(data stored in ACNUC16935 zone)

EMBL: FN392320

ID   FN392320; SV 1; linear; genomic DNA; STD; FUN; 2394163 BP.
XX
AC   FN392320;
XX
PR   Project:PRJEA37871;
XX
DT   25-MAY-2009 (Rel. 100, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   Pichia pastoris GS115 chromosome 2, complete sequence
XX
KW   .
XX
OS   Komagataella phaffii GS115
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Phaffomycetaceae; Komagataella.
XX
RN   [1]
RP   1-2394163
RA   Callewaert N.;
RT   ;
RL   Submitted (05-MAY-2009) to the INSDC.
RL   Callewaert N., Department for Molecular Biomedical Research, Flanders
RL   Institute for Biotechnology (VIB) / Gent University, Technologiepark 927,
RL   Ghent, 9052, BELGIUM.
XX
RN   [2]
RX   DOI; 10.1038/nbt.1544.
RX   PUBMED; 19465926.
RA   De Schutter K., Lin Y.C., Tiels P., Van Hecke A., Glinka S.,
RA   Weber-Lehmann J., Rouze P., Van de Peer Y., Callewaert N.;
RT   "Genome sequence of the recombinant protein production host Pichia
RT   pastoris";
RL   Nat. Biotechnol. 27(6):561-566(2009).
XX
DR   MD5; 8d8b676d1cd3f65338ecb78b2cddbc3f.
DR   BioSample; SAMEA2272385.
DR   EnsemblGenomes-Gn; EFKPAG00000000009.
DR   EnsemblGenomes-Gn; EFKPAG00000000018.
DR   EnsemblGenomes-Gn; EFKPAG00000000020.
DR   EnsemblGenomes-Gn; EFKPAG00000000031.
DR   EnsemblGenomes-Gn; EFKPAG00000000033.
DR   EnsemblGenomes-Gn; EFKPAG00000000035.
DR   EnsemblGenomes-Gn; EFKPAG00000000037.
DR   EnsemblGenomes-Gn; EFKPAG00000000045.
DR   EnsemblGenomes-Gn; EFKPAG00000000048.
DR   EnsemblGenomes-Gn; EFKPAG00000000049.
DR   EnsemblGenomes-Gn; EFKPAG00000000051.
DR   EnsemblGenomes-Gn; EFKPAG00000000055.
DR   EnsemblGenomes-Gn; EFKPAG00000000065.
DR   EnsemblGenomes-Gn; EFKPAG00000000068.
DR   EnsemblGenomes-Gn; EFKPAG00000000071.
DR   EnsemblGenomes-Gn; EFKPAG00000000074.
DR   EnsemblGenomes-Gn; EFKPAG00000000080.
DR   EnsemblGenomes-Gn; EFKPAG00000000081.
DR   EnsemblGenomes-Gn; EFKPAG00000000086.
DR   EnsemblGenomes-Gn; EFKPAG00000000098.
DR   EnsemblGenomes-Gn; EFKPAG00000000101.
DR   EnsemblGenomes-Gn; EFKPAG00000000102.
DR   EnsemblGenomes-Gn; EFKPAG00000000107.
DR   EnsemblGenomes-Gn; EFKPAG00000000111.
DR   EnsemblGenomes-Gn; EFKPAG00000000126.
DR   EnsemblGenomes-Gn; EFKPAG00000000130.
DR   EnsemblGenomes-Gn; EFKPAG00000000138.
DR   EnsemblGenomes-Gn; EFKPAG00000000149.
DR   EnsemblGenomes-Gn; EFKPAG00000000169.
DR   EnsemblGenomes-Gn; EFKPAG00000000179.
DR   EnsemblGenomes-Gn; ENSRNA049509069.
DR   EnsemblGenomes-Gn; ENSRNA049509083.
DR   EnsemblGenomes-Gn; ENSRNA049509089.
DR   EnsemblGenomes-Gn; ENSRNA049509095.
DR   EnsemblGenomes-Gn; ENSRNA049509120.
DR   EnsemblGenomes-Gn; ENSRNA049509146.
DR   EnsemblGenomes-Gn; ENSRNA049509155.
DR   EnsemblGenomes-Gn; ENSRNA049567197.
DR   EnsemblGenomes-Gn; ENSRNA049567260.
DR   EnsemblGenomes-Gn; ENSRNA049567311.
DR   EnsemblGenomes-Gn; ENSRNA049567426.
DR   EnsemblGenomes-Gn; ENSRNA049567550.
DR   EnsemblGenomes-Gn; ENSRNA049567643.
DR   EnsemblGenomes-Gn; ENSRNA049567748.
DR   EnsemblGenomes-Gn; ENSRNA049567805.
DR   EnsemblGenomes-Gn; ENSRNA049567843.
DR   EnsemblGenomes-Gn; ENSRNA049567910.
DR   EnsemblGenomes-Gn; ENSRNA049567986.
DR   EnsemblGenomes-Gn; ENSRNA049568045.
DR   EnsemblGenomes-Gn; ENSRNA049568094.
DR   EnsemblGenomes-Gn; ENSRNA049568153.
DR   EnsemblGenomes-Gn; ENSRNA049568222.
DR   EnsemblGenomes-Gn; ENSRNA049568293.
DR   EnsemblGenomes-Tr; EFKPAT00000000009.
DR   EnsemblGenomes-Tr; EFKPAT00000000018.
DR   EnsemblGenomes-Tr; EFKPAT00000000020.
DR   EnsemblGenomes-Tr; EFKPAT00000000031.
DR   EnsemblGenomes-Tr; EFKPAT00000000033.
DR   EnsemblGenomes-Tr; EFKPAT00000000035.
DR   EnsemblGenomes-Tr; EFKPAT00000000037.
DR   EnsemblGenomes-Tr; EFKPAT00000000045.
DR   EnsemblGenomes-Tr; EFKPAT00000000048.
DR   EnsemblGenomes-Tr; EFKPAT00000000049.
DR   EnsemblGenomes-Tr; EFKPAT00000000051.
DR   EnsemblGenomes-Tr; EFKPAT00000000055.
DR   EnsemblGenomes-Tr; EFKPAT00000000065.
DR   EnsemblGenomes-Tr; EFKPAT00000000068.
DR   EnsemblGenomes-Tr; EFKPAT00000000071.
DR   EnsemblGenomes-Tr; EFKPAT00000000074.
DR   EnsemblGenomes-Tr; EFKPAT00000000080.
DR   EnsemblGenomes-Tr; EFKPAT00000000081.
DR   EnsemblGenomes-Tr; EFKPAT00000000086.
DR   EnsemblGenomes-Tr; EFKPAT00000000098.
DR   EnsemblGenomes-Tr; EFKPAT00000000101.
DR   EnsemblGenomes-Tr; EFKPAT00000000102.
DR   EnsemblGenomes-Tr; EFKPAT00000000107.
DR   EnsemblGenomes-Tr; EFKPAT00000000111.
DR   EnsemblGenomes-Tr; EFKPAT00000000126.
DR   EnsemblGenomes-Tr; EFKPAT00000000130.
DR   EnsemblGenomes-Tr; EFKPAT00000000138.
DR   EnsemblGenomes-Tr; EFKPAT00000000149.
DR   EnsemblGenomes-Tr; EFKPAT00000000169.
DR   EnsemblGenomes-Tr; EFKPAT00000000179.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00004; U2.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00020; U5.
DR   RFAM; RF00030; RNase_MRP.
DR   RFAM; RF00093; SNORD18.
DR   RFAM; RF00472; snosnR55.
DR   RFAM; RF00476; snosnR61.
DR   RFAM; RF01184; snR79.
DR   RFAM; RF01255; snR35.
DR   RFAM; RF01265; snR42.
DR   StrainInfo; 594005; 0.
XX
CC   Contact: Nico Callewaert
CC   Unit for Molecular Glycobiology
CC   Laboratory for Protein Biochemistry and Biomolecular Engineering
CC   Department of Biochemistry, Physiology and Microbiology, UGent
CC   VIB Department for Molecular Biomedical Research, UGent
CC   Technologiepark 927, B-9052 Gent, Belgium
CC   Tel: (32)93313630
CC   Fax: (32)93313609
CC   Email: nico.callewaert@dmbr.vib-UGent.be
CC   ----------- sequencing/assembly
CC   Unit for Molecular Glycobiology
CC   Laboratory for Protein Biochemistry and Biomolecular Engineering
CC   Department of Biochemistry, Physiology and Microbiology, UGent
CC   VIB Department for Molecular Biomedical Research, UGent
CC   ----------- annotation
CC   Unit for Molecular Glycobiology
CC   Laboratory for Protein Biochemistry and Biomolecular Engineering
CC   Department of Biochemistry, Physiology and Microbiology, UGent
CC   VIB Department for Molecular Biomedical Research, UGent
CC
CC   Laboratory for Bioinformatics and Evolutionary Genomics
CC   VIB Department of Plant Systems Biology, UGent
CC   Web site: http://bioinformatics.psb.ugent.be/
CC   Bioinformatics Online Genome Annotation System (BOGAS):
CC   http://bioinformatics.psb.ugent.be/webtools/bogas/
CC   -----------
CC   * NOTE: finishing of chromosomes in process
CC   * Final curation of the annotation in progress
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2394163
FT                   /organism="Komagataella phaffii GS115"
FT                   /chromosome="2"
FT                   /strain="GS115"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:644223"
FT   CDS_pept        complement(266..913)
FT                   /locus_tag="PAS_chr2-1_0002"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68601"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZC7"
FT                   /protein_id="CAY68601.1"
FT                   /translation="MMASPTAGDHPAGDGPASGAQLGGEAGGATGEVSQVFQVRASASA
FT                   SPGGTVLEVEVSREDFQGESQVQEDTSQIQVVNGTAHCRECICGRQATGAEQDRAACWT
FT                   QQGGSVGVRRGVVDWWRFASTNQRCCGCLVRLVGGWLVEICVHQPALLRYAWWALTGGD
FT                   LRPPTSVAALAWWALTGGYLRPPTSVAALAWWALTGGYLRPPTSVAALAWWD"
FT   CDS_pept        2666..2827
FT                   /locus_tag="PAS_chr2-1_0003"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68602"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZC8"
FT                   /protein_id="CAY68602.1"
FT                   /translation="MRRNYVCGDVLTLGQVASSKSNFDEMSSYQRLQGLDLMLARRKTK
FT                   CCILMHWG"
FT   CDS_pept        4976..5725
FT                   /locus_tag="PAS_chr2-1_0004"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68603"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZC9"
FT                   /protein_id="CAY68603.1"
FT                   /translation="MTAMKQKRSRDILKPYHFDPSIDDTMLCSMLPPTTTADPEQLQEP
FT                   EHEQQQHNNPFNCCQEVKVKMADQQKLYLLPEKRTNNIFNSKSAMFVYCNIPQMSLVQS
FT                   FLDLNTSLLATDVTLDRNSFSLDSTIDIPFDQSVQDPYSYRSNSPEVAPQSTACFSVNS
FT                   NLAPVETFTTLLEAAVNSKRQMLQYRQQIKINGLNFSESTFLDHSCILLVRGRSFGGNC
FT                   SRPPKTPLIPGTRSVCYCPSKTGEQYK"
FT   CDS_pept        7508..8287
FT                   /locus_tag="PAS_chr2-1_0005"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68604"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZD0"
FT                   /protein_id="CAY68604.1"
FT                   /translation="MKIHSLLLWNLFFIPSILGQNFTLKLSALAPVSSNYVGNTTENYE
FT                   VAIYNPEVGGLPSQSIGVWFKDGKLLRSTLEQRVWDIYFTPPDSEGRVYVYRASDGQYY
FT                   GLLRFLGDRTNEVPYLGQRHQLGVVYGSDDRRYASEPTRFALEEDGQLRLTEYAGSTTN
FT                   NNTISACYAFSVYSTDEQYVIIAGEITSTLFYHCEPIVLSAVSTNLPSMDAKNPKRLFQ
FT                   RSESPSMTSSQNGGASTSRFSRFLGAAAVLLLNMFFI"
FT   CDS_pept        complement(9189..10913)
FT                   /locus_tag="PAS_chr2-1_0006"
FT                   /product="High-affinity glucose transporter of the major
FT                   facilitator superfamily, expression is induced by low"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68605"
FT                   /db_xref="GOA:C4QZD1"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZD1"
FT                   /protein_id="CAY68605.1"
FT                   /translation="MSFFHKFYNAGDAPPQIFNKTLYLAVFIFGVLGCARGYDEGYIGG
FT                   IEAKAPFQSQFGLDDLTKSETELANLRSNIAAMVQLGSIGGCLLAMYLVDKFGRIRTLQ
FT                   GVCVGWIVGSVIQITSKNVGQLYAGRLIEGLSIGQTVVIGPCYMSEIAPKNIRGLCTCI
FT                   FAGSVYLGSMLSNFINYGCALHLPTDSPKQWIVPTAIKIVIAGLLAIGSLLCHESPRWL
FT                   VKQGLINESGTVLSKIRHLPSTHPYILCEVGDIQEQIDIEDEATQSVSKWHVFKELIMV
FT                   KSIRYRMLLALSAQVLSQWSFAGSITVYFPELVALAGVRGTDRLLYSSILGVVKLTSAY
FT                   LGAFFVIDLLGRKKALYIGITIQMLATLYFAIFLQIIPDAIEDDVQLTGSRKHAGLGAL
FT                   AMLYITGVGWTLGWNSIQYLINAEMLPLRVRNIGTATIMAFHFANQYGNTKALPSMLIS
FT                   LTPAGTFFFGVGVLALGLLWAFFFLPEIAGRSLESMEDLFNLPWYLIGRRGAELCPDNS
FT                   GIAHVKEAESGELDIKQNDEFIENASDQSVDDTMTSKQKKGKSLCNQEFIPQIPPCA"
FT   CDS_pept        complement(join(11580..11679,12583..12767))
FT                   /locus_tag="PAS_chr2-1_0007"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68606"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZD2"
FT                   /protein_id="CAY68606.1"
FT                   /translation="MSAMNSDMPSMKKTDMSSVKKSDMSAMNSDMPSMKKSDMSAMNSD
FT                   MPSIKKSDMSAMNSVTIGDDLKKSESWSAWTLARSAKAESLKLMRKNLK"
FT   CDS_pept        13442..13843
FT                   /locus_tag="PAS_chr2-1_0008"
FT                   /product="Putative protein-methionine-R-oxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68607"
FT                   /db_xref="GOA:C4QZD3"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZD3"
FT                   /protein_id="CAY68607.1"
FT                   /translation="MTNWKAILTPAQYRVLRLGGTETPHTGQYVNFKESGTYLCGGCQT
FT                   PLYKSSTKFDSSCGWPAFYEALPGAVTRIEDNSLGMRGIEIRCSQCDGHLGHVFEGEGY
FT                   DTPTDSRHCVNSISLKFQGEGEDEENTTK"
FT   CDS_pept        complement(join(14152..14390,14621..15947))
FT                   /locus_tag="PAS_chr2-1_0009"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68608"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZD4"
FT                   /protein_id="CAY68608.1"
FT                   /translation="MLTAGSVQRLQISMFQTQEQEQVDLSSSIHTENIFNSESSGPAYP
FT                   NIPQISSVHSFIGAKSSLLADAAPNQCLSFVDSAKVTSFDQSFHGSPSYKLNSAKLAVS
FT                   SSEYLSVESSTEVDSTISLEAQVDRKRQKIQPERHSKTDNLNLFSDFDLLAPAFLTYYL
FT                   PLFRGCSSGGNNKPPKKRSITGTQYVAASLRLESSTIEDICLPKWNENELKDNRRIIRI
FT                   ERRQQGNEIAASFSIVGSALENPHTKPTLDPDVEVLEVSCLRCLVNYDEIDDKQTVHGS
FT                   LLHEVQSEFTEIRKQESTGKRSSYACTSNGTSIECQYYVTSVEVIKIIELLVGSHLIQD
FT                   RKQRRKERGCIRSNLMPFWSKHLISSTTNTMKRRSVTASNENYIAELAHRIKTYEVRRP
FT                   RKVNKDLRILEWSKLGPALRRALHSYYVAVPIDKFKNIAKPTNTSLGTIKMAIAGRSEV
FT                   LETVFIARQSPVEPDACSSIANVRRELCDACTGTQANIVTEKILLTTIAADAGSTIVVP
FT                   VCVP"
FT   CDS_pept        16001..16264
FT                   /locus_tag="PAS_chr2-1_0010"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68609"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZD5"
FT                   /protein_id="CAY68609.1"
FT                   /translation="MLDAESCRIRNCIANSWRNWSSVVEVATFAFELIPTRRYILSRLI
FT                   QLDVLIYYVFSVTQYAFKSQPPCFQHEAEPFAICPPPLSALK"
FT   CDS_pept        complement(19388..21388)
FT                   /locus_tag="PAS_chr2-1_0011"
FT                   /product="ATPase of the ATP-binding cassette (ABC) family
FT                   involved in 40S and 60S ribosome biogenesis, has sim"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68610"
FT                   /db_xref="GOA:C4QZD6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZD6"
FT                   /protein_id="CAY68610.1"
FT                   /translation="MNTETLSRTELIVQGGHNVIIYNEAKKLKAEVILNNAQGVGKHYK
FT                   DLDVSMDGADLSYVRSLGPESQTLHVDVCLDKHGEPVKLVICKNASPFVNVEKVSQENL
FT                   PEKELEKQLLKSSLSPLHGYGIYYRDFVSSSGTIGISVCNLDLSFEKKCLFAGLDFSLS
FT                   LGDKVTIVGDNGSGKTTFLKLISGIEEYTYSGSVVIEGRIAYLPQHFEDVSGDDLAIVT
FT                   LLRSLYDPDIDEFLTKPHKPFASEWLQELNTLGGHETFKQANHIGLSTDLLKMPFKFLS
FT                   GGEKTKVMLCALSILEPDIILLDEPTNCLDWRGIEWLESFLKNFDGGVVMVTHDRSLIN
FT                   AVSNRISELSPHTKKFTHFKGQYKHYVEEEDKRWQRQIEERKHQEKELKKLTLKANQAK
FT                   GKVKSRIVRSGTDRDKLSYNNKEQRAQKGVNRAFAQLSDKVEQLTDDLVDVIPERRHIS
FT                   FDFEDSPAFSASILNIEVSKVSKSFESPLFENISFTLSKGDRLIIQGPNGSGKSTLMKI
FT                   IMSLIKPDEGSVTISGNAKIGYLDQEQESLPLDKSPISLLKKDSSINATDANAITNLRN
FT                   FGIYTWHDLKNSLRTLSIGCRRKAQLCQLILRGSSILLLDEPSNHIDFPSLEFIEDALL
FT                   TFPGIIIAATHDRYFTEKVGTRILDLADYKA"
FT   CDS_pept        complement(22768..24690)
FT                   /locus_tag="PAS_chr2-1_0012"
FT                   /product="Ferrioxamine B transporter, member of the ARN
FT                   family of transporters that specifically recognize sid"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68611"
FT                   /db_xref="GOA:C4QZD7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZD7"
FT                   /protein_id="CAY68611.1"
FT                   /translation="MKFNIFNKNRKESPSSSPESQTTDEEAHIPVLPGVARAEMLRHAW
FT                   SKKSLIVAYAALFFAAFVFQFCGVTVKSYTPYATSSFRQHSMLTTAAVVYKIVCVITLP
FT                   FVARIADCFSRVSGFFIALIFLIATYIMFAASKNVGMYLASEIFLGIGKVSYVMMEKVF
FT                   VADTTQILNRGLWTALPTAVASIPTLYISSIVAEKVLDHSTWRWGYGMWAIITPVSLAP
FT                   LIFIMWRLDRKAQKYGITHNIKASLNLPEGSWYKKLAHLLYVELDIVGGLLMLAGLSLF
FT                   FLPFTLTGSASILDWDEATTIVLLVLGFVVLGIFVFWVLSKFPQRPFISVSILKNPSVL
FT                   MACTLPLFDTINSSTSGAYYSSVLQVSGHFTVGEAARITRASRVCQLVGSVLVGILIKY
FT                   TRTAKIFMISGISLIVITQGFFCYLSDHNGQFGSELHWTVIQVFEGFGRGFYNIPTIIS
FT                   VQANSDPSQIAPSIAMFTMFSQMGAVIGNSIAASVWNELVIKRLTQYLPEGSKSSATSI
FT                   FGSIKVALGYKQGTPEREAIDRAYREVLQKQGYISLGFLLPALIIVFFIKGFDPTQRTS
FT                   VNVDDNGEVVLRTATGKNGEGPQFHTISSNLSSSSSASDLSEEKDGTSAASKEKNSLST
FT                   EPERK"
FT   CDS_pept        complement(25107..25298)
FT                   /locus_tag="PAS_chr2-1_0013"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68612"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZD8"
