)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00418"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72733"
FT                   /db_xref="GOA:D2T2Q9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2Q9"
FT                   /protein_id="CAY72733.1"
FT                   /translation="MKITKNASKFSYGLNSSSLQFPVNTTGGMSCSLPPGAQSTFHRHH
FT                   ETELFLITSGKGRVHIEGRESEDVVPEDIIYIDPLHGHTIENTCENEDLKFTALYWDNP
FT                   NQTQRNDVPKDTLIISTPPTPNGDLHLGHLSGPYLGADIYRRYLTLKGVSARHLTGRDD
FT                   NQTYVKCIATKEQRPPEEVANDYADKIYQTWAKADIALDFFSSPQTTKNYYSRVNSIIG
FT                   RLYDRGFIFAKEVDELYDLNTGFSLHEGYIKGVCPHCHSASDGNACEQCGRPNDCADLI
FT                   NPVASLPETRVGTRTTTKLYFRLSALAPQLTELTFRSNMSARARELTQGMLSDGLPDIC
FT                   ISHRSDWGISVDIPGFEDQVLYVWFEMAAGYLAADEDLHPQDPFFKNKNCDIIHFYGFD
FT                   NTYYHTLLFPAIYYALDEEYNVPVNHVINELLYLRGEKFSTSRRHLIWASKLLSKIPVD
FT                   YVRWGLARSRPEMTNENFSLEPFVDAINDFFVSTLQQHLTTSCRELSLQFQGKVPEPGA
FT                   WTSQHAAFYQRIRNLARDVEHAYHIDAFSPQTATAKLEEMGILTRKFFNAQSKHETQPM
FT                   LRDYQRTTFALNFWAIKQFSLLSQPIMLEGSEYILKLLGLNFEGWDSDREDFIANSHTI
FT                   SACDENHFRIISKDIIEHVCQVN"
FT   gene            complement(479640..480311)
FT                   /locus_tag="EPYR_00419"
FT   CDS_pept        complement(479640..480311)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00419"
FT                   /product="Phosphoglycolate phosphatase; PGPase; PGP"
FT                   /function="Predicted hydrolase (HAD superfamily)"
FT                   /EC_number="3.1.3.18"
FT                   /note="Haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00419"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72734"
FT                   /db_xref="GOA:D2T2R0"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2R0"
FT                   /protein_id="CAY72734.1"
FT                   /translation="MNIERFSHIVFDMDGVLIDSNHMKIDAARQVIHFIFPEAADAFAD
FT                   HFRRNFGQTRQAHFSWAYENLLAKEGFSASIINRLVEKYGKIVAENYPGCAVTDGTSAL
FT                   LAQVSRPCYVLTGSDQSEARELLCSHHLDTRFNDILGGPINKSENLDFIINTYGINPAE
FT                   SVLIGDAFHDFEVASHFGFSFILVTQYMPFDNDPLIAKVKSSGGYIVNRLSDLLTDRFK
FT                   K"
FT   gene            complement(480301..481305)
FT                   /locus_tag="EPYR_00420"
FT   CDS_pept        complement(480301..481305)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00420"
FT                   /product="putative aldolase/synthase"
FT                   /function="Isopropylmalate/homocitrate/citramalatesynthas
FT                   es"
FT                   /EC_number="4.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00420"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72735"
FT                   /db_xref="GOA:D2T2R1"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2R1"
FT                   /protein_id="CAY72735.1"
FT                   /translation="MMTNSNVILLDCTFRDGGYYTNWNFDEDLVNIYYSAIIETDVDIM
FT                   EAGYISVDASDCGRFKVENISGFNFLSVIPGKSWAAMIDSKSILCLENWHDIVIHILKK
FT                   PARPVIDIIRVATKFNQLDNIDQLCNIISASGYRVALNLMQIDLACEEEVTAVFEKISS
FT                   IKSIETVYLADSFGSMPPQRVAELITRLKEITSANIGFHAHNNMGMALINSMTAIQAGA
FT                   NWIDTTFAGMGRGAGNAATEELSELIKKPGTETPAVDVLLKRHMDKLKTTYNWGGGVLY
FT                   RRAGKKKIHPTYVQFLIDADLPVDKVYTLLEKIPAASRSIFNTTLIKALINEY"
FT   gene            complement(481389..481760)
FT                   /locus_tag="EPYR_00421"
FT   CDS_pept        complement(481389..481760)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00421"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72736"
FT                   /db_xref="GOA:D2T2R2"
FT                   /db_xref="InterPro:IPR008000"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2R2"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72736.1"
FT                   /translation="MKSWALTIELRNRKAVEIYREMHLNQIPEIHAGDGALAAIGIKTM
FT                   QIFFMQPNMLFMYMETNDDFIPSREFTHALTLDPKVKAFDDYVHGELLQRVFMNDGPTE
FT                   WAVMDKFYQFDSRPDPVQY"
FT   gene            complement(481773..482681)
FT                   /gene="dapA"
FT                   /locus_tag="EPYR_00422"
FT   CDS_pept        complement(481773..482681)
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="EPYR_00422"
FT                   /product="Dihydrodipicolinate synthase; DHDPS"
FT                   /function="Dihydrodipicolinate synthase/N-acetylneuraminate
FT                   lyase"
FT                   /EC_number="4.2.1.52"
FT                   /note="Aldolase-type TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00422"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72737"
FT                   /db_xref="GOA:D2T2R3"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2R3"
FT                   /protein_id="CAY72737.1"
FT                   /translation="MTYTDVKGVLPVILTPWDENFDIHEDDFARQVDYCYEVGADGIVI
FT                   GQVSELMRMNSRERQKITDLAVKYGKPQGHVVVSTGAESTKNAIEYSLSAQDSGVDAVL
FT                   LMHPSTSPLTEQRMLKYYRDVIQQLRIPVIIHHAKSYAKTPMTIRMQADLLHEFGADRI
FT                   MFKPESSPLPPKHTELQIATDNQARIFEGDGGMMIIDSYFRGLYGAIPATDCVKYVVKI
FT                   WNYLQAGDRQSAEKLAYPLSYMMCQMMNSIDCYQHLSKHILHRKGLITHPRVREPVDHI
FT                   PDSVTYKEIDRIISVLDNICE"
FT   gene            complement(482684..483745)
FT                   /gene="goxB"
FT                   /locus_tag="EPYR_00423"
FT   CDS_pept        complement(482684..483745)
FT                   /transl_table=11
FT                   /gene="goxB"
FT                   /locus_tag="EPYR_00423"
FT                   /product="N-methyl-L-tryptophan oxidase; MTOX"
FT                   /function="Glycine/D-amino acid oxidases (deaminating)"
FT                   /EC_number="1.5.3.-"
FT                   /note="FAD dependent oxidoreductase, FAD dependent
FT                   oxidoreductase, thiamin_ThiO: glycine oxidase ThiO"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00423"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72738"
FT                   /db_xref="GOA:D2T2R4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2R4"
FT                   /protein_id="CAY72738.1"
FT                   /translation="MSIKQNYDVVVLGAGILGAATAHQLTCSGLKTALLERGAPAQGCT
FT                   AYSGGIVRIYHSNDYLTELAASSFKYYLDFEANTGVPASFTRTGYLYFPPVQDNTRVQE
FT                   KVQQLRATVDIEWLDRQQMAEQFPTINCDEGAVYEPGAGYMAPAEVTRAFIRAATAKGA
FT                   TLYPGTEVYRLIRRGNKVVGVSTSQGTFTASHVVVALGPNTPAFLDKNNIPHSLWSQRI
FT                   QVDIKNPRQAVAGHPAWIDDVNDLNGRPYENGQFLLGYPTHDRLFIDSVTPGSPVYSEV
FT                   TSMMGQKRFSWVNEAEQCGSWSSFDCYSPAGIGAAEKIEGFISLSVLTGYSGGGFKLAP
FT                   ELARRITDNIIKE"
FT   gene            complement(483735..485063)
FT                   /gene="pvdA"
FT                   /locus_tag="EPYR_00424"
FT   CDS_pept        complement(483735..485063)
FT                   /transl_table=11
FT                   /gene="pvdA"
FT                   /locus_tag="EPYR_00424"
FT                   /product="L-ornithine 5-monooxygenase"
FT                   /function="Lysine/ornithine N-monooxygenase"
FT                   /EC_number="1.13.12.-"
FT                   /note="L-ornithine 5-monooxygenase; L-ornithine
FT                   N(5)-oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00424"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72739"
FT                   /db_xref="GOA:D2T2R5"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2R5"
FT                   /protein_id="CAY72739.1"
FT                   /translation="MVAEIYDIIGVGFGPSNLALSICIDEHNDKLKSPTPPMKSLFFEK
FT                   NQVFSWHSGMLIDDATMQISYLKDLVTLRNPNSPFSFLNYLHQKNRLEDFINLKNFYPT
FT                   RVEYFDYLNWAAQQQQASVRYWHRVDDIKPWTLHDGSTIFEVLVTDLSVGHQSSYLTRN
FT                   LAVATGIIPRMPDSEHASEFIIHSSRFLPTIESIPSSEKKQFLVVGGGQSAAEIVNHLY
FT                   ERFNNATVTSAFTTFGFKPADDSHFVNRIFDAQSVDMFFNASDSLKNRIMDIHADTNYS
FT                   VVDGDLIAELYKKIYQEKVNDHARLQLRQLTRLVSAKKVKNQTVAILHNLKTNEIYTEV
FT                   FDYIILATGYRVPDITELFPSARELMALAEDNSIKLDRSYGANLNCQVVGKIYLPGMSE
FT                   AQHGLSATLLSLLPIRANEIVRDVANSVRLKTSSVVTEVMNVN"
FT   gene            complement(485144..485245)
FT                   /locus_tag="EPYR_00425"
FT   CDS_pept        complement(485144..485245)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00425"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72740"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2R6"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72740.1"
FT                   /translation="MKKNNLFTSNIFCVFILSDITISRNQGIINSVG"
FT   gene            complement(486431..489769)
FT                   /locus_tag="EPYR_00426"
FT   CDS_pept        complement(486431..489769)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00426"
FT                   /product="probable helicase senataxin"
FT                   /function="Superfamily I DNA and RNA helicases and helicase
FT                   subunits"
FT                   /EC_number="3.6.1.-"
FT                   /note="probable helicase senataxin (SEN1 homolog)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00426"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72741"
FT                   /db_xref="GOA:D2T2R7"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2R7"
FT                   /protein_id="CAY72741.1"
FT                   /translation="MAAFPLPHDILRAWQRVEFFQPYTLEQKDKSLLIPFTKLQQSGDK
FT                   ALPWLSAELRQQHQIPPKSSYNLHLGLFEKSIASTMSQSIFGQNSGHDVDECEQRLNQE
FT                   GTTCFTKVQLNAEGVPALDKLSVSSLPWALGHLHKRQLQQLESNVFLAACNHLANTLRH
FT                   FRTTLKPAKENGHGILRTDDILTLLTTHLVEWAEFEPSWQYAIQIDWFTGNSGGTETAC
FT                   KDESESEGVLNESDKAFSLPILNSFFFEDIERAILSLKQKNRCTTLKAYLSESAPRNTS
FT                   LYSQGGLAAIISQLHPKKMPQGRWPAEPGHAMSLMQQFAINTAVDELADGGILSVNGPP
FT                   GTGKTTLLRDLVAHNIVERAKVLSRFAEVTDTLDSDGFIVQALTGYEMVMASSNNAAVE
FT                   NISKELPQIKSLADEFRSLDYLAPTANQIAAESRPKREHKRDKNGEGKERDYHLFRPLK
FT                   EKNHCWGLISVALGKKANRTRFAQRLLIDEHHLRKTGAEISRPADENFLSLWRWKNHHN
FT                   ATSFANAKKHFIECQKKTAELQQQLETLANLLAKQPDGSLNALSSALEQTEQSYEMYRH
FT                   RLQKITEEQDLLENQIQHAALQQKKIEKKSPGWLARLINRKQVKTYQEERLKAQHHLLT
FT                   LTELLVQKTQRATELRKQVNDIKAKKRAIQQDIKKTTRQQADDRAEMMRLKERFPNITL
FT                   PDPAKRIDDEELQRTAFWQNAEINRQRSRLFIAAMELHQAWLYEALSISSFGKNIRDLS
FT                   HFLSTPHTESTPLRWWQTLFIFVPVISTTFASVGRMFHGVKGEELGWLMIDEAGQASPQ
FT                   QAVGAIWRARRVLVVGDPLQIEPVFTTSPVLVKHLCQNTLYEHAEDWNPGRTSVQQVTD
FT                   RVNPWGCELKVMNLDVWIGIPLWVHRRCIDPMFTLANKMAYDNRMIHGFTTDKISSQQV
FT                   NGVVENHWLASTGGLGEKQYRDSHGKSLLHLLNCLLSENVALHSIYVITPFKAVKTALS
FT                   ALLEQRDLKAWRQYSPLIKHKEITEWLKNCVGTVHTFQGKENEIVILVLGCDEHEDGGA
FT                   KWASSKPNLLNVALTRAKKHIFVIGDPSVWQGLPGFRDVARTLPIRATGSMGENIIKDV
FT                   EDFSH"
FT   gene            complement(489885..490103)
FT                   /locus_tag="EPYR_00427"
FT   CDS_pept        complement(489885..490103)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00427"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72742"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2R8"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72742.1"
FT                   /translation="MLRVSQMGSERPSMIIALPGLQKCRSGHGSVGITVNIRSHEGWQK
FT                   KLAREGDNYRIMHLTPASLPLWRRKGK"
FT   gene            490349..490906
FT                   /gene="yecA"
FT                   /locus_tag="EPYR_00428"
FT   CDS_pept        490349..490906
FT                   /transl_table=11
FT                   /gene="yecA"
FT                   /locus_tag="EPYR_00428"
FT                   /product="Uncharacterized protein yecA"
FT                   /function="Predicted metal-binding protein related to the
FT                   C-terminal domain of SecA"
FT                   /note="YgfB and YecA, ygfB_yecA: yecA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00428"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72743"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2R9"
FT                   /protein_id="CAY72743.1"
FT                   /translation="MQQGPLTEVELEWLDEILVKYGNDESVLDVSELDGLFTAILSGPV
FT                   LVGPQEWLPLIWGGEEHDPDWESEEEFEQFMDLIAQHMNDIADRLNEYPDQFEPLFGTR
FT                   EVEGQEFTVVEEWCFGYMKGVALGDWSRLHESLHPALQAIALHGKEEHFAELDTFSPDE
FT                   YEQSIAAIRPAALSLHQKRQLH"
FT   gene            complement(490956..491771)
FT                   /gene="nlpA"
FT                   /locus_tag="EPYR_00429"
FT   CDS_pept        complement(490956..491771)
FT                   /transl_table=11
FT                   /gene="nlpA"
FT                   /locus_tag="EPYR_00429"
FT                   /product="D-methionine-binding lipoprotein metQ precursor"
FT                   /function="ABC-type metal ion transport system,periplasmic
FT                   component/surface antigen"
FT                   /note="Lipoprotein YaeC, NLPA lipoprotein, TIGR00363:
FT                   lipoprotein, YaeC family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00429"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72744"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2S0"
FT                   /protein_id="CAY72744.1"
FT                   /translation="MKTALNCALIVTLLMLGSLPGGCDNKSKDAHHIKVGVINGAEQDV
FT                   AEVAKKVAKEKYGLDVELVGFSGSLLPNEPTAHGDLDANVFQHRPFLEQDNKARGTSLV
FT                   AVGNTFIFPIAGYSKKIKRIAELKDGDTLAIPNDPTNLGRALLLLQKEKLVTLKPNSGL
FT                   LPTALDITANPRHLKIIETEAAQLPRALDDAQVTVAIINTTYIQQTGLNPVRDSVFIED
FT                   KQSPYVNIIVTRANNKDAAKVHDFIRAYQSPEVAAAADNIFNGGAVVGW"
FT   gene            complement(491902..492159)
FT                   /locus_tag="EPYR_00430"
FT   CDS_pept        complement(491902..492159)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00430"
FT                   /product="putative transcriptional regulator"
FT                   /function="Predicted transcriptional regulators"
FT                   /note="Lambda repressor-like, DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00430"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72745"
FT                   /db_xref="GOA:D2T2S1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2S1"
FT                   /protein_id="CAY72745.1"
FT                   /translation="MLPHRLKEARLKKGLSQQKLGVLAGIDEATASARMNQYERGIHVP
FT                   DFELVCRLAAVLDVPSCYLYTLEDELAALVLLWHAQRQNN"
FT   gene            492290..492619
FT                   /gene="nlp"
FT                   /locus_tag="EPYR_00431"
FT   CDS_pept        492290..492619
FT                   /transl_table=11
FT                   /gene="nlp"
FT                   /locus_tag="EPYR_00431"
FT                   /product="Sugar fermentation stimulation protein B"
FT                   /function="L-serine deaminase"
FT                   /note="Sugar fermentation stimulation protein B (Ner-like
FT                   protein), Lambda repressor-like, DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00431"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72746"
FT                   /db_xref="GOA:D2T2S2"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR038722"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2S2"
FT                   /protein_id="CAY72746.1"
FT                   /translation="MKKRRDMHPADILAAFKKRQTSLAALSRQAGLNSGTLANALKRPW
FT                   PKGEFIIAAALGVHPSAIWPSRYYDSRGLLLARERRLRRSRAIPLAADAPETEENIFIL
FT                   PDSIA"
FT   gene            complement(492638..493879)
FT                   /gene="ampH"
FT                   /locus_tag="EPYR_00432"
FT   CDS_pept        complement(492638..493879)
FT                   /transl_table=11
FT                   /gene="ampH"
FT                   /locus_tag="EPYR_00432"
FT                   /product="Penicillin-binding protein ampH"
FT                   /function="Beta-lactamase class C and other penicillin
FT                   binding proteins"
FT                   /note="Beta-lactamase-type transpeptidase
FT                   fold,Beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00432"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72748"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2S3"
FT                   /protein_id="CAY72748.1"
FT                   /translation="MQLKPKKLLWSAQSFTDRNGRPLKPSLCAFLLLPVLALPLAGQAR
FT                   TAPDPLLAAKTVERYADNIFYNTKASAMAIVAIDANQRVFASRGSVRPGSQQPPEKDSL
FT                   IRVASLSKLMTSQLMVRLAEEGRLQLDDPLSKYAPPGSRVPSFNGQPIRLINLATHTSA
FT                   LPREQPGGKAVRAVFTWPTYSQRWNWLGTAKLKWTPGERAAYSNLAFDLLGDALAKAGG
FT                   KPYSALFREKITRPLGMKDTTFTPSPDQCGRLIVPAKNPSPCDNSLAAIGSGGVYSTPE
FT                   DMGRWMQQFLSSGMHTRSPQADSLQTMIYRRGQLSKVEGMDVPGRADALGMGWVYMAPR
FT                   EGRPGIIEKTGGGGGFITYMAMVPQYSVGVFVVVARTAETRFTPMSDGANNLLTELIGN
FT                   TSGSAQLAASIMAN"
FT   gene            complement(493907..496201)
FT                   /gene="mdoB"
FT                   /locus_tag="EPYR_00433"
FT   CDS_pept        complement(493907..496201)
FT                   /transl_table=11
FT                   /gene="mdoB"
FT                   /locus_tag="EPYR_00433"
FT                   /product="phosphoglycerol transferase I"
FT                   /function="Phosphoglycerol transferase and related
FT                   proteins, alkaline phosphatase superfamily"
FT                   /EC_number="2.7.8.20"
FT                   /note="Alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00433"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72750"
FT                   /db_xref="GOA:D2T2S4"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2S4"
FT                   /protein_id="CAY72750.1"
FT                   /translation="MVSEWFSLLLFLASALLYSCKAGRHKLWFMAILSLLAIYIVLNAT
FT                   LLASNYFTGEGINDAVIYTITSSLSGAGLQKYILPAAGLVAALLLLFTFLSWVLRLRKS
FT                   HNYSPLYSVLALILALASIKTTPAYQQVTALIQSQADKGDSDFYSHYRAPAKRLDGKQP
FT                   NLVYIYAESLERTYFDDGAFPGLAVELNKIKKQSLDFSYTEQLPGTEYTIAGMVASQCG
FT                   IPLFAPFDGNASSSLSSFYPQNICLGDILKTSGYQNYFYQGSSLSFAGKDLFLSSHGFD
FT                   HIYGFTELKSVVKDDKYRNDWGWYDDTVLDVVFDKYLELAQKDRPFSLFALTVDTHHPD
FT                   GFISRSCQRKSYPFAGKENKSFAAVACSQEHIARLIEKIRATPWSKNTLIVVSSDHLAM
FT                   NNTAWKYLNQHDRRDLFFMLRGDDASGQVLNVKRNTMDNGATVLDAMGGDNFIGLGRSS
FT                   LSSTSLSTSYVNIKEKITQWKPDVIKLWNFPKTISDYKIDTAKNTFSFSGAHFKLPLLL
FT                   SVKPDKIEPKLDAWLATPLRQQLARFSADEKFVWIDRCFKIGSVWDDTLAMDGSLCVAS
FT                   GTLNAQPTILRVQPGSLSGKVTFPAQYEQSDDRYQRSLARLKIADSDLKYRSETIWFNL
FT                   PGMPQQVQKIAGLSHLEPWGRWSDANLQPDVTIQYLDPLPAAFTLTLNARAWGDNSLHP
FT                   VTVKIGNWQQQVTFANHDTTLTLQVSNPTQARSITLTPPQPVETSEGTMDGFAARKLGI
FT                   GLVSLRVTPSP"
FT   gene            496774..497925
FT                   /gene="ompU"
FT                   /locus_tag="EPYR_00434"
FT   CDS_pept        496774..497925
FT                   /transl_table=11
FT                   /gene="ompU"
FT                   /locus_tag="EPYR_00434"
FT                   /product="outer membrane protein"
FT                   /function="Outer membrane protein (porin)"
FT                   /note="Porin, Gram-negative type, TC 1.B.1.2 The General
FT                   Bacterial Porin (GBP) Family, OmpU subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00434"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72752"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2S5"
FT                   /protein_id="CAY72752.1"
FT                   /translation="MLIKKPVLTQVIGLGLAVGCASFAANAEMTVLKQNPQAGDPLSRL
FT                   NFTVGGSIRPQFNNFTGDGDKGSYKRNGFDGGSRLRFAADYYLFDDISWISYYELGVDI
FT                   PALFDWDHHYAEGANDTSRRMLYTGLKSKTWGQLTFGQQNSVYYDVVGAKTDLWDYDML
FT                   GQASGNGIKGDYDGSYRSRKMLKYKNTFGDADVYASYLFADNEYLTGKGPRYERKGGGS
FT                   LGVDYHIAKDLTWGTAWNYTRAEMRDPVKGNDKTWDQNIFGSSLSWTPDNWTFTVGGGW
FT                   YDNFLPSKKADVNHYFAGDAWGIEYLAGYTVAVNQYGLKSVMPYVMGDRMQYVTGRDYQ
FT                   RIDNGVGMTFKMNYGFRIDYEHVFTSSTDNLGDMNLVRLRYDF"
FT   gene            498113..498619
FT                   /gene="ygjF"
FT                   /locus_tag="EPYR_00435"
FT   CDS_pept        498113..498619
FT                   /transl_table=11
FT                   /gene="ygjF"
FT                   /locus_tag="EPYR_00435"
FT                   /product="G/U mismatch-specific DNA glycosylase"
FT                   /function="G:T/U mismatch-specific DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="G/U mismatch-specific DNA glycosylase
FT                   (Mismatch-specific uracil DNA-glycosylase) (MUG)
FT                   (Double-strand-specific uracil glycosylase), Uracil-DNA
FT                   glycosylase superfamily, Uracil DNA glycosylase
FT                   superfamily, mug: mismatch-specific thymine-DNA glycosylate
FT                   (mug)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00435"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72754"
FT                   /db_xref="GOA:D2T2S6"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR015637"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2S6"
FT                   /protein_id="CAY72754.1"
FT                   /translation="MEAQGITDIIQPGLRVLFCGINPGKSSAHTGFHFAHPGNRFWKTI
FT                   FQAGFTRTQLKPEQEQQLLATGCGITMLVERPTVLASELASSELRSGGKALVDKIERFQ
FT                   PAALAVLGKQAYQQAFRRSQVAWGRQPLAVGATEIWVLPNPSGLNRASQQEMTEAYAQL
FT                   HLALA"
FT   gene            498794..500440
FT                   /gene="tsr"
FT                   /locus_tag="EPYR_00436"
FT   CDS_pept        498794..500440
FT                   /transl_table=11
FT                   /gene="tsr"
FT                   /locus_tag="EPYR_00436"
FT                   /function="Methyl-accepting chemotaxis protein"
FT                   /note="Methyl-accepting chemotaxis citrate transducer
FT                   (Citrate chemoreceptor protein), Bacterial chemotaxis
FT                   sensory transducer, Methyl-accepting chemotaxis protein
FT                   (MCP) signaling domain"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00436"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72755"
FT                   /db_xref="GOA:D2T2S7"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2S7"
FT                   /protein_id="CAY72755.1"
FT                   /translation="MFNHTRITVLLTGAAGFLLALFTAVSFMTSSFLDKSSRAVSGLNN
FT                   EVSATLSVANTTNFIRRARARMMMALHHMNDADQTMYQAFTQVSRRDVNLAMAFMPEYQ
FT                   SEAKLPGETALAEELQTRFKRYTTSVEALLSALEKKDSVEFLRLAGTDVQRDDEAYDVI
FT                   LAQVIDMHHKSSAAITQAAQSDSRLAYILIILSVMVFLITILLIALLVRRRVIVPLGYA
FT                   GELTRAIGRGDLTRQVGTQRRDEIGLLMSGLGEMQDQLSKVVNNVILGIDEVSRVSGDI
FT                   DQGAQSLSARTGQQAAALEQTSASMEELSATVELNAENSANASKFASEAAQTAVRGGEL
FT                   MQQVVSNMANIRSSSTSIGEIIGVINDIAFQTNILALNAAVEAARAGEHGKGFAVVAGE
FT                   VRTLAQRSASSAKDIANLIQVSEANISEGGALTDRVAKTTADIIESIGSVRDLIGEIAV
FT                   ASREQSQGIGQVGAAVHEMDRVTQQNSSLVSASGESATVLNKQVGNLRAEVAIFVTREI
FT                   AARGGLKELPVRSGKPTKPACADAQGGWASF"
FT   gene            complement(500598..502439)
FT                   /gene="rpoD"
FT                   /locus_tag="EPYR_00437"
FT   CDS_pept        complement(500598..502439)
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="EPYR_00437"
FT                   /product="RNA polymerase sigma factor rpoD (Sigma-70)"
FT                   /function="DNA-directed RNA polymerase, sigma subunit
FT                   (sigma70/sigma32)"
FT                   /note="RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00437"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72757"
FT                   /db_xref="GOA:D2T2S8"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2S8"
FT                   /protein_id="CAY72757.1"
FT                   /translation="MEQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQIEDII
FT                   QMINDMGIQVVEEAPDADDLMLNENSSDTDEDAAEAAAQVLSSVESEIGRTTDPVRMYM
FT                   REMGTVELLTREGEIDIAKRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAGEARLSDL
FT                   ITGFVDPNAEEDIAPTATHVGSELSAEEREDEDEDEESDDDSSDDDNSIDPELAREKFG
FT                   DLRIQYETTRTVIKAKSRSHADAIAEIQNLSDVFKQFRLVPKQFDFLVNSMRVMMDRVR
FT                   TQERIIMKLCVELCKMPKKNFITLFTGNETNETWFKAALAMNKPWSEKLNDVSDDVNRG
FT                   LQKLQQIEEETGLTIEQVKDINRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGL
FT                   QFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIE
FT                   TINKLNRISRQMLQEMGREPTPEELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDS
FT                   HLGDFIEDTTLELPLDSATSESLRSATHDVLAGLTAREAKVLRMRFGIDMNTDHTLEEV
FT                   GKQFDVTRERIRQIEAKALRKLRHPSRSEVLRSFLDD"
FT   gene            complement(502763..504508)
FT                   /gene="dnaG"
FT                   /locus_tag="EPYR_00438"
FT   CDS_pept        complement(502763..504508)
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="EPYR_00438"
FT                   /product="DNA primase"
FT                   /function="DNA primase (bacterial type)"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00438"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72759"
FT                   /db_xref="GOA:D2T2S9"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2S9"
FT                   /protein_id="CAY72759.1"
FT                   /translation="MAGRIPRVFINDLLARTDIVDLIDARVKLKKQGKNYHACCPFHNE
FT                   KTPSFTVNGEKQFYHCFGCGAHGNAIDFLMNYDRLEFVESIEELATLYGLEIPYESGSG
FT                   PSQLERHQRQSLYQLMTGLRDFYQQSLGQGSSSGARGYLAQRGLSDEVIKHFSIGFAPA
FT                   GWDNALKRFGSNPDDRQSLTDAGMLVTNDQGRSYDRFRERVMFPIHDKRGRVIGFGGRV
FT                   LGDGMPKYLNSPETDIFHKGRQLYGLYEALKNHPAPGKLLVVEGYMDVVALAQFGVDYA
FT                   VASLGTSTTAEHIQLLFRSTDTVICCYDGDRAGREAAWRALETALPYMNDGRQLRFMFL
FT                   PDGEDPDTLVRKEGKEAFEARMEQAMPLSTFLYDTLLPQVDLSTPDGRAQLATLALPLL
FT                   RQVPGETLRIYLRQVLGDKLGIPDHIQLEKLFPEKAESAKPVAQPQLKRTTMRILIGLL
FT                   IQNPQLATIVPPLDGLEQSETPGFPLFIELVSTCVAHPGLTTGQLLELYRGTEFSQSLE
FT                   TLATWNHMIVDDEVETMFQDALASMYNNALERRLEELIAHDRTHGLNAEERRELWTLSQ
FT                   ALKKQ"
FT   gene            complement(504802..505017)
FT                   /gene="rpsU"
FT                   /locus_tag="EPYR_00439"
FT   CDS_pept        complement(504802..505017)
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="EPYR_00439"
FT                   /product="30S ribosomal protein S21"
FT                   /note="Ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00439"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72761"
FT                   /db_xref="GOA:D2T2T0"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2T0"
FT                   /protein_id="CAY72761.1"
FT                   /translation="MPVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTER
FT                   KRAKASAVKRHAKKLARENARRTRLY"
FT   gene            505321..506334
FT                   /gene="ygjD"
FT                   /locus_tag="EPYR_00440"
FT   CDS_pept        505321..506334
FT                   /transl_table=11
FT                   /gene="ygjD"
FT                   /locus_tag="EPYR_00440"
FT                   /product="putative O-sialoglycoprotein endopeptidase"
FT                   /function="Metal-dependent proteases with possible
FT                   chaperone activity"
FT                   /EC_number="3.4.24.57"
FT                   /note="probable O-sialoglycoprotein endopeptidase
FT                   (Glycoprotease), Peptidase M22, glycoprotease,Glycoprotease
FT                   family, gcp: metalloendopeptidase,putative, glycoprotease
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00440"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72762"
FT                   /db_xref="GOA:D2T2T1"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2T1"
FT                   /protein_id="CAY72762.1"
FT                   /translation="MRVLGIETSCDETGVAIYDDVAGLLANQLYSQVKLHADYGGVVPE
FT                   LASRDHVRKTVPLIQAALEEAGLQAQDIDAVAYTAGPGLVGALLVGATIGRSLAFAWGV
FT                   PAIAVHHMEGHLLAPMLEDNPPEFPFVALLVSGGHTQLISVTGIGAYTLMGESIDDAAG
FT                   EAFDKTAKLLGLDYPGGPMLSKMAQQGVEKRFIFPRPMTDRPGLDFSFSGLKTFAANTI
FT                   RDNDDSSQTRADIARAFEDAVVDTLAIKCRRALDQSGFKRLVIAGGVSANRTLRAKLAE
FT                   MMQKRGGEVFYARPEFCTDNGAMIAYAGMVRLKGGTHAELSVTVRPRWPLAELPAI"
FT   gene            complement(506344..506958)
FT                   /gene="ygiH"
FT                   /locus_tag="EPYR_00441"
FT   CDS_pept        complement(506344..506958)
FT                   /transl_table=11
FT                   /gene="ygiH"
FT                   /locus_tag="EPYR_00441"
FT                   /product="UPF0078 membrane protein"
FT                   /function="Predicted membrane protein"
FT                   /note="Protein of unknown function DUF205, TC 9.B.31.1.1
FT                   UPF0078 membrane protein ygiH"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00441"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72764"
FT                   /db_xref="GOA:D2T2T2"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2T2"
FT                   /protein_id="CAY72764.1"
FT                   /translation="MSIFAPGMILFAYLCGSLSSAILVCRLFGLPDPRHHGSGNPGATN
FT                   VLRIGGKGVAATVLVFDVFKGMLPVWLAYHFGATPFYLGLTAIAACLGHIYPVFFRFKG
FT                   GKGVATALGAIAPIGWDLTGLVTGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFT
FT                   FPVAMLSCLILLRHHDNIQRLWRGQENKIWKKKNRQGPGEN"
FT   gene            507066..507425
FT                   /gene="folB"
FT                   /locus_tag="EPYR_00442"
FT   CDS_pept        507066..507425
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="EPYR_00442"
FT                   /function="Dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /note="Dihydroneopterin aldolase, Dihydroneopterin
FT                   aldolase, folB_dom: FolB domain"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00442"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72766"
FT                   /db_xref="GOA:D2T2T3"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2T3"
FT                   /protein_id="CAY72766.1"
FT                   /translation="MDIVFIDQLSVITTIGVYDWEQTIQQKLVFDVEMAWDNRKAAASD
FT                   DVNDCLSYADVAEAIIAHVGQGKFALVERVAEEVATLLLARFASAWVRIKLSKPGAVAQ
FT                   AHQVGVIIERGTIPK"
FT   gene            complement(507412..507573)
FT                   /locus_tag="EPYR_00443"
FT   CDS_pept        complement(507412..507573)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00443"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72768"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2T4"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72768.1"
FT                   /translation="MSAIKSTPVKYMKKAVALRYRQIVPAIRQGNLKTEDNVIWFHCDG
FT                   NHIKFISE"
FT   gene            507563..508384
FT                   /gene="bacA"
FT                   /locus_tag="EPYR_00444"
FT   CDS_pept        507563..508384
FT                   /transl_table=11
FT                   /gene="bacA"
FT                   /locus_tag="EPYR_00444"
FT                   /product="undecaprenyl-diphosphatase"
FT                   /function="Uncharacterized bacitracin resistance protein"
FT                   /EC_number="3.6.1.27"
FT                   /note="Undecaprenyl-diphosphatase (Undecaprenyl
FT                   pyrophosphate phosphatase) (Bacitracin resistance protein)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00444"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72769"
FT                   /db_xref="GOA:D2T2T5"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2T5"
FT                   /protein_id="CAY72769.1"
FT                   /translation="MADIHQLWVAAILGLVEGLTEFLPVSSTGHMILVGHLLGFEGDKA
FT                   QTFEVVIQLGSILAVVVMFWRRLFGLIGIHFGEVKHEGIGQGRLSLIHILLGMAPAVVI
FT                   GLLLHDLIKSLFNPVNVMYALVVGGVLLIAAELLKPKQPKSPGVDDITYRQAFIIGCFQ
FT                   CLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMIGATGLDLYKSMGFLTMAD
FT                   FPMFAVGFVSAFIVALIAIKSFLHIIKRISFIPFAIYRFIVAAAVYVLFVL"
FT   gene            complement(508455..509678)
FT                   /gene="cca"
FT                   /locus_tag="EPYR_00445"
FT   CDS_pept        complement(508455..509678)
FT                   /transl_table=11
FT                   /gene="cca"
FT                   /locus_tag="EPYR_00445"
FT                   /product="tRNA nucleotidyltransferase (CCA-adding enzyme)"
FT                   /function="tRNA nucleotidyltransferase/poly(A) polymerase"
FT                   /EC_number="2.7.7.21"
FT                   /note="2.7.7.21], Multifunctional CCA protein [Includes:
FT                   CCA-adding enzyme (tRNA nucleotidyltransferase) (tRNA
FT                   adenylyl-/cytidylyl-transferase) (tRNA
FT                   CCA-pyrophosphorylase) (tRNA-NT); 2'-nucleotidase ;
FT                   2',3'-cyclic phosphodiesterase ; Phosphatase )], tRNA
FT                   nucleotidyltransferase, proteobacteria, Poly A polymerase
FT                   head domain"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00445"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72771"
FT                   /db_xref="GOA:D2T2T6"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2T6"
FT                   /protein_id="CAY72771.1"
FT                   /translation="MKTYLVGGAVRDGLLDLPLKDKDWVVVGASPQQMLDLGYQQVGRD
FT                   FPVFLHPDSHEEYALARTERKSGQGYTGFVCYSAPDVTLEQDLARRDLTMNAIAQDTDG
FT                   NYYDPYGGRNDLQRRLLRHVSAAFKEDPLRVLRVARFAARFAHLNFRIADETLALMQTM
FT                   TDSGELQQLTAERVWKETESALQTPSPQVFFQVLRDCGALAVLFPELDNLYGVPAPAKW
FT                   HPEIDTGVHTLMTLEMAARLSPEIDIRFATLFHDVGKALTPPEKWPSHPGHGPAGVPLV
FT                   AALCERLRVPNALRDLALLVTEFHDLVHTIQHQSPAQLVALFDRLDAWRKPHRVQQIAL
FT                   TSEADARGRTGFEDNPYPQGDYLREAWLIVQNVSTKEVVDAGFKGMEVRDELTRRRIAA
FT                   LDVWKKAQ"
FT   gene            complement(509816..510436)
FT                   /gene="ygiM"
FT                   /locus_tag="EPYR_00446"
FT   CDS_pept        complement(509816..510436)
FT                   /transl_table=11
FT                   /gene="ygiM"
FT                   /locus_tag="EPYR_00446"
FT                   /product="Uncharacterized protein ygiM precursor"
FT                   /function="SH3 domain protein"
FT                   /note="Bacterial SH3-like region"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00446"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72773"
FT                   /db_xref="GOA:D2T2T7"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR016476"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2T7"
FT                   /protein_id="CAY72773.1"
FT                   /translation="MKKTHLISLTLFAFSVTANVHAAEKRYISDDLSTWARSGPGNDYR
FT                   LVGTLNAGEEVELLQKNDNTKYGQIRDSQGRTTWIPLAQLSEQPSLRIRVPQLEQQVKD
FT                   LSTKLANIDGSWNQRTADMQKKVAGSDNAINSLKAENQQLKNQLVVARKKVDAANVQLD
FT                   DKQRTIIMQWFMYGGGVAGIGLLLGLLLPRMIPRRKQNNRWMN"
FT   gene            510686..511990
FT                   /gene="ygiF"
FT                   /locus_tag="EPYR_00447"
FT   CDS_pept        510686..511990
FT                   /transl_table=11
FT                   /gene="ygiF"
FT                   /locus_tag="EPYR_00447"
FT                   /product="Uncharacterized protein ygiF (ORFXE)"
FT                   /function="Uncharacterized conserved protein"
FT                   /note="Adenylate cyclase, CYTH domain"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00447"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72775"
FT                   /db_xref="GOA:D2T2T8"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR039013"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2T8"
FT                   /protein_id="CAY72775.1"
FT                   /translation="MTIEIELKFIAAPEAATKVAAKLAAWPHQHVPGQKLTNIYFETDD
FT                   NQLRRWDMGLRIRGFGDGYEMTLKTAGQTVGGLHQRPEYNVPLTQPELDIQRLPGEIWP
FT                   AGTDVAALQQRLKVLFSTHFVREKWVVTYLQSEIEVAFDCGEVSAGALSEPLMEIELEL
FT                   KNGHRDDLLALATELAMLDGLRLGSLTKAARGYALAQGNPPRSLRPLPLLKARPKATVE
FT                   EGMQAAFQLALGQWQYHEELWLRGHADALREVKDALETLRQAFSLYGVLVPRKASSDLR
FT                   QKLTLLEEAMLDDNVKAETLCFSALWLQPQLALTNWLATARWREFVDSKADAKLQGSFK
FT                   RFSDIMLGRIAADLKETFAQVNHAGEYQDKLMRLHRQLLAVHLLAGSYDAAAVNAWLQS
FT                   WQQLGQAIDGQQDAWFEGHLRQALKQPAFWKNGSL"
FT   gene            512033..514867
FT                   /gene="glnE"
FT                   /locus_tag="EPYR_00448"
FT   CDS_pept        512033..514867
FT                   /transl_table=11
FT                   /gene="glnE"
FT                   /locus_tag="EPYR_00448"
FT                   /product="glutamate-ammonia-ligase adenylyltransferase"
FT                   /function="Glutamine synthetase adenylyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /note="Glutamate-ammonia-ligase adenylyltransferase
FT                   ([Glutamate-ammonia-ligase] adenylyltransferase)
FT                   (Glutamine-synthetase adenylyltransferase) (ATase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00448"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72777"
FT                   /db_xref="GOA:D2T2T9"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2T9"
FT                   /protein_id="CAY72777.1"
FT                   /translation="MVPSLMQPLPALLADQVMRLDPLFNGASSRHQAVLVFSDFIRTSL
FT                   INFPDWWQQLQQQPPRPDEWQHYRQWLQTQLAAVQDENALMRELRQFRRHMLTRIAWMQ
FT                   TLAESTTEQSLRQLSELAERLIVAARDWLWHACCADLGTPMNAAGEPQPLLILGMGKLG
FT                   GVELNFSSDIDLIFTWPENGTTQGGRRELDNAQFFTRLGQRLIKVLGQTTVDGFVYRVD
FT                   MRLRPFGDSGPLVLSFAALEDYYQEQGRDWERYAMVKARLMGDSDDRWSAELRQMLRPF
FT                   VFRRYIDFSVIQSLRNMKSMIAREVRRRGLTDNIKLGAGGIRETEFIVQVFQLIRGGRE
FT                   RSLQQRSLLPTLAAIGELHLLPSDRVGQLQVAYQFLRRLENLLQSINDEQTQTLPDSEP
FT                   DRARLAWAMGFTDWAALHARLDRHMVDVRTIFNELIGDDTADSADNREAGEYGALWQDR
FT                   LEETDLQLLVPHLASNARQQLLRTLNDFRQDLDKRTIGPRGRQALDQLMPRLLSEVVPR
FT                   NDAPVTLMRLTPLLLGVVTRSTYLELLSEYHGALQHLIRLCAASPMVASQLARYPLLLD
FT                   ELLDPATLYHPTATDAYRDELRQYLLRIPEEDEEQQLEALRQFKQAQHLRIAAADIAKT
FT                   LPVMKVSDHLTWLAEAITESVVQQAWNMMVQRYGRPSHLVSDSERGFAVVGYGKLGGWE
FT                   LGYSSDLDLVFLHDCPAEAVTLGERSIDGRQFYLRLAQRVMHLFSTRTSSGILYEVDAR
FT                   LRPSGAAGMLVSTFAAFDEYQRSEAWTWEHQALVRARIVFGDSALSQRFERIRRSVLGL
FT                   PREAQALQTEVREMREKMRAHHGNKHKGRWDIKSDAGGIIDIEFMTQYLVLRYASQHPE
FT                   LTRWSDNVRILELLARSGKMEPAQALALTHAYVTLRDALHHLALQELPGHVSVDAFAQE
FT                   KAEVKACWQAWLSA"
FT   gene            514955..516391
FT                   /gene="rfaE"
FT                   /locus_tag="EPYR_00449"
FT   CDS_pept        514955..516391
FT                   /transl_table=11
FT                   /gene="rfaE"
FT                   /locus_tag="EPYR_00449"
FT                   /product="ADP-heptose synthase"
FT                   /function="ADP-heptose synthase, bifunctional sugar
FT                   kinase/adenylyltransferase"
FT                   /EC_number="2.7.-.-"
FT                   /note="Bifunctional protein [Includes: D-beta-D-heptose
FT                   7-phosphate kinase (D-beta-D-heptose 7-phosphotransferase);
FT                   D-beta-D-heptose 1-phosphate adenosyltransferase ]"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00449"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72778"
FT                   /db_xref="GOA:D2T2U0"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2U0"
FT                   /protein_id="CAY72778.1"
FT                   /translation="MKITLPDFTRAGVLVVGDVMLDRYWHGPTNRISPEAPVPVVKVDS
FT                   VEERPGGAANVAMNIASLGARSRLIGLTGIDDAARALSAALSGVNVQCDFVPVATHPTI
FT                   TKLRVLSRNQQLIRLDFEEGFEGVDPAPMHERIQQSLPGIGALVLSDYAKGALASVETM
FT                   IALARKAGVPVLVDPKGTDFSRYHGATLLTPNLSEFEAVVGKCKSEADIVERGTALMQQ
FT                   YALSALLVTRSEHGMTLLQPGKAPFHMPTQAQEVFDVTGAGDTVIGVLATALAAGNTLE
FT                   ESCYLANAAAGVVVGKLGTSTVSPVELENAIRARPESGFGVMNEAQLIAEVAKARQRGE
FT                   KVVMTNGVFDILHAGHVSYLANARKLGDRLIVAVNSDASTRRLKGKTRPVNPLVNRMMV
FT                   LGALEAVDWVIGFEEDTPQRVIAEVLPDLLVKGGDYKPEDIAGSKEVWENGGDVRVLNF
FT                   EDGISTSNIIKTIICGTGQN"
FT   gene            complement(516436..516720)
FT                   /gene="yqiC"
FT                   /locus_tag="EPYR_00450"
FT   CDS_pept        complement(516436..516720)
FT                   /transl_table=11
FT                   /gene="yqiC"
FT                   /locus_tag="EPYR_00450"
FT                   /product="Uncharacterized protein yqiC"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="Protein of unknown function DUF526, Protein of
FT                   unknown function (DUF526)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00450"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72780"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2U1"
FT                   /protein_id="CAY72780.1"
FT                   /translation="MIDAKKIEQLARQVHDAMPKGIRDLGDDVEKKIRQTLQSQLTRLD
FT                   LVNREEFDVQTQVLLRTREKLAALEQRLAELENRAVPQLPAEVADKPTE"
FT   gene            516827..516994
FT                   /locus_tag="EPYR_00451"
FT   CDS_pept        516827..516994
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00451"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72781"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2U2"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72781.1"
FT                   /translation="MFIALLLFQRYDNFAYSQGGAKFPTGGKSADAESPRALQIHSEGQ
FT                   QIRCNSGADG"
FT   gene            517125..517781
FT                   /gene="ribB"
FT                   /locus_tag="EPYR_00452"
FT   CDS_pept        517125..517781
FT                   /transl_table=11
FT                   /gene="ribB"
FT                   /locus_tag="EPYR_00452"
FT                   /function="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="3,4-dihydroxy-2-butanone 4-phosphate synthase (DHBP
FT                   synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00452"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72783"
FT                   /db_xref="GOA:D2T2U3"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2U3"
FT                   /protein_id="CAY72783.1"
FT                   /translation="MNQSLLSEFGTPEQRVTRAVEALRSGRGVMVLDDEDRENEGDMIF
FT                   AAETMTVEQMALTIRHGSGIVCLCLNEERLEQLDLPMMVQNNTSAYGTGFTVTIEAARG
FT                   VTTGVSATDRLTTIRTAIADDAKPSDLNRPGHVFPLRARSGGVLTRGGHTEATIDLVTL
FT                   AGFKPAGVLCELTNDDGSMAHAPEVMVFARQHNMPVVTIEDLVSWRHSQETLQAS"
FT   gene            517977..518762
FT                   /gene="ygiD"
FT                   /locus_tag="EPYR_00453"
FT   CDS_pept        517977..518762
FT                   /transl_table=11
FT                   /gene="ygiD"
FT                   /locus_tag="EPYR_00453"
FT                   /product="Uncharacterized protein ygiD"
FT                   /function="Uncharacterized conserved protein"
FT                   /note="Extradiol aromatic ring-opening dioxygenase, DODA
FT                   type, Catalytic LigB subunit of aromatic ring-opening
FT                   dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00453"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72785"
FT                   /db_xref="GOA:D2T2U4"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2U4"
FT                   /protein_id="CAY72785.1"
FT                   /translation="MSQQTMPALFLGHGSPMNVLEENIYTQTWRKLGTALPRPEAIIAV
FT                   SAHWYTRGTAVTALEKPRTIHDFGGFPQALFDTHYPAPGSPVLAQQVAGALAPVAVELD
FT                   REWGFDHGSWGVLIKMYPDADIPLVQLSVDGSKPPAYHFELGRKLAALREQGVMIVASG
FT                   NVVHNLSRMRWQDEAQAWPWAESFNQYVRDNLGWEGEASQHPLVNFMQHEGAALSNPTP
FT                   EHYLPLLYVLGARAAGETVSIPVDGIVMGSLSMLSVQVG"
FT   gene            complement(518880..520040)
FT                   /gene="ygiC"
FT                   /locus_tag="EPYR_00454"
FT   CDS_pept        complement(518880..520040)
FT                   /transl_table=11
FT                   /gene="ygiC"
FT                   /locus_tag="EPYR_00454"
FT                   /product="Uncharacterized protein ygiC"
FT                   /function="Glutathionylspermidine synthase"
FT                   /note="Glutathionylspermidine
FT                   synthase,Glutathionylspermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00454"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72787"
FT                   /db_xref="InterPro:IPR005494"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2U5"
FT                   /protein_id="CAY72787.1"
FT                   /translation="MRRIAIAERPAWREKATEYGFRFHTMHGEPYWCEEAYYQFTLQQI
FT                   ESLEDVTSELHQMCLQAVELVTGSEELLAKFRIPKHTWDFVRESWKSGQPSLYSRLDLA
FT                   WDGHSPAKLLENNADTPTSLYEAAFFQWLWLEDQLKAGLLPAGSDQFNSLQEKLIERFS
FT                   ELHKQHGFSWLHLACCRDSEEDRGTVQYLQDCATEAGLPTDFLYMDEIGLGEKGQFTDV
FT                   HDQVIGNLFKLYPWEFMLRETFSTKLADAGVRWLEPGWKSVLSNKALLPLLWKMFPDHP
FT                   NLLPAYFAEDNVPHMDKYVVKPLFSREGANIRIVENGQEIVRVDGPYGEEGMIVQQFHP
FT                   LPKFGDSYTLIGSWLINDRPAGIGLREDRDLITQDLSRFYPHTFIG"
FT   gene            complement(520047..520727)
FT                   /gene="ygiB"
FT                   /locus_tag="EPYR_00455"
FT   CDS_pept        complement(520047..520727)
FT                   /transl_table=11
FT                   /gene="ygiB"
FT                   /locus_tag="EPYR_00455"
FT                   /product="UPF0441 protein ygiB"
FT                   /function="Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00455"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72789"
FT                   /db_xref="InterPro:IPR009576"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2U6"
FT                   /protein_id="CAY72789.1"
FT                   /translation="MKRTKKINYASFRKSWSARHLTPVALAVSAVFMLAACEQADETVS
FT                   MYQNADDCSAANPGKSAQCTTAFNSAKEEAAKTAPKYTSRADCVAEFGEGQCQQAPAQA
FT                   GVGNTNAESQSSGSFWMPLMAGYMMGRLMGGGMGGQQQPLFTSKSPTSPASGQFVDASG
FT                   KSYGAATPGRTMTVPKSALAPKPATTSTVTRGGFGDSVAKQNTLRRNSSSTASSMRSKR
FT                   SMGG"
FT   gene            complement(520892..522352)
FT                   /gene="tolC"
FT                   /locus_tag="EPYR_00456"
FT   CDS_pept        complement(520892..522352)
FT                   /transl_table=11
FT                   /gene="tolC"
FT                   /locus_tag="EPYR_00456"
FT                   /product="Outer membrane protein tolC precursor"
FT                   /function="Outer membrane protein"
FT                   /note="Type I secretion outer membrane protein, TolC,Outer
FT                   membrane efflux protein, TC 1.B.17.1.1 Outer membrane
FT                   protein TolC precursor"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00456"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72791"
FT                   /db_xref="GOA:D2T2U7"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2U7"
FT                   /protein_id="CAY72791.1"
FT                   /translation="MNKLLPLLIGLSLGGFSVASQAENLLQVYQQARLSNPDLRSSAAD
FT                   RDAAFEKINEARSPLLPQLGLGADYTYTNGYRDSSGANSNTKSASLQLTQTIFDMSKWR
FT                   ALTLQEKTAGIQDVTWQTAQQTLILNTATAYFNVLNAIDTLSYTEAQKQSIYRQLDQTT
FT                   QRFNVGLVAITDVQNARSQYDTVLASEVAARNELDNAVETLRQVTGNYYASLASLNVDT
FT                   FKTDKPQPVSALLKEAENRNLSLLAARLSQDLAREQIRSAETGHMPTLDLTASTGLSNN
FT                   RYGGSRANQSTSTKDNISGSNQVGLSFNLPLYSGGSVSSQVKQAQYAFVAASEQLEGAH
FT                   RTAVQTVRSSFNNVNASISSIAAYKQAVVSAQSSLDAMEAGYSVGTRTIVDVLDATTTL