FT                   /protein_id="CAY68612.1"
FT                   /translation="MLFHLLLSKNLKIRSDRSSWHSREPLIPLLDCKVTGTGQKYPYMY
FT                   KTLFKFTEGHMAYSGLSY"
FT   CDS_pept        complement(28006..29259)
FT                   /locus_tag="PAS_chr2-1_0014"
FT                   /product="Fe(II)-dependent sulfonate/alpha-ketoglutarate
FT                   dioxygenase, involved in sulfonate catabolism for use"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68613"
FT                   /db_xref="GOA:C4QZD9"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZD9"
FT                   /protein_id="CAY68613.1"
FT                   /translation="MSASIKPSPVEDKGKAVKYEKNIWRFDDAIHFSPSSDIVREDGVL
FT                   TVSKKAQETSNYPQWLPTWDPKLSFEDEPPFSHVDRGFFADPGLKRLFPEGGAHKISNI
FT                   TPKLGSKVEGVQLSQLTPDQKDDLALFVAQRGVVVFRDQDLRDKDLGEVKKFGQHFGPL
FT                   HIHQTSGAPEGYPEFHITFKRAGPPNTFRNKISAPGWHSDVTYELQPAGITFFGLIEGP
FT                   EAGGDTLFADAIEAYERLSPSFQKFLDGLRLIHSARAQAEDSLKKGSIQRKKFTSETVH
FT                   PLIRYHPVLNKRSIFAKAFGTKIVGLKQEESDLILNFIQRFIATALDLQLRASYEPGTV
FT                   VAWDNRRVFHSAVNDFGEDDPARHCFRITPLAERPVGSKEEYESWSPNGRERTVEEWED
FT                   LYKDGIPNLKEIFLGNLD"
FT   CDS_pept        complement(30119..30256)
FT                   /locus_tag="PAS_chr2-1_0015"
FT                   /product="Putative protein of unknown function identified
FT                   by fungal homology comparisons and RT-PCR"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68614"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZE0"
FT                   /protein_id="CAY68614.1"
FT                   /translation="MKVSSPNAKKEIAAPEFRVWSPTTLLGQALSSLTTVDRTGNGAFC
FT                   "
FT   CDS_pept        32010..32696
FT                   /locus_tag="PAS_chr2-1_0016"
FT                   /product="2-deoxyglucose-6-phosphate phosphatase, similar
FT                   to Dog2p, member of a family of low molecular weight"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68615"
FT                   /db_xref="GOA:C4QZE1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZE1"
FT                   /protein_id="CAY68615.1"
FT                   /translation="MVSIPCDLCLFDLDGTLVLSTKAIEKGWESVFSEYNVNYNMEEFL
FT                   QNNHGVRTGDSFDRWLPQIDNTNSKAGDEFEKRISIEYADLAEPVPGAPQLLNSIPKDH
FT                   WLVVTSGTPLLANGWFSKVLAKFGVTKPEIFVTGQSVSNGKPHPEPYLKGLALWTEKYG
FT                   KKPAHPIVFEDAPNGIKAGTASGCTVIGIASSFGKEVLQAAGATYVVQDLSHVKFHDNT
FT                   LDIDNL"
FT   CDS_pept        complement(32786..34195)
FT                   /locus_tag="PAS_chr2-1_0017"
FT                   /product="Heme-dependent repressor of hypoxic genes"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68616"
FT                   /db_xref="GOA:C4QZE2"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR036910"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZE2"
FT                   /protein_id="CAY68616.1"
FT                   /translation="MNEKDKVSNSLPPLSHLMPMNSMGMKNEITSENGSSVGTTNGMVP
FT                   TAKHSSSASTPLTSVHNNNDESNNGNIGSHANSFNNANGKASGSPNFHTVSANYPPEEP
FT                   KYYYSTESQVASQVASQLMAVPQMPGQLYPQGMSTQFVYPQMVPAPPPPPQPPQIDQNK
FT                   LYEKCSCKNSTNRIPRPRNAFILFRQKNHQALLEEGNVIRTNPEVSRELGRRWRNLSPE
FT                   EKSYWNKSAEEEKRRHAERYPGYKYTPRRSSKKNCPSCKAKQAMKTHSLNVQSYYAQYP
FT                   SASTAVPVPMSNSQKNMNNHTAQMQQYQQMHIQSSPPMQTQYQQVNTMQHGMIPQYQQI
FT                   PSTQGHQFIQPQQHPQPQIHPQFDGSQFPQTYMVAMPKGNSNEAALAQQLPVVEQPTLF
FT                   SNDRTGRSGTLRKLVATPLPGMNGSTNPQSIVSNTVVPDSYHQTQLVASGQKALPSINN
FT                   LKNPISYSEVQ"
FT   CDS_pept        complement(35927..36112)
FT                   /locus_tag="PAS_chr2-1_0018"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68617"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZE3"
FT                   /protein_id="CAY68617.1"
FT                   /translation="MASRLFKHKALQLTIASRDSSLLAEAILESILKKSTMSAVTFSEF
FT                   EPDQVSTGVGYLFIFR"
FT   CDS_pept        complement(37204..37398)
FT                   /locus_tag="PAS_chr2-1_0019"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68618"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZE4"
FT                   /protein_id="CAY68618.1"
FT                   /translation="MSCCCINNLALEDVVVALKICPVISAFLGRHPHPRNSAFYRLLKE
FT                   KFKVQVVAQLLGVAHSFEY"
FT   CDS_pept        complement(join(37498..37643,37946..38027))
FT                   /locus_tag="PAS_chr2-1_0020"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68619"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZE5"
FT                   /protein_id="CAY68619.1"
FT                   /translation="MRAKAGEFWKVKAEACDLSKLIVALQKARSIFASYCWLPNISGIA
FT                   RSRFVVGRSIHWEYQPKYRKVMSMNVEATI"
FT   CDS_pept        complement(join(38470..39155,39579..39639))
FT                   /locus_tag="PAS_chr2-1_0021"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68620"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR013899"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZE6"
FT                   /protein_id="CAY68620.1"
FT                   /translation="MWDDKLGCFFKLNARSSAPSADGQVDYNHSSDKEYVRLRGLADQA
FT                   HKRRTELSKQSQEAYQSGDGERAHQLSVKAKEYLAQADQYNRQAAEYVFVENNADSEDH
FT                   EIDLHGLYVREAEYIVKQRISAAVQRGEKRLSIIVGKGNHSTDGVAKLKPAVEKLCEEA
FT                   GLHHEVSKKNAGVIEVDLSEPSRIPASWGQQSSEPQYAQSHAIPTGVYNQQQQQSAPQQ
FT                   QSASSGSSIDWKLVVRVVKSIIRCFK"
FT   CDS_pept        join(40239..40343,40425..41054)
FT                   /locus_tag="PAS_chr2-1_0022"
FT                   /product="Protein component of the large (60S) ribosomal
FT                   subunit, nearly identical to Rpl7Ap and has similarit"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68621"
FT                   /db_xref="InterPro:IPR005998"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR023106"
FT                   /db_xref="InterPro:IPR035808"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="InterPro:IPR039699"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZE7"
FT                   /protein_id="CAY68621.1"
FT                   /translation="MPQKTTSKYLLMIPIFNRLAFGQCCRFVNHLSGLKLDEEKKAIIS
FT                   ERTAKYYEEYEEAARVLEKAKSDAAASGSYFVEAEPNLVLVVRIKGINKIAPKPRKVLQ
FT                   LLRLLQINAAVFVRITKATAELLRLVEPYVAYGYPSLETVRELIYKRGYGKLNKQRVPL
FT                   TDNDIIEKVLGQYGIISIEDLIHEIYTVGPNFKQANNFLYPFRLSNPDGGWGVRRKFFH
FT                   YIQGGATGNREEHINSLVKKMN"
FT   CDS_pept        complement(41115..41558)
FT                   /locus_tag="PAS_chr2-1_0023"
FT                   /product="Protein of unknown function that may interact
FT                   with ribosomes, based on co-purification experiments"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68622"
FT                   /db_xref="InterPro:IPR008476"
FT                   /db_xref="InterPro:IPR021148"
FT                   /db_xref="InterPro:IPR023139"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZE8"
FT                   /protein_id="CAY68622.1"
FT                   /translation="MSLSTFNAEEAENLDDIEKQFAVKAVTQAETYWNLLTKIPGTKLK
FT                   LTPYDDEIFEALLKDFPEFENPEYASKINEDEMKSLSGKERWRKFMKPFEEKIDDFNFG
FT                   TLLRTDSSKEYDQEGTIFVVRLQFYAIEIARNKYGLNDWISQK"
FT   CDS_pept        42106..42966
FT                   /locus_tag="PAS_chr2-1_0024"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68623"
FT                   /db_xref="GOA:C4QZE9"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZE9"
FT                   /protein_id="CAY68623.1"
FT                   /translation="MLNSLRRMSIKSAGCIIIGDEVLNSKITDTNSRFFAKYCYDLGVD
FT                   LRKISIISDEEDEIIATVKEFDSKFDFIVTSGGIGPTHDDITYSSIAKAYGLSLKHDQF
FT                   AYDKCLEKIGDKIKFNTFTQEQIDANLRMFLLPYDPNDSNFVKTYYANDLWVPIVNINN
FT                   KLNILPGIPRLFQELLTDGITPHVKPFVPKTKFLQYYVAARLPESQVAPLLGRLQKEVI
FT                   EKGLSIKIGSYPHVEKRINTVCITGKEEENEVMRQLVATTIEELGGEEISKEEEEGHSH
FT                   SHIKE"
FT   CDS_pept        complement(42994..44400)
FT                   /locus_tag="PAS_chr2-1_0806"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0806"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68624"
FT                   /db_xref="GOA:C4QZF0"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZF0"
FT                   /protein_id="CAY68624.1"
FT                   /translation="MRPRVIDQTLLRRNLIRSQGISASNINQMYTRWFHHDILLNHNHS
FT                   HNQTQNQTHTDQLGKEKQPSQGEPDEILPPLKRNKSVFSHVKDFFNPHLPISHLQGPNS
FT                   GSHSQTHTESSFSSLTHSHSHGHVEADRAMLSKEGKRITWIGLGVNSSMAVGKFLGGIY
FT                   FHSQALLADAVHAVGDLISDVLTLLTVSFSNQVPNKLYPYGFGKVETLGSMLVSSILLY
FT                   AGVSIGWSSLIEIIGPALPHSIVDTLSSLTHSHSHSHAVSAAVTDEQGTQVTEVADINA
FT                   AWLALGSVFVKEWLFKATKRVGEKLDSQVLIANAWHHRVDSLTSIVALVTISGGYFLNI
FT                   YWLDPVGGLLVSMLVIKVGLAGTFQAFKELIDKAVSPTDPRYVNIENSINVSLMKHQPE
FT                   LLIKKLDVLPSGTNVVANVSLGVGPSHSSYENVLTLGQVASLSEKLEADLNTQHANLKK
FT                   VLVTFENAKK"
FT   CDS_pept        complement(44617..49095)
FT                   /locus_tag="PAS_chr2-1_0025"
FT                   /product="Non-essential protein of unknown function,
FT                   contains ATP/GTP-binding site motif A"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68625"
FT                   /db_xref="GOA:C4QZF1"
FT                   /db_xref="InterPro:IPR001606"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR003349"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013637"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR036431"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZF1"
FT                   /protein_id="CAY68625.1"
FT                   /translation="MDIENSQTSKVDPGSSPSSFSKQNAAPNADSDDISQTNTSRSSKL
FT                   HEQEPPLSNGSELGSPPLSSGPTTFYTHSTTAPPKTTRFYKTLADGYRVSDSNSTHHYN
FT                   PYLYPQHRTRANPPLESINMKGRSTHSSTNPLYPPIPTFTISSQEMENPYKFIESIRAE
FT                   GEKYGAVRVILENWEHKLNINTELFWFRARRQLLNSHKSEVEARMEFHQSLASFLRENK
FT                   ITISKLPSIDKRSLDLYRLRVCVKLRGGYDTVCQKKLWAQIGRELGYSGKITSSLSSSL
FT                   KSAYHKVLYGYDLHIAKLEEEQKNVDYKKDKETSPPPVNGSVQNGSSGSRKHETASTDD
FT                   PPTKKLKTDESSEDIPIIIGSAIEYKRSRDKLQKLGFPTYFDMMTDNRSGITFDDEQTL
FT                   ATYDFYNWHKGMNVDDVSAYDSKLSPLYNLRQFFDKNLKFQELLFERFKVAFNPTPNDL
FT                   EKLYWTVVKDKDSSYEVECSVRIPTSVHESGFNKNEKLQNHVKENTNQNGSPPDTHGLW
FT                   NLNNFFENQSSVLRYLPQFNSISKPTLSIGMMFGTQNWVAEDHYLYLCDYHHIGDTKVW
FT                   YFIPPKDHLKYEALLKEHLKNNTPSETQPDFQIYQKDFKNSDFVQCTLENKIPTSRNHR
FT                   RFSHKNAAFQPLLKDQDEKVLYSQDFFLTPEFLKEKGVDVYSCYQEPGEFIFKFPKAYS
FT                   STVFLGFSTSESVNFAPPSWLSKGLEAEKWLQEQNVYPLFSMFQLLLSIAKECTDPTIL
FT                   KESLDMYKPLLNKVLKERKEVRQHFPKTNEFINKNASSYITDALENSFPSKIVIIHNNT
FT                   EISLPLEKALERKDYINALLKQNAVLELHLFEPDESLIQAMGLFATYNQTPLEWYEKLE
FT                   DKLTASSQPNISILQELYLEGKKVLAIHNNIPEKAKKGFESLESFVLDANDWLDQVRGF
FT                   LKVSDPISESKDLLVDKHQLTSHSLEEFTLLLARIPNLRFEAKEIDELLQYGKLVEEFE
FT                   IQFRKLLLDQEQKVSISVIDSLVKKGKQFSVNLPSVDCLEKLIRRKKWYLAAENVSVHT
FT                   SLSDLQHLVQEGEQILDEHDRALKLEPLTKYFKGSQLYNKELEEFIKLKPIGGYDVDKL
FT                   KELYDRKDRFSVQSEDLRKFITEKNERKQILDEWLQAVQPKIDQLKNLRKQKQSAEQKL
FT                   ANNIELSEKEKKLLESYKVTGKQNIFLKEFEFGPKIFEGKEIIEKASGLNVNVAFFKEQ
FT                   VKKTQEWASQVQNVLKINKEQLKHRFKQWRNLYLNMYNLDDGQSELFCFCREADSGVMV
FT                   ECDECKEWFHLKCLKMNDNKPGNNEIFVCPFCDLDQSRKSTEEFFLAVEKKPKFEQIRQ
FT                   LDTVSESLIFYPEGFGHFKLLMLEVYKFLQIANRELLLGVEKPRARFLIRKFVSGPFVM
FT                   EREWEAFGDLIGKRTKEGSKGSVVKQSTLDKSTVAGNAGKVLENGAMPDAGSTENTEEG
FT                   QGSNGTGSTKIKVESQNDSFESPIKVENEQS"
FT   CDS_pept        49531..51141
FT                   /locus_tag="PAS_chr2-1_0026"
FT                   /product="Trimeric heat shock transcription factor,
FT                   activates multiple genes in response to stresses that incl"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68626"
FT                   /db_xref="GOA:C4QZF2"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR027725"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZF2"
FT                   /protein_id="CAY68626.1"
FT                   /translation="MSDFPKVEQASPSEGMPQVQTNNAPEIEEIEDIIRDTPNVMDVLG
FT                   NGSQSWDGTNSNGAAMGSLDTVPANKLVAYNKYDNNIYPDPLQPLSDTALPNSMGYYSM
FT                   IKAGDKGLKPQSFRKTKKKPTPSGPKTRPAFVMKLWNMVHDPSNQAFIRWLPDGKSFQV
FT                   TNREDFLKHVLPKYFKHNNFASFVRQLNMYGWHKVQDVGNGSLTANEELWQFENPNFIR
FT                   DREDLLDQIVRNKSKPGEDDENIDFGLVLNELETIKMNQMAISEDLRRIRQDNETLWQE
FT                   HYLARERHKTQAETLEKMMRFLASVYGNNSKLLSEPTNDEFQKSSGAPQRHDTSNISKP
FT                   TNAASKKLLMLTDHAHKPSTNGSSSTSGAATGDVTPTVLPSHNSSVASQHPFIQEIVNR
FT                   SNQNLAPINSMPSPGTFFPELNEQLNESASQKVKNHSSMMQNVEDNINQQGESIKQIHE
FT                   WINKLAPTSSTTNSKKTDSDAIADDDFDVNDFFLPHTPVDEPGATSIPIIEELTPTDSL
FT                   KRENGAGEGDNSASKRAKK"
FT   CDS_pept        51223..52572
FT                   /locus_tag="PAS_chr2-1_0027"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68627"
FT                   /db_xref="GOA:C4QZF3"
FT                   /db_xref="InterPro:IPR007518"
FT                   /db_xref="InterPro:IPR033979"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZF3"
FT                   /protein_id="CAY68627.1"
FT                   /translation="MLLGVRAILPQAPIRILLLLLHPQMTQFSTKTIQWQDDLYHDHHV
FT                   NKILIQNSNGPCFLIALVNSLILASELTLNGWTNVGSKAIEASHVKAEHLVPLKELLTK
FT                   NVVQLDELLNEITNLVIQVADSDFDLSPLLESLPRLHTGLNVNPNFLLPRITSKQDGNS
FT                   KVLDILELFNLELYHGWLIDERTPGYELLSRLGDYDSLQSYILEIKNAIRDSALVDNYE
FT                   YEDLSLEQLDHLLDKSDDARLKQFLNEYQDIQNFLRSNRTELSETGLSRLMFDSQNTIK
FT                   RSSFAIFFRNEHFNTVYKNQSDSLFTLLIDEGYSKSKTYVWQTLSSVDGSNDKLLDGNF
FT                   EFTIEQIQPLSQEPISIDATDFIINEEEIETANDDEALAKKLQKQEDENAARAIQKKYD
FT                   KQAKTKTKSKTKSTIKSQPGSSADSNNKRDNSTAAGVKNNTEDKGKCIVM"
FT   CDS_pept        complement(52576..54954)
FT                   /locus_tag="PAS_chr2-1_0028"
FT                   /product="Putative kinase, suppressor of GTPase mutant,
FT                   similar to bovine rhodopsin kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68628"
FT                   /db_xref="GOA:C4QZF4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZF4"
FT                   /protein_id="CAY68628.1"
FT                   /translation="MFKVFKASGIEGNHQLSNNPTFINGPWSVYAAKNKSTKKKCSVFI
FT                   FNKKQFESNLSRSGLLNNRNKQQILNDCFNVLQQYVANLMKFKHPNILNVLEPMEDHKS
FT                   KCLFVTEYVISDLEAFTKERLDDTPVEEIIVTKGLLQISNAVKFLHENQNLCHLNIQPN
FT                   TILITENFDWKLSGFSFIQPCDSSKDFFLDTFDQRMPMFTNVSFRFSSPNLILNHKLDY
FT                   SNDLFSLGLLIHYLFSAKSLLHTDNTFQDYETEIKRLNHLLKSSSALNNPEFRHIPQNH
FT                   KHLMILLLNQQSTSDNAIELEDSVTIDTVISDQIFQSELIKILNFVDELQAATVEEKCI
FT                   FLTTLKAHLHQFPKTLLLNKFVPLLTSTLLSPYLSTSMSKKNQTPKVQLSAEEERLIVL
FT                   SLENLFLASSQISQLSFSENVFPYLEQVLALNLASANVALAKGIPLVESKLGLPSQSSY
FT                   KDSYTKFQVSLFHNSMDTSEIEPQEAVLSTLIDFIKYQPYHTISQKFLPMISEQFAKTT