FT                   FNAKQQLSNARYSYMINQLNIKSALGTLNEQDLQTLNSQLGKDVVTAPDVVAPENPQQD
FT                   ARAVGAAHKVRNGNAPAATRTIGNPLSY"
FT   gene            522575..523210
FT                   /gene="yqiE"
FT                   /locus_tag="EPYR_00457"
FT   CDS_pept        522575..523210
FT                   /transl_table=11
FT                   /gene="yqiE"
FT                   /locus_tag="EPYR_00457"
FT                   /product="putative resistance protein"
FT                   /function="NTP pyrophosphohydrolases including oxidative
FT                   damage repair enzymes"
FT                   /EC_number="3.6.1.13"
FT                   /note="ADP-ribose pyrophosphatase (ADP-ribose
FT                   diphosphatase) (Adenosine diphosphoribose pyrophosphatase)
FT                   (ADPR-PPase) (ADP-ribose phosphohydrolase) (ASPPase),
FT                   NUDIX, NUDIX domain,TIGR00052: conserved hypothetical
FT                   protein TIGR00052"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00457"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72793"
FT                   /db_xref="GOA:D2T2U8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2U8"
FT                   /protein_id="CAY72793.1"
FT                   /translation="MTAVNNYPVIFTKNDVEIMARETLYQGFFSLQRYRFRHRLFNGGM
FT                   SGEITREIFERGHAAVLLPYDPRRDEVVLIEQIRIATYDTSPTPWVLELVAGMIEAGET
FT                   PEDVARREAVEEAGLTAGRIKPIINYLSSAGGTTERLAVFVGEVDASVAQGNHGLEEEN
FT                   EDILVHVVSRSQAYQWVEQGRIDNAAAVIALQWLELHHKQLRQEWKNE"
FT   gene            523210..523632
FT                   /gene="yqiB"
FT                   /locus_tag="EPYR_00458"
FT   CDS_pept        523210..523632
FT                   /transl_table=11
FT                   /gene="yqiB"
FT                   /locus_tag="EPYR_00458"
FT                   /product="Uncharacterized protein yqiB"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="Protein of unknown function DUF1249, Protein of
FT                   unknown function (DUF1249)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00458"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72794"
FT                   /db_xref="InterPro:IPR009659"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2U9"
FT                   /protein_id="CAY72794.1"
FT                   /translation="MKRYVPDFPEMMRVCETNFAQLRRLLPKEDRAGESVAYQVTGASY
FT                   LITIQESTRYTTLVEIRQTAPAVSYWSLPSMSVRLYHDAMVAEVCSTQQIYRFKARYDY
FT                   PNKKLHQRDEKHQINQFLADWLRYCLSHGAMAVPVC"
FT   gene            523734..524561
FT                   /gene="icc"
FT                   /locus_tag="EPYR_00459"
FT   CDS_pept        523734..524561
FT                   /transl_table=11
FT                   /gene="icc"
FT                   /locus_tag="EPYR_00459"
FT                   /product="Uncharacterized protein syc0937_d"
FT                   /function="Predicted phosphohydrolases"
FT                   /note="Metallophosphoesterase, Calcineurin-like
FT                   phosphoesterase C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00459"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72796"
FT                   /db_xref="GOA:D2T2V0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR013622"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2V0"
FT                   /protein_id="CAY72796.1"
FT                   /translation="MDSLLKLPVASGSRVRILQITDTHLFAGKDETLLGVNTWASFDAV
FT                   LEAVAAERRHFDLIVATGDLAQDHAVEAYQHFAEGIARLPAPCVWLPGNHDYQPTMFST
FT                   LGASSIADQKQVLIGDHWQAVLLDSQVFGVPHGELSDYQLEWLERAMAAEPQRHTLILL
FT                   HHHPLPSGCSWLDQHSLRNPHMLDAVLRRYPLAKTLLCGHIHQELDLNWHGRRVLATPS
FT                   TCVQFKPHCTHFTIDAEAPGWRWLNLDQDGHLETEVKRLNTRKFNPDLDSEGY"
FT   gene            524565..525143
FT                   /gene="yqiA"
FT                   /locus_tag="EPYR_00460"
FT   CDS_pept        524565..525143
FT                   /transl_table=11
FT                   /gene="yqiA"
FT                   /locus_tag="EPYR_00460"
FT                   /product="Esterase yqiA"
FT                   /function="Predicted esterase"
FT                   /EC_number="3.1.-.-"
FT                   /note="Protein of unknown function UPF0227,Uncharacterised
FT                   protein family (UPF0227)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00460"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72797"
FT                   /db_xref="GOA:D2T2V1"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2V1"
FT                   /protein_id="CAY72797.1"
FT                   /translation="MATLLYLHGFNSSPQSAKATQFRQWLTQHHPDIRLYVPQLPAYPS
FT                   EAAQLLEDFVMQSAGEPLGIIGSSLGGYYATWLSQCFTLPAVVVNPAVRPFELLVDYLG
FT                   ENENPYTGQQYVLESRHIYDLKVMHIDPLESPDLLWLLQQTGDEVLDYRQALDYYSACR
FT                   QTVEEGGNHAFIGFERHFSAILDFLNVKD"
FT   gene            525198..527093
FT                   /gene="parE"
FT                   /locus_tag="EPYR_00461"
FT   CDS_pept        525198..527093
FT                   /transl_table=11
FT                   /gene="parE"
FT                   /locus_tag="EPYR_00461"
FT                   /product="DNA topoisomerase IV, B subunit"
FT                   /function="Type IIA topoisomerase (DNA gyrase/topo
FT                   II,topoisomerase IV), B subunit"
FT                   /EC_number="5.99.1.-"
FT                   /note="DNA topoisomerase 4 subunit B (Topoisomerase IV
FT                   subunit B)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00461"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72799"
FT                   /db_xref="GOA:D2T2V2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2V2"
FT                   /protein_id="CAY72799.1"
FT                   /translation="MTQSSYNADSIEVLSGLEPVRRRPGMYTDTARPNHLGQEVIDNSV
FT                   DEALAGHAKRVEVILHPDQSLEVIDDGRGMPVDIHPEEGVPAVELIFCRLHAGGKFSNK
FT                   NYQFSGGLHGVGISVVNALSKRVEVTVRRNGEVYEMAFENGDKVQDLTVTGTVGKRNTG
FT                   TRVQFWPDESFFDSPRFSVTRLSHLLKAKAVLCPGVEIVFKDRLNKTEQSWCYADGLTD
FT                   YLMEAVNGLPLLPEKPFVGAFSGDVEAVDWALLWLPEGGELLTESYVNLIPTMQGGTHV
FT                   NGLRQGLLDAMREFCEYRNILPRGVKLSAEDIWDRCAYVLSVKMQDPQFAGQTKERLSS
FT                   RQCAAFVSGVVKDAFSLWLNQNVQAAEMLAELAISSAQRRMRAAKKVVRKKLTSGPALP
FT                   GKLADCSAQDLSRTELFLVEGDSAGGSAKQARDREYQAIMPLKGKILNTWEVSSDEVLA
FT                   SQEVHDISVAIGIDPDSEDLSQLRYGKICILADADSDGLHIATLLCALFVRHFRTLVKN
FT                   GHVYVAMPPLYRIDLGKEVYYALDEEEKAGILEQLKRKKGKPGVQRFKGLGEMNPLQLR
FT                   ETTLDPNTRRLVQLTISDEDVDQTLAVMDMLLAKKRSEDRRNWLQEKGDSAEIEV"
FT   gene            complement(527183..527356)
FT                   /locus_tag="EPYR_00462"
FT   CDS_pept        complement(527183..527356)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00462"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72801"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2V3"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72801.1"
FT                   /translation="MGDERGMAHFISLRTCTSFAAKIAVEDLPERNANGIGNLIQRVYT
FT                   RMLVVEIFQPQA"
FT   gene            complement(527346..527471)
FT                   /locus_tag="EPYR_00463"
FT   CDS_pept        complement(527346..527471)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00463"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72802"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2V4"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72802.1"
FT                   /translation="MAVIIKAGMLLPPVFIGRFHRGFHAGRLNDIQFITLNIIGG"
FT   gene            complement(527383..527478)
FT                   /locus_tag="EPYR_00464"
FT   CDS_pept        complement(527383..527478)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00464"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72803"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2V5"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72803.1"
FT                   /translation="MNIGRHYQGWNVIAACFYRALSPGFPCGQTE"
FT   gene            527722..528432
FT                   /locus_tag="EPYR_00465"
FT   CDS_pept        527722..528432
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00465"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72805"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2V6"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72805.1"
FT                   /translation="MFNNVSSSSVHRVSSSSNSYAIHPDIHIMSPASHPKGALTGALQG
FT                   NKLLYISDLHGKLFIPKLIAESAKDLKKAGADHLAVEFVKFTDGALLREALHDGKSAVH
FT                   DFLENSWGKHGSAWLHEVAGALVNAHKAGIYVSGIDRRLAVAEPNTAMEKIQYMKKRLS
FT                   LNVAWDAAVKREAEAVSAGKSIVWGGAGHFSDSKNEGPKDMRPGLVISFDLSGNGRNKI
FT                   NDTDQHSHIVIAGK"
FT   gene            complement(528598..528909)
FT                   /gene="ygiN"
FT                   /locus_tag="EPYR_00466"
FT   CDS_pept        complement(528598..528909)
FT                   /transl_table=11
FT                   /gene="ygiN"
FT                   /locus_tag="EPYR_00466"
FT                   /product="Protein ygiN"
FT                   /function="Uncharacterized conserved protein"
FT                   /note="Dimeric alpha-beta barrel"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00466"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72807"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2V7"
FT                   /protein_id="CAY72807.1"
FT                   /translation="MLTVLAEICIRPGRRHVVLQAIEALIPEVLAEEGCASYQPLIDHK
FT                   AQVPWKQHSPHSIFMVEHWESLRHLEQHQQAQHMENHRTAIKDDVVDVKIFILEPAIK"
FT   gene            529218..529988
FT                   /gene="pheC"
FT                   /locus_tag="EPYR_00467"
FT   CDS_pept        529218..529988
FT                   /transl_table=11
FT                   /gene="pheC"
FT                   /locus_tag="EPYR_00467"
FT                   /product="cyclohexadienyl dehydratase, putative"
FT                   /function="ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain"
FT                   /EC_number="4.2.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00467"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72809"
FT                   /db_xref="GOA:D2T2V8"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2V8"
FT                   /protein_id="CAY72809.1"
FT                   /translation="MMMKTGAMVLLLLAGSASAQSHLDRVMQSKTLTVCTTGDYKPYTY
FT                   LRPDGSYEGIDISLAQSLAKTLGAEVKWVPTTWKTLTADFIGKQCDVALGGVSVTLKRQ
FT                   QTAWFASPLDSDGKIPLVRCVDKNKYRTVKQLNKPTVRLIEPAGGTNEAFAHAFLPQAN
FT                   LTLFHDNVTIFQQLVDKKADVMVTDASEALYQQKRYPQLCAINPGKPLQYGEKAWMLPR
FT                   DDISWKMYVDQWLHLGKASGEYQQIVGQWLATKG"
FT   gene            530249..532525
FT                   /gene="parC"
FT                   /locus_tag="EPYR_00468"
FT   CDS_pept        530249..532525
FT                   /transl_table=11
FT                   /gene="parC"
FT                   /locus_tag="EPYR_00468"
FT                   /product="topoisomerase IV subunit A"
FT                   /function="Type IIA topoisomerase (DNA gyrase/topo
FT                   II,topoisomerase IV), A subunit"
FT                   /EC_number="5.99.1.-"
FT                   /note="DNA topoisomerase 4 subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00468"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72810"
FT                   /db_xref="GOA:D2T2V9"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2V9"
FT                   /protein_id="CAY72810.1"
FT                   /translation="MSDLTQDGAERLALHKFTENAYLNYSMYVIMDRALPYIGDGLKPV
FT                   QRRIVYAMSELGLSNNAKFKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLV
FT                   DGQGNWGAPDDPKSFAAMRYTESRLSKYAEVLLGELGQGTVDYVPNFDGTLQEPSMLPA
FT                   RLPNILLNGTTGIAVGMATDIPPHNLREVAKAAITLIDSPKTTLDELLDIVQGPDYPTE
FT                   AEIITPRNEIRKIYQNGRGSVRMRAVWKKEEGDVVITALPHQVSGARVLEQIAVQMRNK
FT                   KLPMVEDLRDESNHENPTRLVIVPRSNRVDMDQVMNHLFATTDLERSYRINLNMIGLNN
FT                   RPAVKNLLEILSEWLIFRRDTVRRRLNHRLEKVLKRLHILAGLLVAFLNIDEVIEIIRA
FT                   EDEPKPVLMSRFDISEIQAEAILELKLRHLAKLEEMKIRGEQDELEKERAHLEAILASE
FT                   RKMNTLLKKELQADSDAYGDDRRSPLREREEAKAIGEHELIPSEPVTIVLSQSGWVRSA
FT                   KGHDIDPAGLSYKAGDAYLGAARGKSNQPVVFIDSTGRSYALDPLTLPSARGQGEPLTG
FT                   KLTPPPGAVVEQVLMADETQKLLMASDAGYGFVCTFSELVSRNRAGKALLTLPSNAKVM
FT                   TPLAIQSNDDLLLAITAAGRMLMFPVSELPQLSKGKGNKIVSIPSAEAASGEDKLAWLL
FT                   LLTPENAITLYVGKRKLTLKAADLQKFRAERGRRGTLLPRGLQRIDRVDVEGAVCAAAT
FT                   DDSGE"
FT   gene            532699..533436
FT                   /gene="plsC"
FT                   /locus_tag="EPYR_00469"
FT   CDS_pept        532699..533436
FT                   /transl_table=11
FT                   /gene="plsC"
FT                   /locus_tag="EPYR_00469"
FT                   /function="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /note="1-acyl-sn-glycerol-3-phosphate acyltransferase alpha
FT                   (1-AGP acyltransferase 1) (1-AGPAT 1) (Lysophosphatidic
FT                   acid acyltransferase alpha) (LPAAT-alpha)
FT                   (1-acylglycerol-3-phosphate O-acyltransferase 1) (Protein
FT                   G15)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00469"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72812"
FT                   /db_xref="GOA:D2T2W0"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2W0"
FT                   /protein_id="CAY72812.1"
FT                   /translation="MLTLLRTLVVVVYSILVCVFGCIYCLFSPRNPRHVATFGHLFGRL
FT                   APVFGLKVELRKPAGAENYPNAIYICNHQNNYDMITAAAIVQPTTVTVGKTSLLWVPFF
FT                   GLLYWLTGNLLIDRENRTKAHGTIGELVEQFRKKKISFWMFPEGTRSRGRGLLPFKTGA
FT                   FHAAVAAGVPIIPVVVSNTHGKIKLNRLKNGLAIVEMLPPVDTPAFADQSVRKLATHCR
FT                   EIMSAKLDELNAEVAAREASGKL"
FT   gene            533533..534957
FT                   /gene="sufI"
FT                   /locus_tag="EPYR_00470"
FT   CDS_pept        533533..534957
FT                   /transl_table=11
FT                   /gene="sufI"
FT                   /locus_tag="EPYR_00470"
FT                   /product="Protein sufI precursor"
FT                   /function="Putative multicopper oxidases"
FT                   /note="Cupredoxin, Multicopper oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00470"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72814"
FT                   /db_xref="GOA:D2T2W1"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR026589"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2W1"
FT                   /protein_id="CAY72814.1"
FT                   /translation="MSFSRRQFLQASGIALCASSLPFNARAAGAINALPVPPLIESRRG
FT                   QPLFLTLQRSHWSFNGSNKAAVWGINGLYLGPTVRVWNGDDVKLIYSNRLTEPVAMTVS
FT                   GLQVPGALMGGAARLMSPGVDWAPVVPIRQAAATCWYHANTPNRMAPHVYNGLAGMWLV
FT                   EDEVSKSLPIPNHYGVDDFPLIIQDKRLDNFATPVYAPSAKGGFVGDTLLVNGVQNPYV
FT                   EVSRGWVRLRLLNASNARCYQLRMSDGRPFNVIASDQGFLPAPVAVEQLSLAPGERREV
FT                   LVDMSQGNEVAITAGEAAGIVDRLRGFFEPSSILTSTRVLTLRPTGLLPLVTDNLPMRL
FT                   LPDQVIEGAVSRTREFRLDDSMPGINGALWEMMRIDVQAQQGSYERWIIHADTPQSFHI
FT                   QGVMFLIKNVNGAQPMAEDRGWKDTVWVDGEVELFVSFTQPSSEHFPFVYYSQTLEMAD
FT                   RGVAGQLVVNPAQQAG"
FT   gene            complement(535008..535832)
FT                   /gene="yqhE"
FT                   /locus_tag="EPYR_00471"
FT   CDS_pept        complement(535008..535832)
FT                   /transl_table=11
FT                   /gene="yqhE"
FT                   /locus_tag="EPYR_00471"
FT                   /product="putative 2,5-diketo-D-gluconic acid reductase A"
FT                   /function="Aldo/keto reductases, related to diketogulonate
FT                   reductase"
FT                   /EC_number="1.1.1.274"
FT                   /note="2,5-diketo-D-gluconic acid reductase A (2,5-DKG
FT                   reductase A) (2,5-DKGR A) (25DKGR-A) (AKR5C)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00471"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72815"
FT                   /db_xref="GOA:D2T2W2"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2W2"
FT                   /protein_id="CAY72815.1"
FT                   /translation="MANQPIIKLHDGNMMPQLGLGVWQASIDEARSAAVKALSVGYRSI
FT                   DTAAIYKNEEGIGQALQETDIARDEIFITTKLWNDDQLNAQQALETSLQKLQLESVDLY
FT                   LMHWPCPGKNNYVAAWQQMIELQQQGLTKSIGVCNFSEAHLKRLMDDTGVSPVINQVEL
FT                   HPLLQQRTLHAWNAMHQIQTESWSPLAQGGEGVFDQQAIKKLAKKYGKSPAQIVIRWHL
FT                   DSGLVVIPKSITPARIEENFRVFDFRLEKAEISDIAALDQGKRLGPDPDELN"
FT   gene            536049..536969
FT                   /gene="yqhC"
FT                   /locus_tag="EPYR_00472"
FT   CDS_pept        536049..536969
FT                   /transl_table=11
FT                   /gene="yqhC"
FT                   /locus_tag="EPYR_00472"
FT                   /product="Uncharacterized HTH-type transcriptional
FT                   regulator yqhC"
FT                   /function="AraC-type DNA-binding domain-containing
FT                   proteins"
FT                   /note="AraC-type transcriptional regulator,
FT                   N-terminal,AraC-type transcriptional regulator N-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00472"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72817"
FT                   /db_xref="GOA:D2T2W3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2W3"
FT                   /protein_id="CAY72817.1"
FT                   /translation="MRYSFSERQTIMDRKIVCARLAQQVSGLVKQDKMTPVPGITLFYS
FT                   ESGTVRQPVMYKPAIVIVLQGKKTGYLGKSVFHYDASKYLMLTVPLPFECETFATPELP
FT                   LTGLSLRVDALQLQDLLIDIGEDDGFYPQPLTHGIHSALLTEKMLCATGRLLDAMAHPR
FT                   DARVLGPHIVREILYHALQGPCGGALLALVSRQTQFSQIARALRRIEHHFTDSLSVEQL
FT                   AAEANMSVSAFHHNFKAVTSTSPLQYIKSYRLHQARMMMMQEGMKASVAALKVGYESPS
FT                   QFSREFKRYFGVTPGEEMTRLRHAG"
FT   gene            537172..538566
FT                   /gene="dat"
FT                   /locus_tag="EPYR_00473"
FT   CDS_pept        537172..538566
FT                   /transl_table=11
FT                   /gene="dat"
FT                   /locus_tag="EPYR_00473"
FT                   /product="diaminobutyrate-2-oxoglutarateaminotransferase"
FT                   /function="4-aminobutyrate aminotransferase and related
FT                   aminotransferases"
FT                   /EC_number="2.6.1.76"
FT                   /note="Diaminobutyrate-2-oxoglutarate aminotransferase
FT                   (L-diaminobutyric acid transaminase) (Diaminobutyrate
FT                   transaminase) (DABA aminotransferase) (DABA-AT)
FT                   (L-2,4-diaminobutyrate:2-ketoglutarate 4-aminotransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00473"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72819"
FT                   /db_xref="GOA:D2T2W4"
FT                   /db_xref="InterPro:IPR004637"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2W4"
FT                   /protein_id="CAY72819.1"
FT                   /translation="MMTDKVRIDNLGATSFDGNNQTYLARQAEFESNVRSYPRKLPLAI
FT                   AKAEGVWISDVENNQYLDCLAGAGTLALGHNHPDILQSIQNVITSGLPLHTLDLTTPLK
FT                   DRFSEYLLSLLPGEGKEYCLQFTGPSGADAVEAALKLAKKYTGRTGVISFSGGYHGMTH
FT                   GALAVTGNLSPKDAVNGMIPEVQFMPYPHQYRCPLGIGGEAGVQALTYYFENLINDVES
FT                   GVRKPAAVILEAVQGEGGVNPAPAEWLQRIRKVTQEHGILLIIDEVQAGFARTGKLFAF
FT                   EHAGIEPDIIVMSKAVGGGLPLAVLGIKKQFDAWEPGHHTGTFRGNQLAMATGLTTLQH
FT                   LKDNHVADKVAAQGEWLKAQLAELQKRYPVIGHVRGLGLMLGIEIVKPNEAQDHMGCYP
FT                   ADGQLSALLQKKCFENGLILERGGRHGCVLRLLPSLLISNDELGIFLDKFEQALLAAGV
FT                   KPVCVE"
FT   gene            538571..540043
FT                   /gene="ddc"
FT                   /locus_tag="EPYR_00474"
FT   CDS_pept        538571..540043
FT                   /transl_table=11
FT                   /gene="ddc"
FT                   /locus_tag="EPYR_00474"
FT                   /product="L-2,4-diaminobutyrate decarboxylase"
FT                   /function="Glutamate decarboxylase and related
FT                   PLP-dependent proteins"
FT                   /EC_number="4.1.1.-"
FT                   /note="L-2,4-diaminobutyrate decarboxylase (DABA
FT                   decarboxylase) (DABA-DC), Pyridoxal phosphate-dependent
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00474"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72820"
FT                   /db_xref="GOA:D2T2W5"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2W5"
FT                   /protein_id="CAY72820.1"
FT                   /translation="MSRLNPILAASAQSSEAYQQAMAQSSAAVVQWLQQPEMYQGKSVA
FT                   ELRERIALDFNPQGLGNQAAIERAVEFFLKDSLSVHHPQCVAHLHCPSLVVSQAAEVLI
FT                   NATNQSMDSWDQSPSATIIEMKLIEWLRTRVGYQPGDAGVFTSGGTQSNLMGLMLARDA
FT                   FFARQGHSIQQDGLVGDLRKIKVLCSENAHFSVQKNMALMGLGYQSVTLVKTDRFARMD
FT                   INDLAEKVALAQANGEQILAIVATAGTTDAGAIDPLPAIAQLAAEHQIWVHVDAAWGGA
FT                   LLMSEQYRHYLDGIERVDSVTLDFHKQFFQTISCGAFLLKEARHYELMRYQAAYLNSEF
FT                   DEAQGVPNLVSKSLQTTRRFDALKLWMSLEALGEKQYAEIIDHGVTLAQQVAQYVDEQA
FT                   LLELVMQPQLASVLFRYRPQQLANGSDAAVALLNQQIGDALLESGRANVGVTEFAGVTC
FT                   LKMTLLNPTVSLQDIKLLLALVERTAQQLPTA"
FT   gene            540062..540394
FT                   /locus_tag="EPYR_00475"
FT   CDS_pept        540062..540394
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00475"
FT                   /product="hypothetical protein"
FT                   /note="Protein of unknown function DUF1813, HSP20-like"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00475"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72821"
FT                   /db_xref="GOA:D2T2W6"
FT                   /db_xref="InterPro:IPR014944"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2W6"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72821.1"
FT                   /translation="MTRPLLRQAAGGYTALSNGAAVTHDYGRQIVGYRPKGGERDTPQX
FT                   SIAGKWLAEAGFAVGTGVSLTVLDGCLLXIPDSREERRLRAMEQQLKAQQQELEQTKQR
FT                   MIAMLA"
FT   gene            complement(541062..542102)
FT                   /locus_tag="EPYR_00476"
FT   CDS_pept        complement(541062..542102)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00476"
FT                   /product="Insertion element IS630 uncharacterized 39 kDa
FT                   protein; ISO-IS200 39 kDa protein"
FT                   /function="Transposase and inactivated derivatives"
FT                   /note="Integrase, catalytic core"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00476"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72822"
FT                   /db_xref="GOA:D2T2W7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2W7"
FT                   /protein_id="CAY72822.1"
FT                   /translation="MPIIAPISREERRLMRKAIHKTRDKNHARRLTAILMLHRGNRVSH
FT                   VARTLCCARSSVGRWINWFTLSGVEGLKSLPAGRSRRWPFEHICTLLRELIKHSPGDFG
FT                   YQRSRWSTELLAIKIKDITGCRLHAGTVRRWLPAAGLVWRRAAPTLRIRDPHKDEKMAV
FT                   IRQALDKCSAEHPVFYEDEVDIHLNPKIGADWQLRGQQRRVVTPGQNEKYYLAGALHSG
FT                   TGKVSYVGGNSKSSVLFISLLKHLKASYRRAKTITLIVDNYIIHKSRETLSWLKQNPKF
FT                   RVIYQPVYSPWVNHVERLWQALHDTITRNHQCRSMWQLLKKVRHFMKTVSPFPGGKHGL
FT                   AKVERY"
FT   gene            complement(542650..543630)
FT                   /locus_tag="EPYR_00477"
FT   CDS_pept        complement(542650..543630)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00477"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72824"
FT                   /db_xref="GOA:D2T2W8"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2W8"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72824.1"
FT                   /translation="MISFKSMKFMAVMQPVFIALAVMWVSVPLAISAAILYPRACKHFK
FT                   MKSWRLVVDIRRYYKLTPINRFVLYIGSLAFMFFLLGQILFGDDSFFLTGFSFVVMSIS
FT                   FAIDIYNRSIYIFKKIWSGLLGKTIITLLAALSFVITHYLARRWIYITTDLDPKFFSDF
FT                   TNIVSIFFTPLAYLILMGIFSLVIVIPEFIGIALMSLLTPIKENFLRNKFKKLANLSVR
FT                   MRTGKRIEKLTSSELVLLNSRVLFFRILSSPMFVCLIFYTFSWASSITGSFWDSTARLG
FT                   LVNYYYHAEEKSPISKMRHYNYDEENFSTAIFNGSRWEFFTFNKK"
FT   gene            complement(543911..544675)
FT                   /locus_tag="EPYR_00478"
FT   CDS_pept        complement(543911..544675)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00478"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72826"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2W9"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72826.1"
FT                   /translation="MSNGLIHIQKLHFFRTTSANTSFDLKLKCNKDYLRIFLEDELVFA
FT                   TTPDELLMRRGRKENLVSGFDNFLEMMTFDLLYVGIAKKNQDSYSRLIAKGHTARMNIL
FT                   AAEEQRSPGARVSDETYLLFFEIEPLTITVFGAGDDFDDEDFNFTIDYHRIIADAEKAV
FT                   ISTFKPKYNKQLYVNYPKGVDGLYGQGYDGYSYAIAEGVAFNTTYGTIKGARDSQDLLP
FT                   SNDADFISINGNEVVLNISGVDFNIPLDDSAL"
FT   gene            complement(544763..545548)
FT                   /locus_tag="EPYR_00479"
FT   CDS_pept        complement(544763..545548)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00479"
FT                   /product="probable transposase for insertion sequence
FT                   element ISRM3-like"
FT                   /function="Transposase and inactivated derivatives"
FT                   /note="Transposase, mutator type, Transposase, Mutator
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00479"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72827"
FT                   /db_xref="GOA:D2T2X0"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2X0"
FT                   /protein_id="CAY72827.1"
FT                   /translation="MPLKSRLLNGRTARWMHFIPFVYLDCIVVKVRHDGSVINKAVFLA
FT                   LGINTEGQKELLGMWLAENEGAKFWLSVLTELKXRGLQDILIACVDGLKGFPDAINSVY
FT                   PQTNIQLCIIHMVRNSLKYVSWKDYKAVTGGLKKVYQAPTEEAALMALDKFAGIWDEKY
FT                   PQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIESLNSVIRAAIKKRKVFPTDDSVRK
FT                   VIYLAIQSASKKWNMPIQNWRLAMXRFIIEFGXRLSDHL"
FT   gene            complement(545475..545972)
FT                   /locus_tag="EPYR_00480"
FT   CDS_pept        complement(545475..545972)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00480"
FT                   /product="probable transposase for insertion sequence
FT                   element ISRM3-like"
FT                   /function="Transposase and inactivated derivatives"
FT                   /note="Transposase, mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00480"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72828"
FT                   /db_xref="GOA:D2T2X1"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2X1"
FT                   /protein_id="CAY72828.1"
FT                   /translation="MDEKKLKALAAELAKGLKTEAXLNAFSRMLTKLTVETALNAELTD
FT                   HLGHEKNAPKAGSNTRNGYSSKTLLCDDGEIELSTPRDRENTFEPLLIKKNQTRITQMD
FT                   SQILSLYAKGMTTRDIVATFREMYDADVSPTLISKVTDAVKEQVAEWQNRPLDALYPIC
FT                   LS"
FT   gene            547104..547718
FT                   /locus_tag="EPYR_00481"
FT   CDS_pept        547104..547718
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00481"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72829"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2X2"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72829.1"
FT                   /translation="MQGRYTIDYLSAVSFTKGLGCGCLDMGVSSAYYLDTDEKRKKVLN
FT                   KIQKAYAEEYGVPSVEDFFAQCVRTNFYMQPILSNVIGKECALTFGYIKDGETDYFKQD
FT                   NSFYKEKLTSKVSGVVNIHAWLTLPSMEILDLTICTTRLVALLKDKNLTPHDYQQQLMA
FT                   SDDFGGVVVGDGNNLTGTSLIYYPQVVGFDYAFKSGFVQVA"
FT   gene            548824..549708
FT                   /locus_tag="EPYR_00482"
FT   CDS_pept        548824..549708
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00482"
FT                   /product="hypothetical protein"
FT                   /function="Integrase"
FT                   /note="Integrase, catalytic core, phage"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00482"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72830"
FT                   /db_xref="GOA:D2T2X3"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR024456"
FT                   /db_xref="InterPro:IPR024457"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2X3"
FT                   /protein_id="CAY72830.1"
FT                   /translation="MAKLNKNLMTLARQAGGSFKTVSDRMKIADRFAERXLKLNIQXRD
FT                   VKNIKTGHVELYIRSRLTENISKRTLQNEMAAIRALLRVAGKTFMADPSHEKLSNEALN
FT                   ISGTSRDGTKVAITDDYYRQVLSSAEEKDKGVACAIRLSRLLGLRTEEXVQSVKSLRTW
FT                   QKNLDNNEGKIRVVFGTKGGRARDTTIIKREETIQAIRQAIQYAEENNGRLINKSSLHL
FT                   AIERYRNIARDAGLVGEFAPHSLRYAYTQDVTAFHLNKGFSLKEAQALASMDLGHGDGR
FT                   GHYIARVYNKTKN"
FT   gene            550051..550395
FT                   /locus_tag="EPYR_00483"
FT   CDS_pept        550051..550395
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00483"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72831"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2X4"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72831.1"
FT                   /translation="MFLLNTLHSVAVFTERAVRRIAPESRFSGWLCCFRSDAEALCLIA
FT                   DELERAATYTRPEHKMLAEFSVYHAAYFFADRQYHGMMKRWPRALLRSLANSGLRLDAT
FT                   QWQEGCNQAR"
FT   gene            550530..550916
FT                   /locus_tag="EPYR_00484"
FT   CDS_pept        550530..550916
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00484"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72832"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2X5"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72832.1"
FT                   /translation="MSVSTSSASACMSIYDITVARLGESTRSCVDFIMMISVMESALLT
FT                   IRALNNCGIPDHIDQDGCPDRVWEVVHIAGLLGEACELKLIPEYLFQRYVAEVILIGLS
FT                   LDECAWNYGFRDGVSNAHFAQMVD"
FT   gene            551008..551316
FT                   /locus_tag="EPYR_00485"
FT   CDS_pept        551008..551316
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00485"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72833"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2X6"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72833.1"
FT                   /translation="MRSILLSLIAHAMAGLNRLSLALDPQQSEWFTNRSGHSSFRPEII
FT                   PQGSGFNAVISRRTGYSSRDWRYQPHASAGQFSSARKALRAGRRMARQMAELRYRFD"
FT   gene            551395..552003
FT                   /locus_tag="EPYR_00486"
FT   CDS_pept        551395..552003
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00486"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72834"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2X7"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72834.1"
FT                   /translation="MIRFTSTQLRPVLSQRGGMQRPLILEKNLGIYIRVPDDKNPGEWL
FT                   KAWAVGCNPSTDNNWSENADALIAEKEYSFQTFMAQSSFDAVLNDHHDLLMTPVNNPST
FT                   GMTVKKETRPPQKVYVPVGEFRNQVQWLHDQSLRHFHACVSNSERLSWRSQALSVLDQV
FT                   IRLDAKRAKPADREMFDSAVRSVRDRIRQVMSDGFVRYA"
FT   gene            552083..553063
FT                   /gene="ardC"
FT                   /locus_tag="EPYR_00487"
FT   CDS_pept        552083..553063
FT                   /transl_table=11
FT                   /gene="ardC"
FT                   /locus_tag="EPYR_00487"
FT                   /function="Antirestriction protein"
FT                   /EC_number="2.7.7.-"
FT                   /note="Region of unknown function DUF1738, Domain of
FT                   unknown function (DUF1738)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00487"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72835"
FT                   /db_xref="GOA:D2T2X8"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="InterPro:IPR017113"
FT                   /db_xref="InterPro:IPR041459"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2X8"
FT                   /protein_id="CAY72835.1"
FT                   /translation="MKKTPRGRKAASTQRTDLYQQVTDKIILALENGVPPWRRPWRSAQ
FT                   NVHGSALPVNATTGRHYSGVNIPLLWMAAEEHGYTSDRWLTYQQAKTAGGQVRKGERSA
FT                   LAIIYKPFEKQARDNSDNLLFRDGEPVMEQLAMLRPLQLFNVAQCDGLPDTIRGGLREE
FT                   APENSAVLSAERLQRVQSIVNATGVSCAHYRQNRAYYQPLSDRIVMPTVAQFASEADYC
FT                   STLLHELVHASGHGKRLNRVGITSSSRKFGDPVYAFEELIAETGSAFLCAELGVIGEVQ
FT                   HESYLASWLKALREDKKAFFRACRFAREASEYLLQPLNRQTVQAA"
FT   gene            553160..554101
FT                   /gene="yccB"
FT                   /locus_tag="EPYR_00488"
FT   CDS_pept        553160..554101
FT                   /transl_table=11
FT                   /gene="yccB"
FT                   /locus_tag="EPYR_00488"
FT                   /product="Uncharacterized protein yubA"
FT                   /note="Protein of unknown function DUF1281, Protein of
FT                   unknown function (DUF1281)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00488"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72836"
FT                   /db_xref="InterPro:IPR009694"
FT                   /db_xref="InterPro:IPR023136"
FT                   /db_xref="InterPro:IPR041329"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2X9"
FT                   /protein_id="CAY72836.1"
FT                   /translation="MFSWCHNRLDITGKSVCIDVMQSWIVGTETPRYRHAIRQAIKLFL
FT                   AGCAGILKPVKATTYPAYPALTASGLGAQTSANHAFQHFLELLEKDAWLDGATLSRMEK
FT                   IWLQSGIDGLKWENIPLAARQIISQLVAVHYADWFGVASGAGQFDPQERWDSLSIMPET
FT                   TCPCDMLMVMPSRLATELNGTSGLFSGLNTTSELYMQLFGMEFPAGHQARWSREDISSL
FT                   ALTLSSPGYPPSGEVMGQMSSLFDCEIRHYWISQDTGLSGYNCFDRGDHVDSGPYPSDV
FT                   RDAATGGEGARIYLLAPEASGAGAAQYGSVRA"
FT   gene            554197..554922
FT                   /locus_tag="EPYR_00489"
FT   CDS_pept        554197..554922
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00489"
FT                   /product="hypothetical protein"
FT                   /function="Type I restriction-modification system
FT                   methyltransferase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00489"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72837"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2Y0"
FT                   /protein_id="CAY72837.1"
FT                   /translation="MVFSFLPEIPVKNAINHENAFISLFDQTARYHHRYQVFEDFISCS
FT                   VIALQNGLQFCDRREQKYMRIVSKYQKPDVTNMAQLLAHVVSGLEESPGDFLGRVFMLL
FT                   ELGDKYRGQFFTPWSVGVMMAQLQLGNVEEQFRDKPFITLSEPTCGAGCMALAFASVLR
FT                   EVGFPPHRRMWVSATDIDPLAAGMAYIQLSLCGVAGEVVIGNALSDERRRVLYTPMHYW
FT                   GGWPYRLRSRINRDSAVAV"
FT   gene            554912..555028
FT                   /locus_tag="EPYR_00490"
FT   CDS_pept        554912..555028
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00490"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72838"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2Y1"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72838.1"
FT                   /translation="MLCSSGFNYYYIRQVGKPACFFCGIHLQQVMEARLFYF"
FT   gene            complement(555043..555603)
FT                   /locus_tag="EPYR_00491"
FT   CDS_pept        complement(555043..555603)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00491"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72839"
FT                   /db_xref="GOA:D2T2Y2"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2Y2"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72839.1"
FT                   /translation="MQQAIIVAYFIIWLGISAGVSILYTSGTSWLLLVWPLIFCMPFLL
FT                   RPLGWLERQFRPHLSLASRRKGRAYVHLSPWQPTVRLSAQQIRAFWSSVNRSTCEALQK
FT                   NRTVIVSSHLLTTNRATRLKAHLAESGRHFRCRAFSVPFTPAARAVMQLEILFRQWRWR
FT                   SPARKVWPVMVIRKKSSGTGSST"
FT   gene            complement(555701..555808)
FT                   /locus_tag="EPYR_00492"
FT   CDS_pept        complement(555701..555808)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00492"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72840"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2Y3"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72840.1"
FT                   /translation="MPRHYSAPENDATLKDPSAMTMENPECPALQIPLA"
FT   gene            555811..557373
FT                   /locus_tag="EPYR_00493"
FT   CDS_pept        555811..557373
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00493"
FT                   /product="hypothetical protein"
FT                   /note="Protein of unknown function DUF1528, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00493"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72841"
FT                   /db_xref="InterPro:IPR011093"
FT                   /db_xref="InterPro:IPR011119"
FT                   /db_xref="InterPro:IPR022391"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2Y4"
FT                   /protein_id="CAY72841.1"
FT                   /translation="MRGLKXLTGRNVKAGAGRLAVPEQYGRNAADSAGFHPLKTGAVLL
FT                   QTDERRRLIRVLTENSPLSTPVTEAWWLRPLEEMAARVQECPAAWNGQFSGPGGFTDLS
FT                   LNVATRAVRLVRGMMLPPGATPEEQAEQGAGWACALYWAGLFHHFEWLTQMEGATKSGR
FT                   PWYPGLNVPADQWRVRPKASPAGGMNAMYMAIRLLPAEGLIWLQRWPAISDSLLGFLAG
FT                   SRAGSGLLNSIVSDARNSCGFTGGTVTDVPPPAGVSPVVTVPETGHISPKLYENEAVPL
FT                   SSVSSALPVENHIVTTPQPYTQSAENKVHPQVINSLVSDTALLSALGSEESIPADNESD
FT                   DRQQQVPGGNLMSMLDLMAEGQPLPSADEAPVLPESAPAGEESISEVSRQESGKTEITD
FT                   GERFLQWLRQSITDGTLSVNERDSVLHILARFIFVASPDVFYKYISSAGDDIQDKHQLQ
FT                   KSFEALSVHHSRNGKGLYHYHKYDAPDKSGRFIKVSGYMIETNLIFRKGSCPPDSIWLS
FT                   PRS"
FT   gene            557408..558367
FT                   /locus_tag="EPYR_00494"
FT   CDS_pept        557408..558367
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00494"
FT                   /product="Tyrosine recombinase xerD"
FT                   /function="Site-specific recombinase XerC"
FT                   /note="DNA breaking-rejoining enzyme, catalytic core,Phage
FT                   integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00494"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72842"
FT                   /db_xref="GOA:D2T2Y5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025269"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2Y5"
FT                   /protein_id="CAY72842.1"
FT                   /translation="MADVMTFDDVLIDYFFSKSLRPATEWSYRKVVKSFISFTGNEVVP
FT                   EEVDKKLVLQWRRKVIIEDGLTKITWNNKLTHMRAIFNHAITQGHISQRENPFNGTVVR
FT                   PDVKRKKTLNDAQIKKIYLLMEAREAEERTGRVGACKNALRPAWFWMTVVDILRRTGMR
FT                   QNQLLHIRLCDVNFEHNWISLRPEGAKNHREHRVPITTHLRPRLERLYDQSVGRGAKMA
FT                   DQLFNISRFDGRRKETSENMDHPPLRAFFRRLSNECGFVVSPHRFRHTIATNLMSLPDR
FT                   NLKMAQDLLGHSTPAVTLQYVESDIEKVRFVLEQLDAS"
FT   gene            complement(558644..558719)
FT                   /locus_tag="EPYR_t021"
FT   tRNA            complement(558644..558719)
FT                   /locus_tag="EPYR_t021"
FT                   /product="tRNA-Phe"
FT                   /anticodon="(pos:558684..558686,aa:Phe)"
FT   gene            complement(558830..559429)
FT                   /gene="yjdC"
FT                   /locus_tag="EPYR_00495"
FT   CDS_pept        complement(558830..559429)
FT                   /transl_table=11
FT                   /gene="yjdC"
FT                   /locus_tag="EPYR_00495"
FT                   /product="HTH-type transcriptional regulator yjdC"
FT                   /function="Transcriptional regulator"
FT                   /note="Tetracycline transcriptional regulator,TetR-related,
FT                   C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00495"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72843"
FT                   /db_xref="GOA:D2T2Y6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2Y6"
FT                   /protein_id="CAY72843.1"
FT                   /translation="MVNVENRVQREQVLKQALNTLEQHGLAATTSLVMMANELGYSEQQ
FT                   LQRFWSDRDALLYDALRYHGQQIDTWRHKLLLDDSLNAEQKLLARYQVLAEAVNNQRYP
FT                   GCLFIAACSFYPQPDHPIHEVAELQKQASWQFSHALLCELETDNPPLVAHQMELILEGC
FT                   LSRLLVKRNVQEVENARRLAEDIVSNALCRKNGALS"
FT   gene            complement(559448..561211)
FT                   /gene="dsbD"
FT                   /locus_tag="EPYR_00496"
FT   CDS_pept        complement(559448..561211)
FT                   /transl_table=11
FT                   /gene="dsbD"
FT                   /locus_tag="EPYR_00496"
FT                   /product="thiol:disulfide interchange protein DsbD"
FT                   /function="Thiol:disulfide interchange protein"
FT                   /EC_number="1.8.1.8"
FT                   /note="Thiol:disulfide interchange protein dsbD precursor
FT                   (Protein-disulfide reductase) (Disulfide reductase) (C-type
FT                   cytochrome biogenesis protein cycZ) (Inner membrane copper
FT                   tolerance protein)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00496"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72844"
FT                   /db_xref="GOA:D2T2Y7"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2Y7"
FT                   /protein_id="CAY72844.1"
FT                   /translation="MKFAITRFIWREQIPVMDQRITPFIFLLLTTLFSLNASASLFGQN
FT                   NSAQFVTANQAFSFDFSQKNERLHLSWQIKPGYYLYRQQIKISLKGATLAQWSLPAGQP
FT                   HEDEFYGKMAVYPHSLTLPFTLIQAAAGAQLTVSYQGCAAAGFCYPPETRNVPLNAVAA
FT                   QSSLANAAMPASLVEDSNEHSLPFSALWALLIGIGVAFTPCVLPMYPLISAIILGGNRQ
FT                   YSLSRLFALAMLYVQGMALTYTLMGVVVAAAGLRFQAALQAPAVLMVLSALFILLALSM
FT                   FGLFNLQLPSALQTRLTLWSNRQQGGSLPGVFLMGALAGLICSPCTTAPLSAILLYIAQ
FT                   SGNMLTGAGTLYLYALGMGLPLIAITLFGNRLLPKNGPWMQTVKEGFGFVILALPVFLL
FT                   ERVVGESWGLRMWSGLGVAFFGWAFISSLKSNCGWLRVLQILLLGAMLIAARPLQDWAF
FT                   GNAPAPQAAAPISFTPVTHAGLLNQQLQSSNGKITMLDLYADWCVACKEFDKYTFRDAP
FT                   VRAALASMQLLQADVTANNARDSALLKHLNVLGLPTILFFAADGHEIPGSRVTGFMKPS
FT                   DFHAHLQKLAR"
FT   gene            complement(561371..562672)
FT                   /gene="dcuA"
FT                   /locus_tag="EPYR_00497"
FT   CDS_pept        complement(561371..562672)
FT                   /transl_table=11
FT                   /gene="dcuA"
FT                   /locus_tag="EPYR_00497"
FT                   /product="Anaerobic C4-dicarboxylate transporter dcuA"
FT                   /function="Anaerobic C4-dicarboxylate transporter"
FT                   /note="transporter, anaerobic C4-dicarboxylate uptake (Dcu)
FT                   family, TC 2.A.13.1.1 Anaerobic C4-dicarboxylate
FT                   transporter dcuA"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00497"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72845"
FT                   /db_xref="GOA:D2T2Y8"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2Y8"
FT                   /protein_id="CAY72845.1"
FT                   /translation="MLVPEFLVVFAAIYLGSRLGGIGIGFAGGLGVLVLTLGFQILPGA
FT                   IPFDVIEIIMAVIAAIAAMQVAGGMDYLVNLAERLLRKHPRYITLLAPLVTYLMSLLAG
FT                   TGHTAFSTLPVIAEVAKEQGVRPSRALSIAVVASQIAITASPISAAVVFMAGILEPKGI
FT                   SYLMLLAVAIPATMAGIFIAALITNFLGKELKDDALFQARLAKGEVTLRGASKFELKPG
FT                   AKRSVVLLLAGIVAVVMYATAIGDAVGLIDNPVLPRNEAIVVFMLTVAMLICFSCKIDS
FT                   AEILNASTFKSGMSACVCVLGVAWLGDTFVKAHIGDIQQVAGNLLHDYPWMLAVILFFA
FT                   STLLYSQAATTKALMPAALMLGVSPVTAVASFAAVSALFVLPTYPTLLAAVEMDDTGST
FT                   RIGSLVFNHSFLVPGTLAIVLSVAFGFLLGGVLL"
FT   gene            complement(562781..562894)
FT                   /locus_tag="EPYR_00498"
FT   CDS_pept        complement(562781..562894)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00498"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72846"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2Y9"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72846.1"
FT                   /translation="MPYLSQLSGRLLAGKSLAGATKMIKREGARRANAFAA"
FT   gene            complement(562910..564346)
FT                   /gene="aspA"
FT                   /locus_tag="EPYR_00499"
FT   CDS_pept        complement(562910..564346)
FT                   /transl_table=11
FT                   /gene="aspA"
FT                   /locus_tag="EPYR_00499"
FT                   /product="aspartate ammonia-lyase"
FT                   /function="Fumarase"
FT                   /EC_number="4.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00499"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72847"
FT                   /db_xref="GOA:D2T2Z0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2Z0"
FT                   /protein_id="CAY72847.1"
FT                   /translation="MVNNIRIEEDLLGMREVPADAYYGVHTLRAIENFYISNSKISDIP
FT                   EFVRGMVMVKKAAALANKELQTIPRNVANAIISACDEVLNNGKCMDQFPIDVYQGGAGT
FT                   SVNMNTNEVLANIGLEIMGHQKGEYQFLNPNDHVNKCQSTNDAYPTGFRIAVYSSILKL
FT                   LDAIGQLSEGFQRKAVEFNTILKMGRTQLQDAVPMTLGQEFHAFNVLLNEEIRSILRNA
FT                   ELLLEVNLGATAIGTRLNTPDGYQQLAVAKLAEVSGLACVPAEDLIEATSDCGAYVMVH
FT                   SSLKRLAVKLSKICNDLRLLSSGPRAGLNEINLPELQAGSSIMPAKVNPVVPEVVNQVC
FT                   FKVIGNDITVTMASEAGQLQLNVMEPVIGQALFESIHILTNACYNLLEKCVDGITANKA
FT                   VCEAYVFNSIGIVTYLNPYIGHHNGDIVGKICAETGKSVREVVLERGLLTESELDDIFS
FT                   TQNLMFPVYKARRYTDENEQ"
FT   gene            564714..565178
FT                   /gene="fxsA"
FT                   /locus_tag="EPYR_00500"
FT   CDS_pept        564714..565178
FT                   /transl_table=11
FT                   /gene="fxsA"
FT                   /locus_tag="EPYR_00500"
FT                   /product="Protein fxsA"
FT                   /note="Protein fxsA (Suppressor of F exclusion of phage T7)
FT                   (Fragment), FxsA cytoplasmic membrane protein, FxsA
FT                   cytoplasmic membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00500"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72848"
FT                   /db_xref="GOA:D2T2Z1"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2Z1"
FT                   /protein_id="CAY72848.1"
FT                   /translation="MRWLPFLIMFVLVWIEISLFIQIAHVIGVLLTMLLVIFTSCIGIS
FT                   LVKNQGMKNFMLMQQKLHAGESPAAEMTKSVSLVLAGFLLLLPGFFSDFIGLLLLLPPV
FT                   QKHLTLKLMPHLKMRRGPGAGPDSGVTVDGEFERKEVMRIEHDDGNPPHQ"
FT   gene            565399..565692
FT                   /gene="groE"
FT                   /locus_tag="EPYR_00501"
FT   CDS_pept        565399..565692
FT                   /transl_table=11
FT                   /gene="groE"
FT                   /locus_tag="EPYR_00501"
FT                   /product="10 kDa chaperonin (Protein Cpn10) (groES
FT                   protein)"
FT                   /function="Co-chaperonin GroES (HSP10)"
FT                   /note="GroES-like, Chaperonin 10 Kd subunit"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00501"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72849"
FT                   /db_xref="GOA:D2T2Z2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:D2T2Z2"
FT                   /protein_id="CAY72849.1"
FT                   /translation="MKIRPLHDRVIVKRKEVESKSAGGIVLTGSAAGKSTRGEVLAVGN
FT                   GRILESGDVKPLDVKVGDVVIFSEGYGAKTEKIDNEEVLIISESDILAIVEA"
FT   gene            565729..567378
FT                   /gene="groL"
FT                   /locus_tag="EPYR_00502"
FT   CDS_pept        565729..567378
FT                   /transl_table=11
FT                   /gene="groL"
FT                   /locus_tag="EPYR_00502"
FT                   /product="60 kDa chaperonin"