FT                   SFKVKNLTIHAFITLITFEPNPLDDFVIVEKILPIVQATSVKNFNNVSILSNVINLYHV
FT                   MFVKLSETLTSFGSEKMDLGVIMERVLFELWKLLRYVPDKKEAANLKSILDQIQAFVFS
FT                   KAISSLPEEIPKKAQPNQRIQDDTEFGDFDSNVVDSKQRHGLAQQDGLRSSTQNKNLTL
FT                   ENIHSNFVPVTPPTSTILNPKTPLVLRPDRPNPNGTLEIRNTVSNSPIPASTPQIDWSA
FT                   SRNATLEPEAQKLPPGFSAGIIQPNRVKPKPKIDDQRLI"
FT   CDS_pept        complement(55127..57685)
FT                   /locus_tag="PAS_chr2-1_0029"
FT                   /product="Zinc-finger transcription factor of the
FT                   Zn(2)-Cys(6) binuclear cluster domain type, involved in
FT                   the"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68629"
FT                   /db_xref="GOA:C4QZF5"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZF5"
FT                   /protein_id="CAY68629.1"
FT                   /translation="MPPKREKTFTGCWTCRSRKVKCTLERPECDRCIKGGYHCTGYDIK
FT                   LRWSQPVQFDKFGSQLSQTNIEPNDDETMRRRNIEPVRYNAKQAYKDYDQLDTDIDGLH
FT                   SYRLETEKDRDSTVIKGMFGVFRQQKRKREKDVSFSPEKLPFGSPSMFDPLSGFTQGNE
FT                   WVSNELIDDALLTASAINGDTHFLDIFRADTLNPLVNTNSSSTPFYGYNADVQKIYPNP
FT                   SRRDKDLSQYAPDEMFNVLFHRKEEEEPHGVHVGSDGVLIGDSNGSPLVRSSTMSASAS
FT                   QPISGAQQDLPPAKKMKFSIDSIQLDAPDGTSKMPGNIMEARTVPGLPQTLAIEKSGLP
FT                   TTALQVNPMTRYLLNYYIEDVADMMTVIPLPKNPWKFIYFPRAIMAVGEIGSLGKTSYA
FT                   RSCLLNALLAVSAFNLQSRFPKNSNEMKYYVNLGIQLRQQASVFLKHCLMEDVLTQKYK
FT                   DVLVAVLSMVTIDVVWGTMSDCKTHLNICEKIIEKKMTVKKKLSAKALILHRIYSSMKL
FT                   IQDSTNLEIVSKDEIFLNESNYKQFITSSRVDSAESNQGSRIDKLFRKSPSSLLSDSSN
FT                   HVSSTSSSKGVFHEKINDQGKIRIEYIVHDQNTESPGEIPNERKDSQIPLFIDITKASF
FT                   KPSKNKLDDHDISSDAIYGLPNSLILLFSEVVHLIRFKVYCDSTSTQLPLFFKLLADEL
FT                   STKLSDWKLEWKLTTQEDSEKFISARHEGIYHHVMSFYHGLVIYFYRFIEDINPNYLQE
FT                   YVEKVLVHLNRIQEIVQSDKDILIIPLFWQGFIAGSEAMTVYLQNGFKKWGTDISKTGI
FT                   GTYWVARQIMLEVWRRKNFNEKKSNWIDVIRDWDMNVMLT"
FT   CDS_pept        complement(57904..59400)
FT                   /locus_tag="PAS_chr2-1_0030"
FT                   /product="Putative ATP-dependent RNA helicase of the
FT                   DEAD-box family involved in ribosomal biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68630"
FT                   /db_xref="GOA:C4QZF6"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZF6"
FT                   /protein_id="CAY68630.1"
FT                   /translation="MGSELKASHGEKIKKEKKEKKEKKVKKDKKVKKEKKEKREKKDKK
FT                   EKKEKKEKDHNETPQPATEVDQATIDAYLKENEISIDDPHNAEVSPILNFSMLQGIEEK
FT                   IKNKISQFDKPTTIQAVSWPYLLKGNDVIGVAETGSGKTFAFGVPAISHVLQKNSKGLQ
FT                   VLVISPTRELAVQIYDNLKQLTDLCGLECCCIYGGVSKDDQRRQVKQSQCVIATPGRLL
FT                   DLMEEGSIDLTGINYLVLDEADRMLEKGFEEAIKSIMANVNTDRQTLMFTATWPKEVRE
FT                   LASHFMKSPVKVTVGDRDELSANKKITQIVEVIDPYDKEKKLLQLLSKYSKNDDKILIF
FT                   ALYKKEATRVERTLNYKGYKVSAIHGDLSQQQRTQSLNDFKTGKSSLLLATDVAARGLD
FT                   IPNVKVVINLTFPLTVEDYVHRIGRTGRAGKTGIAHTLFTEHEKHLSGALQNILRGANQ
FT                   PVPEELLKFGGHTKRKEHSVYGAFFKDVDMNQKAKKIKFD"
FT   CDS_pept        join(59772..60263,60317..60376)
FT                   /locus_tag="PAS_chr2-1_0031"
FT                   /product="Protein of unknown function required for normal
FT                   levels of resistance to oxidative damage, null mutan"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68631"
FT                   /db_xref="InterPro:IPR006571"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZF7"
FT                   /protein_id="CAY68631.1"
FT                   /translation="MSKLKDSIKSLKSTTREEPPDYHPFDPPLTGLELNGYKNTTKQRL
FT                   LHKELAEDLRLHLPARLQVTHNWNLLYSLEQDGISLNTLYKKMRPLPSEINKRYGYLLV
FT                   IRDSHHNVFGAYVSDYLRPIERKQYYGNGECFLWKAEKDTVPNLVDLGRQEELDVQYRL
FT                   KCLHWQWRWEIWSLDRRRPG"
FT   CDS_pept        complement(60473..61231)
FT                   /locus_tag="PAS_chr2-1_0032"
FT                   /product="Putative protein of unknown function with
FT                   similarity to glutamine amidotransferase proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68632"
FT                   /db_xref="GOA:C4QZF8"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZF8"
FT                   /protein_id="CAY68632.1"
FT                   /translation="MTKSTFIAVLNLDQQNPDLLAYGDYGDMGILLMRKAGIVDQELRK
FT                   YNVIDNMEFPSQDSLQNVAAIYITGSKYDSWRYSEYEWMQKLIAFIQDVYFNHKIPLIG
FT                   ICFGHQIIAIALGGTAKKVGWEIGTEKVQVSLTDGHIQTLTGNSKKVAKDLAEKGSFLV
FT                   SEYHQDAVTKIPVETINYGSTSNQQIQGLINDRIFTFQGHPEFPTEVEYSLLEKRIDIV
FT                   GKELYEDALKRKDEDDGFFLGRLIKSFIGI"
FT   CDS_pept        61726..62640
FT                   /locus_tag="PAS_chr2-1_0033"
FT                   /product="Nitrogen catabolite repression transcriptional
FT                   regulator that acts by inhibition of GLN3 transcripti"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68633"
FT                   /db_xref="GOA:C4QZF9"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR017298"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZF9"
FT                   /protein_id="CAY68633.1"
FT                   /translation="MISNLSAGLRTINLNDEKAEDSRSQHQQQTVIDQSRAESMNSKSQ
FT                   DSGNRITQYFTNLPKEGFTLFSHSSAPNGFKVAIVLSELGYPYKTLFLDFNKGEQRAPE
FT                   FVSVNPNARVPALIDHNCDNLALWESGAIILYLCQKSLRETGVCDIYSDNPQDQAQINS
FT                   WVFFQTSGHAPIIGQALHFRYFHDVNVPSAVERYTDEVRRVYGVLEMALAERREALIME
FT                   LDIQNSANYSNGTTPLSQSKYFDHPVWLVGDSISVADLSFVPWNNVVDRIGINLKSEYP
FT                   EVYKWTKHMMRRPAVVRALRGDT"
FT   CDS_pept        complement(62702..63853)
FT                   /locus_tag="PAS_chr2-1_0034"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68634"
FT                   /db_xref="InterPro:IPR029005"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZG0"
FT                   /protein_id="CAY68634.1"
FT                   /translation="MSVLAIAINVAHGAPVSWAHHFFTTTYTSVGMIPVREPYYPPGGM
FT                   EIPASMDAVQPHINVPNATAGQQEQTQGPPPLRRHNMVQYQLNTNLKRQLSNFTLLKFL
FT                   EFCELAGARSKLHDKEYWQKVSEDYFTPEGTISFVLKKDNKSSDTPNGGPDSIPQLRHF
FT                   EMLTSLIPQFVTGWISPGVESVDIFPLLIKVEILANGSTYIESRKFCLKYTFKDGSHFD
FT                   ITGIARVVYNQQLKIDLFEFQDVETSRAVDLKSLYSTFEKCLKRSTIESGKAERHNDLE
FT                   TESQLNLPFALEEEVLSNKQSSMIKMIADEVLNASGQNTLDMDKKFHSLLQLYDTFSIM
FT                   STLVEFSTANGIASPLESLDTFLNLNKHILKESSGPPAKRPRT"
FT   CDS_pept        63910..64101
FT                   /locus_tag="PAS_chr2-1_0035"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68635"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZG1"
FT                   /protein_id="CAY68635.1"
FT                   /translation="MVERSGLYFFSSRLSSIQEVELIPAGGCIVEIKTSLQICSINFPT
FT                   DYHSHLILEIIDDTLDRI"
FT   CDS_pept        complement(64168..64995)
FT                   /locus_tag="PAS_chr2-1_0036"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68636"
FT                   /db_xref="GOA:C4QZG2"
FT                   /db_xref="InterPro:IPR006880"
FT                   /db_xref="InterPro:IPR029523"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZG2"
FT                   /protein_id="CAY68636.1"
FT                   /translation="MSSEDISELSEISDGNISSRSDEELEDEIQENGYTPFEEDDDYGH
FT                   DEDDDDDDNIHDQDQDDYLDSSTQPETVDSEITSQPRSKQNSLVVKLQPRRAKTRLSYN
FT                   ESDDEFPEDEELDEEEEVEEEDDDDDDNFETPQLGEPTDVSKMTERQRAKFLEQEEPQS
FT                   FLELPTNKKKKELTEEEILLKREENSRKRKNFNERRLEEEKRDTLNKLLKKRASKVRSK
FT                   KSLDEFDDDENEVSKRLNRPRRPQLVHPALSRWTCTSKDEQVIIRYGIPGTSK"
FT   CDS_pept        65610..66530
FT                   /locus_tag="PAS_chr2-1_0037"
FT                   /product="Nitrilase, member of the nitrilase branch of the
FT                   nitrilase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68637"
FT                   /db_xref="GOA:C4QZG3"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZG3"
FT                   /protein_id="CAY68637.1"
FT                   /translation="MTKQVVAALQVGSSPKGTKETLKKILSYEQEIKEKGVKILVLPEA
FT                   ILGGYPKGSNFGTYLGFRLQEGKEAFKRYFKEAIDLDGEEIRELAQLSNRTGAFITAGV
FT                   VERAGSTLYCTMVYIDPVKGYVGKHRKLQPTGTERLIWGQGDGSTLTTVETSVGTLGGA
FT                   ICWENFLPLLRQAMYAKGVQVWAAPTVDGRKIWGNCMQTLGYEGRLFVVSAVQFMPPPK
FT                   EMGYELKDWDENENCINGGSLIVDPYGEVLAGPFTGKEGLLHAEIDLDKIIEARFDFDP
FT                   VGHYARGDVFQLTVNERSRDVTFTK"
FT   CDS_pept        67060..67641
FT                   /locus_tag="PAS_chr2-1_0038"
FT                   /product="Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68638"
FT                   /db_xref="GOA:C4QZG4"
FT                   /db_xref="InterPro:IPR008417"
FT                   /db_xref="InterPro:IPR040463"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZG4"
FT                   /protein_id="CAY68638.1"
FT                   /translation="MSLFLNLVCGLMFFEMGLFSAMTIPFPPKIRKPILNIVSLPFKSI
FT                   HFQVAYKCILGFILILFIDSVNKVIKVSSDLTSFDSAASSALGNNSVDRTDILLRRFYA
FT                   QRNMYICGFTLFLTLILSRTYALVDEVMVLKEQRYSKVANSADAADPDEVSKLKAQLTE
FT                   KEENIQILKKQAEHLSKDYEELIAKKPKNE"
FT   CDS_pept        complement(67727..70477)
FT                   /locus_tag="PAS_chr2-1_0039"
FT                   /product="Essential 121kDa subunit of the exocyst complex
FT                   (Sec3p, Sec5p, Sec6p, Sec8p, Sec10p, Sec15p, Exo70p,"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68639"
FT                   /db_xref="GOA:C4QZG5"
FT                   /db_xref="InterPro:IPR007191"
FT                   /db_xref="InterPro:IPR039682"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZG5"
FT                   /protein_id="CAY68639.1"
FT                   /translation="MEQPINSVHNGSNSLDNLEHLLKEAEENWQVLMAKDSVSALDIAL
FT                   PFLDRTSVGMASQYPEFKELERNLFNGLQNVVFENFNAFNDSVAAYQVTREKIGKSQNI
FT                   IKEINGTLEQSGKDIMSNKEILKELNNNSQKYEQIIETLDQIEILRKKNVEIEALIDKK
FT                   AFYKVERLLAESWDICNQYNLNELESLSHIKENLEVQSNNLVELVVEELHSIIYLKNIK
FT                   RQEETHEELKTYKKIKDFLFKFENNYNFFDMINKEVAFIDNDYEYVYLLLKTLKNLNSL
FT                   DETLNSLKSRLSTELQFLFNSIQEEIKSSNGKNIQVANLDMTDLDSFGISDIGNSVLQS
FT                   FFSRIFNRCCHVLEFLLVTYKISEIVSENSNCKLNFQFSDLWDIFSAEISNLMLAYISK
FT                   SESSDKSQHSNDKHMFQFNSLDFKNTKAETFSIDLQSILQDLFPNYDLKNPITNSVYIK
FT                   DDFSVNKTTLIPPNVFNMSVILNNLLQFIHLSLQLVSIVANEKIDPALLCDRFMETAFL
FT                   PRLQHLLDGIFQSLFKDGTVDTESYHNVFKTFFSKVCDILNTSIIYKSEYVRIILKLLN
FT                   KMSSLYSECFNKHFGGTGKNTKTVQLVVNSSLRNASKIQDFAAETSILLSNNFMGQVTT
FT                   RDFLTDEELTQLIKLLTSIDRMLEWLLPMRRVGSSLNQDHSNDNDEKVDFLKDKWLFLE
FT                   GSPISTVLLTFSKDSVVEFDSQVDTFYKLMTDIKLILRYDLRLKIGYFVSQMFLTETWL
FT                   LPYERNRPSLLIESLNKKILQIDHLLTNRDYKTFVFQGVSSFANKLFIKGASDIVALNE
FT                   HGIGKLYSNIIILQQVLRTLVDDPDEINFSSCINYYEMFKKTDKGIVDQVSRGENRYSY
FT                   EENAQMIKLYFSEGLSKQMNTGKKMSFGADKRCEESIQALKNLYK"
FT   CDS_pept        complement(70761..72305)
FT                   /locus_tag="PAS_chr2-1_0040"
FT                   /product="Protein with similarity to ATP-binding cassette
FT                   (ABC) transporter family members"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68640"
FT                   /db_xref="GOA:C4QZG6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZG6"
FT                   /protein_id="CAY68640.1"
FT                   /translation="MNLVELKNVLFQRATGSASKVCSKRLLFKNPINLNLNSDKRWAII
FT                   GHTKSSFLEVLSGKHLAIPIEGRKYPILANELASNSIELLQFSNNNYGKSATGTGNGGF
FT                   THLGARYEFFKDLEIDIRVDQFISDYSYNASHKVDSDKIANLIKTFKLDGLEDKYINGL
FT                   SNGQFRRARLAKSIYKAPKILLIDDPFLGLDPNATDLVSNVLSQDHESAILLGLRIQDP
FT                   IPSWIDNVVLVNQDGVVKHGPKDELAPELEANLDEFKKSQVKELENIKKKELAFIERQT
FT                   ANTDNSEIISMRNVNVAHKGKKILTNLNWNVRCGEKWHIRGPNGSGKTTILSLLTLDHP
FT                   QSWNKSISVYGAPRRIGSTNYFDTNKYIGFTSPELHALFPKKLTVFKAVSTGFVTGSYL
FT                   PPNNLTADQINRINNLLEYFQLGELKDTSFDELSISHQKVVLFIRAVINNPRILILDES
FT                   LSAMDENDVLRCKDFVSSYNQGCVLVVGHVDEEVPKCDKYLQLIDAPKGEYKIGYV"
FT   CDS_pept        72637..74013
FT                   /locus_tag="PAS_chr2-1_0041"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68641"
FT                   /db_xref="GOA:C4QZG7"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR033310"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZG7"
FT                   /protein_id="CAY68641.1"
FT                   /translation="MSLNCGDSDSEVDSFPSSESEFNVLGTNLLVSRRQNNSKTTECSS
FT                   LSPDFSNKHAAGQSTPKSEIFVDEGSSLILLDNDHLTDRVIEILDSSIMDLEDDNGSPL
FT                   DRSSSQEENNQVELSLDEIITSSQFTQEGTNAKEEEPKSYLQQLLERATPQELRRVNKV
FT                   TRTQEEMLSKVKIEISNSFLEHIKRKATFEFDSVQIEELDSKHKEIRWKYELDCLYYPE
FT                   QEIVVPLPQGKIEIVNESTILLSYTAEEMATNLLNESLISLINEYPADSFFIILVEGWD
FT                   TYLRSIKTKHNRDFVKEIRMRLDQEELHQKRLKSTPRPSKPNPVDPDKLWEKVLCMELE
FT                   FKVNIFPVHNVVDSLEWIKSFTSTLASRTFNKKHRNTGFERVGTVRSGSNGADCYFQAL
FT                   QQLKYMTPITAKKLMNEYPSINRLYDHISRHNHLEGCSKSIREALIKLFTCDNPNELIN
FT                   "
FT   CDS_pept        complement(74120..74983)
FT                   /locus_tag="PAS_chr2-1_0042"
FT                   /product="Hsp70 (Ssa1p) nucleotide exchange factor,
FT                   cytosolic homolog of Sil1p, which is the nucleotide exchan"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68642"
FT                   /db_xref="GOA:C4QZG8"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013918"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZG8"
FT                   /protein_id="CAY68642.1"
FT                   /translation="MEKLLKWSISANSQDEESKKRAGQPDPELLAQLFGGPDEPTLMNE
FT                   SMKVINNPETDLENKEVAFDNFEMLIENMDNANNIENMHLWPPLLQNLDSEYISLRRFA
FT                   CSCIGTAVQNNPKCQEHFLKHSDGIKKLIAISSNSEEDDSVKLKALYALSNVLRHNKPA
FT                   YEEFSNQGGWNEISPLLTSLDNSNEKIKLRTLSLLSSIITNGLSEEVIEHLHNNKVVIS
FT                   MLKVLKAEGHITSIDKVLSLLTTLVQNKFRFSDEEINLIRQSLTTIAELEDSLNNDDLN
FT                   TIKQVL"
FT   CDS_pept        join(75124..75178,75319..76250)
FT                   /locus_tag="PAS_chr2-1_0043"
FT                   /product="Subunit of TFIIH complex, involved in
FT                   transcription initiation, similar to 34 kDa subunit of
FT                   human T"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68643"
FT                   /db_xref="GOA:C4QZG9"
FT                   /db_xref="InterPro:IPR004600"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZG9"
FT                   /protein_id="CAY68643.1"
FT                   /translation="MDAIADRAFQEKQHNVSQDETPSLLAVVIDTNPLEWTKLKGVICL
FT                   KELCKSVLVLLNAHLSLNSGNRVAVLTSSSLNSGPKFLYPDPNDKTYEKRESLLSSDIH
FT                   RQFKFVDQKIIQELQILLDNEPLNPENQELKGSIAGAMSMALSYINRLTNIEPESTGNT
FT                   LRAKMLVISISDDSTQQYVPFMNCIFSAQKMKVSIDVCKMGPDSSFLQQASDVTNGVYM
FT                   LIKNVHGLIQYLTTALFIDPSLRPIMVLPTNSDLDFRASCFVTNKVIDIGYVCSVCLCI
FT                   FSIIPRNNVCPTCQSKFDDAVVKKLRQKPIVIPLQKKKKLEDGVQRT"
FT   CDS_pept        complement(76262..76690)