FT                   /function="Chaperonin GroEL (HSP60 family)"
FT                   /EC_number="1.3.1.-"
FT                   /note="60 kDa chaperonin (Protein Cpn60) (groEL
FT                   protein),chaperonin GroL"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00502"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72850"
FT                   /db_xref="GOA:D2T3C3"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3C3"
FT                   /protein_id="CAY72850.1"
FT                   /translation="MAAKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFG
FT                   SPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIVNEGL
FT                   KAVAAGMNPMDLKRGIDKAVIAAVEELKKLSVPCSDSKAIAQVGTISANSDETVGELIA
FT                   QAMEKVGKEGVITVEEGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILL
FT                   ADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGF
FT                   GDRRKAMLQDIAVLTGGTVISEEIGMELEKAALEDMGQAKRVVINKDTTTIIDGTGEEV
FT                   AISGRVTQIRQQIEEATSDYDREKLQERVAKLAGGVAVLKVGAATEVEMKEKKARVEDA
FT                   LHATRAAVEEGVVAGGGVALVRVAAVLADLRGQNEDQNVGIKVALRAMESPLRQIVSNA
FT                   GEEPSVVTNAVKAGEGNYGYNAQTEEYGNMIDFGILDPTKVTRSALQYAASVAGLMITT
FT                   ECMVTDLPKGDAPDLGAGGGGMGGMGGMGGMM"
FT   gene            567570..567914
FT                   /gene="yjeI"
FT                   /locus_tag="EPYR_00503"
FT   CDS_pept        567570..567914
FT                   /transl_table=11
FT                   /gene="yjeI"
FT                   /locus_tag="EPYR_00503"
FT                   /product="Uncharacterized protein yjeI precursor"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00503"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72851"
FT                   /db_xref="InterPro:IPR025294"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3C4"
FT                   /protein_id="CAY72851.1"
FT                   /translation="MRINLPGLSVAALLLAGCSSSHTLSSAGGRVTFTDQQPARSCQLL
FT                   GNVTGVQSNWFSGSGGEGSSLRGAANDLRNRAAEMGGNVIYGATSPTQNFWSSFAPLDS
FT                   KMSGQVYKCP"
FT   gene            complement(567979..569007)
FT                   /gene="yjeK"
FT                   /locus_tag="EPYR_00504"
FT   CDS_pept        complement(567979..569007)
FT                   /transl_table=11
FT                   /gene="yjeK"
FT                   /locus_tag="EPYR_00504"
FT                   /product="Uncharacterized kamA family protein TP_0121"
FT                   /function="Lysine 2,3-aminomutase"
FT                   /note="Protein of unknown function DUF160, Radical SAM
FT                   superfamily, TIGR00238: lysine 2,3-aminomutase YodO family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00504"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72852"
FT                   /db_xref="GOA:D2T3C5"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022462"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3C5"
FT                   /protein_id="CAY72852.1"
FT                   /translation="MAHIVTLNTPEREEWLHQLADVITDPDELLQLLALQHHPELVSGH
FT                   DARRLFALRVPRAFAARMRKGDPQDPLLLQVITSRQEFVDAPGYSADPLDEQSSVVPGL
FT                   LHKYRNRALLLVKGGCAVNCRYCFRRHFPYQENQGNKRNWQQALEYIRQQPELDEIIFS
FT                   GGDPLMAKDHELDWLIGQLEQIPHLKRLRIHSRLPVVIPKRITEALCQRLAQSRLQTLM
FT                   VTHINHAQEIDDDLRHGMHMLKRAGVTLLNQSVLLRDINDSAPALAALSNALFDAGILP
FT                   YYLHVLDKVQGAAHFYVSDERARAIVRELLTMVSGYMVPKLAREIGGEPSKTPLDLQLR
FT                   QE"
FT   gene            569049..569615
FT                   /gene="efp"
FT                   /locus_tag="EPYR_00505"
FT   CDS_pept        569049..569615
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="EPYR_00505"
FT                   /product="Elongation factor P (EF-P)"
FT                   /function="Translation elongation factor P
FT                   (EF-P)/translation initiation factor 5A (eIF-5A)"
FT                   /note="Translation elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00505"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72853"
FT                   /db_xref="GOA:D2T3C6"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3C6"
FT                   /protein_id="CAY72853.1"
FT                   /translation="MATYSSNDFRPGLKIMFEGEPYAIESSEFVKPGKGQAFARVKMRR
FT                   LLTGSRVEKTFKSTDSAEGADVVDTNLNYLYNDGDFYHFMHPETFEQHPVEAKTVGDAA
FT                   KWLLDNAECIVTLWNGKPIQVLPPNFVELEITDTDPGLKGDTAGTGGKPATLSTGAVVK
FT                   VPLFVQIGEVIKVDTRSGEYVSRVK"
FT   gene            569830..569961
FT                   /locus_tag="EPYR_00506"
FT   CDS_pept        569830..569961
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00506"
FT                   /product="Entericidin B"
FT                   /note="Entericidin EcnA/B family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00506"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72854"
FT                   /db_xref="GOA:D2T3C7"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3C7"
FT                   /protein_id="CAY72854.1"
FT                   /translation="MKKGIVALLSVLVFASVLTACNTTRGVGEDVEAGGKAIQRSTQ"
FT   gene            complement(570014..570538)
FT                   /gene="blc"
FT                   /locus_tag="EPYR_00507"
FT   CDS_pept        complement(570014..570538)
FT                   /transl_table=11
FT                   /gene="blc"
FT                   /locus_tag="EPYR_00507"
FT                   /product="Outer membrane lipoprotein blc precursor"
FT                   /note="Calycin, Lipocalin-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00507"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72855"
FT                   /db_xref="GOA:D2T3C8"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3C8"
FT                   /protein_id="CAY72855.1"
FT                   /translation="MKLWKKVTAIVGALLSVACSTTPPHGVTPVADFDSKRYLGSWYEI
FT                   ARFNHPFERGLDHVTASYSQRDDGGLKVVNRGFNQKKQRWQESTGKAYFTGSSDRAALK
FT                   VSFFGPFYAGYNVIALDKDYQHALVCGPNRDYLWMLSRTPQLDEQVKQDLIEEARRAGF
FT                   TVDELIWIDQR"
FT   gene            570710..571687
FT                   /gene="yjeA"
FT                   /locus_tag="EPYR_00508"
FT   CDS_pept        570710..571687
FT                   /transl_table=11
FT                   /gene="yjeA"
FT                   /locus_tag="EPYR_00508"
FT                   /product="putative lysyl-tRNA synthetase"
FT                   /function="Truncated, possibly inactive, lysyl-tRNA
FT                   synthetase (class II)"
FT                   /EC_number="6.1.1.6"
FT                   /note="putative lysyl-tRNA synthetase (Lysine-tRNA ligase)
FT                   (LysRS) (GX), Aminoacyl-tRNA synthetase, class II (D, K and
FT                   N), tRNA synthetases class II (D, K and N),genX: lysyl-tRNA
FT                   synthetase homolog GenX"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00508"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72856"
FT                   /db_xref="GOA:D2T3C9"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3C9"
FT                   /protein_id="CAY72856.1"
FT                   /translation="MSDTASWQPSASIANLLKRAAIMAEIRRFFADRGVLEVETPAMSQ
FT                   ATVTDVHLFPFQTRFVGPGAAAGVDLYLMTSPEYHMKRLLAAGSGPIYQLCRSFRNEEM
FT                   GRHHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLECAPAETLSYQQAFQRHLEIDPLS
FT                   ADKAQLREAAEKLGAGDLAHREEDRDTLLQLLFVLGVEPEIGKEKPAFVYHFPATQAAL
FT                   AEISPEDHRVAERFEVYFKGIELANGFHELTDSREQRQRFEQDNRKRAAAGLPQQPIDN
FT                   YLLEALAGGMPDSSGVALGVDRLVMLALKAERLSDVIAFTVDRC"
FT   gene            complement(571788..575123)
FT                   /gene="bspA"
FT                   /locus_tag="EPYR_00509"
FT   CDS_pept        complement(571788..575123)
FT                   /transl_table=11
FT                   /gene="bspA"
FT                   /locus_tag="EPYR_00509"
FT                   /product="putative osmoadaptation receptor"
FT                   /function="Small-conductance mechanosensitive channel"
FT                   /note="The putative osmoadaptation receptor, BspA, MscS
FT                   Mechanosensitive ion channel, TC 1.A.23.1.2 BspA protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00509"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72857"
FT                   /db_xref="GOA:D2T3D0"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3D0"
FT                   /protein_id="CAY72857.1"
FT                   /translation="MLRLILTLLLGWSLLQPVYAASVPDASQIKQELEEAKSNKTSTNQ
FT                   TATVDALQSTLNWLEERQQSLERAQDYQQVIDNFPKLSRELRQQIATQTNSRKPLRSSM
FT                   SAADLEQEILLGSSQLLEESRQVQQEQDRAREISDSLSQLPQQQTEARRALGEIERRLQ
FT                   GQPSPSTPAGQAQRAQRQAESAAQKARVDELELAQLSANNRQELARIRAEVHQRKAAEL
FT                   DGWLQDLRNQLNNLRQREAELALARTEQLAEDSGDMPHGITEQFRINRELSAALNQQAQ
FT                   RMDLVTSQQRTAANQTIQVRQALSTIREQSQWLGVSNVLGEALRAQVARLPEMPKPQQL
FT                   DNEMAELRVKRLYYEDLLEQQPSLRQLRQDDNSNLTSEQERILTAQLKTQRELLTSLLS
FT                   GCDNLILEVTKLKVGNSQLVDALNEVKEATHRYLFWTADVSALSFSYPIELAHDLKRLL
FT                   SLDTLGQLGGAMVMMITSRETLLPLFSAIVLVGFSISSRRHFHAFLERASSKVGKVTQD
FT                   QFSLTIRTVFWSILVALPLPVLWAALGYGLQHAWPWPIAVAIGDGVTASVPLLWAFMIC
FT                   NTFARQQGLFIVHFRWPRSRVARAMRFYTLCIGLVVPLMMLLIAFDNLQDREFSPTLGR
FT                   LCFILICGALSMVTVSLKRAGIPLHIDKEGSGENFINNVLWNVMIAIPMLAALASCIGY
FT                   LETSQALLARVETSLAIWFLLLVIYHIIRRWMLIQRRRIAFDRARSRRAEILAQRARSE
FT                   EELAAQQTAADNIEIEEPVIDLDAISAQSLRLVRSILTLIALVSVIVLWSEIHSAFGFL
FT                   ENIRLWDVSTTIQGVESLQPITLGSVMVAILVLIITTQLVRNMPALLELALLQHLSLTP
FT                   GTGYAITTLTKYLLILIGGLTGFALIGIDWSKLQWLVAGLTLGLGFGLQEIFANFMSGL
FT                   IILFEKPIRIGDTVTIRDLTGSITRINTRATTITDWDRKEIIVPNKAFITEQFINWSLS
FT                   DSVTRVVLSIPAPAEANSDEVTNLLLTAAQRCSYVLETPQPEAFLVDLQQGIQLFELRI
FT                   HAAEMGHRMPLRHELHQLILRGFQEHGLEMPFPPFQVRMDTLGRKTPASNGTPAARSYK
FT                   SGGL"
FT   gene            complement(575134..576033)
FT                   /gene="psd"
FT                   /locus_tag="EPYR_00510"
FT   CDS_pept        complement(575134..576033)
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="EPYR_00510"
FT                   /function="Phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /note="Phosphatidylserine decarboxylase proenzyme
FT                   [Contains: Phosphatidylserine decarboxylase alpha chain;
FT                   Phosphatidylserine decarboxylase beta chain]"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00510"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72859"
FT                   /db_xref="GOA:D2T3D1"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3D1"
FT                   /protein_id="CAY72859.1"
FT                   /translation="MLDRIKLGLNHLLPKKALTELAGWGASKRAGWLTKAVIDAFVWYF
FT                   KVDMKEAQKPDTASYRTFNDFFVRPLRDEARPIETDPNQLVLPADGAISQLGPVEGDQI
FT                   FQAKGHTYSLEALLAGNAAMTDMFRNGEFVTTYLAPCDYHRVHMPCNGILREMIYVPGD
FT                   LYSVNPLTAQNIPNLFARNERVICRFDTEFGPMVQILVGATIVGSIETVWSGTVTPPRE
FT                   GVIKRWSWPGADEDGAVVLLKGQEMGRFKLGSTVINLFAPGKVKLAENLTAGSQTRLGA
FT                   PLATALQKESAEDVLHHP"
FT   gene            complement(576131..577192)
FT                   /gene="yjeQ"
FT                   /locus_tag="EPYR_00511"
FT   CDS_pept        complement(576131..577192)
FT                   /transl_table=11
FT                   /gene="yjeQ"
FT                   /locus_tag="EPYR_00511"
FT                   /product="putative GTPase"
FT                   /function="Predicted GTPases"
FT                   /EC_number="3.6.1.-"
FT                   /note="GTPase EngC, Protein of unknown function,
FT                   DUF258,TIGR00157: ribosome small subunit-dependent GTPase
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00511"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72861"
FT                   /db_xref="GOA:D2T3D2"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3D2"
FT                   /protein_id="CAY72861.1"
FT                   /translation="MSKNKLSKGQQRRVSANHDRRLKQRADKPEPDDNLFGEARDGVAI
FT                   SRFGMHADVEDADGSVHRCNIRRTIRSLVTGDRVRWRPGVAGGATVKGIVEAVHERTSV
FT                   LTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVASETLGVEPLLVLNKTDLL
FT                   DDEGREFVDEQMEIYRHIGYRVLMVSSHKKEGLRELEGALTGRVSIFAGQSGVGKSSLL
FT                   NALLGLELGSEEILTNDVSDVSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEP
FT                   EQITRGFVEFRDYLGGCKFRDCKHDTDPGCAIRAAVDKGEIDASRFVNYHHILESMSEV
FT                   QAKTRRSFSADKE"
FT   gene            577266..577847
FT                   /gene="yjeR"
FT                   /locus_tag="EPYR_00512"
FT   CDS_pept        577266..577847
FT                   /transl_table=11
FT                   /gene="yjeR"
FT                   /locus_tag="EPYR_00512"
FT                   /product="oligoribonuclease"
FT                   /function="Oligoribonuclease (3'->5' exoribonuclease)"
FT                   /EC_number="3.1.-.-"
FT                   /note="Polynucleotidyl transferase, Ribonuclease H
FT                   fold,Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00512"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72863"
FT                   /db_xref="GOA:D2T3D3"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3D3"
FT                   /protein_id="CAY72863.1"
FT                   /translation="MPPRRTMTANANNLIWIDLEMTGLNPEQDRIIEIATLVTDADLNI
FT                   LAEGPVFAVHQSDAQLGLMDEWNVRTHTNSGLVERVKASQVDDRAAELATIAFLQQWVP
FT                   ANSSPICGNSIGQDRRFLFKYMPELEAYFHYRYLDVSTLKELARRWKPEILAGFKKQGA
FT                   HQALDDIRESVAELAYYREHFIQLAAPQAD"
FT   gene            578025..578100
FT                   /locus_tag="EPYR_t022"
FT   tRNA            578025..578100
FT                   /locus_tag="EPYR_t022"
FT                   /product="tRNA-Gly"
FT                   /anticodon="(pos:578058..578060,aa:Gly)"
FT   gene            579011..579460
FT                   /locus_tag="EPYR_00513"
FT   CDS_pept        579011..579460
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00513"
FT                   /product="putative membrane protein"
FT                   /note="Protein of unknown function DUF943,enterobacteria,
FT                   Enterobacterial putative membrane protein (DUF943)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00513"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72864"
FT                   /db_xref="InterPro:IPR010351"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3D4"
FT                   /protein_id="CAY72864.1"
FT                   /translation="MKKIKVIVIIALLLVSGCVIFFNSRSVNIIDAHYDQYSASIIVDH
FT                   LPLTDDNKINWWKKNQKSIRDKYHIPVKSAAGMLKVYIWAFGEGYMERAKYDRLCFDDM
FT                   KEKNNCIEKNQLMNIDTDREGNLIYGFEKNSYLQKKEGELIKLPD"
FT   gene            579511..579609
FT                   /locus_tag="EPYR_00514"
FT   CDS_pept        579511..579609
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00514"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72866"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3D5"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72866.1"
FT                   /translation="MLQRLKFKLTGNFLFAKRRFVNGFFCGRVLYR"
FT   gene            complement(579572..580114)
FT                   /gene="hsdR"
FT                   /locus_tag="EPYR_00515"
FT   CDS_pept        complement(579572..580114)
FT                   /transl_table=11
FT                   /gene="hsdR"
FT                   /locus_tag="EPYR_00515"
FT                   /product="type I restriction-modification system, R
FT                   subunit"
FT                   /function="Type I site-specific restriction-modification
FT                   system, R (restriction) subunit and related helicases"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00515"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72868"
FT                   /db_xref="GOA:D2T3D6"
FT                   /db_xref="InterPro:IPR025285"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3D6"
FT                   /protein_id="CAY72868.1"
FT                   /translation="MITEGPSHSANFAFLAEHDPLFIKITTTAEQVFSSDPNTTLMKLR
FT                   QFAEALAQNIAVRLNIATEGNPSQQELLYRLDRELQFDPAIRQLFHTLRLEGNRATHQF
FT                   QTPHREAMDALKIARALAIWFHQTFGKNNDAFNPGPFVPPRDPSEQLRKSQAAIESLKQ
FT                   GLLAALSGTKRGRRKTR"
FT   gene            580546..580621
FT                   /locus_tag="EPYR_t023"
FT   tRNA            580546..580621
FT                   /locus_tag="EPYR_t023"
FT                   /product="tRNA-Gly"
FT                   /anticodon="(pos:580579..580581,aa:Gly)"
FT   gene            581022..581097
FT                   /locus_tag="EPYR_t024"
FT   tRNA            581022..581097
FT                   /locus_tag="EPYR_t024"
FT                   /product="tRNA-Gly"
FT                   /anticodon="(pos:581055..581057,aa:Gly)"
FT   gene            complement(581521..581628)
FT                   /locus_tag="EPYR_00516"
FT   CDS_pept        complement(581521..581628)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00516"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72869"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3D7"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72869.1"
FT                   /translation="MMHFCAGQHHPKILRNGVIRLVGLEPFGDAGSKTS"
FT   gene            581789..583309
FT                   /gene="yjeF"
FT                   /locus_tag="EPYR_00517"
FT   CDS_pept        581789..583309
FT                   /transl_table=11
FT                   /gene="yjeF"
FT                   /locus_tag="EPYR_00517"
FT                   /product="Uncharacterized protein yjeF"
FT                   /function="Uncharacterized conserved protein"
FT                   /note="Carbohydrate kinase, Carbohydrate kinase,yjeF_cterm:
FT                   YjeF homolog, C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00517"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72871"
FT                   /db_xref="GOA:D2T3D8"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3D8"
FT                   /protein_id="CAY72871.1"
FT                   /translation="MNHLNLQNDHASLPDSVWPAESLTHLEQEGADCLGITLFELMQRA
FT                   GEAAFNLLRTQWPSAQHWLILCGNGNNGGDGYIVARLAQSAGLAVTLVAVDGSKPLPEE
FT                   SQQAREAWLAAGGVIHDAAIAWPESTELIIDALLGTGLNRAPVAAYAALIAQANRHPAP
FT                   IFALDIPSGLVAANGTTPGMVIHASHTLTFIALKPGLLTGKARDCVGQLHHHSLGLQQW
FT                   LDAQPAPMARYDASNLANWLPPRRPTSHKGNHGRLLVIGGDHGTAGAIRMTAEAALRCG
FT                   SGMVRVLTHKENIGPLLTARPELMVQELSRSTLDAGLEWADVIVIGPGLGQGQWGKEAL
FT                   KKVENSPKTMLWDADALNLLAISPDKRQNRIITPHPGEAARLLNVKTAEIGSDRLLAVR
FT                   RLVKRYGGVVVLKGAGTLIAGGDKLAFADVGNAGMASGGMGDVLSGIIGSLAGQKLPLF
FT                   DAACAGCVAHGAAADAVAQRRGTRGMLATDLFSELYLFVNPEISNTKA"
FT   gene            583306..583782
FT                   /gene="yjeE"
FT                   /locus_tag="EPYR_00518"
FT   CDS_pept        583306..583782
FT                   /transl_table=11
FT                   /gene="yjeE"
FT                   /locus_tag="EPYR_00518"
FT                   /product="UPF0079 ATP-binding protein yjeE"
FT                   /function="Predicted ATPase or kinase"
FT                   /note="Protein of unknown function UPF0079, ATPase
FT                   bacteria, Uncharacterised P-loop hydrolase
FT                   UPF0079,TIGR00150: conserved hypothetical protein
FT                   TIGR00150"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00518"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72873"
FT                   /db_xref="GOA:D2T3D9"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3D9"
FT                   /protein_id="CAY72873.1"
FT                   /translation="MKTCVIALPDEAATLELGASLARTCEGAATLYLYGSLGAGKTTFS
FT                   RGFLQALGHQGNVKSPTYTLVEPYVLPDRRVYHFDLYRLSDPEELEFMGIRDYFGSDSV
FT                   CLVEWPQQGAGVLPEPDLELHLSYQGHAREALLRACSLAGEVMVQRIAAERGEA"
FT   gene            583782..585440
FT                   /gene="amiB"
FT                   /locus_tag="EPYR_00519"
FT   CDS_pept        583782..585440
FT                   /transl_table=11
FT                   /gene="amiB"
FT                   /locus_tag="EPYR_00519"
FT                   /product="N-acetylmuramoyl-l-alanine amidase II"
FT                   /function="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="N-acetylmuramoyl-L-alanine amidase amiB precursor"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00519"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72874"
FT                   /db_xref="GOA:D2T3E0"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3E0"
FT                   /protein_id="CAY72874.1"
FT                   /translation="MRRLMCWWMLALFCCSFASVAANLSDINVSNGSNEAQITLSFAGQ
FT                   PVYAFFPLHNPERVVLDVRQSAIVRGLPLDFSGDNIVKRIRASTAKDSHSIRLVFDLTR
FT                   PGKTRAVTRREGSHYNVVFTITGSRTAPVASRSINASGNVNTRTSSPPKSPFDENRVTR
FT                   VSSGNEVARPRRARSSNDTVIVAIDAGHGGQDPGAIGGGGLKEKNVTIAIAHKLKALLN
FT                   ADPMFKGVMTRDGDYFISVMGRSDVARKQNANLLVSIHADAAPARSASGASVWVLSNRR
FT                   ANSEMAGWLEQHEKQSELLGGAGDLLANSQTDPYLSQAVLDLQFGHSQRVGYDVAIKVI
FT                   AQLQRVGALHKRKPEHASLGVLRSPDIPSLLVETGFISNPSEERLLGSSAYQQKIAESI
FT                   YKGLRNYFLAHPLQSVPKEENRPLQFAAAVEPVINPALAGTLSAAASQRHMVKRGETLS
FT                   GIAAHYGVSMATLRAMNTLKNDVVWVGQRLKVPAASKAVSVAKREKSVKHKVVRGDSLT
FT                   AIAAHYGVSPQAVQQANKLKSQNVMLGQTLTIPTS"
FT   gene            585455..587281
FT                   /gene="mutL"
FT                   /locus_tag="EPYR_00520"
FT   CDS_pept        585455..587281
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="EPYR_00520"
FT                   /product="DNA mismatch repair protein mutL"
FT                   /function="DNA mismatch repair enzyme (predicted ATPase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00520"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72876"
FT                   /db_xref="GOA:D2T3E1"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3E1"
FT                   /protein_id="CAY72876.1"
FT                   /translation="MLIQVLPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDID
FT                   IEKGGAKLIRIRDNGCGIDKDELAMALARHATSKIASLDDLEAIISLGFRGEALASISS
FT                   VSRLTLTSRTEAQSEAWQAYAEGRDQAVTVKPAAHPVGTTLEVLDLFYNTPARRKFMRT
FT                   EKTEFTHIDEIIRRIALARFDVAISLSHNGKLVRQYRAVSDDGQRERRLGAICGTAFLT
FT                   HALKIAWQHSELSLHGWVADPVGSKALSELQYCYVNGRMMRDRLINHAIRQAYQDKLGD
FT                   RHQPAYVLYLEIDPHQVDVNVHPAKHEVRFHQSRLVHDFIYQGVISVLQESGVETLPEI
FT                   ATVQPAEHRQPENRQAAGGNHFSTPAAAAPRPASPGGGSWQRQEPLYQKREGAVYQQLL
FT                   QTPARSEEPPPASAAPNKEPPLSGHTHSFGRVLTVVQERYALLEGKNGLALLALAVAAR
FT                   WLKQAQLEPGSEGLKPQPLLIPLRLKLDKAERDAGSRCSALLNQMGIDLQFDAHHVMLR
FT                   AVPLPLRQQNLQNLIPEMLGYLTRHQEVTAYQLAQWLARQSASEPQHWNHSQAITLLAE
FT                   VERLSPQLVKSPPSGLLQNVDIEMAMNALKHE"
FT   gene            587319..588224
FT                   /gene="miaA"
FT                   /locus_tag="EPYR_00521"
FT   CDS_pept        587319..588224
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="EPYR_00521"
FT                   /product="delta(2)-isopentenylpyrophosphate tRNA-adenosine
FT                   transferase"
FT                   /function="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.8"
FT                   /note="tRNA delta(2)-isopentenylpyrophosphate transferase
FT                   (IPP transferase) (Isopentenyl-diphosphate:tRNA
FT                   isopentenyltransferase) (IPTase) (IPPT)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00521"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72877"
FT                   /db_xref="GOA:D2T3E2"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3E2"
FT                   /protein_id="CAY72877.1"
FT                   /translation="MGPTASGKTALAIALRQALPVELISVDSALIYRGMDIGTAKPSAE
FT                   ELALAPHRLLDIRDPSQAYSAAEFRRDALAEMAEITRRGNIPLLIGGTMLYYKALLEGL
FT                   SPLPSADAAVRQRIEQMAREAGWEALHRQLCDIDPVAAHRIHPNDPQRLSRALEVFFIS
FT                   GKTLTELIKTSGKALPYDVSQFAIAPASRELIHKRIEQRFHQMLASGFEAEARALFARG
FT                   DLHTEMPSIRCVGYRQMWSYLSGEIDYDDMVYRGICATRQLAKRQMTWLRGWKDVQWLD
FT                   SEQPDAAYSRVLQVLSAKPG"
FT   gene            588326..588637
FT                   /gene="hfq"
FT                   /locus_tag="EPYR_00522"
FT   CDS_pept        588326..588637
FT                   /transl_table=11
FT                   /gene="hfq"
FT                   /locus_tag="EPYR_00522"
FT                   /product="Protein hfq (Host factor-I protein) (HF-I)
FT                   (HF-1)"
FT                   /note="Like-Sm ribonucleoprotein-related, core, LSM domain,
FT                   Hfq: RNA chaperone Hfq"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00522"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72878"
FT                   /db_xref="GOA:D2T3E3"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3E3"
FT                   /protein_id="CAY72878.1"
FT                   /translation="MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVIL
FT                   LKNTVSQMVYKHAISTVVPSRPVSHHSNNTGGGSNNYHHSSSNQAPSSQPQQDSVDAE"
FT   gene            588867..590147
FT                   /gene="hflX"
FT                   /locus_tag="EPYR_00523"
FT   CDS_pept        588867..590147
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="EPYR_00523"
FT                   /product="GTP-binding protein hflX"
FT                   /function="GTPases"
FT                   /note="GTP-binding protein, HSR1-related, GTPase of unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00523"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72879"
FT                   /db_xref="GOA:D2T3E4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3E4"
FT                   /protein_id="CAY72879.1"
FT                   /translation="MFDRYDAGEQAVLVHIYFSQDKDTDDLQEFETLVSSAGVEALRVV
FT                   TGSRKAPHPKFFVGEGKAVEIADAVKESGATVVLFDHALSPAQERNLEALCECRVIDRT
FT                   GLILDIFAQRARTHEGKLQVELAQLRHLATRLVRGWTHLERQKGGIGLRGPGETQLETD
FT                   RRLLRNRITLILSRLERVSKQREQGRQARNKADVPTVSLVGYTNAGKSTLFNRLTSAEV
FT                   YAADQLFATLDPTLRRVDVADVGEVVLADTVGFIRHLPHDLVAAFKATLQETREAALLL
FT                   HIVDAADLRIEENIDAVNVVLEEIESAEIPSLLVMNKIDMLDGFVPRIDRDEENLPVRV
FT                   WLSAQTGEGIPLLFQALTERLAGEIAQFELRLPPAAGRLRSRFYQLRAIDKEWNEEDGS
FT                   LGLQVRMPIVDWRRLCKQEPELVDYII"
FT   gene            590265..591518
FT                   /gene="hflK"
FT                   /locus_tag="EPYR_00524"
FT   CDS_pept        590265..591518
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /locus_tag="EPYR_00524"
FT                   /product="protease specific for phage lambda cII repressor"
FT                   /function="Membrane protease subunits,stomatin/prohibitin
FT                   homologs"
FT                   /EC_number="3.4.-.-"
FT                   /note="HflK, SPFH domain / Band 7 family, hflK: HflK
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00524"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72880"
FT                   /db_xref="GOA:D2T3E5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3E5"
FT                   /protein_id="CAY72880.1"
FT                   /translation="MAWNQPGNNGQDRDPWGSSNNQGGNSGGNKGGRDKGPPDLDDIFR
FT                   KLSNKLGGLGGGKKGADGNGGTPRAAGNGGRLVGIVAVAAVVIWAASGFYTIKEAERGV
FT                   VTRFGKFSHLVEPGLNWKPTFIDRVRAVNVEAVRELSASGTMLTSDENVVRVEMNVQYR
FT                   VTNPERYMFAVTSADDSLRQATDSALRGVIGRSTMDRILTEGRTVVRSDTQRELEETIR
FT                   PYDMGITLLDVNFQTARPPEDVKASFDDAIAARENREQSVREAEAYANDKLPRARGDAQ
FT                   GILEQARAYKARVTLEAQGEVDSFARILPEYKAAPQITRERLYIETMERVLGHTRKVLV
FT                   NDKGNNLMVLPLDQLMRGQAGASTGNSQDGSSSLLRLPPASGSKERANSSSSSSPDDIM
FT                   DQRRVNALRSDTQREGRE"
FT   gene            591522..592526
FT                   /gene="hflC"
FT                   /locus_tag="EPYR_00525"
FT   CDS_pept        591522..592526
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="EPYR_00525"
FT                   /product="protease specific for phage lambda cII repressor"
FT                   /function="Membrane protease subunits,stomatin/prohibitin
FT                   homologs"
FT                   /EC_number="3.4.-.-"
FT                   /note="HflC, SPFH domain / Band 7 family, hflC: HflC
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00525"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72881"
FT                   /db_xref="GOA:D2T3E6"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3E6"
FT                   /protein_id="CAY72881.1"
FT                   /translation="MRKPLIVVLIVVLVVLYTSLFVVQEGQRGIVMRFGKVLRDNENKP
FT                   LVYAPGLHFKIPFLESVKSLDARIQTMDNQADRFVTKEKKDLIVDSYIKWRVSDFSRYY
FT                   LATGGGDVSQAEVLLKRKFSDRLRSEIGRLDVKDIVTDSRGRLTTDVRDALNTGSAGQD
FT                   DDVTTPAADDAIASVAKRVERETNSNEPAINPNSMAALGIQVVDVRIKQINLPTEVSDA
FT                   IYARMRAERESVARSQRAQGAEEAAKVRAQADYEVEHTLAEARRQALITQGEGDAEAAK
FT                   LFADAFSKDPDFYAFVRSLRAYDNSFKSNQDVMVLSPDSDFFRFMKSPATTTR"
FT   gene            592636..592800
FT                   /locus_tag="EPYR_00526"
FT   CDS_pept        592636..592800
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00526"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72882"
FT                   /db_xref="GOA:D2T3E7"
FT                   /db_xref="InterPro:IPR019201"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3E7"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72882.1"
FT                   /translation="MIFEGIGLMLWPRLWRRMIIAMAQMPDSLLHRVGGGLVVAGIVVC
FT                   YMLSRTHAG"
FT   gene            592923..594221
FT                   /gene="purA"
FT                   /locus_tag="EPYR_00527"
FT   CDS_pept        592923..594221
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="EPYR_00527"
FT                   /product="adenylosuccinate synthetase"
FT                   /function="Adenylosuccinate synthase"
FT                   /EC_number="6.3.4.4"
FT                   /note="Adenylosuccinate synthetase (IMP-aspartate ligase)
FT                   (AdSS) (AMPSase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00527"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72883"
FT                   /db_xref="GOA:D2T3E8"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3E8"
FT                   /protein_id="CAY72883.1"
FT                   /translation="MGKNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLV
FT                   INGEKTVLHLIPSGILRENVTSIIGNGVVLSPAALMKEMKGLEDRGFPVRERLFISEAC
FT                   PLILEYHVALDVAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFNKETFATKLK
FT                   EVMEYHNFQLVNYYKTEAVDYDKVLADVMAIADILTSMVVDVSELLDGARQRGDLIMFE
FT                   GAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGIGPRYVDYVLGIVKAYSTRVGAGPFPT
FT                   ELFDETGEFLCRQGNEFGATTGRRRRTGWLDAVAVRRAVQINSLSGFCMTKLDVLDGLK
FT                   EVKICVAYRMPDGSEVTTTPLAAEGWEGIEPIYETLPGWSETTFGVKTLDGLPQAARDY
FT                   IKRVEEVTGVPVDIISTGPDRSETMILRDPFDA"
FT   gene            594419..594670
FT                   /gene="yjeB"
FT                   /locus_tag="EPYR_00528"
FT   CDS_pept        594419..594670
FT                   /transl_table=11
FT                   /gene="yjeB"
FT                   /locus_tag="EPYR_00528"
FT                   /product="putative negative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00528"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72884"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3E9"
FT                   /protein_id="CAY72884.1"
FT                   /translation="MQLTRFTDYGLRALFCPASLRTGRMTNNSKFCHITPACRRKTARH
FT                   DRVQRFLHELDRYTLAERVEDNHPLYPILLIEYPSLSR"
FT   gene            594687..597128
FT                   /gene="vacB"
FT                   /locus_tag="EPYR_00529"
FT   CDS_pept        594687..597128
FT                   /transl_table=11
FT                   /gene="vacB"
FT                   /locus_tag="EPYR_00529"
FT                   /function="Exoribonuclease R"
FT                   /EC_number="3.1.-.-"
FT                   /note="Ribonuclease R (RNase R) (VacB protein homolog)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00529"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72885"
FT                   /db_xref="GOA:D2T3F0"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3F0"
FT                   /protein_id="CAY72885.1"
FT                   /translation="MSHDPFQEREAEKYDNPIPSREFILAHLDKREKPASREELAQELD
FT                   ISGEEQTEALRRRLRAMERDGQLVFTRRQCYALPERLDLLKGKVIGHRDGFGFLRIEGS
FT                   KDDLYLSAEQMKMCMHGDVILAQAMGADRKGRREARVVRVVEPRKSQIVGRYFTDAGVG
FT                   FVVPDDSRLSFDILIPAEELMGARMGFVVVVELSQRPTRRTKAVGKIVEVLGDNMGTSM
FT                   AVDMALRTHDIPHVWPEALEKQIAHLSEEVPEEAKRGRVDLRDLPLVTIDGEDARDFDD
FT                   AVFCERKRGGGWRLWVAIADVSYYVRPGTPLDDEAVNRGTSVYFPSQVVPMLPEVLSNG
FT                   LCSLNPEVDRLCMVCEMTISSTGKLTGYKHYEAVMNSFARLTYNKVWNILQGDQELRQH
FT                   YEPLVKDLEELHRMYLALEKSREQRGGISFETEEAKFIFNAERRIERVEQVVRNDAHKL
FT                   IEECMILANIASARYVEKNNEPALFRDHDRPGEENVKSFRSVLNELGLTLPGGDKPQPL
FT                   DYAELLKQIAGRPDHEMLQTMLLRSMKQAVYDPENRGHFGLALASYAHFTSPIRRYPDL
FT                   LLHRAIKYLLTKEAGTLQGNTTPNGGFHYEMPQMLQFGQHCSMTERRADEATRDVADWL
FT                   KCDFMQDQVGETFSGVISSVTGFGFFVRLTDLFIDGLVHVSTLDNDYYRFDAVGQRLIG
FT                   ESGGRTYRLGDTVEVRVDAVHMDERKIDFALISSSRKPRGEGKTEREREKRGAAKNSGS
FT                   RRRAPRKGANVEPDSAFRTPKPADSAPAAAKPKRSRKPSDKSRKIASATRAKRAKKSDD
FT                   A"
FT   gene            597206..597943
FT                   /gene="yjfH"
FT                   /locus_tag="EPYR_00530"
FT   CDS_pept        597206..597943
FT                   /transl_table=11
FT                   /gene="yjfH"
FT                   /locus_tag="EPYR_00530"
FT                   /product="putative tRNA/rRNA methyltransferase"
FT                   /function="rRNA methylases"
FT                   /EC_number="2.1.1.-"
FT                   /note="23S rRNA (guanosine-2'-O-)-methyltransferase rlmB
FT                   (23S rRNA Gm2251 2'-O-methyltransferase), RNA
FT                   methyltransferase TrmH, group 3, SpoU rRNA Methylase
FT                   family, rRNA_methyl_3: RNA methyltransferase, TrmH family,
FT                   group 3"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00530"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72886"
FT                   /db_xref="GOA:D2T3F1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR024915"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3F1"
FT                   /protein_id="CAY72886.1"
FT                   /translation="MSEIVFGIHAVQALLDSDPQRFQEVFILKGREDRRLQTLVKALEA
FT                   QGIVIQVANKQMLDNTSEGAVHQGIIARVKPGRQYQEGDLPDLLASLDNPFLLILDGVT
FT                   DPHNLGACMRSADAAGVHAIIVPKDRSAALNATAKKVASGAAEHIPLVRVTNLARTMRV
FT                   LQEANVWIVGTAGEADHTLYQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSV
FT                   SSLNVSVATGVCLFEAVRQRSVK"
FT   gene            complement(598009..598377)
FT                   /locus_tag="EPYR_00531"
FT   CDS_pept        complement(598009..598377)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00531"
FT                   /product="UPF0379 lipoprotein yjfO precursor"
FT                   /note="Protein of unknown function DUF1471"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00531"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72887"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3F2"
FT                   /protein_id="CAY72887.1"
FT                   /translation="MTYNKSYHSCEVMIMRKIAAVLITLLLSSCHSLYNSPQPLPVPTA
FT                   QAQEIDRAQSHGLPRLGIANVTVEGSPDDAGRALAAKANAAGARYYQILALSEKRGAGI
FT                   WYGSAILYGPAGAATGAY"
FT   gene            complement(598379..600331)
FT                   /gene="tar"
FT                   /locus_tag="EPYR_00532"
FT   CDS_pept        complement(598379..600331)
FT                   /transl_table=11
FT                   /gene="tar"
FT                   /locus_tag="EPYR_00532"
FT                   /product="Methyl-accepting chemotaxis serine transducer"
FT                   /function="Methyl-accepting chemotaxis protein"
FT                   /note="Bacterial chemotaxis sensory
FT                   transducer,Methyl-accepting chemotaxis protein (MCP)
FT                   signaling domain"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00532"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72888"
FT                   /db_xref="GOA:D2T3F3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3F3"
FT                   /protein_id="CAY72888.1"
FT                   /translation="MIQGITMKRFFLKTRSLGVQLSVLTSFSVAVLFLILTLTLSHNAA
FT                   QQVRALAIVDMQNQADDISDMASMFNTTLREEVINYSRLFQSYLPGPFSLDESQSIQVG
FT                   SLATPALRAGMRKLNLDHTLVDDFRQRTGAIATIFVRSGDEFVRISTSLRKENGERALA
FT                   TRLDHHSPAWEPLNKGKVFQGIALLFGKPYITQYQPLRDESGRIIAIQFIGIDISKQYA
FT                   AIREKVLAKHLGDSGSFYVLNSTAGPDRGQYLLHPSREGQLPGLPLEAQQQIHSQPQGT
FT                   LECVDDTGEAKMLTWHYLPEWSWVVVGEVNKSSLLAPVKHTRNMFLLIGAALVVMFAGL
FT                   FIWAIQRWLSHPLHRVINLAQQYAAGNLLATLETRRQDEIGQLIVAINGIGDGLQQVVA
FT                   QVRTAADEISGGTDAIVSSSSDISEQITCQASSMEETCANMELLGATVEQNAHNVMQAL
FT                   KLVGEAAEAVSQGNETVGRSAATMSDINSAAQSIADITQVIESIAFQTNILALNAAVEA
FT                   ARAGEQGKGFAVVAGEVRALSQRSAQAAKEIDRLIADSLEKVVQGQQLSGQTRQAMDNI
FT                   TARIEQVKALMGDINIASQEQSSGIGQVSQAMAQIGQASQQNSQRVADSEMTAQELNCK
FT                   GHHLNELVKVFSVRS"
FT   gene            600507..601268
FT                   /gene="yjfP"
FT                   /locus_tag="EPYR_00533"
FT   CDS_pept        600507..601268
FT                   /transl_table=11
FT                   /gene="yjfP"
FT                   /locus_tag="EPYR_00533"
FT                   /product="Seprase"
FT                   /function="Dipeptidyl
FT                   aminopeptidases/acylaminoacyl-peptidases"
FT                   /EC_number="3.4.21.-"
FT                   /note="Seprase (Fibroblast activation protein alpha)
FT                   (Integral membrane serine protease) (170 kDa melanoma
FT                   membrane-bound gelatinase),Phospholipase/Carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00533"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72889"
FT                   /db_xref="GOA:D2T3F4"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3F4"
FT                   /protein_id="CAY72889.1"
FT                   /translation="MIELNTERFAEIECLHAFPSGKRHQALPTVLFYHGYSSSKEVYAY
FT                   FAVALAQAGYRAVLPDADMHGARYDGDDQRRLTRFWDILRTNIDELPQIERALRQHQLV
FT                   DGARLAVAGASMGGMTALGALARYPQLHSCACLMGSGYYRQLASTLFPPLVADRAEQEK
FT                   QLAEYDVSHQLARFANRPLLIWHGDADEVVPVAESVRLEQALRRSGLDRNLTYLIEKGV
FT                   GHRITPPALSALTGFFAHHLPLSAGDGKATR"
FT   gene            601448..601843
FT                   /gene="rpsF"
FT                   /locus_tag="EPYR_00534"
FT   CDS_pept        601448..601843
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="EPYR_00534"
FT                   /product="30S ribosomal protein S6"
FT                   /function="Ribosomal protein S6"
FT                   /note="30S ribosomal protein S6 [Contains: 30S ribosomal
FT                   protein S6, fully modified isoform; 30S ribosomal protein
FT                   S6, non-modified isoform]"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00534"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72890"
FT                   /db_xref="GOA:D2T3F5"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3F5"
FT                   /protein_id="CAY72890.1"
FT                   /translation="MRHYEIVFMVHPDQSEQVPGMIERYSATITGAEGTIHRLEDWGRR
FT                   QLAYPINKLHKAHYVLLNVEAPQAAIDELETNFRFNDAVIRSMVMRVKHAVTEASPMVK
FT                   AKDERRERREDFANETSDDADAGDSEE"
FT   gene            601849..602166
FT                   /gene="priB"
FT                   /locus_tag="EPYR_00535"
FT   CDS_pept        601849..602166
FT                   /transl_table=11
FT                   /gene="priB"
FT                   /locus_tag="EPYR_00535"
FT                   /function="Primosomal replication protein N"
FT                   /note="Nucleic acid-binding, OB-fold, Single-strand binding
FT                   protein family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00535"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72891"
FT                   /db_xref="GOA:D2T3F6"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR023646"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3F6"
FT                   /protein_id="CAY72891.1"
FT                   /translation="MTANRLTLSGTVCKAPMRKVSPSGIPHCQFVLEHRSQQVEAGFNR
FT                   QVWCRMPVIISGKAHQAITQSITVGTQLTVQGFICSHKGRNGLNKIVLHAEQIELIDSG
FT                   D"
FT   gene            602171..602398
FT                   /gene="rpsR"
FT                   /locus_tag="EPYR_00536"
FT   CDS_pept        602171..602398
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="EPYR_00536"
FT                   /product="30S ribosomal protein S18"
FT                   /function="Ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00536"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72892"
FT                   /db_xref="GOA:D2T3F7"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3F7"
FT                   /protein_id="CAY72892.1"
FT                   /translation="MARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRIT
FT                   GTRAKYQRQLARAIKRARYLSLLPYTDRHQ"
FT   gene            602437..602889
FT                   /gene="rplI"
FT                   /locus_tag="EPYR_00537"
FT   CDS_pept        602437..602889
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="EPYR_00537"
FT                   /product="50S ribosomal protein L9"
FT                   /function="Ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00537"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72893"
FT                   /db_xref="GOA:D2T3F8"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3F8"
FT                   /protein_id="CAY72893.1"
FT                   /translation="MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNVE
FT                   FFETRRAELEAKVADVLAAANARAEKINALGTVTLASKSGDEGKLFGSIGTRDIADAVT
FT                   AAGVEVAKSEVRLPNGVLRTTGEHEVDFQVHSEVFAKLIVNIVAEA"
FT   gene            complement(602940..603488)
FT                   /gene="ytfB"
FT                   /locus_tag="EPYR_00538"
FT   CDS_pept        complement(602940..603488)
FT                   /transl_table=11
FT                   /gene="ytfB"
FT                   /locus_tag="EPYR_00538"
FT                   /product="Bifunctional protein glmU"
FT                   /EC_number="2.3.1.157"
FT                   /note="Bifunctional protein glmU [Includes:
FT                   UDP-N-acetylglucosamine pyrophosphorylase
FT                   (N-acetylglucosamine-1-phosphate uridyltransferase);
FT                   Glucosamine-1-phosphate N-acetyltransferase
FT                   ],Opacity-associated protein A, Opacity-associated protein
FT                   A LysM-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00538"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72894"
FT                   /db_xref="GOA:D2T3F9"
FT                   /db_xref="InterPro:IPR007340"
FT                   /db_xref="InterPro:IPR013731"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3F9"
FT                   /protein_id="CAY72894.1"
FT                   /translation="MPDASPGSHFTSWSSRLWHLPDRVSWMDPLPAPHRRGIIAAALLM
FT                   LLAFLWPYPSKQHSVQPVTPLHSGSAATEAPLQAQLTDSSPSTFAPQSDADGQWRNYTV
FT                   ASGQTLAQLFRDNNLPVTDVFAMAQVEGNDKPLSTLHSGQTVKIRQNTQGVVTGLTLEG
FT                   ANGNILFTRQPDGSFIQAP"
FT   gene            603814..604434
FT                   /gene="fklB"
FT                   /locus_tag="EPYR_00539"
FT   CDS_pept        603814..604434
FT                   /transl_table=11
FT                   /gene="fklB"
FT                   /locus_tag="EPYR_00539"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
FT                   /function="FKBP-type peptidyl-prolyl cis-trans isomerases
FT                   1"
FT                   /EC_number="5.2.1.8"
FT                   /note="FKBP-type peptidyl-prolyl cis-trans isomerase fkpA
FT                   precursor (PPIase) (Rotamase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00539"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72895"
FT                   /db_xref="GOA:D2T3G0"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3G0"
FT                   /protein_id="CAY72895.1"
FT                   /translation="MTTPSFDSVEAQASYGIGLQVGQQLQESGLQGLQPEALLAGLRDA
FT                   LEGNAPAVPVDVVHRALREVHERAEVVRQERQQALAVEGQTFLEENAKRDGVNSTETGL
FT                   QFSVLTQGEGPIPSRQDRVRVHYTGKLIDGSVFDSSVQRGEPAEFPVSGVIPGWIEALT
FT                   LMPVGSRWQLVIPHNLAYGERGAGASIPPFSTLVFEVELLEIL"
FT   gene            complement(604645..607950)
FT                   /gene="ospG"
FT                   /locus_tag="EPYR_00540"
FT   CDS_pept        complement(604645..607950)
FT                   /transl_table=11
FT                   /gene="ospG"
FT                   /locus_tag="EPYR_00540"
FT                   /product="Ribosomal protein S6 kinase alpha-5"
FT                   /function="Serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="Protein kinase-like"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00540"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72896"
FT                   /db_xref="GOA:D2T3G1"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3G1"
FT                   /protein_id="CAY72896.1"
FT                   /translation="MLETIANYRKSIGNNQNYHHRKIGKSVTCVRADNSNNSSTPNPIR
FT                   QFGAYITEAINSPDEKHRIPSQQTSPPGKVLTLIQFMLLLDNITLPISESCLPEEQMIS
FT                   ASGKNVLPRPQSHPSGIEQSTLAKVNKNQAPSAVEAGKYPSLIPGAYAAPIFNGNEGVI
FT                   QVIENDSCMINSEQKKDKLISAITEQVVSNGQLSADDANDFEFSLRSEAAGAPIYIAHL
FT                   HVTPKKSRIIREAQSAQDERIMGHIKGTCAFEEEIYNSNGESVGKTFLLYAQRAENPFR
FT                   TIYDNKDGRPSPETQGLAEGLNISADIITLGLKSFIARLIANKLREKHYSDLGDKICAQ
FT                   RFSNLFIADMGTSLNADGQIFKRGSSSGKVKPHELFNALPAQSRAAFYTRNSQTGIRTE
FT                   VLLELNQLKGSINDNGRVIYLKSTGIDNEFITYHPNAVNQGLLQKKVIVNNDLRWRYAD
FT                   TFDSTGLNVQTREGKKQINLYGDYYELNQNSVGKFEIVIKKESGIRENIPVYMEPLSRN
FT                   WHLNVHNGHQVFNNEQKEIVSAIKTHKEDGFYYVPRSNNNEPYYGNGKIYHQEKVGDAG
FT                   HYPWGRYIEINGELVPVRNVEHKGKGILYEIYDIKNPDKKGYAVEWDGDRWLFEKPTSA
FT                   HISKNVESFLSDYKHIQNIDVSKLSAPDHHGVRWTVDGESYIKVNNEFYKMTLTDEGGI
FT                   IHISESESLGMKLSFGKNKFENDALLSSATNKDVLTPKAPAHTDQRLNRQGARKIKNTK
FT                   ALEDIISKDIIRTDFKPGDLSPQNSMGIRKDGSGNMYIKVKNGWVSLSKSDTGYSIPVG
FT                   KEKIRVEFTKNRWSAAETAPGFPGQLNYFPSEQASVTVSCTDGYSTTFDIDPTKTLTKN
FT                   ILEHFDPIDDGLLFDMKKSQSDHKHEFFSINKVTIKTSDSERSVYYPDDKPGGLKNSDV
FT                   LFDVVPINFKTSKNILIAPNKYKTEMVYTHYPYDLHVMKQGTIKSCGFACITMIAKDLK
FT                   KVRNIDESVIKHFMSLNKDSTDGAFSLTLSEIMSESGVSNKYLRIEDPAKYIQDKMRED
FT                   RWTGIVNIDGHFCIITKADTHEFYFRDPYQGILSLEKTDKLKNLSIGKDIIEM"
FT   gene            complement(608151..608363)
FT                   /gene="cpdB"
FT                   /locus_tag="EPYR_00541"
FT   CDS_pept        complement(608151..608363)
FT                   /transl_table=11
FT                   /gene="cpdB"
FT                   /locus_tag="EPYR_00541"