FT                   /locus_tag="PAS_chr2-1_0044"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68644"
FT                   /db_xref="GOA:C4QZH0"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR039258"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZH0"
FT                   /protein_id="CAY68644.1"
FT                   /translation="MKRTLDDFSDASNEQKSTRISNQALFRCTLGACKADFTDHSSLNH
FT                   HILQYHTFICQSCKKNFPNERFLYLHIQEHHNPFNSIKEERGEKIYQCFLETCDKICSS
FT                   PQTRRLHMIDKHQYPKEFLYSVIKNGMSKGQTSLLKSR"
FT   CDS_pept        76765..77550
FT                   /locus_tag="PAS_chr2-1_0045"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68645"
FT                   /db_xref="InterPro:IPR035426"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZH1"
FT                   /protein_id="CAY68645.1"
FT                   /translation="MKRQNQPYELLTLKKQKAEQPESSIEHTHGPVDLQFGQRKAFPVD
FT                   LDIDPSRLPQNEGSLPQDVMTYLAMVRMEAEGNARYNIDEDENFYLHETVKTKENIALD
FT                   PVDNEHQVHITWHHDYTEYFKARQEKLSILGKEIEGDEKFIEPSSAQLWKKYVFETTPD
FT                   DRLIVAIPFDVKFKMIIYFTRWLNKTLNANLIKWIEITLESLPELLEGTEISLLRNLAK
FT                   KAIKLRGNDLDSTSLSVMDEIISIVGDVYHQRDLLEGYL"
FT   CDS_pept        join(77696..77733,77795..78083)
FT                   /locus_tag="PAS_chr2-1_0046"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68646"
FT                   /db_xref="InterPro:IPR005351"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZH2"
FT                   /protein_id="CAY68646.1"
FT                   /translation="MSEDPRRPDEVVKYVHVPAQTRNTAANVVGSTLPMAAMFLRNKVV
FT                   SWSALFIALQAYLNEPRFKPQNKDGPSQPGLMTVGFALLAVLTSYTDVLFPTPGVGKKI
FT                   VPSV"
FT   CDS_pept        complement(78280..78732)
FT                   /locus_tag="PAS_chr2-1_0047"
FT                   /product="Cytosine deaminase, zinc metalloenzyme that
FT                   catalyzes the hydrolytic deamination of cytosine to urac"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68647"
FT                   /db_xref="GOA:C4QZH3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZH3"
FT                   /protein_id="CAY68647.1"
FT                   /translation="MTFSDEDGIKLALKEAQKGYEDGGIPIGAALVSEDGTVLGVGHNL
FT                   RIQKGSSVFHAEMSALENAGRLPGKTYKNCTMYTTLSPCHMCSGACLMYGIKRVVLGEN
FT                   ETFQGAEELLRSKGVEVVNAKNDECKELISKFIKERPADWSEDIGE"
FT   CDS_pept        79295..81538
FT                   /locus_tag="PAS_chr2-1_0048"
FT                   /product="Ferric reductase and cupric reductase, reduces
FT                   siderophore-bound iron and oxidized copper prior to u"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68648"
FT                   /db_xref="GOA:C4QZH4"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZH4"
FT                   /protein_id="CAY68648.1"
FT                   /translation="MLITSLLVLILFNVLATAKIFAKPSSLMFSCLTASQEFQYDFVPP
FT                   PDVIPFWYIACNYEPALGSIVFCMDSNADSICPFSNSLEVLALGCQTQGDRTLTQTYLM
FT                   ESGKNATKYMKNPASDPDFNFTQLTTPIMFNMSEVVNKKDAYYNFFDNLDDSTKFGDFT
FT                   IIYWGVLLILIGLFNHISAHNYLKSISLNSRLNQWKALVVLPTLSSYHLNPARFRGIAF
FT                   FEALLPLRQETFVLIAYILLCVYYTTSNYKVIANSPLFGSPYRQYLRFISDRTGIFAFT
FT                   QLPLLILFGGRNNILMTISGLPFNTFIIFHKWISRVMMLCAVVHAHQFVIYLEATGTFR
FT                   RSLGELYFQFGELALLCCLLIMVQSVFYFRKRCYELFLVLHIFLAFIFLVGCYFHVSKI
FT                   GYSEWILATLGLWILDRVWRFVNIYRYGVQTAQLTVFHPHSTDSNREDPTVKVSIPKPA
FT                   TWKSYPGCFVYLYFLDPHLKFWESHPFTIYDSTDQFGDPTPMINIYIKPKCGTTKAIYD
FT                   QIMSRDITGVKVLVEGPYGHRAHTENYDQLLLFVGGNGIPGPFSHAARSVSALPYKDVE
FT                   SFKKVELVWSIKTLSALNWFYDELIQLKDTNVSVTVYVTRGDLSLADDDNSSTSSNNNI
FT                   EPEILTETSHLLKDDTNNKSKKREVSSIITIAEKFHNLSKFVTFIRGRPNFEKKLDQVI
FT                   NECSQASKITTIGLVACGPSLMCDNIRNLVAHRLSRNDTGKFRIDLLEELQVW"
FT   CDS_pept        81862..83619
FT                   /locus_tag="PAS_chr2-1_0049"
FT                   /product="Aminophospholipid translocase (flippase) that
FT                   maintains membrane lipid asymmetry in post-Golgi secre"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68649"
FT                   /db_xref="GOA:C4QZH5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZH5"
FT                   /protein_id="CAY68649.1"
FT                   /translation="MGFKQFCKDNFVAVSPKKLKKSDLHNVEISVEDDPFKKSAVIEDK
FT                   KLDVESSVTESSESFRPHRNLKNRHIQLIGIGGTIGTAIFVSISGALFKGGPLSLFLGF
FT                   TIWCIPILAVTASTAEMVSYLPITSPFIRMAGICCDDALEFVSGLNFWILTGSLIPYEI
FT                   VGVNTIIHYWSDSYSPAITICIQIVLYFLINLFSVGIYGETEFWLSVWKVCLAVGLMFF
FT                   TLVTMSGGNPLNDAYGYRNWNSPSPMMEYISVGALGRFQGFIACLSQACFTISGPDYVS
FT                   SVAGESANPRKTLPTAFKQVFYRLTFIFIIGVLCIGTVCSPRDPHLIAALEEGRPGSGS
FT                   SPYVIAMDNLKIKVLPHVVNGALALSAFSSGNSYTYCSSRVLYGLAYTGKAPKIFAYCT
FT                   KSGIPLYSVLMSLCWAFLSFLEMNTQSQIVLVWIINLVTSSQLLNYTITMLTYTRFYAA
FT                   LKHKGIERKSLPFYAWFQPYTAIFGGFCTFSMIFISQYLLFYPSREYWAISTFLFAFLS
FT                   LFVIIALFIAYKLVFRTKWKSVDEIDWELELQEVERDQAYFDELAYYDNNAKKPWYDKL
FT                   IAILVGNNK"
FT   CDS_pept        83824..88701
FT                   /locus_tag="PAS_chr2-1_0807"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0807"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68650"
FT                   /db_xref="GOA:C4QZH6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR032630"
FT                   /db_xref="InterPro:IPR032631"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZH6"
FT                   /protein_id="CAY68650.1"
FT                   /translation="MERQSRGDGDTNDPPRITDPSVTKPRKRGLSLRSQLLNKKLLNNP
FT                   ATNNSVPDIELSEVDASHEGSDSQAVKTEPKERFAEESYHDLVLEDREPTSGDQSSRKT
FT                   SFLKNLHNKLLGVKNVSNSKGQRRVPLQIGGEAPNYAYLQNKQGKSLLKDPKTNKAFCD
FT                   NNIKSSRYTLATFVPRQLYAQFSKVANCYFLCISIMQMIPSWSTTGTYTTIIPLMVFVS
FT                   ISIAREGYDDWKRHRQDKDENHKKVMVVASQSPGLYSNTTLRSANSLSELNTDIGDTEP
FT                   YQAQVLGRSRGSTISESNNVFDGIEERFSGKRFHLSKSYWKDVRVGQVIVLKRDDWVPA
FT                   DIILLSSTGDSGEVFIETMALDGETNLKAKVPHPELYKRCNTNTGLEAVQADVSTENPN
FT                   LDLYNFEGSLKFKGESISYPLGPDNIVYRGSIIRNTDYCLGLVIFTGEETKIRMNAIKN
FT                   PRTKAPKLQRAINMIVFFMIFVVASLSAFLTMAQRIWYEKTKDQYIYLYEEDVGVAATL
FT                   MGYIVMLNTLIPLSLYVTMEIIKAMQLVLLQSDIDMYDRKSNTPAEARTATILEELGQV
FT                   SYIFSDKTGTLTDNLMLFRKFTVAGTAWVHDIDLVNQQNEQGDEPEETDSPNLEVNGNK
FT                   ETLEPRTSISHRGGQATYTGRPSLASISSNHNPKQSETTTTISLEASTSSSPTKSFSDP
FT                   SSTGSLKSTVELIRYLQRYPSSFFSKQVKFMLLSLALCHSCLPRRADPGASDDDDEDNI
FT                   NYQASSPDELALVIAARDMGYIVFDRKLKMLTLKVYPNSFDGEPVLENYEILDTVEFTS
FT                   SRKRMSVIVKFPDGRICMLTKGADNVMLERFRDKELVERKIKELKKQTSERKNQEADIV
FT                   LQHKNEDASANVRTSISSIGSSLAERVSLQIGRTSLHVNPDPHNSIDGRIMNEEPDEEE
FT                   EYVKNITKSSRKSIHLQQAKKYDISSEPTADSPIEDYVTSEKLVFNEEFVLERTLQHIE
FT                   EFSVEGLRTLMYCYRWLDKDVYERWSQQYADAKSSLTDRKYNIEKVGEILEFDFELVGA
FT                   TAIEDKLQEGVPEAIEKLRKAGIKLWMLTGDKKETAINIGYSCKLIKDYSSVVILSSDE
FT                   GIQNLSTKMAASELEIKEGNVAHCVVVVDGATFTDIENDLTLMTLFIELGVKADSVICC
FT                   RASPSQKATMVSVIRKYNMKKVTLAIGDGANDIAMIQQADIGIGITGKEGLQAARTSDY
FT                   SIAQFRFLLKLLLVHGRYNYIRTCKFVLCTFYKEILFYLTQAIYQRYTLFTGSSLYESW
FT                   SLSMFNTLFTSLPVLCIGMLEKDLKPSTLLAVPALYKIGRNYEAFNLVTFIYWMLLGTS
FT                   QSLLISFANYLGWGGSSSQDNTTYPLGVASFTALVFVVNLKCQVLEMHNITKFSLIGTL
FT                   VSCLGWFLWLILLTGLYQSKDSKIFFVKSGLFHTFGTDITWWCNLLVLILIGPLLDIIL
FT                   TVIKKDLIPSDTDIFQNIEKIPMFRKTFEIKAFPYMFQGWTWPHESVILEEKKLSVSPF
FT                   KRNYYNFKSILKKGSTGPTMTTRKRNGTLPSIYELPPGSPSVVRKVTSKDGYESEILPS
FT                   GKVIQVKHGVSRLKKVTRMFKLDNVDEETDYDTEAIIDRRIKETET"
FT   CDS_pept        88960..92829
FT                   /locus_tag="PAS_chr2-1_0050"
FT                   /product="Plasma membrane ATP-binding cassette (ABC)
FT                   transporter required for the export of a-factor, catalyze"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68651"
FT                   /db_xref="GOA:C4QZH7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZH7"
FT                   /protein_id="CAY68651.1"
FT                   /translation="MRLFKRKKDPEKEHLDEKDAQFKNPDDQLNEKFDQLDPATREVLE
FT                   GQLKGVSFKASLADLYGLLRGWEYLIAFIAYVCSIIAGAALPLMTLVVGDMAQQFTNYF
FT                   TGVLGRSEFEDKIRDNSLYFVYLGIGLTVFQYLATFLHIVISEIIASRVRQKFVWSILH
FT                   QNVAFLDSMGSGEITESITSDTRLIQEGVSEKIGMTVECLATVVSALVVAFAKYWKLAL
FT                   VLLSVMVGLIMSATPTTLMLIKMYMKSLESYGKASSIAEETFSAIRTATAFGAHEFQLS
FT                   RYNIFILESRGYGFKKALWLSLMIGSVWFIVFNTYALAFWQGSRFMVSDNSGIGKILTA
FT                   CMAMLFGAMTIGNVTTHMKDVSVGIGAASKLLAVINREPYLDSSSEDGSKLERVDGSIS
FT                   FRNVTTRYPSRPDITVLSDFTLDVKPGNTVALVGESGSGKSTVIGLLERFYEYLDGDIL
FT                   LDGVSVKDLNIKWLRQQIALVQQEPVLFAASIYENICYGLVGTKYEDAPEEVKRDLVEK
FT                   ACKDANAWEFITQMSHGLDTEVGERGLSLSGGQKQRIAIARAVISQPKILLLDEATSAL
FT                   DTKSEGIVQDALNRLSESRTTLVIAHRLSTIQNADLIVVMSNGRIIERGTHQELIKLRG
FT                   RYYQLVQVQNINTKINSTQVTKSIAASTISDSENDKPNDSESLIYEPSPEIASDLPPQK
FT                   KPSVGQLFLMLLKISKGEYHLIIPAMFCALIAGMGFPGLSLLMGHIVEAFQVSGPDEYP
FT                   HMRSQINKLTGYLFMIGVIEFINYIFLISSLVMASEYLIYKMRYRCFKQYLRQDMAFYD
FT                   QPQNKVGSLVTMLAKDPQEIEGLSGGTAAQITVSVIIVVVGIIISLITNWRLGLVCTST
FT                   VPLLLGCGFFRVYLIIMFEERSLKSYQGSASYACEQVSALRTVISLTREKGIYDKYSKS
FT                   IKAQVRRSTQSVAKTAIMHGLIQGMVPWIFALGFWYGSKLMIEGRCTNREFFTVLIAIL
FT                   FGAQSAGQIFSYAPGMGKAKQAAANVKKVLDTFPNVIDIESEEGAIVDPSEVKGGIEFR
FT                   NVTFRYPTRMEVPVLQDLNLTIKPGQYIGLVGASGCGKSTTVGLIERFYDPLSGEVLLD
FT                   GVDIRNLHLRTYRQALALVQQEPVLFGGSIRDNILLGSIDEVSDDEVIEACREANIYDF
FT                   VSSLPEGLDTLCGNRGAMLSGGQKQRIAIARALIRNPRVLLLDEATSALDSESEKAVQE
FT                   AIDRASKGRTTITIAHRLSTIQNCDVIHVFEGGKIIESGKHDELLALGGKYYDLVQLQG
FT                   LESQN"
FT   CDS_pept        93286..94329
FT                   /locus_tag="PAS_chr2-1_0051"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68652"
FT                   /db_xref="GOA:C4QZH8"
FT                   /db_xref="InterPro:IPR007828"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZH8"
FT                   /protein_id="CAY68652.1"
FT                   /translation="MSVQKSTKVFNNNTKDFKKHTQLRNGKLLEQTDDHIQNVNRRKRD
FT                   LKLSQILNCTDSDSEVTKNFDGKDSKEESPWYDNSSSDFLKSVDTKAYRQYDLACERVK
FT                   DFYKEQHENQTVAYNLQARINFKTKKRDVMTVWDALVKLNVLLDESDPDTELSQIDHAI
FT                   QTAEAIRRDCKPRWFQLVGLIHDLGKLLYFYDSKGQWDVVGDTFPVGCRFSKRIIFFEF
FT                   FKNNPDNDNPLYNKKYGIYSPHCGLEDVMLSWGHDEYIYHIAKGQSKLPPEGLAMLRYH
FT                   SFYPWHQDGGYRYLMNENDAQMLQAVKAFNPYDLYSKTDITYDIEELKPYYLELIDEFF
FT                   PQKLVKF"
FT   CDS_pept        complement(94422..95816)
FT                   /locus_tag="PAS_chr2-1_0052"
FT                   /product="Cell wall protein with similarity to glucanases"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68653"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZH9"
FT                   /protein_id="CAY68653.1"
FT                   /translation="MLSTILNIFILLLFIQASLQAPIPVVTKYVTEGIAVVTETNVRVV
FT                   TKTIPIVQVLISDGATYTHTLTTVSTAEENGNFQPITTTSIVNKEVVVPTSVTPNTQQT
FT                   RPTQVDTTQNNADTPAAPTPSPTTSSNNGVFTTYSTTRSVVTSVVVVGPDGSPIENTGQ
FT                   TANPTTTAPTTSTTAARTTSSTSTTPTASSTPGGNHPRSIVYSPYSDSSQCKDATTIET
FT                   DLEFIASKGISAVRIYGNDCNYLTVVLPKCASLGLKVNQGFWIGPSGVDSIDDAVQEFI
FT                   QAVNGNNGFNWDLFELITVGNEAISAGYVSASSLISKIKEVSSILSSAGYTGPITTAEP
FT                   PNVYEDYGDLCSTDVMSIVGVNAHSYFNTLFAASDSGSFVKSQIEVVQKACSRSDITII
FT                   ETGYPSQGATNGKNVPSKENQKTAIFSIFEVVGTDVTILSTYDDLWKDPGPYGIEQFFG
FT                   AIDLFS"
FT   CDS_pept        join(96002..96125,96228..96340)
FT                   /locus_tag="PAS_chr2-1_0053"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68654"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZI0"
FT                   /protein_id="CAY68654.1"
FT                   /translation="MAGIKVGSGTSRNGKYQKQSKIQCIESEDIVLYQPFQTTLYAISK
FT                   NGWDEILHRHDHWMQDHEVNFVRGNWFRFWEKM"
FT   CDS_pept        96665..98233
FT                   /locus_tag="PAS_chr2-1_0054"
FT                   /product="Putative hexose transporter, expressed at low
FT                   levels and expression is repressed by glucose"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68655"
FT                   /db_xref="GOA:C4QZI1"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZI1"
FT                   /protein_id="CAY68655.1"
FT                   /translation="MTEESLESTRMSTLGKDKHHKTTPSIVYCLGLALAGIVFGFDIGS
FT                   IGMINFQTYRDQFGDIVYPSGEKRINEVVLGLIVSGFSLGAALGGLLLPRFADNYGKKP
FT                   LILFSMFLYFLGSLTVFWAWVWWQVFLGRILNGAGVGCCGVVSVMLISELSPPDLKGPL
FT                   VSSFQVFTTVGILFGALVIYLCKNERSRWQYRIGLVIQMNLANIVAIVTAFVPESPVYL
FT                   IKSRQYNKALRSIGRIKGLSPTDHRVETELNDLRERTQLESLNIALSDPNSTSILKGEP
FT                   RILFRTVIGTILMIFQQLTGINYFFFFGVAIFENAGVEDPFLTPVILGAVNLVFSFLSL
FT                   WLVSQYPRRWLLISGSFVMMILIFMFSTCGVFFLDSSNGAVVGSIMILLTCFFIGAFAC
FT                   TWGPLSFVVLSELFPIRVRSKSMSIASAMNWTTTFALSLLSPLIIRYIGFWYGYVFAAF
FT                   LFLSAFFVFYYIPETKYDTIEQIDHYYETMTTFNEFSIGFPTKTFKKRNKSITVKQPEI
FT                   QLHDV"
FT   CDS_pept        98740..100866
FT                   /locus_tag="PAS_chr2-1_0055"
FT                   /product="Plasma membrane transporter for both urea and
FT                   polyamines, expression is highly sensitive to nitrogen"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68656"
FT                   /db_xref="GOA:C4QZI2"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR031155"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZI2"
FT                   /protein_id="CAY68656.1"
FT                   /translation="MAGGIETPLPQGAGYAVVLGLGFFFSFLMIGITYGLQRYKKEIMT
FT                   SEEFNTGGRSIGTGLIASAVVSSWTWAATLLTSSTMAYNFGVSGSFFYAAGACVQIVLF
FT                   SYLAIKAKQRAPECHTYLEIVKARYGTLTHCVFMFFAIATNVLVTAMLLTGTSAVISDL
FT                   TGMHTVAVCFLMPISVVAYTIVGGLKSTILSDYSHNGALLIIILVFAFTTYAGSDKIGS
FT                   PTRLWEMVNARSALNPVEGNAGGNYFTMSSRGGGIFFVINIAGNFGTVFLDNGYWNKAI
FT                   AASPAAAMPGYVLAGFHWFSIPFLCATTMGLACLALEDLNDPLTPQQVSAGLVLPTAAT
FT                   QLLGKGGAVASLLLVFMAATSALSSELISVSSIFTYDIFKGYLRPRASGKTLLVTSHLS
FT                   VMAFAMIMSAFSTGLWYAEISMGYLYELMGILISAAVVPASCTLLWKDQNKVAATLSPP
FT                   LGCALAITGWLVYSKVNFGEVTVDTTFEDMSMLTGNCVALLSPLLFVPLFSFIFGFQNF
FT                   DWRVLKSINRVDEDEEIIEKTEPNVHIDAETGMYPIKSQITNAAEEIALKTGDERLTAE
FT                   EAQLKRSSRIAGFACLVSASSFLILWPMPMYGSRYIFSSQFFTGWVTVGIIWVFSTIGL
FT                   VLLLPIWEGRHTLYTTFRGIYWDLSGNSHKLKEWQESHPEELHVVQSQISAQVQRHNRI
FT                   QVIDDLVETDSDRK"
FT   CDS_pept        101035..102195
FT                   /locus_tag="PAS_chr2-1_0056"
FT                   /product="Palmitoyltransferase that acts on the SNAREs
FT                   Snc1p, Syn8p, Tlg1p and likely on all SNAREs"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68657"
FT                   /db_xref="GOA:C4QZI3"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZI3"
FT                   /protein_id="CAY68657.1"
FT                   /translation="MVQFIPILVLIFLLFCFILIVLFGDLPSYRGTLIPRIRQTLILIL
FT                   SCSGNGLVAADRRFLGGVVTKLVSSPIIRKTLGWLIPSMYFVIMWNCLKLFFNKVYPTL
FT                   YSQLEFILVIVPSLIVNFSSFLLATFISPGVPTHTDLDKLLAQFPYNGLIFHSFYDYKF
FT                   SNPEYYNKKVTCSTCHLTKIPRSKHCSHCGQCFLLLDHHCIWLNNCVGYNNYKWFLIFL
FT                   VDMDWVFLYGGYLNYKFLKNQIADEVPWSSYLREIWVLRKVSFDNEVAQILLLLCTVLF
FT                   PVVFGFTIEHFRNIYLGVTTNETAKWKFIQALIEEGILYQYSDKNTQCTYLIKSRLHFL
FT                   RLDNEESFKDIDFMIGRLSKIESIHDIDNIYDKGFLQNFKERMRIQ"
FT   CDS_pept        complement(102265..106845)
FT                   /locus_tag="PAS_chr2-1_0057"
FT                   /product="Aminophospholipid translocase (flippase) that
FT                   localizes primarily to the plasma membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68658"
FT                   /db_xref="GOA:C4QZI4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR026871"
FT                   /db_xref="InterPro:IPR032630"
FT                   /db_xref="InterPro:IPR032631"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZI4"
FT                   /protein_id="CAY68658.1"
FT                   /translation="MVGKSSKGVTSPQKSARFDENMSNGESELGRADSILKSPNPMHLS
FT                   SFHLPRINERVQFDQENDSIEKDKEEEEGKMKRMRWGTTRHASGRPKRSKSIWRRNTTR
FT                   RREKEEPQESNPTNVANDHRGEQRKIFHNLPLDPDMLAENGDPRNTYPRNKIRTTKYTP
FT                   LSFIPKNIAFQFRNIANVYFLTMIILGAFDIFGVPNPALSAVPLIVIVIITAIKDAIED
FT                   SRRTGLDMEINNQITHLLHGIPNPNVLSSNVSLWRKFKKANTKLLFIVLRSVKKLFKKS
FT                   EIKLPEAANNRVSLETMRSSIGEDPFNSELKPLKFSRDYWKDVKVGDIIRIKNNDSIPA
FT                   DVCILATSDEDGACYVETKDLDGETNLKVKNSLKCTSSVVRRPHDLDKLQFHIDSEGPH
FT                   HNLYSYQGNFVLHDGYSSSSEPITINNLLLRGCSLRNTKWAIGIVIFTGVDTKIMINAG
FT                   ITPTKKSKISRDLNYSVLLNFLLLFILCLVSGLVNGIYYTNDNTSRTYFEFGTIGGTPA
FT                   VNGIISFFVAVILYQSLVPISLYVSIEIIKTAQAFFIYSDVKMYYPQLDYPCTPKSWNI
FT                   SDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEAYAGIRKRQGVDVEEESS
FT                   REKKEIEADRLEMFESLQKISKNPTLSLEDLTFVSKLFVDDLKKEDSVQKHCNENFMLA
FT                   LGLCHTVVTEENPKTGKVEFKAQSPDEAALVSTASDMGFTFVDKTKKGMILNVQGEERQ
FT                   YQILSTLEFNSTRKRMSAIIKIPPTSPDAKPKALLICKGADSVIYERLSKTRNNTKMVD
FT                   RTAIHLEQFATEGLRTLCIAQRELEWEEYEEWAIRHDEAAASITDREERLEECADSIER
FT                   ELVLLGGTAIEDRLQDGVPDAIELLGQAGIKLWVLTGDKVETAINIGFSCNLLGSYMDL
FT                   LIIKTHGEDVHEVLGKDYSDTDEKQVVQRLISKYLEENFDMQGSMEELMQARKEHNPPS
FT                   PRFGLIIDGDALKIALQDDCKRQFLLLCKQCKAVLCCRVSPAQKAAVVKLVKDSLNVMT
FT                   LAIGDGSNDVAMIQAAHVGVGIAGEEGRAAAMSSDYAFGQFRYLARLVLVHGRWSYKRL
FT                   AEMIPSFFYKNVIFTLALFWYGIYNNFDGSYLFEFTYLMFYNLAFTSLPVIFMGIFDQD
FT                   VSDVVSLLVPQLYSTGILRSEWTQSKFWWYMGDGFYQSVICFFFPYLMYYKNGFVTMNG
FT                   LQLDHRYLIGTVVATISILACNIYILFHINRWDWLTMLSILFSIVVLYAWTGIWSSSLS
FT                   SGEYYKAAASMYGTLSFWVCSFVGLVICLIPRFTYDFFQKLYFPKDIDVIRECVDRGDF
FT                   SQYPDDYDPTDPNRKKISQYSRDMLAEQQPTYKEELYKPTMAVNHEYRDSINGVAGKRG
FT                   SFMKSIFHKNKNKNDANIARYNAYGQSASSLQTEEIEMEFTSDDQDKGAALRMKNSRQS
FT                   FESRRRGSLNPERRASLNNTRLQMIRNGELDENPDTSPSAIQGIRTSMDLPELTAAETL
FT                   VSLTSK"
FT   CDS_pept        complement(107358..107813)
FT                   /locus_tag="PAS_chr2-1_0058"
FT                   /product="Ubiquitin-conjugating enzyme involved in the
FT                   error-free DNA postreplication repair pathway"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68659"
FT                   /db_xref="GOA:C4QZI5"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZI5"
FT                   /protein_id="CAY68659.1"
FT                   /translation="MSQLPKRIIKESQRLISDPVPGITAVPHEDNLRYFQVTIQGPKES
FT                   PYQDGLFKLELYLPDDYPMVAPKVRFLTKIYHPNIDRLGRICLDVLKKNWSPALQIRTI
FT                   LLSIQALLSAPNPDDPLSNEVAEHWKRDEQDAIATAKEYTKLYATEQ"
FT   CDS_pept        108193..108432
FT                   /locus_tag="PAS_chr2-1_0059"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68660"
FT                   /db_xref="GOA:C4QZI6"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZI6"
FT                   /protein_id="CAY68660.1"
FT                   /translation="MVKPKGPSTTQRTVVLLLGTGFGLYWGMKYLNENYKLVSYKPPKD
FT                   DKPVKFSLKYRDVQPLEKRKPIEAEIVEATSEKN"
FT   CDS_pept        108797..109495
FT                   /locus_tag="PAS_chr2-1_0060"
FT                   /product="Hydroperoxide and superoxide-radical responsive
FT                   glutathione-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68661"
FT                   /db_xref="GOA:C4QZI7"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZI7"
FT                   /protein_id="CAY68661.1"
FT                   /translation="MSVIEITSKEHFTQVTDVPKDKLLALYFHTQWAPPCIQMNTVYQT
FT                   LSQQHPEVSFISINADNHSELSEMFDVSAVPFFALIRDNTILKEMSGADPKEFVTSLNE
FT                   LTNGKSTGEDSQRNEQHNSTAPGDETEEQLNLRLSKLTSAAPVMLFMKGTPASPQCGFS
FT                   RQVVAILREHQVRFGFFDILKDDSVRQGLKKFSDWPTFPQLYINGEFQGGLDIIKENLQ
FT                   EDPKFFENTI"
FT   CDS_pept        complement(109581..110858)
FT                   /locus_tag="PAS_chr2-1_0061"
FT                   /product="Checkpoint protein, involved in the activation of
FT                   the DNA damage and meiotic pachytene checkpoints"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68662"
FT                   /db_xref="GOA:C4QZI8"
FT                   /db_xref="InterPro:IPR004582"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZI8"
FT                   /protein_id="CAY68662.1"
FT                   /translation="MQIDLTRVSKRPRLSKRPKSDSSPWIEKYAPRKIESIAVNPQKIK
FT                   QVQSALSQCLQGLIKIIFLVGPTGTGKSTVARAVSRLLLNEVFGKNEGLDRVLDYESGK
FT                   GSEHFAKFLQECLILTHTKTAKSIIVDDLPNLSNDVTREKTSSALLRWLDYRGLTPPLI
FT                   ICVSENSQGEEANQYVEKMFDKQVLNHSKVVRINFNKVTQKILEKVLKNILRNEGAQCK
FT                   DLQSFSSMGDISSAINGMEQNVKHGFSDVKDDDIGLFDAIGKVLYGSRNSRMRELIADQ
FT                   YKYIWSRFNLCLLENYTNVKWFHSRMDNKKWEALESIVDCLSHSDLLKDVYLPVFKLRY
FT                   EMDKLEKLGNVDSGAKHKINYFSKLPKKEITVKFDQYKYYEDLLAKRRKNYNSASLSKG
FT                   TTDESEIESIEDSEMTTDDELDNMEL"
FT   CDS_pept        111011..112648
FT                   /locus_tag="PAS_chr2-1_0062"
FT                   /product="JmjC domain-containing histone demethylase which
FT                   can specifically demethylate H3K36 tri-and dimethy"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68663"
FT                   /db_xref="GOA:C4QZI9"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR003349"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZI9"
FT                   /protein_id="CAY68663.1"
FT                   /translation="MTRAIKPDHYEQGIPVFKPSTDQFEDFYAFNKAVHPYGMQSGIIK
FT                   VIPPSDWIDSLHDSPDYLTQEDLLNVKLKNPIEQQVSLMSNKSCFSIDNVEKHRTYTLP
FT                   QWKKLHDQLKYSLPRPRGAKSDTFNSKDGPIPKEKEGEFTAKIDTSIYEPDYIEFLESQ
FT                   YWKSLKFSAPLYAADSLGSLFPKNLKTWNVSSLPNLLDYLPEKIPGVNDSYLYAGLWKA
FT                   TFSWHLEDQDLHSINYIHFGAPKKWYSIPQDQHREFYQLMSNTYPDDAKHCPEFLRHKT
FT                   FLVDPKYIRSNGITVNEIVHREKEFIITYPYGYHSGFNLGYNLAESVNFAIEEWLPIGL
FT                   RAKKCECIDDSVGIDVRKLMESVSKCILCPTLMQKNIFQESFDKLLILGTNSKAHRICG
FT                   KLIPGLEVDGDLITKYFSMIDNTKLSICNYCGEGGYCVSCSFQDCTNCYHVLCSLNSNV
FT                   SIDRCKIYCELHKGEAVTTFDSLEIGDIISFDSKYGEIVSLDKEKETTTMATFPEAQHK
FT                   LIHRYQFDSIKAPSRKRERDNNDSELVF"
FT   CDS_pept        complement(112637..113545)
FT                   /locus_tag="PAS_chr2-1_0063"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68664"
FT                   /db_xref="GOA:C4QZJ0"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZJ0"
FT                   /protein_id="CAY68664.1"
FT                   /translation="MSDLSNLTFDFLLYEVTPVVISLSTLIPFLIIHGLILCDFIGESN
FT                   DKAERLFSLIINSYPSLTLYVLEILNLAFPLMIFVKSRLFNLDISASLNNYTKHIPAKY
FT                   IQITVVAIQVWRILQVLFAPSQILFKGQSDNNFVPVVIFLVFIYNIRTSAVQSDEAVES
FT                   KLEEYGYQEQENSMISLQKYCLAVAITFNERLLSLNSLISFVQLATGNLSSNIEILYFQ
FT                   YRDISPIISSHPLFNSLFEGLFHIYQLGMLSSILLATCTIETNSYLSMKKFKHTFWIVV
FT                   SLILIIEKDFLFIALMDKLED"
FT   CDS_pept        114025..114345
FT                   /locus_tag="PAS_chr2-1_0064"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68665"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZJ1"
FT                   /protein_id="CAY68665.1"
FT                   /translation="MGSLSPESDVEFPSLFSVDTSSSTHCSITEYAAEKRPTFTIPICV
FT                   SFPYYEQKNMLSVKVNRRRDTIEISWRLKKWRQRYIDGSYNSPSDLANEQPEISNHTTE
FT                   QC"
FT   CDS_pept        115122..118688
FT                   /locus_tag="PAS_chr2-1_0065"
FT                   /product="Chitin synthase III, catalyzes the transfer of
FT                   N-acetylglucosamine (GlcNAc) to chitin"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68666"
FT                   /db_xref="GOA:C4QZJ2"
FT                   /db_xref="InterPro:IPR004835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZJ2"
FT                   /protein_id="CAY68666.1"
FT                   /translation="MKNSFSSDNYQEFDVESGDLNRKRSLVRHDRARNDPHNPHYHYAN
FT                   VVAQESDHIKVQSFDTGLDPTRWDSLSRSASARGRSIPLDDLNSKGQIMHDFEDDSTQV
FT                   DPRGTEIQGLNDEQSLHRNNTIRSNKLASKVIKSKSSSKYEFWPIYCTIITFWAPSPLL
FT                   RLFGFKTKERQFAWREKMGLISIILYIGTFVAYLTFGFSRTVCSNTRTRIENNSVSTGY
FT                   LIINGRAYDLTASSHPAAAGIDAGTNILYPPINAGGKDASFLFQNVNGNCKGLITPKED
FT                   SEIPFDGDEVAWYMPCKLFAQDGSSSPNFTASEYYNGWGCHTSTTARDAFYSLDVTGDV
FT                   YFTWNDIRNSSRNLVVFSGDVLDLDLISWIDSDNLNYPELFDRLRTDEQMRGHDISILL
FT                   SSSSERKAARCLVETIKVGVIDSETIGCIASDIVLYVSLIFILSVVISKFLCACYFKWV
FT                   ISRRQGATTSSTKEMNERERDIEDWADDINKQAPVASVQPFQRFDYRNQSKGNRVSKLF
FT                   NRASRYSMATQLDGFDYVNSVGTLASSAKYPMTTMTLQTTKMLRASKDRRSHVRNRSSV
FT                   MLNTNASRQSLLLGSDYHNPFDANDGFYIQSLSADLIHPDVAPQPPVEYQPYGYPLAHV
FT                   ITLITCYSEDEDGLRTTIESIATTDYPNSHKLILVICDGMIKGAGNDKTTPEIALDLMT
FT                   DFVTPPDDVQPFSYVSVAQGSKRHNMAKVYAGFYNYKDSNLPPEKQQRVPVVTIVKCGT
FT                   PAETGAAKPGNRGKRDSQIILMSFLQKVMFDERMTQLENEMLKSIFSITGLMTEMYEIV
FT                   LMVDADTKVYPDSLTHMVAEMVKDPTVMGLCGETKIANKRQSWVTAIQVFEYYISHHQA
FT                   KAFESCFGSVTCLPGCFCMYRIKTPKGRDGYWVPILANPDIVERYSDNVLDTLHKKNLL
FT                   LLGEDRYLSSLMLQTFPKRKQIFVPKAACKTIVPERFKVLLSQRRRWINSTVHNLFELF
FT                   LVNDLCGTFCFSMQFVIGIELVGTLVLPAAICFTVYVIIFAIVSHPTPILSLVLLGIIF
FT                   GLPGLLIVVTVSSWSYILWLLVYLVALPIWNFVLPSYAYWKFDDFSWGETRVTSHEIKD
FT                   AHGEIEGLFDGSHIIQKRWREFERDRRRSNSPNLNHRGSELPVPSAAWDPANINHDFEK
FT                   DSDVYVNAQEEAESSSSQNYLK"
FT   CDS_pept        complement(118734..123380)
FT                   /locus_tag="PAS_chr2-1_0066"
FT                   /product="Peripheral membrane protein with a role in
FT                   endocytosis and vacuole integrity, interacts with Arl1p a"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68667"
FT                   /db_xref="GOA:C4QZJ3"
FT                   /db_xref="InterPro:IPR026829"
FT                   /db_xref="InterPro:IPR032629"
FT                   /db_xref="InterPro:IPR032691"
FT                   /db_xref="InterPro:IPR032817"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZJ3"
FT                   /protein_id="CAY68667.1"
FT                   /translation="MTLAYLVQELGTLSHDSKRKYPELKEAADASIDMIRSFKQRVPIQ
FT                   ELVKFESFVDPFLLSIQTRSLKLVNTGLACLQKLIIESAIADTKLESLVNSLLVCSQFK
FT                   SDDVHLKILQLLSLLLQSYPIRLKNELLSKFLFVCSNLYTQSKSPAIINTASATYLQLL
FT                   TGVFDKIKIEDSKISPDDPVYTVSLDDNKTIEVRQCAYDSQRILLDLINLIQHQKPIFL
FT                   KTNSISEEFGLELLETILKDNSELFNEHLELEYLLRIKISPLILDYLTSSDEFPIMVRV
FT                   ARIIQLMLLQHFTTLKNESKPILSTLTFQLTKDSNSPFWKKVLSLEIYLSIVKDFTLVQ
FT                   QIHKTYDSQLDSNEKTVFKSFFDVCFEIVVLNKSLLNTGDTILPKFISREYQKPADFAG
FT                   LTVAKSSSKVLFIDYLDKLEPPQTSSTYMLYLILQTLTSMCDSLSKAVIGLDKNSSSYI
FT                   EIKDLVSNNWVLWKDMATVFLYSSLCETLFNGLTKSLQKLTLTVSFLDLKDARKKLLFL
FT                   ICKSITNLTGSSGFRSKSLGESIVGTISTTIQTLSQQPVSNVSTSIQPYSRSFNSRMAV
FT                   LFRMLINLVISLGNLLDGSEWILIFKTIQWLDYFLNGASSDKLLPQDKPSADLISSQEI
FT                   LSIQDSIVKLEDSVSGYNSTTLSLIIESFVTLTTELLLEEGGSKVPFEENDDLTLRTSS
FT                   YNKLFFVGKLTNILQNNTIQLLATANGVWDYTLEFYKSIIQQRTLDDQTRFLITDSFDS
FT                   VVKKIAADGFTNDEIRNTEHVVLNSLNKIDTSLSNLPTSKELLIVNCETDIRLRVLKTL
FT                   STVLNRYGSNFAESWSLVYTLLDAPFQLIEKTVLEDPILLKDPQLRINVGQLLESNFET
FT                   VKLLLDEFLTSLPKKQLKPLIDILCKFFYQTLDLNISLNSLSYFWLISDSLKNSFNATK
FT                   DSSYVGENLDLVLNDKEDLTTLINSPSTDPALIDHLIWICLIISLNKAASDPRAQVRNG
FT                   AISTCFSIIDSHGSLLGCWKLIYRLVIEKEFYTIDYSDSLDSDHLESITLILRGLCSLY
FT                   SSQFLSFDSSDSKNTKSLLLFWEGLFGYFEKLLKLNWLDLEYQIFKQFQELSKQGLEHE
FT                   IPTELKELFYSFWSTYQILYQVNPLAQDTLVVYFESFDSIYKMVSPIQDVQKMERILAI
FT                   LNTAIRYPILPSTRSSDSIKSTKLQETVLNILGYMEFDDYHYKSMLIQQLANISMLPLA
FT                   PKSAIEQKFIKKVQDSGFQVPTYIHFSHKAIIVLENKLADLSPAKVLDLGSFTERLFEQ
FT                   LLTIVQERSVGLEETEQELWMIASRILVDLSQKLLQSYDSSLEYLSMLFIRLTDTILSY
FT                   YGKNSLYERFDIVQYDKLYACLIPPLTEMPKSVQVEFAHSIWKNSFLYEFDDTETALIG
FT                   LDELKDIPAQQSLCSRLLSFPFDTIANTTSPIQTHPRKNLSLRCLNDLIDLCSDPQFQK
FT                   VVTPFFISRTAIALHRVIVCKSLLDRRPLPRLQHLEIETIINGISSLVQKNGDRNIQDQ
FT                   IHELKPLFLRYVPFTDERDLQKVLSLSE"
FT   CDS_pept        123721..124896
FT                   /locus_tag="PAS_chr2-1_0067"
FT                   /product="Pseudouridine synthase, catalyzes only the
FT                   formation of pseudouridine-55 (Psi55), a highly conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68668"
FT                   /db_xref="GOA:C4QZJ4"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZJ4"
FT                   /protein_id="CAY68668.1"
FT                   /translation="MNGIFAVEKPYGVSSNKFLQQINNIFTNSSIFGADLAELRKRKLA
FT                   GYGKNSARGLKKASKAKVKMGHGGTLDPLASGVLVIGVGQGTKRLQEYLGGSTKLYETE
FT                   ALLGAATTTGDSEGDVICKTEVNHITKDMCLQTAKKFVGELIQTPPLFSALKMNGKPLY
FT                   EYAREGKPLPMEIKPRTVQVYSLEVEESDLLSTDHDYKLKESIIDEDGTPLESKLSENP
FT                   LLQNDKLHFSKEFIESASQEGLRTDVDPPHLIKDISVQISKAPLLHFVAQVSSGTYIRS
FT                   LVSDFGKALSSSAYMVKLIRRKQGEWDLSSNCFTLADFQENEQVWGPVLKKVFEHGDEI
FT                   NVLEEMQRSKEKFVQNEHQEQSEETSEEVPKENLEARSEETTNKTDETFTA"
FT   CDS_pept        complement(124961..126730)
FT                   /locus_tag="PAS_chr2-1_0068"
FT                   /product="N-glycosylated integral membrane protein of the
FT                   ER membrane and plasma membrane, functions as a stre"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68669"
FT                   /db_xref="GOA:C4QZJ5"
FT                   /db_xref="InterPro:IPR024338"
FT                   /db_xref="InterPro:IPR036790"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZJ5"