FT                   /product="2':3'-cyclic-nucleotide 2'-phosphodiesterase"
FT                   /function="5'-nucleotidase/2',3'-cyclic phosphodiesterase
FT                   and related esterases"
FT                   /EC_number="3.1.4.16"
FT                   /note="2',3'-cyclic-nucleotide 2'-phosphodiesterase
FT                   precursor, bifunctional 2',3'-cyclic nucleotide
FT                   2'-phosphodiesterase/3'-nucleotidase periplasmic precursor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00541"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72897"
FT                   /db_xref="GOA:D2T3G2"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3G2"
FT                   /protein_id="CAY72897.1"
FT                   /translation="MFKSCLTLGALLVSHTLHAATVDFRILETTDWHCNMMDFDTKKDR
FT                   STNDYRLVRTTLPIKGRTGRQSASC"
FT   gene            608602..609342
FT                   /gene="cysQ"
FT                   /locus_tag="EPYR_00542"
FT   CDS_pept        608602..609342
FT                   /transl_table=11
FT                   /gene="cysQ"
FT                   /locus_tag="EPYR_00542"
FT                   /product="Inositol-1-monophosphatase"
FT                   /function="3'-Phosphoadenosine 5'-phosphosulfate (PAPS) 3'-
FT                   phosphatase"
FT                   /EC_number="3.1.3.25"
FT                   /note="Inositol-1-monophosphatase (IMPase)
FT                   (Inositol-1-phosphatase) (I-1-Pase), Inositol
FT                   monophosphatase, Inositol monophosphatase
FT                   family,bisphos_cysQ: 3'(2'),5'-bisphosphate nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00542"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72898"
FT                   /db_xref="GOA:D2T3G3"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3G3"
FT                   /protein_id="CAY72898.1"
FT                   /translation="MLEKICQLAREAGDAIMQVYDGQAPLDVAQKPDDSPVTAADMAAH
FT                   KVIVAGLQALTPTIPVLSEEAPQSWEIRQHWQQYWLVDPLDGTKEFIKRNGEFTVNIAL
FT                   IKAGKTVLGVVYAPVLAVMYCAAEGKAWKEEGGHKIRIQVQDARPPLVVVSRSHADSEL
FT                   EDYLKQLGDHQTTAIGSSLKFCLVAEGKAQLYPRFGPTNIWDTGAGHAVAAAAGAHVND
FT                   WQGKPLDYAPRESFLNPGFRVSIF"
FT   gene            609879..610085
FT                   /gene="ytfK"
FT                   /locus_tag="EPYR_00543"
FT   CDS_pept        609879..610085
FT                   /transl_table=11
FT                   /gene="ytfK"
FT                   /locus_tag="EPYR_00543"
FT                   /product="Uncharacterized protein ytfK"
FT                   /note="Protein of unknown function DUF1107, Protein of
FT                   unknown function (DUF1107)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00543"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72899"
FT                   /db_xref="InterPro:IPR009491"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3G4"
FT                   /protein_id="CAY72899.1"
FT                   /translation="MKIFQRYNPLQVAKYVKTLFRGRFYIKDVGAFEFDKGKILIPRVK
FT                   DKQHYSVMSEVNRQVLRLQTEFN"
FT   gene            complement(610135..611463)
FT                   /gene="ytfL"
FT                   /locus_tag="EPYR_00544"
FT   CDS_pept        complement(610135..611463)
FT                   /transl_table=11
FT                   /gene="ytfL"
FT                   /locus_tag="EPYR_00544"
FT                   /product="UPF0053 protein yrkA"
FT                   /function="Hemolysins and related proteins containing CBS
FT                   domains"
FT                   /note="Protein of unknown function DUF21, Domain of unknown
FT                   function DUF21"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00544"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72900"
FT                   /db_xref="GOA:D2T3G5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3G5"
FT                   /protein_id="CAY72900.1"
FT                   /translation="MLDSFLVIVMLIAVSSFFSLSEISLAAARKIKLKLLADEGNINAQ
FT                   RVLKMQETPGMFFTVVQIGLNAVAILGGIVGDAAFSPAFKALFERFFDAEMAERISFIC
FT                   SFTLVTSLFILFADLFPKRLGMIAPERVALKIINPMRFCLFIFRPLVWFFNGGANIIFR
FT                   LFKIPLVRKDDITSDDIYAVVEAGALAGVLRKQEHELIENVFELESRTVPSSMTSRENV
FT                   VWFDLHEDESSLKEKIARHPHSKFLVCNEDIDHIVGYVDSKELLLRVLGNQSMTLNSGV
FT                   QIRSALIVPDTLTLSEALESFKTAGEDFAVIMNEYALVVGIITLNDVMTTLMGDLVGQG
FT                   LEEQIVARDENSWLVEGGTPIEDVMRVLHIDEFPQSGNYETIGGFMMFMLRKIPKRTDF
FT                   VKLHGYKFEVVDIDSYRIDQLLVTRIDARPLASVLPKDAEETA"
FT   gene            612073..613812
FT                   /gene="ytfM"
FT                   /locus_tag="EPYR_00545"
FT   CDS_pept        612073..613812
FT                   /transl_table=11
FT                   /gene="ytfM"
FT                   /locus_tag="EPYR_00545"
FT                   /product="Uncharacterized protein ytfM precursor"
FT                   /function="Outer membrane protein"
FT                   /note="Bacterial surface antigen (D15), Surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00545"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72901"
FT                   /db_xref="GOA:D2T3G6"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3G6"
FT                   /protein_id="CAY72901.1"
FT                   /translation="MPRIHVYCMFCLLIAAPVAQAVNVRLQVTGLSGELEKNVRARLST
FT                   ITSDEVSADGRFMSRVSEAVKEGLKALGYYEPQIDFELQPPPTGGKRPLLLAKVIPGQP
FT                   IKLAGETVILRGGARTDEDYRRLVNGAKPKLGSVLNHNDYDKFKSSLSNMALRKGYFDA
FT                   DYRKSQLGVSVERHEAFWDIDYDSGQRYRFGDVSFSGSQIRDDYLKNLVPFKKGDDYNS
FT                   RDLAELNRRLSATGWFNSVVVVPEFDQGRASKVLPLHGVFSPRTENTIETGVGYSTDVG
FT                   PRVKATWKKPWVNDRGHSFSTSANLSTPEQQLDFSYKIPLLKSPLEQYYLLQGGLKRTD
FT                   LNDTQADSSTLAASRYWDSSSGWQRAINLRWSLDHFTQGNVTNTTMLIYPGVSINRTRS
FT                   RGGLMPTWGDSQRYSLDVSDTTWGSDIDFAVIQAQNVWIRTLAEKHRFVARANLGWIET
FT                   NNFEKVPPDLRFFAGGDRSIRGYKYKGISPRDDDGKLTGASKLATGSLEYQYNVTGKWW
FT                   SAVFIDSGEAVNDIKQSNVKTGAGVGVRWQSPIGPVKLDIARAIGDEDKRDIQFYIGLG
FT                   PEL"
FT   gene            613914..617582
FT                   /gene="ytfN"
FT                   /locus_tag="EPYR_00546"
FT   CDS_pept        613914..617582
FT                   /transl_table=11
FT                   /gene="ytfN"
FT                   /locus_tag="EPYR_00546"
FT                   /product="Uncharacterized protein ytfN"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="Protein of unknown function DUF490, Family of
FT                   unknown function (DUF490)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00546"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72902"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3G7"
FT                   /protein_id="CAY72902.1"
FT                   /translation="MNSAARWVPGLDIQQVDGGWRNLTLKGISYKMPGVTVEAGEFHLA
FT                   LRLGCLKQSAFCINDLALKDVNVVVDSKKMPPAAEPPVEEESSTGEISTPYPLTLSRLA
FT                   LHNINVKIDDTAISLADFTSGLHWQERAMTLTPTHIQGLLMALPKAAQVAKEPVAPPKT
FT                   EQPAAQDTPLGETLKALFAKPLLPILPEFVLPLDVNVQQILGEQLRITGDSDITVNRLL
FT                   LKAKTERNQLWLQSLDVDSPQGQLNAQGQATLSGSWPLNFTLNSAINVEPLKGEKIKMT
FT                   LDGDLRDTTKLALNLSGPVRAQLDADSQLAVAGLPLNMRLQSPQLRWPLDGAAQFQASN
FT                   VNFSINGKATDYVMSLKAALQGEGMPPATLTLDGKGNVEQFSLDKLRLAALQGNTDLTA
FT                   LVDWSKAISWRSKLTLSGINTAKHYPAWPAKLEGVITTRGSLYGGSWQMRVPELKLKGN
FT                   VRNNAVSADGSLSGNSYNQWDIPGIKLVLGRNNLNLKGALGDKLNLDADIDARHLDNAL
FT                   PGLGGAAQGRIRARGDLKTPQLLADLTASGLRWQAMRVARIKLDGDIRSGEQIQGKVNL
FT                   RVEQLKQDALSVKLLQLDASGTEKQHQLKLNVQGEPVSGQLALNGAFDRAGGRWQGALN
FT                   NTRFATPVGEWRLTRAIALDYLNAKQAVSIGPHCWQNPNAELCVPQTIKAGPSGHARVV
FT                   LNRFDLAMIAPFMPETTQLDGVFNGDADVSWTADGGLPTGRVALKGRGVKVNQDVQGNT
FT                   LPIAFDTLNLNAALKNGRAQLDWLIHIANNGQLDGNVQIADPQGRRTLSGNVNITNLSL
FT                   AMLNPALMQGEKMAGMLNTHLRLGGNLQKPQVFGELGLRNVDVDGSFMPVDLTAANLTM
FT                   AFNGMSSTLEGLIQTSQGQIALNGNADWSQLNAWRARIATKGEKIRITVPPMVRMDVSP
FT                   DLVFEATPQLFNLEGRVDIPWARITVQEVPTSAVGVSSDEVLLDKDLKPIAPKSASIPI
FT                   NSHLTIHVGDDVRLSAFGLKAKLNGDLKMVQDKRGVGLNGQINIPSGRFHAYGQDLIVR
FT                   KGELQFSGPVDQPYLNIEAIRNQEATEDDVTAGVRVTGLADEPKVEIFSDPAKSQQEAL
FT                   SYLLRGQGLGASGSESDALTSALVGLGLAQSGQIVGKIGETFGVSNLALDTTGVGESQK
FT                   VQVSGYVLPGLQVKYGVGIFDSLATLTLRYRLMPKLYLEAVSGVDQALDLLYQFEF"
FT   gene            617585..617935
FT                   /gene="ytfP"
FT                   /locus_tag="EPYR_00547"
FT   CDS_pept        617585..617935
FT                   /transl_table=11
FT                   /gene="ytfP"
FT                   /locus_tag="EPYR_00547"
FT                   /product="UPF0131 protein ytfP"
FT                   /note="Butirosin biosynthesis, BtrG-like, AIG2-like family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00547"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72903"
FT                   /db_xref="GOA:D2T3G8"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="InterPro:IPR039126"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3G8"
FT                   /protein_id="CAY72903.1"
FT                   /translation="MRIIVYGSLRRKQGNSHWMTNAQWLGDHPIDGYALYNLGHYPGVV
FT                   MGDGRVYCEVYRIDAATLGELDALRTKGGEYRRELVSTPYGSAWLYVYQRSVVGKKRIE
FT                   SGDWLQKDAAAQ"
FT   gene            complement(618040..618570)
FT                   /gene="ppa"
FT                   /locus_tag="EPYR_00548"
FT   CDS_pept        complement(618040..618570)
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /locus_tag="EPYR_00548"
FT                   /function="Inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="Inorganic pyrophosphatase (Pyrophosphate
FT                   phospho-hydrolase) (PPase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00548"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72904"
FT                   /db_xref="GOA:D2T3G9"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3G9"
FT                   /protein_id="CAY72904.1"
FT                   /translation="MSLNHVPAGKDLPDDIYVVIEIPANAAPIKYEVDKESGALFVDRF
FT                   MATAMFYPCNYGYINNTLSLDGDPVDVLVPTPYPLQPGSVIRCRPVGVLKMTDESGEDA
FT                   KVVAVPHSKLSKEYEHIQDVNDLPELLRGQISHFFEQYKALEKGKWVKVDGWEGVAAAK
FT                   AEIVSSFERAAKK"
FT   gene            619041..620606
FT                   /gene="tsr"
FT                   /locus_tag="EPYR_00549"
FT   CDS_pept        619041..620606
FT                   /transl_table=11
FT                   /gene="tsr"
FT                   /locus_tag="EPYR_00549"
FT                   /product="Methyl-accepting chemotaxis citrate transducer"
FT                   /function="Methyl-accepting chemotaxis protein"
FT                   /note="Methyl-accepting chemotaxis citrate transducer
FT                   (Citrate chemoreceptor protein), Bacterial chemotaxis
FT                   sensory transducer, Methyl-accepting chemotaxis protein
FT                   (MCP) signaling domain"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00549"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72905"
FT                   /db_xref="GOA:D2T3H0"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3H0"
FT                   /protein_id="CAY72905.1"
FT                   /translation="MLKRISIRSGLLALLGLMTLLLIVVSVMGIIAIQKGNRSLDAVNR
FT                   IQGIELNALYISNGSLLRARAVASLAMRQLETGKPDKAAKTGERALNYVAASENELKKF
FT                   IAAGTVTEHGRVLAEAVAVSYRDYLANGITPLMAAMQKQSPGDFYAILEGNLSLLAGKY
FT                   SDAVDNFGRYANEVTASRLEQAANNQSMMTILILVSGALTLMLVAAAWMILRELLLKPL
FT                   DNAIQHLEHVAEGDLTQQVPESSKNEIGRLNAALGIMQQSLQHSVIKVRDASIQIDIGS
FT                   RELSSGNLNLSQRTEESAASLEQTAASMEQLTATVKQNADNAQQAHLLAKSVSDTAERG
FT                   AEVVSYVMEKMSEISSSSKRVGDILGVIDGIAFQTNILALNASVEAARAGEQGRGFAVV
FT                   ASEVRNLAQRSATAAKEIRTLIAESQTRVSEGSNMATKAGETMDEISSEVMRVTTLMKE
FT                   ISSASQEQSHGIEQVNVAVTQMDEVAQHNAALVEEAAAVTQSLEEQSRQLVQTMAVFKV
FT                   TQVA"
FT   gene            621544..623427
FT                   /locus_tag="EPYR_00550"
FT   CDS_pept        621544..623427
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00550"
FT                   /product="leucine aminopeptidase-related protein"
FT                   /function="Trypsin-like serine proteases, typically
FT                   periplasmic, contain C-terminal PDZ domain"
FT                   /note="Peptidase, trypsin-like serine and cysteine"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00550"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72906"
FT                   /db_xref="GOA:D2T3H1"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3H1"
FT                   /protein_id="CAY72906.1"
FT                   /translation="MTITGDTINLEVHFPRESDYSSASLVLKRILYTPLAAKDRSIIGE
FT                   KDERRRLVCYKDDNNAIYEHGLSSVYMLLGNKGSGSLLGKDNLFLTNHHVVKTTEEVKN
FT                   GEIWLNWYHRNCSEDDKTEKKPIKIQGDKLLSHGSGGAKDYALLTADPFDFKYGNIKRL
FT                   FGGLAISKKNPAIGEALHIPQYGNGTIRPAYVADTESGSPCKLLSAGAVLAYNCDTRSG
FT                   SSGSPVISTVSQMLVGVHYASGSDKNLAVGAETLIKDLSAFITDKNNQSQPPLSYAINA
FT                   NQLSITPFSYQGELAISEKPIWFSSSDPELNIEHQYDYSLVTFMKKNLQTGDVVKDENK
FT                   SLKLWLENNCGKFAIDKKPFCRNPGKTSLKYAMDVEEKDFTNGSWKKYWLLLTQHDEQQ
FT                   NKEENVFQISESFYDVISPPFAEERAIVKELVLQEKTTEKLSWAYEGKDNLGLVAFYTE
FT                   QGPVSLVRRVDGRTEVPVILRDEKRDLMQKVILDVSRRTACSETQMNSSVTCKASDKYT
FT                   EFNVRFNPGKNPGILDGKFMGILPLKLKSSDGEVEENVLYKISLDNQKETPEDIPDWNS
FT                   ATIYEQACQKVKYAGKAWLNGWWTQNSPPGKAGAWDVWREEGSVDMHTHCK"
FT   gene            complement(623544..624542)
FT                   /gene="fbp"
FT                   /locus_tag="EPYR_00551"
FT   CDS_pept        complement(623544..624542)
FT                   /transl_table=11
FT                   /gene="fbp"
FT                   /locus_tag="EPYR_00551"
FT                   /product="fructose-bisphosphatase"
FT                   /function="Fructose-1,6-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /note="Fructose-1,6-bisphosphatase, cytosolic
FT                   (D-fructose-1,6-bisphosphate 1-phosphohydrolase) (FBPase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00551"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72907"
FT                   /db_xref="GOA:D2T3H2"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3H2"
FT                   /protein_id="CAY72907.1"
FT                   /translation="MKTLGEFIVEKQHDFPHATGELTALISAIKLGAKIIHRDINKAGL
FT                   VDILGASGAENIQGEQQMKLDLYANEKLKAALKARGFVAGIASEEEDEIVIFEGVENGK
FT                   YVVLMDPLDGSSNIDVNVSVGTIFSIYRRITPAGTPVTEEDFLQPGSQQVAAGYVVYGS
FT                   STMLVYTTGCGVHAFTYDPSLGVFCLSAERMTFPEAGYTYSINEGNYIRFPQGVKKYLK
FT                   FCQEEDKASSRPYTSRYIGSLVADFHRNLLKGGIYLYPSTASHPKGKLRLLYECNPMAF
FT                   LAEQAGGKASDGKNRILDLVPETLHQRSPFFVGNDHMVNDTERFLREYPDK"
FT   gene            624715..626067
FT                   /gene="mpl"
FT                   /locus_tag="EPYR_00552"
FT   CDS_pept        624715..626067
FT                   /transl_table=11
FT                   /gene="mpl"
FT                   /locus_tag="EPYR_00552"
FT                   /product="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate
FT                   ligase"
FT                   /function="UDP-N-acetylmuramate-alanine ligase"
FT                   /EC_number="6.3.2.-"
FT                   /note="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate
FT                   ligase (Murein peptide ligase),utamyl-meso-diaminopimelate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00552"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72908"
FT                   /db_xref="GOA:D2T3H3"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3H3"
FT                   /protein_id="CAY72908.1"
FT                   /translation="MRIHILGICGTFMGGLAMLARALGHEVTGSDANVYPPMSTLLEKQ
FT                   GIDLIQGYDASQLEPVPDLVIIGNAMTRGNPCVEAVLERNIPYLSGPQWLHDFVLRDRW
FT                   VIAVAGTHGKTTTAGMTAWILQACGYEPGFVIGGVPGNFEVSANLGKSPFFVIEADEYD
FT                   CAFFDKRAKFVHYCPRTLILNNLEFDHADIYDDLRAIQKQFHHLVRIVPGQGKIILPEH
FT                   DANLKQMMSMGCWSEHEAVGENGCWQVKKLSPDASCWEVMLDGERVAEVNWSLVGEHNM
FT                   RNGMMAIAAARHVGVKPEDAGRALNDFINARRRLELRGESNGIKVYDDFAHHPTAIHAT
FT                   LAALRGKVGGTARILAVLEPRSNTMKMGISKDDLAPALGRADEVFLYQPHHIPWQVSEV
FT                   ADACIQPAHWSADIDTLVEAIAKVAHPGDTILVMSNGGFGGIHQKLLDRLA"
FT   gene            complement(626182..626724)
FT                   /gene="yjgA"
FT                   /locus_tag="EPYR_00553"
FT   CDS_pept        complement(626182..626724)
FT                   /transl_table=11
FT                   /gene="yjgA"
FT                   /locus_tag="EPYR_00553"
FT                   /product="UPF0307 protein YPTB3542"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="Protein of unknown function DUF615, Protein of
FT                   unknown function (DUF615)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00553"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72909"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3H4"
FT                   /protein_id="CAY72909.1"
FT                   /translation="MTKQPDEWLDEVPDNQEEDEEEIIWVSKSEIKRDAEELKRLGAEL
FT                   IELGKNSLDKIPLDEELRNAIELAQKIKKEARRRQLQLIGKLLRSREEEPIRTALDKLK
FT                   NRHNQQVALFHKLEMMRDRLVEQGDDAVAEVLALYPDADRQQLRAMIRNAQKEKAGNKP
FT                   PKAYRQIFQYLRELAEA"
FT   gene            626886..628226
FT                   /gene="pmbA"
FT                   /locus_tag="EPYR_00554"
FT   CDS_pept        626886..628226
FT                   /transl_table=11
FT                   /gene="pmbA"
FT                   /locus_tag="EPYR_00554"
FT                   /product="Protein pmbA"
FT                   /function="Predicted Zn-dependent proteases and their
FT                   inactivated homologs"
FT                   /note="Peptidase U62, modulator of DNA gyrase, putative
FT                   modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00554"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72910"
FT                   /db_xref="GOA:D2T3H5"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3H5"
FT                   /protein_id="CAY72910.1"
FT                   /translation="MKLLSQVAEQRKTLEQAVATALELAKASSDGAEVAVTKTTGISVS
FT                   TRYGSVENVEFNSDGALGITVYHQNRKGSASSTDLSHDAIQRTVQAALDIARYTSADPY
FT                   AGVADPDLLAFTAPDLDLFHPSEIDADRAIELAARAEQAALKSDKRITNTEGGSFNSHV
FT                   GIKVFGNSHGMIQGYCSSRHSLSSCVIAEENGDMERDYAYTIGRAMEDLKSPEYVGEEC
FT                   ARRTLSRLSPRKLSTMKAPVMFAAEVATGLFGHLVGAISGGSVYRKSTFLLDSLGQQIL
FT                   PEWLTIEEHPHLLKGLASTPFDSEGVRTQRRDIIQDGVLQNWLLTSYSARKLGLKSTGH
FT                   AGGIHNWRIAGQGHSFDDMLKQLGTGLLVTELMGQGVSGITGDYSRGASGFWVENGVIQ
FT                   YPVSEITIAGNLKDMWRNMVSVGSDTETRSNIQCGSVLLPEMKIAGQ"
FT   gene            complement(628416..629315)
FT                   /locus_tag="EPYR_00555"
FT   CDS_pept        complement(628416..629315)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00555"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72911"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3H6"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72911.1"
FT                   /translation="MINFTKISSLFLWASVKASPKPVKGNFLMSNITGVKSSSNELGIL
FT                   LKDFVGGNSTSLYASEERLKDELNTFFGPSRNPVPGNNDFHAALNSSTAAVGVARITKR
FT                   QAPQPGLAEKLIACKSQLDQARQGNESSPGLKPSAAAVDVAHSTXRQAPQPGLAEKLIA
FT                   CKSQLDQAPKGNESSPGLKPSAAAVDVAHSTKRQAPQPGLAEKLKAVVDAARESQLNQA
FT                   AQDNESSTGLKPSADSVHVKQSVKRQAPQPPVQANQEVDKAQLLSELEKTRQGAPPTAS
FT                   IKAFMVQLASVSPLRRKL"
FT   gene            629724..630068
FT                   /locus_tag="EPYR_00556"
FT   CDS_pept        629724..630068
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00556"
FT                   /product="Glycine dehydrogenase"
FT                   /EC_number="1.4.4.2"
FT                   /note="Glycine dehydrogenase [decarboxylating] (Glycine
FT                   decarboxylase) (Glycine cleavage system P-protein), PRD"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00556"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72912"
FT                   /db_xref="GOA:D2T3H7"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR020044"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3H7"
FT                   /protein_id="CAY72912.1"
FT                   /translation="MSKGTVPVSAVAECGGDIQRLAARVMKQIAGLFAARNIQPNPVQQ
FT                   QMLASHVRAMALRSLTGEALPEIAADLFEDISPQSTALAQQVVDLFGNLPVEESWLLSV
FT                   HFEVAKENQN"
FT   gene            630078..630437
FT                   /locus_tag="EPYR_00557"
FT   CDS_pept        630078..630437
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00557"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72913"
FT                   /db_xref="InterPro:IPR020034"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3H8"
FT                   /protein_id="CAY72913.1"
FT                   /translation="MPQITVVIGDRLGKGQKVAAGIEKAGGKAIVVPGVAADMKLGDVM
FT                   NAESADFGISFCGSGGAGAITAQNKYGFKAKHGMRSIEEGVTAINEGATVLGFGFMDKE
FT                   ELGERLVQAWHKKQG"
FT   gene            630416..630736
FT                   /locus_tag="EPYR_00558"
FT   CDS_pept        630416..630736
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00558"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72914"
FT                   /db_xref="InterPro:IPR020037"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3H9"
FT                   /protein_id="CAY72914.1"
FT                   /translation="MAQEARLMKEQFTTTVKVSGKGNSKTKAFADALSQVQNTVLKSSN
FT                   KVLLRIEPVEVKVLRAGVGVSKEKFLFFFLAREKRLYSVELEIVVNVAAIATDRVEFTV
FT                   NN"
FT   gene            630770..631546
FT                   /locus_tag="EPYR_00559"
FT   CDS_pept        630770..631546
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00559"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00559"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72915"
FT                   /db_xref="GOA:D2T3I0"
FT                   /db_xref="InterPro:IPR020042"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3I0"
FT                   /protein_id="CAY72915.1"
FT                   /translation="MFLIILFKSLIIGGLVGVGVGAGAARMFHAPTTQGMGAFRTLGEL
FT                   NSCEGDPASHFSFGLGFFFNAWASSVAAGSFTQDVDHRIIPNWGAAALMVKNRNLAQTL
FT                   HDPKKMAIACGLIGMIVVAFLNSTASAVPAALQVTAVKVLVPAANLLVNTVMPVLFWLA
FT                   AIDAGKKSGFWATIFGGLAQLMMGNAVPGLVLGILIGKGVEESGWNRVTGVMMVAIILL
FT                   FVLSGFFRGFDMQMLQSFQLGVPIWLDMLHNSLSGK"
FT   gene            631560..632204
FT                   /locus_tag="EPYR_00560"
FT   CDS_pept        631560..632204
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00560"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72916"
FT                   /db_xref="GOA:D2T3I1"
FT                   /db_xref="InterPro:IPR025456"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3I1"
FT                   /protein_id="CAY72916.1"
FT                   /translation="MDKSKSGFWYADWSFPIFVGLLSAGVFAGTHMYYVYGLGAFNEVA
FT                   FVSMLRSGMETGVYGAVAAFGASFLFARIIEGSLVGILDIGGAIQTGIGLGVPALLLGA
FT                   GIIYPVANFAAALVTGLALGLAVGYLIILARKFTINNSDSTYGADVMMGAGNAAGRFLG
FT                   PLIILSAMSASIPIGLGSLFGSLLFYLWNKPITGGAILGAMLLGAIFPVAL"
FT   gene            632251..633384
FT                   /locus_tag="EPYR_00561"
FT   CDS_pept        632251..633384
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00561"
FT                   /product="putative amidohydrolase"
FT                   /function="Predicted amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00561"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72917"
FT                   /db_xref="GOA:D2T3I2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR020043"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3I2"
FT                   /protein_id="CAY72917.1"
FT                   /translation="MFDLIIRQARLSNGSLSDIAIKEGKIAAVGTLSGSARREWHLAGR
FT                   YWLSAGWIDSHVHCYPKSPIYHDEADRIGVETGVTTVVDAGSTGADDIDDFFQLTCCAN
FT                   TRVYALLNIARSGILTQNELADMASLDGKAVEAALQRHPGFICGLKARISSSVVEKNGI
FT                   KPLEHAKAIQQENGPLPLMVHIGNDPPDLDEIADLLTAGDIITHCYNGKPNRILTPSGI
FT                   LRASITRALQRGVRLDVGHGSASFSFAVARAAIAQGILPHTISSDIYCRNRVNGPVHSL
FT                   AHVMSKFLHIGMTLPQVIDCVTAHAADGLRLAGIGRLEPGYVADLTIFDLQQAVCLFSD
FT                   ADGQTLPGEMQLVPLAAVVGGQEFVTDEGKKRNDLSL"
FT   gene            633368..634489
FT                   /gene="selA"
FT                   /locus_tag="EPYR_00562"
FT   CDS_pept        633368..634489
FT                   /transl_table=11
FT                   /gene="selA"
FT                   /locus_tag="EPYR_00562"
FT                   /product="Selenocysteine synthase"
FT                   /function="Aspartate/tyrosine/aromatic aminotransferase"
FT                   /EC_number="2.9.1.1"
FT                   /note="L-seryl-tRNA(Sec) selenium transferase (Sec
FT                   synthase) (Selenocysteinyl-tRNA(Sec) synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00562"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72918"
FT                   /db_xref="GOA:D2T3I3"
FT                   /db_xref="InterPro:IPR006337"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3I3"
FT                   /protein_id="CAY72918.1"
FT                   /translation="MTSVYEKYGLKQVINASGRMTLLGVSTPSADVVETVKFGLNHYFE
FT                   INDLVNKSGACIAGLLGCEAAVVVSCASAGLAQSVAALIIKDNAWLLDNLHVAPLAVAH
FT                   DIVLPKGHNVNYGAPVGTMVALGGGRLVEAGYANECSAEQLSAAITAQTAAILYIKSHH
FT                   CVQKSHLSVEQAAVVAHQHGVPLIVDAAAEEDLQAYYNAGADLVIYSGAKAIEGPTSGL
FT                   VVGKTQYVEWVKRQSQGIGRAMKVGKEGILGLTLAIENYLLREKATGAQMVEKMTPFIA
FT                   NLNQLPGIEARVVWDAAGRDIARAEIHFDEATVGRTTGEIVQSLRTGDIAIYFRGYKAN
FT                   EGIVEVDVRSVTVDQLHTIFTCIHALLFGEKRA"
FT   gene            634486..635226
FT                   /locus_tag="EPYR_00563"
FT   CDS_pept        634486..635226
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00563"
FT                   /product="hypothetical protein"
FT                   /function="2-keto-3-deoxy-6-phosphogluconate aldolase"
FT                   /note="Protein of unknown function DUF1341, Protein of
FT                   unknown function (DUF1341)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00563"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72919"
FT                   /db_xref="GOA:D2T3I4"
FT                   /db_xref="InterPro:IPR010763"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3I4"
FT                   /protein_id="CAY72919.1"
FT                   /translation="MTLTPQFYRNRVCLNVLAGSKQNARDIWEAAEGHVLVGVLSKDYG
FT                   DVDSAVTDMREYAALINNALSVGLGAGDPNQSTMVSAIAARIQPQHVNQVFTGVATARA
FT                   LLGQPQTVVNGLISPSGQPGMVKISTGSLSSRQADGIVPVATAVALLKDMGGSSVKYFP
FT                   MGGLETLDEFKAVAAACAAQDFWLEPTGGIDLNNFAAILQSALDAGVSKIIPHIYSSII
FT                   DKSTGLTRPEDVARLLTITKQLVD"
FT   gene            635338..637272
FT                   /gene="licR"
FT                   /locus_tag="EPYR_00564"
FT   CDS_pept        635338..637272
FT                   /transl_table=11
FT                   /gene="licR"
FT                   /locus_tag="EPYR_00564"
FT                   /product="probable licABCH operon regulator"
FT                   /function="Transcriptional antiterminator"
FT                   /EC_number="2.7.1.69"
FT                   /note="probable licABCH operon regulator [Includes:
FT                   putative phosphotransferase enzyme IIB component (Putative
FT                   PTS system EIIB component); Putative phosphotransferase
FT                   enzyme IIA component (Putative PTS system EIIA component)],
FT                   Phosphotransferase system,phosphoenolpyruvate-dependent
FT                   sugar EIIA 2, PRD domain"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00564"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72920"
FT                   /db_xref="GOA:D2T3I5"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3I5"
FT                   /protein_id="CAY72920.1"
FT                   /translation="MRFPNQRLAQLFTILQNETLPQDELARRLNVSTRTVRTDINALNE
FT                   LLTDYTACFVLSRGAGYQLKIADAQRYQQLLQQSSSPLRVPRTSEERVNYLLTRFLTSA
FT                   FALKLEDLADEWFVSRTTLQSDMAEVREWLARYQLAIETKPRYGMKLFGSEVAMRTCLT
FT                   DLLYQIALGHSDSPLLRGEGVNSGMLERLQPLLQQSLSRFNIRLTDDGEFYLRLYCAVA
FT                   VRRIGEGYPLTDFSAEDVNDEVCAAARDIVNLMRPIVGKAISPAEEAYLRVNIAARRVE
FT                   ELAASAIGADDGDSLVEYILTYINTHYNFNLQNDPQLHADLLTHIKTMITRVRYQIHIP
FT                   NPLLTNIKQHYPLAWDVTLAAVSSWSKYTPYTICENEIGFLVLHIGVGLERHYHVGYQR
FT                   HPQILLVCDTGNSTVRMIQAMLWRKYPQIVVNQIISLRDYALQASVEEDFVISTVRLSD
FT                   KDKPVVVMSPFPTEYQLEQLGKLVLLDRTRPYMLEKFFDASHFMILDRPIDRSLLFRQL
FT                   CDQLEQEGMVDNTFYPSVEEREAIVTTILGEGIALPHSLGLLAKKTCVYTVLAPQGITW
FT                   GDETAYVIFLLAIGKTEYEEAMAIYDLFVTFMRERAMVRLRDSKDFAAFKAVAMDCLNR
FT                   FQGGTYGAG"
FT   gene            complement(637309..637881)
FT                   /gene="yraP"
FT                   /locus_tag="EPYR_00565"
FT   CDS_pept        complement(637309..637881)
FT                   /transl_table=11
FT                   /gene="yraP"
FT                   /locus_tag="EPYR_00565"
FT                   /product="Uncharacterized protein HI1658 precursor"
FT                   /function="Predicted periplasmic or secreted lipoprotein"
FT                   /note="Transport-associated, putative phospholipid-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00565"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72921"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3I6"
FT                   /protein_id="CAY72921.1"
FT                   /translation="MKALSACAVILTALLLQGCVAAVVGSAAVATKTATDPRTVGTQVD
FT                   DGTLELRVTNALSKDAQIKQTAHIVATAYQGKVLLTGQAPGSELALRAKQIAVGVDGAT
FT                   EVYNEIRTGNKVSFGTASSDTWITTKVRSQLLGSDRVKLSSVKVTTENSEVFLLGLVTN
FT                   EEAKAAADIASRVSGVKHVTTAFTLLK"
FT   gene            complement(637893..638483)
FT                   /gene="yraO"
FT                   /locus_tag="EPYR_00566"
FT   CDS_pept        complement(637893..638483)
FT                   /transl_table=11
FT                   /gene="yraO"
FT                   /locus_tag="EPYR_00566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00566"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72922"
FT                   /db_xref="GOA:D2T3I7"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR023070"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3I7"
FT                   /protein_id="CAY72922.1"
FT                   /translation="MLERIKVCFTESIQTQIAAAEALPDAISRAALTVVQSLLNGNKVL
FT                   SCGNGTSSANAQHFAASMINRFETERPSLPAIALSADNVLLTAIGNDRLHEEIYAKQVR
FT                   ALGHTGDILLAISTRGNSRDIVKAVEAAVTRDMTIVALTGHDGGELAGLLGPQDVEIRI
FT                   PSHRSARIQEMHMLTVNCLCDLIDNTLFPHQEV"
FT   gene            complement(638513..638905)
FT                   /gene="yraN"
FT                   /locus_tag="EPYR_00567"
FT   CDS_pept        complement(638513..638905)
FT                   /transl_table=11
FT                   /gene="yraN"
FT                   /locus_tag="EPYR_00567"
FT                   /product="UPF0102 protein yraN"
FT                   /function="Predicted endonuclease distantly related to
FT                   archaeal Holliday junction resolvase"
FT                   /note="Protein of unknown function UPF0102,Uncharacterised
FT                   protein family UPF0102, TIGR00252: conserved hypothetical
FT                   protein TIGR00252"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00567"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72923"
FT                   /db_xref="GOA:D2T3I8"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3I8"
FT                   /protein_id="CAY72923.1"
FT                   /translation="MEPVSSRTDRSGHLSRQQQGANREIQARRLLETSGLHFVAANVRY
FT                   RSGEIDLIMRDKQVWVFVEVRYRRDARFGGAALSVTRSKQLKLLQAAALWLHSRKQSFD
FT                   TADCRFDVVAITGEQVEWLPNAFTAD"
FT   gene            complement(638863..640887)
FT                   /gene="yraM"
FT                   /locus_tag="EPYR_00568"
FT   CDS_pept        complement(638863..640887)
FT                   /transl_table=11
FT                   /gene="yraM"
FT                   /locus_tag="EPYR_00568"
FT                   /product="Uncharacterized protein yraM"
FT                   /function="Putative lipoprotein"
FT                   /note="LppC putative lipoprotein, LppC putative
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00568"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72924"
FT                   /db_xref="GOA:D2T3I9"
FT                   /db_xref="InterPro:IPR007443"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3I9"
FT                   /protein_id="CAY72924.1"
FT                   /translation="MLPSNVVHRKAVRNVPLLLAVLIFAGCTGQAPQTPPVNVQGAANG
FT                   TSDYYLQQVQQSSDDNKVDWQLLAIRALLNEGKVPQANDALMQLAADLNAVQHQEQLLL
FT                   QTQLDIARQNLSAAADQLKQVDISTLSQDQQVRYYQMQIAARQGQPSLDVVRAWIALEP
FT                   LQTHPTDKQKNIDDTWQALLQIPQQQFSTLTINADENVLQGWLDLLGIYKTNASDPDML
FT                   KSAIGDWQTRYPFNPAAKMLPGPLTQAKNLRPASTGKIALLLPLSGQAQVFANAIQKGF
FT                   NDAKNGVLAPAAAISSTAQPMQAPGALPGDATVAISPSASPVDAAAQPAEQPQPATEHD
FT                   IATAAPSSSTQIQLYDTNAQPVEQALTQAQNDGATLVVGPLLKNDVDKMLNSQTALNVL
FT                   ALNEPETVQNRPNICYFALSPEDEARDAAHHMWEQGKRAPLLLVPRSSLGDRVNKAFAT
FT                   EWQKLGGTTVLQQQFGSSAELKQGINSGAGIRLSGNPVDVQPQQPAGITIAGLTIPPPP
FT                   TDAQIGVSSSNGRVDSVYIVATQEEMILIKPMIAMRISSRDNVGLYASSRSYQAGAGPD
FT                   FRLELEGLQFSDAPLLSGANPALMQQAAKMFNNDYSLVRLYAMGIDAWTLANRFSEMRN
FT                   QPGFQIRGDTGNLSANQDCIINRKLVWSQYHQGQIVPAT"
FT   gene            640950..641813
FT                   /gene="yraL"
FT                   /locus_tag="EPYR_00569"
FT   CDS_pept        640950..641813
FT                   /transl_table=11
FT                   /gene="yraL"
FT                   /locus_tag="EPYR_00569"
FT                   /product="UPF0011 protein BU091"
FT                   /function="Predicted methyltransferases"
FT                   /note="Protein of unknown function UPF0011, Tetrapyrrole
FT                   (Corrin/Porphyrin) Methylases, TIGR00096: conserved
FT                   hypothetical protein TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00569"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72925"
FT                   /db_xref="GOA:D2T3J0"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3J0"
FT                   /protein_id="CAY72925.1"
FT                   /translation="MKQHDRADISASTLYIVPTPIGNLGDITQRALKVLASVDLIAAED
FT                   TRHTGLLLQHFAINARLFALHDHNEQQKAEVLLTRLREGQSIALVSDAGTPLINDPGYH
FT                   LVRLCREAGIRVVPLPGACAAITALSAAGLPSDRFCYEGFLPAKSKGRCDTLKALEQEP
FT                   RTLIFYESTHRLLDSLHDMVTVWGPDRYVVLAREITKTWESIFGAPVGELLAWVQEDEN
FT                   RRKGEMVLIVEGYHAEEESLPPEALRTLALLQGELPLKKAAQLTAEIHGVKKNALYKYA
FT                   LEQQGE"
FT   gene            complement(642325..642591)
FT                   /locus_tag="EPYR_00570"
FT   CDS_pept        complement(642325..642591)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00570"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72926"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3J1"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72926.1"
FT                   /translation="MCNQLRETNFMPVHPLRQMASGAGALSTRISNTRYGALFRRRWPS
FT                   IVPPHRRYLLPFQRPDPLPIFHPVICHTGWSVRFVLKKCEADR"
FT   gene            complement(642669..642908)
FT                   /locus_tag="EPYR_00571"
FT   CDS_pept        complement(642669..642908)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00571"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72927"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3J2"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72927.1"
FT                   /translation="MPKQDNKFVNTSKQQHYELEDWLYRNSFSKKHDNVEEIRRIINTK
FT                   IKQGVTSHNIKWAELDAALKTHPEWFALLVAPGK"
FT   gene            complement(643158..643862)
FT                   /gene="yhaK"
FT                   /locus_tag="EPYR_00572"
FT   CDS_pept        complement(643158..643862)
FT                   /transl_table=11
FT                   /gene="yhaK"
FT                   /locus_tag="EPYR_00572"
FT                   /product="Protein yhhW"
FT                   /function="Pirin-related protein"
FT                   /note="Cupin, RmlC-type, Pirin"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00572"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72928"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3J3"
FT                   /protein_id="CAY72928.1"
FT                   /translation="MIDSRTAQQCGTADYGWLQARYTFSFGHYFDPSLLGYASLRVLNQ
FT                   EVLAPGSGLQPRTYPKVDVLNLILQGTAEYRDSEGHYAQAQAGEALLLATHPGVSYSEH
FT                   NISKEHVLTRMQLWLDACPQRENAQVQRLNIAECRPYTLVASPDGSAGSMQLRQQVWIH
FT                   QLVLKPGENYHLPLNGHRAYLQSIYGALTVATPSPQHETLSCGDGAFLRDEHSVTLVAT
FT                   TPVRALVIDLPV"
FT   gene            643981..644889
FT                   /gene="yhaJ"
FT                   /locus_tag="EPYR_00573"
FT   CDS_pept        643981..644889
FT                   /transl_table=11
FT                   /gene="yhaJ"
FT                   /locus_tag="EPYR_00573"
FT                   /product="Uncharacterized HTH-type transcriptional
FT                   regulator ydhB"
FT                   /function="Transcriptional regulator"
FT                   /note="LysR, substrate-binding, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00573"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72929"
FT                   /db_xref="GOA:D2T3J4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3J4"
FT                   /protein_id="CAY72929.1"
FT                   /translation="MTMAKDRALTLEALRVMDAIDRRGSFAAAADELGRVPSALSYTMQ
FT                   KLEDELDVVLFDRSGHRTKFTHVGRMLLERGRVLLEAADKLTTDAEALARGWETHLTIA
FT                   TEALVSTERLFPLVEKLANKANTQLSLVKEVLAGAWERLEQGRADIVIAPDMHFRASSE
FT                   INTRKLFTLMSVYVASPDHPIHQEPEPLSEATRVKYRGIAVADTARERPVLTVTLLDKQ
FT                   QRLTVSSIEDKHRALLAGLGVGTMPYTMVEKDVAEGRLRVVSPEYKLEVDIIMAWRRDS
FT                   MGEAKAWCLREIPKLLARRQN"
FT   gene            complement(644924..645343)
FT                   /gene="yqjG"
FT                   /locus_tag="EPYR_00574"
FT   CDS_pept        complement(644924..645343)
FT                   /transl_table=11
FT                   /gene="yqjG"
FT                   /locus_tag="EPYR_00574"
FT                   /product="Uncharacterized protein yqjG"
FT                   /function="Predicted glutathione S-transferase"
FT                   /note="Glutathione S-transferase, C-terminal-like"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00574"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72930"
FT                   /db_xref="GOA:D2T3J5"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3J5"
FT                   /protein_id="CAY72930.1"
FT                   /translation="MLAHSASTACWVKTAKSATLTAIFLARAAGPAALAGRRPPHRSGY
FT                   RFVDHAGDFDPIEVTRFKYDRSCICDNLNLNVYLRNLYQTAALAATVNIDHISHHYYCS
FT                   HKTINPGGVFSLGSYHHQDKPHGRDRCFERWSAPC"
FT   gene            complement(645297..645689)
FT                   /gene="yqjF"
FT                   /locus_tag="EPYR_00575"
FT   CDS_pept        complement(645297..645689)
FT                   /transl_table=11
FT                   /gene="yqjF"
FT                   /locus_tag="EPYR_00575"
FT                   /product="Inner membrane protein yqjF"
FT                   /note="Surfeit locus 4-related, DoxX"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00575"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72931"
FT                   /db_xref="GOA:D2T3J6"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3J6"
FT                   /protein_id="CAY72931.1"
FT                   /translation="MKKCEDIGILVARILMPALFIYAGWGKISDYAGTQQYMAAMGVPG
FT                   FFLPLTILLELGGGLAILFGFLTRFTALFTAVFTLLTAFIFHTDFAQGVNSLMFMKNLS
FT                   IAGGFLLLSITGAGAFSIDRLLGKNG"
FT   gene            complement(645898..646179)
FT                   /gene="yqjK"
FT                   /locus_tag="EPYR_00576"
FT   CDS_pept        complement(645898..646179)
FT                   /transl_table=11
FT                   /gene="yqjK"
FT                   /locus_tag="EPYR_00576"
FT                   /product="Uncharacterized protein yqjK"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00576"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72932"
FT                   /db_xref="InterPro:IPR025612"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3J7"
FT                   /protein_id="CAY72932.1"
FT                   /translation="MSRKREARKAELLRQIQQQRLDLSAGRNAWLDSTARYDHGWLALL
FT                   SAKRWLALGGGMMAIWSVRNPRKITRWARRGLGAWSTWRMVRNYLPRR"
FT   gene            complement(646179..646571)
FT                   /gene="yqjE"
FT                   /locus_tag="EPYR_00577"
FT   CDS_pept        complement(646179..646571)
FT                   /transl_table=11
FT                   /gene="yqjE"
FT                   /locus_tag="EPYR_00577"
FT                   /product="Inner membrane protein yqjE"
FT                   /function="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00577"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72933"
FT                   /db_xref="GOA:D2T3J8"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3J8"
FT                   /protein_id="CAY72933.1"
FT                   /translation="MADHSQSHGPGKGVINIGQRIVTTLVGMVETRVRLAVVELEAEKA
FT                   NLLQMLLMVGLTMLFTAFGLMSLMVLIIWGIDAQYRLMAVAITTGVLFALALILGLWTL
FT                   VKSRRSTLLGATRKELSEDRKLLEGD"
FT   gene            complement(646573..646878)
FT                   /gene="yqjD"
FT                   /locus_tag="EPYR_00578"
FT   CDS_pept        complement(646573..646878)
FT                   /transl_table=11
FT                   /gene="yqjD"
FT                   /locus_tag="EPYR_00578"
FT                   /product="Uncharacterized protein yqjD"
FT                   /note="Protein of unknown function DUF883, ElaB,Bacterial
FT                   protein of unknown function (DUF883)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00578"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72934"
FT                   /db_xref="GOA:D2T3J9"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3J9"
FT                   /protein_id="CAY72934.1"
FT                   /translation="MSKDITSENLRAELKSLADTLEEVLSSSSEKSRSELDKLRSKAQS
FT                   ALKDTRARLGDSGDLIAQTTREAAGRADVYVRDNPWTSVGVGAAVGVVLGVLLTRR"
FT   gene            complement(646921..647295)
FT                   /gene="yqjC"
FT                   /locus_tag="EPYR_00579"
FT   CDS_pept        complement(646921..647295)
FT                   /transl_table=11
FT                   /gene="yqjC"
FT                   /locus_tag="EPYR_00579"
FT                   /product="Intersectin-1 (EH and SH3 domains protein 1)"
FT                   /note="Protein of unknown function DUF1090, Protein of
FT                   unknown function (DUF1090)"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00579"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72935"
FT                   /db_xref="InterPro:IPR009468"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3K0"
FT                   /protein_id="CAY72935.1"
FT                   /translation="MMKLYIIFSISLLTVGTFAHAGALCQQKEQAVQHEIDLAEKHDNK
FT                   HRITGLQQALSEIRANCRDNDLKKTQREKIRHHEQKVTERKHELQQEIAKAGSREKIDK
FT                   REKKLSEAQRELKKVLDAPY"
FT   gene            complement(647459..647851)
FT                   /gene="yqjB"
FT                   /locus_tag="EPYR_00580"
FT   CDS_pept        complement(647459..647851)
FT                   /transl_table=11
FT                   /gene="yqjB"
FT                   /locus_tag="EPYR_00580"
FT                   /product="Protein-export membrane protein secD"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00580"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72936"
FT                   /db_xref="GOA:D2T3K1"
FT                   /db_xref="InterPro:IPR026574"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3K1"
FT                   /protein_id="CAY72936.1"
FT                   /translation="MITALLKKCAPQRRFLPWLVVAIVALTGLAKIPALFRHDSTLQIR
FT                   ASRQGVSLPDGFYVYQTLSTQGIHIKSITPEQDSLVIRFDSPEQSCAAERVLRELFPQG
FT                   FDIAHQPGQGATSWINHISLLPQSVG"
FT   gene            complement(647848..648522)
FT                   /gene="yqjA"
FT                   /locus_tag="EPYR_00581"
FT   CDS_pept        complement(647848..648522)
FT                   /transl_table=11
FT                   /gene="yqjA"
FT                   /locus_tag="EPYR_00581"
FT                   /product="putative YdjX-Z family transporter"
FT                   /function="Uncharacterized membrane-associated protein"
FT                   /note="The YdjX-Z (YdjX-Z) Family, 9.B.27.2.2 Inner
FT                   membrane protein yqjA"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00581"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72937"
FT                   /db_xref="GOA:D2T3K2"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3K2"
FT                   /protein_id="CAY72937.1"
FT                   /translation="MDIFKSLVQALWQQDYAALADPSLVWAIYFVLFVILFLENGLLPA
FT                   AFLPGDSLLILVGVLIAKGTMSFTMTLFILTTAASLGCWISYIQGRWLGNTVTVQKWLS
FT                   HLPAHYHQRAHQMFHRHGLSALLIGRFIAFVRTLLPTIAGLSGLSNTRFQFFNWVSAFL
FT                   WVLILTVIGFAIGKTPIFRQYEDQLMFCLMLLPLVLLVFGLCGSLYVLWRKKRSDNEKG
FT                   NS"
FT   gene            648732..649007
FT                   /locus_tag="EPYR_00582"
FT   CDS_pept        648732..649007
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00582"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72938"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3K3"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72938.1"
FT                   /translation="MKFYRGGRPSERSFTQADITERILHREAYQAGGLSFFLPARGVIA
FT                   GEVRVFSKYGRVDMGFSFGRGEYSLHRGDIFRTVVCGARLLASLMF"
FT   gene            complement(649004..649132)
FT                   /locus_tag="EPYR_00583"
FT   CDS_pept        complement(649004..649132)
FT                   /transl_table=11
FT                   /locus_tag="EPYR_00583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00583"
FT                   /db_xref="EnsemblGenomes-Tr:CAY72939"
FT                   /db_xref="UniProtKB/TrEMBL:D2T3K4"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAY72939.1"
FT                   /translation="MKRKGFPHNGKPCMKALGACQNTRNPEKTRGFLLSASQRPNH"
FT   gene            complement(649164..650399)
FT                   /gene="sstT"
FT                   /locus_tag="EPYR_00584"
FT   CDS_pept        complement(649164..650399)
FT                   /transl_table=11
FT                   /gene="sstT"
FT                   /locus_tag="EPYR_00584"
FT                   /product="putative DAACS family transporter"
FT                   /function="Na+/serine symporter"
FT                   /note="The Dicarboxylate/Amino Acid:Cation (Na+ or H+)
FT                   Symporter (DAACS) Family, TC 2.A.23.4.1
FT                   Serine/threonine:Na+ symporter, SstT"
FT                   /db_xref="EnsemblGenomes-Gn:EPYR_00584"
FT                   /db_xref="EnsemblGe