FT                   /protein_id="CAY68669.1"
FT                   /translation="MFCFIYGILLWSLVVQALSSNMWPHCYDLLTTVDGKFLRHTYYHP
FT                   EVTLQECLNLECDELNDSQDRKQCLELEELDIEPLDFLERDIEYTSQIDQDALVHRSFR
FT                   FTSVDLSIGDDSQLNDWKPVRKYISQNETHYYEFPINNTNPGVSSSFDALIFITGNICS
FT                   LPDTDLDENGLSLYYTFNQSVFSIETIDQMTKLDFRLGYVQALASNPTSAPFSTLYVAM
FT                   QPNDVGTNTVSGQWTYELGISQNGLVFQWDDRAWAHLLDADGESALLMTGALDTDLYSN
FT                   ISDIDPGLTDSYSLHLFDYTYKSTFQNLNRSWCAIKSGPELSSISINTSFVQKNESIRE
FT                   QFYVQNLNSSSQYIAYLTQNSGTQNSDSGGTVFHQFEFETMLEDTCTLIYDLEFCNNVD
FT                   YAVPMSMQFFDGLISATELGALYDDYAKEHYENFTKSLQIVQCDTDASSRYSPLRTCQD
FT                   CANSYQNWLCSVLIPRCTTRNNTSGYKYRTTSDGRNSFINEEIQPPNPYYEILPCVDSC
FT                   NAIVRDCPGSFGFVCPTTNETIRESYYWDEGEDYVSCNALGFIVQSSGARLSVKRNLEV
FT                   VIALWIIIIYKLL"
FT   CDS_pept        127073..128071
FT                   /locus_tag="PAS_chr2-1_0069"
FT                   /product="Subunit of heteropentameric Replication factor C
FT                   (RF-C), which is a DNA binding protein and ATPase t"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68670"
FT                   /db_xref="GOA:C4QZJ6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZJ6"
FT                   /protein_id="CAY68670.1"
FT                   /translation="MSIRAGQDNTNLPWVEKYRPSSLDYVYGQHDTVDTVRKFVQDGRL
FT                   PHLLFYGPPGTGKTSTIMALAKEIYGKNYRNMVLELNASDDRGISVVRDQIVNFASTRQ
FT                   IFSNGFKLIILDEADAMTNVAQNALRRVIEKFTKNTRFCVLANYAHKLNPALLSRCTRF
FT                   RFQPISQEAIQLRINDVIKQEGINIDDDALQSLLKLSKGDMRKALNVLQACFTGLDSPS
FT                   QAITSPMIYECVGAPDPQDIEHVLDTIIQENWEAAFTIMNRLKLEKGYALIDLVNGFVD
FT                   ILGGYQLEKMCRLTILKGLADIEYAISRGGNDAIQNTAVIGVIKKGFETQT"
FT   CDS_pept        128169..128714
FT                   /locus_tag="PAS_chr2-1_0070"
FT                   /product="Phosphatase that is highly specific for
FT                   ADP-ribose 1''-phosphate, a tRNA splicing metabolite"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68671"
FT                   /db_xref="GOA:C4QZJ7"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZJ7"
FT                   /protein_id="CAY68671.1"
FT                   /translation="MVKYINGDVFAILNQKSNLPVILAHSCNCFGSWGGGIAFALKQKF
FT                   PSSYTLYSDYCSRFQDNPQELLGKCLLLPISKTDPGYTSVVGDKFLIACLFTGASGGKA
FT                   EILKYTDVSLSHLGKIIQSKKSEISIPRVDEILQSINTDDVPIYLPKINSGIFGVPWPN
FT                   TEKILENHNDLKFVVYSI"
FT   CDS_pept        complement(128737..130011)
FT                   /locus_tag="PAS_chr2-1_0071"
FT                   /product="Putative protein kinase, possible substrate of
FT                   cAMP-dependent protein kinase (PKA)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68672"
FT                   /db_xref="GOA:C4QZJ8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZJ8"
FT                   /protein_id="CAY68672.1"
FT                   /translation="MVFYLDETVVESDSDNDDGHADLVEHLGANLSSAHPPTRRRKSSV
FT                   YSKISVHNEDTGNGQISITEYTKGEQETNASISDFEPITVLGQGAYGTVKLVKNKHTSK
FT                   LYAQKELKKASLVINEKHVERTMEERNILSKISEHPNIVKLFYAFHDHDKLYLMMEYVP
FT                   GGELFQHLNEEKFLGEDIASFYAAQMALAINYLHTMGIVYRDLKPENCLLDSQGFLVLT
FT                   DFGLSKQSLDTGASSIEHDGSFKSIIGTPEYMAPEVLKGDPYSFSCDWWSLGAVIFDMM
FT                   IGKPPFTGANSKIIMDKIVNKTLKFPYYLTPTAKELLQKLLNKSPAKRDVDTTFNKFQK
FT                   HSFFRNIDWDALLKRDLTKISPPIVPIITNLELAENFSRDFTDLKLSDDVSTDLNLIPT
FT                   TKTKDAFQGFSYVASNSYMNRYLGC"
FT   CDS_pept        130900..132387
FT                   /locus_tag="PAS_chr2-1_0072"
FT                   /product="Delta(9) fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68673"
FT                   /db_xref="GOA:C4QZJ9"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR001522"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR009160"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZJ9"
FT                   /protein_id="CAY68673.1"
FT                   /translation="MEQPQAMEKVESVDVTEANAVAAGTNKLTKRIVAAGLGGKLMGTK
FT                   SMVDVTADQLAKDSINELLARDKALKEKYEKQKHISEQPWTKDNWHQHINWLNMILVCG
FT                   LPLFGAIATYYKPPTKETVILGVVLYILGGLSITAGYHRLWSHRAYSARTPLKVLFALF
FT                   GAGAVEGSIKWWSHSHRVHHRYTDTHRDPYDARKGFWYSHMGWMLTKPNPRYKARADIS
FT                   DLADDWIVRFQHRHYLLIMTFMALILPTIIAKYFWDDAWGGFIYGGIFKVFVIQQATFC
FT                   VNSLAHWIGVQPFDDRRTPRDHFLTAIVTFGEGYHNFHHEFPSDYRNALKWYQYDPTKI
FT                   VIYLSSKVGLSYNLKTFSDNAIKQGLVQQQQKKLDSMRAHLNWGTPLQDLPVWDKSEFF
FT                   EKSKDKKGLVIISGIVHNVENFIGEHPGGEKLVKGALGKDATTAFNGGVYAHSNAAHNL
FT                   LATMRVAVIRDGNANANTFSLQNEFLDKKAAAAAASN"
FT   CDS_pept        complement(132422..133921)
FT                   /locus_tag="PAS_chr2-1_0073"
FT                   /product="Component of the RIM101 pathway, has a role in
FT                   cell wall construction and alkaline pH response"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68674"
FT                   /db_xref="GOA:C4QZK0"
FT                   /db_xref="InterPro:IPR014844"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZK0"
FT                   /protein_id="CAY68674.1"
FT                   /translation="MTISKRNIIWRYRVPSEHTYPTCEGVQLGEGIIMCTDPAIMAYSS
FT                   SIKYHARCYDGHPVYSAMNNRLQDEFGISTLPIIDEDWQLFASQSTPTTSPLESSIYPL
FT                   IYTLSASAVIIGYLTIIVFTKNYLHSQRPTKLLRLSILLGAVAIMMYFVASIVELNRQH
FT                   RYEGVSNADLLISYLNSRIYINVVLFFAFFALLLAQVQIITRLFPRRKEKRYIFIVGTI
FT                   CTVLIQIIWALSAFLSSNYYYDSEDESKLAMIPAFMYLLRISLAVVFSSLVCVYAFSKS
FT                   QYLFDREMFLLTAFTAIAINITVAFFIADVSEIWVSELSEVFNVTSYVICNVTTWEWIN
FT                   RISYLEKMVQRASVLGRPYYEDDVLESTNRRSISGTGDHVEFSKKLDISIDNSPSLSSS
FT                   VVGSHIEKPKKARFVKLSSFKHNIRNKFSTTRDHIRSTGLRKKKGSSTVASSNNPQSNE
FT                   VFVHQVQRVEVTEPSELDSDEEYDDTFTTETVITDNNHNNT"
FT   CDS_pept        134416..135756
FT                   /locus_tag="PAS_chr2-1_0074"
FT                   /product="GTPase-activating protein for Sec4p and several
FT                   other Rab GTPases, regulates exocytosis via its acti"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68675"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZK1"
FT                   /protein_id="CAY68675.1"
FT                   /translation="MSDRPVSASNAESLFQLYRDKSPEKPGIESKRKTVDLNGRDRYGF
FT                   KISASFVDQEKYNTWWDQYSRYLIRRKLKWVKLMNKNGFEADEDSMPTKFPTRSEELKR
FT                   YVRKGIPAEWRGNAWFYFCKGPERLSKNKGLYDNLCAKMDTLDEVNLEAIEKDLHRTFP
FT                   DNIHFNDYSGEESLMIGSLRRVLRCYALYNPEIGYCQSLNFIAGQLLIFMDEEKTFWML
FT                   VIIHEKLLVDVHTMNLEGVSVHQGVLLLCFRQYLPLTWSVMREHDTINDDFLVNIPSLG
FT                   ICTTSWFMSLFIGILPVETVLRIWDCLFYEDSKSIFRISLGIFKLMEPQFVKTPEDELY
FT                   HLIQSFPRTILNPNDLLDVCYRKLNSISHLKQQEIQLCKQYVINYRAKYKNLKHEDNNL
FT                   LSNQERLKLLQEGIQEFGKPRVLKGLRWNSRLNKQIRKLRVESEHDI"
FT   CDS_pept        complement(135753..136400)
FT                   /locus_tag="PAS_chr2-1_0075"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68676"
FT                   /db_xref="GOA:C4QZK2"
FT                   /db_xref="InterPro:IPR019383"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZK2"
FT                   /protein_id="CAY68676.1"
FT                   /translation="MTLFFYNYHEFSIYDYKKIGESTVRSHDKPLIITHFDNPYISLLS
FT                   AGKGTRIVRVPRVHDVPGDSYIRFSTVLPGEEPAAIRADEQTDKEHTLETQPFTIDGIY
FT                   EEHGYGLTSHSPLSNIFTDEEFQKVVTEINRLLKAKRNWWMEKLSILAFGILSFYTQTS
FT                   VDDYVIQKNREWEEKNIDARIVPPSWNGYLSLDFEVLDPMLFAIGSESKNER"
FT   CDS_pept        136541..137110
FT                   /locus_tag="PAS_chr2-1_0076"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68677"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZK3"
FT                   /protein_id="CAY68677.1"
FT                   /translation="MSVNEIVFAQKYLDLINITSPKVLSDNYSVPISSVKSPGDLSFRK
FT                   LKVKAVPPPRGEVQVQVNLRSIKPPKFSVDYSLSGKATIYSLKQKLVEDGQVADKSTIK
FT                   LMNKSKIAGDEASLEDLAKDNKVSLVVMVSKETALNVQEDAEPQSELPSRVITSQSWTK
FT                   IHQLLRDDLGEPEASKVLDRWKTSSS"
FT   CDS_pept        137155..138129
FT                   /locus_tag="PAS_chr2-1_0077"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68678"
FT                   /db_xref="GOA:C4QZK4"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZK4"
FT                   /protein_id="CAY68678.1"
FT                   /translation="MDFALIHLGAGKHNEKNKDHYRNLCFRALKRKKTKTKAGSPNPYN
FT                   YVKERQSFEELLSVLDSIANVLESSPLTNTGRGASVNCEGNILCDASIILQESKILHSS
FT                   CCEITSPFPISVIIDNFKEQLNPRHDHILSPLATVYHKSSCRPSLITPSNQDISDTIGI
FT                   SLLNNSISLTASSSGGNLFKPVGRIGPAGIIGSAIYSDFNDCYRVSIMCTGSGEDIISM
FT                   DLARSVCNYLLANMTEDAFASELMSNHIEKCASKYYLRSEYGLYVGVVGWILDAHSRDL
FT                   RVIYAHSTESLVFAYFDSHLKFYYSTNNKVGKLLHGEFKCSSP"
FT   CDS_pept        138721..140799
FT                   /locus_tag="PAS_chr2-1_0078"
FT                   /product="Plasma membrane G protein coupled receptor (GPCR)
FT                   that interacts with the heterotrimeric G protein a"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68679"
FT                   /db_xref="GOA:C4QZK5"
FT                   /db_xref="InterPro:IPR022596"
FT                   /db_xref="InterPro:IPR023041"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZK5"
FT                   /protein_id="CAY68679.1"
FT                   /translation="MSTETARITDFSDESARIIRILAISSSSTSIAFGLVSFYLFGAID
FT                   YSKRVFRHQLIIFLILFDFLKAIFLLIFPARTLDNPESADNRTFCNAIGFFTAVSIEGA
FT                   DIAILAFAVHTALLIFRPNKKVRNGNNLEGGLFRYRYPVYLVSFLTPILLASLAFINGS
FT                   GYVPISSWSYLPVHPIWYRLVLSWVPRYIILISIITIYCSIYFYILSQYNSVGGTAKIM
FT                   WKESLWYKLSNIVLMLFFPDISLSSRSHGQNAEAAPDSKNIDNVSVDDNTEFGNWNRLF
FT                   SIKEEDNSMSSNIQRPFEKVKIPSSSSMSPRNTAAYEEKEKDQIIHDLRERIQLETQET
FT                   INKETVELFQIRRLQILKQMKVIFIYPIAYIFLWLFPFILQCVEFNYSREGGPVLWLNY
FT                   VAAFMQPFNCTVDSLVFFFRETPWNLTSSSVDHLYEHKYSDFRRSVSFLPMYGLPDQYL
FT                   RGTPPVAPSNADQNNSISPFTNYLMNKPRSLRPSVSSNIDPSQTEEIAGADDDMSFTEA
FT                   LQFLRGEPPAEKPVPNSADLSASPKARKLSKVSWRSSRRGSATDSHYSAKRNRSDPSSD
FT                   EQPSSNLNSSNKSPDDPSDSPPFSLPHTGALEPQLTHIPETSASSPKHSPKQSRQSSAS
FT                   NRKDVPFLGFFKSSKSEPQSSEASQVDNHSHQSHSQSHNGSEEDLTFLEFLSQGPKN"
FT   CDS_pept        complement(140981..142621)
FT                   /locus_tag="PAS_chr2-1_0079"
FT                   /product="Subunit of the cytosolic chaperonin Cct ring
FT                   complex, related to Tcp1p, required for the assembly of"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68680"
FT                   /db_xref="GOA:C4QZK6"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012720"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZK6"
FT                   /protein_id="CAY68680.1"
FT                   /translation="MNGQVPTIVVLKEGTDTSQGRGQIITNINACIAIQESLKPTLGPL
FT                   GSDVLIVGADGKTTISNDGATILKLLDVIHPAAKILVDISRSQDAEVGDGTTSVTLLAG
FT                   EILKECKGFIEEGISTTVICKGLRKASQLAVKNIKELQVEVSSKGGANRELLENCAKTA
FT                   MSSKLIHNNDEFFTKMVVDAVLTLDQEYLDEKLIGIKRIPGGSMEDSLFVNGVAFKKTF
FT                   SYAGFEQQPKQFTNPKILNLNVELELKAEKDNAEVRIEQVKDYQNIVDAEWKIITQKLE
FT                   AIEASGANIVLSKLPIGDLATQYFADRNIFCAGRVASGDLDRVIQAVGGSIQTTTSDIL
FT                   PEHLGTCASFEEVQIGGERYNIFKGCPEAKTCTLLLRGGAEQVIAEVERSLHDAIMIVR
FT                   RAVKNTAIVAGGGAIEMELSKILREYSRTIPGKQQLIIGAFAKALEVIPRQLCDNGGFD
FT                   GTDLLNKLRAAHAKGEVWYGVDFRNGGINDNLKSFVWEPSMMKINAIQSATEAAMLILS
FT                   VDETIKNEERASAGAAAAAQGARGRNIPQ"
FT   CDS_pept        complement(142809..144665)
FT                   /locus_tag="PAS_chr2-1_0080"
FT                   /product="Peripheral protein of the cytosolic face of the
FT                   mitochondrial outer membrane, required for mitochond"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68681"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZK7"
FT                   /protein_id="CAY68681.1"
FT                   /translation="MESDNISKAVATASALYSSGSLNKDVFLKNNSYRKTINETLSNKN
FT                   TSMILKYSSAIPLLSRRRHSLDKKQRNRKPKLYAELSDELVRDIPDERLETDHGGPTSV
FT                   FSLFQGFNATLPEVNEEIERIKKGSSKLLEGGFVDKESRELDDPNRDPLPAGITESKIK
FT                   HSQNPHHLKQFKAEIDYKLDLLEIRKGLTANEIQEIDIKLEKLHKMRASVFNKIALYER
FT                   DEIALENYLDEIESRLSLIKDIDPDLNETDESSEEDEDAEDVEPDPKSENLMMNQSVYG
FT                   RLTDEHHKKSRKIKPTLQQYYEPGSNIAEFHGHEDTITTFGFDLPFGTMVSASLDNTVR
FT                   VWDLSRSKCIGLLEGHNAAVKCLQIEDSTVVTGSLDASIKMWDLNRLHNEEQDPLIHSF
FT                   DSHVDEITALHFNNNTLISGSNDKTIRQWDMTTGHCLQTIDVLWASSMMNASSGSYTTS
FT                   SPVVAAEQSSFIGSLQCYDAALATGTADGLVRLWDLRSGEVIRQLSGHTGPVTCLQFDD
FT                   KHLITGSSDRSIRIWDLRTGNIVDAFVYDTGITSLQFDSRRIISTNGDSVVKVYDRIEE
FT                   KHWDCGPRVSDPSSEVNIIFARYQEGYMVEGRTDGAFGVWAI"
FT   CDS_pept        complement(144960..145517)
FT                   /locus_tag="PAS_chr2-1_0081"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68682"
FT                   /db_xref="GOA:C4QZK8"
FT                   /db_xref="InterPro:IPR013966"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZK8"
FT                   /protein_id="CAY68682.1"
FT                   /translation="MSLDLHLRNIQKNAKSLRTLYFKPPGIFTNAIINKPEITRLIRDS
FT                   DPLERSLYTIEDGEPHRIDGINNYAETPSDEKTIIKIPDYSTQDTPSTLIQLNDETEIS
FT                   ELLERASDLVTRYPLEDMAAKLEASTLKYEQLQQSIAEYELLEQQQAEDLQGHDINEDQ
FT                   LEEIAKEETRIRELKLILEQND"
FT   CDS_pept        145849..149526
FT                   /locus_tag="PAS_chr2-1_0082"
FT                   /product="Subunit of the multiprotein cohesin complex,
FT                   essential protein involved in chromosome segregation an"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68683"
FT                   /db_xref="GOA:C4QZK9"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028468"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZK9"
FT                   /protein_id="CAY68683.1"
FT                   /translation="MGRLIGLNLYNFKSYRGLNRIGFGSANFTSIMGTNGSGKSNLMDA
FT                   ISFVLGLQSNSLRSTNAKDLIYRGRVAGTDNDDDDDDMDNSDKENYSGDGSRNAYVSAI
FT                   YETSEGEQVQFKRVINSNGSTEYRINEKLVTMSEYSDLLKDENILIKAKNFLVFQGEVE
FT                   KIAAQSAKELTNIIEIISGSNEYKEEYDYLKEQLDEAHNVTVATFGRRRALKNDFKQYK
FT                   EQTIEVQRYEDKTRERDQLEITAKMCSMFHNDNNISKLQEQLQAVNQQIGDLSARLEKE
FT                   ESTFEALKTAYSEKALNASNDKHKLSKRIEALKDQKLTIIPLDTEKQGIRRQLANLEVR
FT                   LNEMNADSDKQKSVIKTITKSLNFAQKELKELDEKYVSESITLPEESLKEYNKLRQTFL
FT                   VKGNLLEAELNEKSQKIDMLTQEFQDLQDKLDAETSKLDNLESLKTSKEKSLHSKTSLL
FT                   NDQLEFLQTKQASLSSFKSIRQTHLKQVQEVNLKLRDVLSQLDELNASQRESQRERALS
FT                   DINVSLKRVYGAMVKGSVHSLLKPTHKRYQAAISAALGKDWDSIIVENASAAQQCIHYL
FT                   KENRSGTATFIPINSVKVSPVSPHLRNIHPEARPLIDVIEYNSSLHNAMAYVCSNTLVC
FT                   DTLDLAKHLKFDQRVNCKVVALNGAVINKSGLMTGGVNPNDVPRWDKAKALGLTKRKDE
FT                   LLFELEELDKKKPNEFDERALIDEISAIELELPLLRRNRTEAERAIRDVELEIEYQKQK
FT                   VAEVQTLLEHSELGQLRQSYGEVQSKVTHLQLEIYADFCKRNGLESIQQYENSERHREF
FT                   TRQKTKLLQQISSLENKLEYEKEKYQNTQNTRQDIEREEDKLKESLEDVSRRHAQSVER
FT                   LDREDAELEVEKEALEMEFEKLGKELETTKQKGDEVADLRGQYEDLQTHKLHYDEELEK
FT                   ENMKKIQVLKDCKMKSIDIPLLYGDMETLELEDDNEASNSSNILADQFVIDYDGNLDEK
FT                   YKSGDLDTHLQDLSVQMELLSEEINNLTPNTKSLERLAEAEKALKSCERQFNGAREDEK
FT                   EILSQFDTVKEKRFRLFDEAFQHISKSIDNIYKELTKSKVSPLGGSAYLTLSQEDEPYL
FT                   GGINFHSMPPTKRFREMNLLSGGEKSIAALALLFAIHSYKPSPFFVLDEVDAALDNANV
FT                   NRLANYIVKNASPTFQFIVISLKNSLFEKADALVGIYREQRLNSSKAVTLDLRNFSDKE
FT                   "
FT   CDS_pept        complement(149547..151085)
FT                   /locus_tag="PAS_chr2-1_0083"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68684"
FT                   /db_xref="GOA:C4QZL0"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZL0"
FT                   /protein_id="CAY68684.1"
FT                   /translation="MSYLPPPQRRLRHVVCVSVRNILPKGGHPRPVSTKSSTNLRELSS
FT                   TSKNAGTLRNVLYDTFISFHECFQYDKPFYITEISHGTINPVFQDVHFAGTSLSRKITF
FT                   SMMVWVRESKSKNDWVLFKRINLKLSFLNYLGPTLEKAEKAVKDVRNILLLNLVDGWYY
FT                   YPLESNLIAMATDGIQSDKLKTVKSKPSFLKSRELKSCSFDQIIKLSNVKFSIIDTIGF
FT                   KHRLSIQIDHLISSTFRTDSAQQIEAIKHRLAYQYAPRVEMLSRENTSLQNVISKLRTN
FT                   CDRLRSLIKNKNTDTEILAKVLHSLRESHGSLLVRVEEVQEYVSIQKSRLIKDLSSIFS
FT                   ITQTNGKHHEHCMFGLIFPHAKISSSNFQFLRSQELEINALLGYVVQLVHLLATYLRCP
FT                   LRYPIQAFGSNSYISDPISRLKGSRVFPLWIKDGTVYRFQYAIMLLTKNVKQLMDHEKI
FT                   KSIEAYHLLGNLQILFVCLTNTADSELNFKPKLDLEQLKIHLHSQNTQSLIEAE"
FT   CDS_pept        151366..152019
FT                   /locus_tag="PAS_chr2-1_0084"
FT                   /product="Protein possibly involved in a post-Golgi
FT                   secretory pathway"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68685"
FT                   /db_xref="InterPro:IPR021713"
FT                   /db_xref="InterPro:IPR037520"
FT                   /db_xref="InterPro:IPR037521"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZL1"
FT                   /protein_id="CAY68685.1"
FT                   /translation="MGSFIFSLAHFCETHGPTVVLNTQHIATEQHEKLISSNYDQQACE
FT                   SCKLQLPGGSSTLTSIDNEVTYVSTQYPTSQAKYSILRQVAIKCLSVESTSELSPVMFG
FT                   DPILGFTLACIFKISDNTARGGERRYSVMIVAEDESELIHYWNIIATNFKEWIHCIKQK
FT                   REQVLSRQAEQGNNEQFFRRTQLSNKNMVQLLEDPQFFVKMHVWASGVLKQLVN"
FT   CDS_pept        complement(152016..153131)
FT                   /locus_tag="PAS_chr2-1_0085"
FT                   /product="Putative glycoprotease proposed to be in
FT                   transcription as a component of the EKC protein complex
FT                   wit"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68686"
FT                   /db_xref="GOA:C4QZL2"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR034680"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZL2"
FT                   /protein_id="CAY68686.1"
FT                   /translation="MTTYLDTRLKPGKDHYLAIGLEGSANKLGVGIIRHPKGELSDSNK
FT                   AVILSNVRDTYITPPGEGFLPRDTARHHRNWVVRVIKNALKDAQVAPSDLDAICFTQGP
FT                   GMGAPLQSVAVAARMISQLWHLPLVGVNHCIGHIEMGREITNAHNPVVLYVSGGNTQII
FT                   AYSRQKYRIFGETLDIAIGNCLDRFARTLKISNNPSPGYNIEQLAKKGKNLVELPYTVK
FT                   GMDLSMSGILEFIDNLAKDLFANKKNKLLVTSDGSKITVEDLCFSLQECLFAMLVEITE
FT                   RAMAHVNSNQVLIVGGVGCNERLQQMMEIMVKDRNGSIYATDERFCIDNGIMIAHAGLL
FT                   QYRMGDVTDIKDTVCTQKFRTDEVWVKWRLD"
FT   CDS_pept        complement(153341..153817)
FT                   /locus_tag="PAS_chr2-1_0086"
FT                   /product="Ribosomal protein L30 of the large (60S)
FT                   ribosomal subunit, nearly identical to Rpl24Ap and has
FT                   simi"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68687"
FT                   /db_xref="GOA:C4QZL3"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="InterPro:IPR023442"
FT                   /db_xref="InterPro:IPR038630"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZL3"
FT                   /protein_id="CAY68687.1"
FT                   /translation="MKIEVDSFSGSKIYPGRGTLFIRGDSKIFRFQNSKSASLFHQRKN
FT                   PRRIAWTVLFRRHHKKGITEETSKKRTKKAVKTQRAIVGASLDLIKERRSLKPEQKKAI
FT                   KEAAAKKEEEAKAKREAHKAKRQAEKAKAIANGGFIISKQSAKGSFQKVQATSR"
FT   CDS_pept        join(154085..154087,154149..154469)
FT                   /locus_tag="PAS_chr2-1_0087"
FT                   /product="Protein component of the large (60S) ribosomal
FT                   subunit, has similarity to rat L30 ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68688"
FT                   /db_xref="GOA:C4QZL4"
FT                   /db_xref="InterPro:IPR000231"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR022991"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR039109"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZL4"
FT                   /protein_id="CAY68688.1"
FT                   /translation="MAPKVKNSDTINQKLALTIKSGKYTLGFKSTVKAIRQGKAKLIII
FT                   SSNTPVLRKSELEYYAMLSKTNIYYFQGGNNELGTACGKLFRVGTLAILDAGDSDLLSV
FT                   VGN"
FT   CDS_pept        155095..156714
FT                   /locus_tag="PAS_chr2-1_0088"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68689"
FT                   /db_xref="GOA:C4QZL5"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZL5"
FT                   /protein_id="CAY68689.1"
FT                   /translation="MTLSSQASNAIIYVTYGLTLIFCVGLAWYHNDKSKFLSSNQTKTG
FT                   IPLALNFIASAMGCGILTTYTQVANLAGIHGLMTYTIVGALPIFFFSFWGPLIRRKCPE
FT                   GFVLTEWTFQRFGSVTGYYLSLATILTMFLFMVAELSAIKFAVEALTGLDGLPVVIVEC
FT                   IVTTIYTSIGGFQVSFSTDNYQACVVLVLAVIGVIGFALNVNIDPELKRETESYLLGAN
FT                   KLGWQLLYILFIAIATCDCFISGFWLRTFAAKTNKDLMIGTGIASIVAMTICTLVGLPG
FT                   IFGVWTGDVVIGSPEGYLSFFIMVSTMGNWMIGLILIFSIVLSTCTFDSLQSGLTSTIV
FT                   NDFGRGRMPLWAARVITILVMVPSIVVAVKVADDVLKIYFIADLISSSVIPSLFIGLST
FT                   RFYFWSGWEVVGGGFAGLFFVWVFGTVYYGDAAEGGKLLLIWNGIYDSEDWGPFGAFVV
FT                   APGVSLVGGLIICGVRLAVLKVYSNIKGTPFTALDRPEKLGFGGVAIGDSSDIEEVYEE
FT                   TLNESQSKKSTDYVKEEDNFRA"
FT   CDS_pept        complement(156825..159830)
FT                   /locus_tag="PAS_chr2-1_0089"
FT                   /product="Component of the mitochondrial
FT                   alpha-ketoglutarate dehydrogenase complex, which catalyzes
FT                   a key step"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68690"
FT                   /db_xref="GOA:C4QZL6"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZL6"
FT                   /protein_id="CAY68690.1"
FT                   /translation="MLKSFKGISSRSSILRNAPRRLIQTRLLATDSFLQSNNANYIDEM
FT                   YEQWSKDPSSVHSSWNAYFKNLDQGVPPSRAFQAPPTLIPQPAGGIPNLVPVGNASGNS
FT                   NVLTHLKAQLLVRAYQVRGHQKAKIDPLGISFGDDKSKPVPKELTQEFYGFTEADLDTE
FT                   ITLGPGILPKFAEAGHPTMKLRDIIKACEKIYCSSYGVEYVHIPSREKCDWLRERIEIP
FT                   TPYKYSVDEKRQILDRLIWSCSFENFLSSKFPNDKRFGVEGAESVIPGMKALIDTAVEN
FT                   GVEDVVIGMAHRGRLNMLSNVVRKPNESIFSEFTGSKDFDEGSGDVKYHLGMNYVRPTT
FT                   SGKKVHLSLVANPSHLEAEDPVVLGRTRAIQHYKGDVGEFNKAMGILVHGDAAFAGQGI
FT                   VYETMGFAALPAYSTGGTIHIIINNQIGFTTDPRFARSTPYPSDIAKSINAPILHVNAD
FT                   DVESVIFNFQLAAEWRQTFHSDVILDVVGYRKYGHNETDQPSFTQPLMYQKIAEKKQVL
FT                   DIYVDKLIKEGSFTLDDINEHKQWVWNTLEEAFTKSVEYKPTSREWLTTPWEGFKSPKE
FT                   LASEVLPHLPTSVERGVVERIGDTISSWPEGFEVHRNLKRILKNRKDSIQKGEGIDWST
FT                   GEALAFGSLVIEGYHVRISGQDVERGTFSQRHAVLHDQNSEKVYIPLKHLSKVQSDFGI
FT                   SNSSLSEYGCMGFEYGYSLTSPDALVMWEAQFGDFANTAQVIIDQFLAAGESKWKQRSG
FT                   VVLSLPHGYDGQGSEHSSARLERYLQLCNEDPRVYPSPEKLERQHQDCNMQVAYPTTPA
FT                   NLFHLLRRQMHRQFRKPLILLFSKKLLRHPLARSNIEDFIGESSFQWIIEDSELGKTIN
FT                   DKEGIKRLVLCSGQVHSSLHKKRADIGDKETAVLKIEQLHPFPFEQLKNAIDSYPSLDE
FT                   IVWCQEEPLNMGSYAFSAPRIVTVLEQTEKYKDYNLRYAGRNPAAAVAVGTKSMHVAQE
FT                   EAFLDDVFQIQN"
FT   CDS_pept        160918..162453
FT                   /locus_tag="PAS_chr2-1_0090"
FT                   /product="tRNA methyltransferase, localizes to both the
FT                   nucleus and mitochondrion to produce the modified base"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68691"
FT                   /db_xref="GOA:C4QZL7"
FT                   /db_xref="InterPro:IPR002905"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZL7"
FT                   /protein_id="CAY68691.1"
FT                   /translation="MLKRLLQSLKNILKPIKSQVMTDLDAYNKIKEGKAEILFPKEDKV
FT                   FYNPIQQFNRDLSICGIRAWSELYQSAGKKRNNEGEVKPFINILEALSASGLRALRYGH
FT                   EIPLVKKVVANDFSPAAVESIKLNIEHNQLNGIVKANEGDAILFMSQFRDKPEFHVIDL
FT                   DPYGTATPFIDSAVQAVKNDGLLLVTCTDLGVLAGSSYPEKCFALYGGTNIPGDATHES
FT                   ALRLVLSMIASTAAKYKKTIEPMLSLSIDFYVRLFIRVKTSPIKVKEHASTTMINYHCS
FT                   GCGTTYDQPLGKKTQDEKTGRYKFTMARGPPVGEKCTFCHKTMHLAGPMWAGQLHNKTF
FT                   IDKSLQISKSLDKDVYGTTDRIEGMLTLAKQELETPFYFKPGSLSSVIKCPAPPINELV
FT                   SALGNLGYMASLTHAMPSAIKTNAPWEAIWYIMKTWLNHRKEESGKNLSETSPGYAIIH
FT                   NDQIGKDIELKEYEELYKKNDLYHEIKSLRNFKIVRFQQNPTKFWGPKAKPTN"
FT   CDS_pept        complement(162816..163547)
FT                   /locus_tag="PAS_chr2-1_0091"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68692"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZL8"
FT                   /protein_id="CAY68692.1"
FT                   /translation="MSKESTLSLINDQLSYLNDITSTLTNCSYGKNVPNELSKAHLDRI
FT                   FNKAEYDDEFENIDGFKLIQLGCKIARLMEGPVEEFFDQLERLPNNDLRSYSPNGFDSD
FT                   YKLDLVVGLVNSLLKLLTSDIFINYTPGQTYYQIISTSTNITKSRSADIHEMKATLKVC
FT                   RYNKSLIVKKLIEQIAKVFKFLKTYVLSVKLTQYDDINSQLMNLKILCNGSITNKVLKI
FT                   LTHLSETLVSENVLKINQLLE"
FT   CDS_pept        164552..165376
FT                   /locus_tag="PAS_chr2-1_0092"
FT                   /product="Pho85 cyclin of the Pcl1,2-like subfamily,
FT                   involved in entry into the mitotic cell cycle and regulat"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68693"
FT                   /db_xref="GOA:C4QZL9"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR012104"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZL9"
FT                   /protein_id="CAY68693.1"
FT                   /translation="MSDAQCLKIFLQSPVTEEMIHHLVVQTLQVLPCDESTNTKLPSLM
FT                   SFITKLVRYTNVYTGTLMSTLVYLQRLRSKLPQDAKGLPCTRHRIFLACLILSAKYHND
FT                   SSPKNKHWTRYTDGLFSSQDVNLMERQLLTLLNWDLKIDSKELCYSVRRFLEPIRLDIQ
FT                   RSSKLRFRKERRETSLSSLSSMASSASNASINSIHSVGSLYPSSLGRSNSSSSIETNSS
FT                   LDTTELTANYCQKPIMIPVHTAKMESSLHQTALKEQQELDTLMRQYCRGTAF"
FT   CDS_pept        165774..167102
FT                   /locus_tag="PAS_chr2-1_0093"
FT                   /product="GDP-mannose pyrophosphorylase
FT                   (mannose-1-phosphate guanyltransferase), synthesizes
FT                   GDP-mannose from"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68694"
FT                   /db_xref="GOA:C4QZM0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZM0"
FT                   /protein_id="CAY68694.1"
FT                   /translation="MSTKAIVLVGGDTRGTRFRPLSLDTPKILFPIAGKPLLGHILDSL
FT                   ILLPSLTEIILIGFYDKAVFEGFISDYNAKFQLEERNIEIKYLKEFKALGTAGGLYHYR
FT                   KEILKGGPDEFFVVHGDVITGFPFTEIFKFYQSLKSAKKNVEAILFGVKINNYEYFKVL
FT                   NNSTDRHSFGTIVSADTKVVHYVEKPEQKISNIINGGIYLFDNKLFKRLSNAKITKINI
FT                   ANDISHPELVDEDVISLEQDVLQKLPDDGTTYVYEYKGFWKQIKTPADALIGNELFLEN
FT                   LFQKRLVPDKAIKLTAESGAENGITIVPPVYISPSAKIAENTRIGPYVAIGNNVSVETG
FT                   SRISNSIILRDSTIGAHSVILNSILSNNCTIGSWARIEGTGLDSKKIAESIESQANIIG
FT                   IKGTGNITILGSNTEVAEDSYILNSYILPNKSIKFDVRYEIIM"
FT   CDS_pept        167266..170787
FT                   /locus_tag="PAS_chr2-1_0094"
FT                   /product="Protein required for mismatch repair in mitosis
FT                   and meiosis, forms a complex with Msh2p to repair bo"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68695"
FT                   /db_xref="GOA:C4QZM1"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR015536"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZM1"
FT                   /protein_id="CAY68695.1"
FT                   /translation="MAKKKVVAPDNQPSVFSFFKKKPSVNSAEPKKEQKLPTPSSSPQK
FT                   ADLSSGTSDKENHPTTPTKNEHKTQLPSASSSVVRANKLEDDEEEGVVSGRKRRRVAID
FT                   SEDEEDAFDEEESVDNDDDEDYNEDDLHNISDEDFVISTQEMMQLEKELEGEEEPNNSE
FT                   GEEEEEVHQVKPLKKSKQSTSQKLNQFGWTPSSSSQNDAKGKTANSQVKRSNLINPLKP
FT                   KASKKLDEERYHWLEDVRDAEGRAQGDPEYDPRTLFIPSSAWSSFTPFEKQYWEIKSKM
FT                   YDCVVFFKKGKFYELYENDADIAHNEFDLKLAGGGRANMRLAGVPEMSFDYWANAFINA
FT                   GYKVAKVDQKESMLAKEIREKGKTITKEEKVIKRELQCVLTGGTLTDESMLTDEMATYC
FT                   LSLKEVDNGLDGRTFGVCFVDTATGKMRLTEFEDSVECTRLETLLAQVRPKEVLVAKNQ
FT                   ISPLTARILRFNSPSSCIWNKLKPDTEFLNHEVTFEELTRGKYFEASDLDDLSNYPPLL
FT                   VEYHEKHHVAFSAFGALLWYLKSLKLDESIISMGNISPYDPYQHATSMTMDGVTLQNLE
FT                   IFANTFDGSNKGTLFKVLNRATTPFGKRLFKDWVVHPLLLKKSIDERLDSVELLLNDGE
FT                   LKHIFINTLSRLPDLERLLSRIHSGSLKIQDFTKVIEGFERISKLVRTLRSSFGENFES
FT                   IGGSLGKILSQLPQELEIQVSKWATSFDRVAATSQGLLIPEPGVEEEFDQSKLKIENLK
FT                   DKLNQFLRQYRRELKCQEMEFRDSGKEIYLIEVPKKVISKVPKDWQQMGSTSKVTRYWS
FT                   PEVKLVVRELMEATELHKILMDTLQLKVYRKFDENYSLWSETIRCIGSIDCLISLANAS
FT                   ESLGSPSCRPEIVDKDEAFIDFEELRHPCFIPGGASGSRDFIPNDVKLGNGFANIALLT
FT                   GANAAGKSTVLRMTCIATIMAQIGCFVPASKATLVPVDKIMTRLGANDNIMQGKSTFYV
FT                   ELSETKRILQNATPRSLLVLDELGRGGSSSDGFAIAEACLHHIATHIQSIGFFATHYGT
FT                   LGASFIGHPQVMPLRMAILVDESSKTITFLYKLEKGASNGSFGMHVATMCGIPKEIVDN
FT                   VEIAAKNLKHNSMITQVSKAGVSLGLQSDISWLTAGKDIGAGITKYDEKIRKKGLEYIL
FT                   QMIEGIK"
FT   CDS_pept        complement(join(170844..172119,172181..172191))
FT                   /locus_tag="PAS_chr2-1_0808"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0808"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68696"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZM2"
FT                   /protein_id="CAY68696.1"
FT                   /translation="MKARPTLPDSTDSSTSTGLVSYSKRSWRIKKYRNDDSEEQSNMIQ
FT                   SMAQSTETKAPRRPKPKTGRSTEFLFVETSPQKLSGQSASSSSNTPKRATRMSRLFKYK
FT                   KKDESLSENSVSSSTSPVKDPFLQEIMANDLAPLCMRVDKSGRAILAATEPSSPAITPG
FT                   VTSVSAGPPSASEDYFSRPLENKAKRSKTPIRSNSTISSHSLVYPLASVEDIPPSSASP
FT                   VLNPRNRHHRSCSSLSLSSKIKYNSPLKFNRKRHQHSISITGNDAQIESPYFQSDDNLF
FT                   FDSERSHPLTHSDVYDSSSMTSNGIVSSMASSKFALGPPLGASPKNEESITPVSFIENE
FT                   LKLDSFLDFPHYSQSSNDITPKVSEYQSAQHLQAQCASTDSSNTITNLVQQTDAVLESD
FT                   LQFFHKQEHFYDYVDDDYPLYNFVTEAEH"
FT   CDS_pept        complement(173188..177351)
FT                   /locus_tag="PAS_chr2-1_0095"
FT                   /product="Nucleosome remodeling factor that functions in
FT                   regulation of transcription elongation"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68697"
FT                   /db_xref="GOA:C4QZM3"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="InterPro:IPR023779"
FT                   /db_xref="InterPro:IPR023780"
FT                   /db_xref="InterPro:IPR025260"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037780"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZM3"
FT                   /protein_id="CAY68697.1"
FT                   /translation="MSRDLPDEVFENPELYGLRRSRRPHTAPITTSGEDDDQSNDKLEF
FT                   DESFDESASEESDIEFGVAKKRKVTPKAVSKEKRSAKTNGNLVEAAEVRFSTRNNKTVN
FT                   YALEDDEDEFLESDNGQDEDSYAYDGYYDQEVEENNTASIDQVLDHRLKGLDELTSDAD
FT                   EQAVKLETEKEERARLNSSGDPYVDFEFKIKWTGISHLHNTWESYSDLNGFKGIKKVDN
FT                   YIKQFIIYDQEVRNDTFTTREDIEALDLDRERRREELAEYTHVERIVDSDRIIEDGDSK
FT                   LQYLCKWKRLNYDECTWEDANTIVKLSPDKVTHFQQRANSKTLPSLSASYGNNRPKFEK
FT                   LEVQPVYIKNGELRDFQLTGLNWMAFLWSRNENGILADEMGLGKTVQTVSFLSWLIFAR
FT                   RQYGPHLVVVPLSTVPAWQETFEKWAPSVNTIYYMGNTNSRKMIRDYEFFLPGKSKKPK
FT                   FNVLLTTYEYILKDRAELGQFKWQFLAVDEAHRLKNAESSLYESLFDFKIANRLLITGT
FT                   PLQNNIKELAALVNFLMPGKFTIEQEIDFETASEEQETYIKDLQSKIHPFILRRLKKDV
FT                   EKSLHSKTERILRVELSDLQTHYYKNILTKNYAALNAGPKEAQISLLNVMAELKKTSNH
FT                   PYLFDGAEEQVLANLGSSSRENIFRGLIMSSGKMVLLDKLLTRLKKDGHRVLIFSQMVR
FT                   MLDILGDYLTFKGYSFQRLDGTVPSARRRVAIDHFNADGSQDFVFLLSTRAGGLGINLM
FT                   TADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILE
FT                   YAIISLGISDPGQTKKKSNEPSSGELSEILKFGAGNMFKASDNQKKLEDLNLDDVLNHA
FT                   EDHVTTPDLGESNLGGEEFLKQFEVTDYKADVDWDDIIPEDELKKLKEEEKKRQDEEYL
FT                   KEQIEMFSKRKAALKAMENSAEGTDVESTDGGSRRRRATETQGLIEKDYRTIYRALLRY
FT                   GDLNDRWTELIGEGILPNKKVELMQDVYNGLVHQAQDLLKAEDDRRSKENSVPDSANND
FT                   GPRKKERKAVLFEYHGVKNVNAEMVVSRPGDLKLLSLKMPSDPLQFKFQRPPKVINGWS
FT                   CEWTERDDAMLLVGIFKFGYGSWIQIRDDPLLGLQSKIFLETAPSTLSKEEKEKFNKRT
FT                   PGAVHLTRRVDYLLGFLKEEGEESKEEKKHTKRVSKSSTPESRPKSKSLEIKKKKEPRR
FT                   VLKKESKKEIKKDSKKENKDGKKDSKKEIKKEMKKEIKKEIKKEVKKEVKKENVKERSH
FT                   ADKTSSDDDHLPPHEESICRSQLSKVQSSLSRLKQGENGLPRKEWAALLKKKLITIGDE
FT                   IDKEAQGNSIKLKHLWVYATQYWPAKVPSKKIRNMYTKLKGSST"
FT   CDS_pept        178705..180525
FT                   /locus_tag="PAS_chr2-1_0096"
FT                   /product="Essential iron-sulfur protein required for
FT                   ribosome biogenesis and translation initiation"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68698"
FT                   /db_xref="GOA:C4QZM4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007209"
FT                   /db_xref="InterPro:IPR013283"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034348"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZM4"
FT                   /protein_id="CAY68698.1"
FT                   /translation="MSEKNTRIAIVSDDRCKPKKCRQECRKSCPVVKTGKLCIEVEAYS
FT                   KIAFISETLCIGCGICVKKCPFGAINIINLPTNLEKEVTHRYSANSFKLHRLPTPRPGQ
FT                   VLGLVGTNGIGKSTALKILAGKQKPNLGRYDAPPDWEEILKYFRGSELQNYFTKVLEDN
FT                   IKAIIKPQYVDNLPRAIKGPVNKVGELLKAKLERKEEGKHIIQVLELKHVLNREVAKLS
FT                   GGELQRFAIGMTCVQDANVYMFDEPSSYLDVKQRLNAAQIIRSLLHATCYVIVVEHDLS
FT                   VLDYLSDFVCILYGVPSVYGVVTLPASVREGINIFLDGHIPTENLRFRTESLKFKLTDA
FT                   SDSVLIEQSRAFEYPKMVKTQGDFKLTVNAGDFSDSEIIVMMGENGTGKTTLCKLLAGA
FT                   IEGDEGTKVPKLNVSMKPQKIAPKFTGTVRQLFLKKIRSSFLHPQFNTDVMKPLKVDDV
FT                   IDQEVQHLSGGELQRVAIVLALGKEADIYLIDEPSAYLDSEQRIICSKVIRRFILHSKK
FT                   TAFIVEHDFIMATYLADKVMVFEGQPSKNAVANRPETLLTGCNRFLKNLNVTFRRDPNS
FT                   FRPRINKLDSQMDREQKLSGNYFFLENTEL"
FT   CDS_pept        181250..183130
FT                   /locus_tag="PAS_chr2-1_0097"
FT                   /product="Poly(A) binding protein, part of the 3'-end
FT                   RNA-processing complex, mediates interactions between th"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68699"
FT                   /db_xref="GOA:C4QZM5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002004"
FT                   /db_xref="InterPro:IPR003954"
FT                   /db_xref="InterPro:IPR006515"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR036053"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZM5"
FT                   /protein_id="CAY68699.1"
FT                   /translation="MSVDTKEVQESLDQLNISESPATAVTEETPATSTEAAEESNESST
FT                   QASETLASLYVGELDPTVTESDLYEFFSPIGSVNSIRVCRDAVTKRSLGYGYVNFHSQA
FT                   AGERALEELNYAEIKGVRCRLMWSQRDPSLRRSGSGNIFIKNLDPAIENKTLHDTFSSF
FT                   GKVLSCKVATDENGNSKGFGFVHYESDEAAQAAIENINGMLLNGREIYVGPHLAKKDRE
FT                   SRFQEMIKNYTNVFVKNFDTESTEDELRELFESYGPITSIHLQVDSEGHNKGFGFVNFA
FT                   EHDDAVKAVEALNDKEYKGKPLYVGRAQKKNERVHELTKKYEADRLEKLQKYQSVNLFI
FT                   KNLDESIDDARLEEEFKPFGTITSAKVMLDENGKSRGFGFVCLSTPEEATKAISEMNQR
FT                   MVANKPLYVALAQPKAIRRSQLAQQIQARNQMRMQQQAGPGIPNQFVQPIFYGQQPGML
FT                   PPGARVPPMGNQIPQFAGMPRPGPFPQGQFPRMAPNGQPMPVYGQPVFNGNGPQQRGYY
FT                   PNNRQNKNRNQKEEGNSLAAILPQLPLEQQKRVLGEELYPKVVATNKTQDPEAAGKITG
FT                   MILDLDNQEILQLLEDEELFNTHFNEALQAYEEYKSKTVEQQQQADAQAN"
FT   CDS_pept        complement(183385..183726)
FT                   /locus_tag="PAS_chr2-1_0098"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68700"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZM6"
FT                   /protein_id="CAY68700.1"
FT                   /translation="MLFQDGSLFEQVLILQLLAAHVNSLIVTTIDSVLSNCPFYISLAS
FT                   SKPQTKVKSFKYRIPALKAEPLVYQFPLILSISSRLYGNGHRKNWYVQKQLGYREHLAL
FT                   RLNMQINPN"
FT   CDS_pept        join(183904..183934,183990..184891)
FT                   /locus_tag="PAS_chr2-1_0099"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68701"
FT                   /db_xref="GOA:C4QZM7"
FT                   /db_xref="InterPro:IPR001388"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZM7"
FT                   /protein_id="CAY68701.1"
FT                   /translation="MPPKEDVMKQLIYVTLTSNSTTLYTYDNAPLINKLQVNCTELISQ
FT                   ELGLINSMSDFKDESGSIIINNRKPVLVNGEYVNLVMYYVKGSLSNSDLITVVAVVSDH
FT                   VLKEFVLQTLWKILVEFRKFREVSVGEEQTQKGPENGKVAKVGNVAYSPSQSSPSSPIS
FT                   LHTSLNFSASGQDSSSVLSFKKIMTSIIKKEESKYLHYGATYDATFDEIEQVRNIMNKN
FT                   IERTINRGERINLLVSKTSKLTNSSNSFRRRTVALKRKMWWSNVKFIILVGILVVVMLY
FT                   FLIGIECGMPWYQNCLHPSKPEQPHQSSI"
FT   CDS_pept        complement(join(184895..185536,185588..185686))
FT                   /locus_tag="PAS_chr2-1_0100"
FT                   /product="Shared subunit of DNA polymerase (II) epsilon and
FT                   of ISW2/yCHRAC chromatin accessibility complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68702"
FT                   /db_xref="GOA:C4QZM8"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZM8"
FT                   /protein_id="CAY68702.1"
FT                   /translation="MPAKGWKKTSDGSFTPKGPAAKQDKESENISIENLLFPKATIGKL
FT                   AKSVLQGDENESNMILSKDGLTAVQRSAVVFVSYLYHHAREVSKDQNRKTVNVQDILKA
FT                   LENTEFSALIPTVQEELISFNQRKEAKKLKNEKDKDQEVEEEGDDEKYEANKKLKIVEG
FT                   AVDASSVHASQEPTAEEVADDDEATEDATEEASEEVYNLVESSDEEVPEAPDVIDTIDR
FT                   DPLNGVEEHSETNAEGSLHEEDEQ"
FT   CDS_pept        185845..186891
FT                   /locus_tag="PAS_chr2-1_0101"
FT                   /product="Exopolyphosphatase, hydrolyzes inorganic
FT                   polyphosphate (poly P) into Pi residues"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68703"
FT                   /db_xref="GOA:C4QZM9"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZM9"
FT                   /protein_id="CAY68703.1"
FT                   /translation="MSKISKFLDLIKRQALNEVVLVCGNQSADLDSIASSISYAYFHYQ
FT                   KYRFTKGLVIPLLNIPEKDLALRKDAEFVLTQNGIKRSQLWFTDDLSKFDQFKLIMVDH
FT                   NVPQGEVAKSRLTHVVGIIDHHQDEQKYLDSAPRVIEECGSCSSLVLNYWYDLIGEDVG
FT                   ECATLLASAIMIDTTNFTQRVKSHDEKALETIKMLGIYNVSAFTTNFEKIQESKSDLEG
FT                   LSMNDILRKDYKQFVFDGNTVGVSSIVKPFSWLDKHFDIDKETKSFGEEHKLDLLVLMT
FT                   AYTTNDQFKREISFHDVLKDLSERCIKGMKDKLDLNRISGNRFTQNNIKASRKQVVPYL
FT                   EQTLTNTD"
FT   CDS_pept        complement(187101..188309)
FT                   /locus_tag="PAS_chr2-1_0102"
FT                   /product="B-type cyclin involved in cell cycle progression"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68704"
FT                   /db_xref="GOA:C4QZN0"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="InterPro:IPR039361"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZN0"
FT                   /protein_id="CAY68704.1"
FT                   /translation="MSNVQPNENVYSIRHTRSKTQELKRNVLTDVSNNSKVPHHGLHKK
FT                   DQVGTQHARKEDTEDKMDITIVETASSVANVFPENIQKENILSGPADRNRNTKSSLKRS
FT                   ATITDVPQVTNKKAKVDYSWDDLDADDSDDPLMVSEYVGEIFEYLHRLEKETLPDPNYL
FT                   QWQKSFKPKMRSILVDWLVEVQLKFRLLPETLYLSINIMDRFLSKEPVQINKLQLLATG
FT                   CIFISAKYEEVYSPSIKYYAQDSGFSEEEILDAEKFILEILDFNINYPGAMNFLRRISK
FT                   ADDYDVQSRTIGKYLLEITIIDHKFLGVLPSLCAAASMYVARKMLGRYEWNGNLIHYSG
FT                   GYTEAHLKETCEMLIDYLVSPIIHEEFFKKYASKKFMKVSILARQWAKKVTTEGRSIMD
FT                   PIL"
FT   CDS_pept        189096..190502
FT                   /locus_tag="PAS_chr2-1_0103"
FT                   /product="One of three repressible acid phosphatases, a
FT                   glycoprotein that is transported to the cell surface"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68705"
FT                   /db_xref="GOA:C4QZN1"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR016274"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="InterPro:IPR033379"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZN1"
FT                   /protein_id="CAY68705.1"
FT                   /translation="MFSPILSLEIILALATLQSVFAVELQHVLGVNDRPYPQRTDDQYN
FT                   ILRHLGGLGPYIGYNGWGIAAESEIESCTIDQAHLLMRHGERYPSTNVGKQLEALYQKL
FT                   LDADVEVPTGPLSFFQDYDYFVSDAAWYEQETTKGFYSGLNTAFDFGTTLRERYDHLIN
FT                   TSEEGKKLSVWAGSQERVVDTAKYFAQGFMKSNYTDMVEVVALEEEKSQGLNSLTARIS
FT                   CPNYNSHIYKDGDFPNDIAEREADRLNTLSPGFNITADDIPTIALYCGFELNVRGESSF
FT                   CDVLSREALLYTAYLRDLGWYYNVGNGNPLGKTIGYVYANATRQLLENTEADPRDYPLY
FT                   FSFSHDTDLLQVFTSLGLFNVTDLPLDQIQFQTSFKSTEIVPMGARLLTERLLCTVEGE
FT                   EKYYVRTILNDAVFPLSDCSSGPGFSCPLNDYVSRLEALNEDSDFAENCGVPKNASYPL
FT                   ELSFFWDDLS"
FT   CDS_pept        complement(join(190625..190924,190978..191148))
FT                   /locus_tag="PAS_chr2-1_0104"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68706"
FT                   /db_xref="GOA:C4QZN2"
FT                   /db_xref="InterPro:IPR013714"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZN2"
FT                   /protein_id="CAY68706.1"
FT                   /translation="METEQNYNSLFKAANLFVAGATVSKIRSRTVIQGKLLTLVLLQIF
FT                   AGALQLLNGLNAFLLSLFIIAFGGVIAALEIKPELVPKVTPYLSFLLSFLGRGGFYIFL
FT                   GVLISGGSIFRGLIGFLLVIVGVGFVSLEFVGSIEPPPSMREVVSFEEEDII"
FT   CDS_pept        complement(191513..192286)
FT                   /locus_tag="PAS_chr2-1_0809"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0809"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68707"
FT                   /db_xref="GOA:C4QZN3"
FT                   /db_xref="InterPro:IPR000308"
FT                   /db_xref="InterPro:IPR023409"
FT                   /db_xref="InterPro:IPR023410"
FT                   /db_xref="InterPro:IPR036815"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZN3"
FT                   /protein_id="CAY68707.1"
FT                   /translation="MSREDSVYLAKLAEQAERYEEMVENMKTVASSGLELSVEERNLLS
FT                   VAYKNVIGARRASWRIVSSIEQKEEAKGNQSQVSLIREYRSKIETELANICEDILSVLS
FT                   EHLIPSARTGESKVFYFKMKGDYHRYLAEFAVGDKRKEAANLSLEAYKSASDVAVTELP
FT                   PTHPIRLGLALNFSVFYYEILNSPDRACHLAKQAFDDAIAELETLSEESYKDSTLIMQL
FT                   LRDNLTLWTSDMSETGQEESSNSQDKTEAAPKDEE"
FT   CDS_pept        complement(192872..194509)
FT                   /locus_tag="PAS_chr2-1_0105"
FT                   /product="Shuttling pre-60S factor"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68708"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZN4"
FT                   /protein_id="CAY68708.1"
FT                   /translation="MELQVAPRDADILLKDKNILNNEVLEKYTSAGKIAQSCLTYLVKL
FT                   INEGYHTQVGTVYSINELCALGDSYLINTINGLTETKSVIREKGIAQPVCIEANDVVSG
FT                   YSPELDETANVYLQPGDIATITLGCHLDGYTANVSHTVVIFPPGQSPTGPLLTGKADAV
FT                   CAAHIATETITTLLAATTTPEKIPAAFGNKIIGSTIRSVVDSIAQSFNCRVLPGSRVRR
FT                   VRRFLAGQAEGLVAEKEYKGVVWSESDQEKAFLESVNSSQDLTVVHKLSPLVRNLSTVP
FT                   TDEFQVLPGEAYIVDIRMASLEGINEVGYVTLQSVDQIVGKNKEKSSITSKPSIFLRDV
FT                   IMVRHLKLKASRTLLDTIDKKLSVFPFKLAHTASSYPINISNDGTAEPVETQLSNILNE
FT                   MKRGRLGMSEITNRRLCVTKPIQTARFIPLKVVLEASNATGLDGYDAANPTLPGLETPL
FT                   PRLGISSLKLKSLLKKSIPIDVARECSTILLPEQQPPIRLTGGSTSRPSYVHSNYELDG
FT                   PYKQAIYELVKLTEDSKFGLNIQECPPF"
FT   CDS_pept        complement(194627..195670)
FT                   /locus_tag="PAS_chr2-1_0106"
FT                   /product="Protein necessary for structural stability of L-A
FT                   double-stranded RNA-containing particles"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68709"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZN5"
FT                   /protein_id="CAY68709.1"
FT                   /translation="MENREYEANDKSHVMFTSLGMFIVDEVHLLNGSVRKDVMGGGGLY
FT                   ATVGARIVCDNPRTIGGFADFGGDMVDDDHEVKRVISSWNTLMKQRVDRRRLTTRGLVN
FT                   YTMSSTEQMSFSYLTPKKRIGVADLDEEEELLYSKSFHLLSDGPKLIEIVQGIVDKRNC
FT                   AEKPLIVWEPFGVYCVSARLEETIKALEHVDIFTPNAAEAACLLGRSEPETREEMDFVA
FT                   NSFVKYLKKPNSAIVLRCGKLGSLTITGDKSYHKWFPAYHDPKFSDFKVVDTTGGGNSF
FT                   AGAVAFMFASTGNWTLSNIAANVASSFVIEQLGVPVYDPVEDTWNGVATSARQKEYIRR
FT                   YEDVALN"
FT   CDS_pept        195830..197170
FT                   /locus_tag="PAS_chr2-1_0107"
FT                   /product="Gamma-aminobutyrate (GABA) transaminase
FT                   (4-aminobutyrate aminotransferase) involved in the
FT                   4-aminobu"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68710"
FT                   /db_xref="GOA:C4QZN6"
FT                   /db_xref="InterPro:IPR004631"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZN6"
FT                   /protein_id="CAY68710.1"
FT                   /translation="MSKNEQELSQLGSVFDTRAAYFVCNYFASHDNYLVDLDGNEYLDV
FT                   YAQISSIALGYNHPELIKVAKSDEMAVALVNRPALGCFPSSDYRTILEEGILAAAPPSL
FT                   DKVWTSLSGSDANETAFKAAFMYHALQKRGKGTPFTEEEMKSCMENLPPGCPDYVILSF
FT                   EHGFHGRLFGSLSTTRSKAIHKLDIPAFQWPKTPFPRLKYPLEEFEKENSQEEERCLEL
FT                   FSSVIDQWKGRIVAFIVEPIQSEGGDNHASPYFFQRLREISLEKNVLMIVDEVQTGVAS
FT                   TGKFWAHEHWNLTTPPDFVTFSKKFQAAGFYFQNPEFVPNQPFRQFNTWCGDPSKAIIA
FT                   RTIFKQIQKDNLVSKIREVGDYLYEKLETVFKSTPVTNLRGKGRGTFIAWDFDSAQERN
FT                   EFLLKMKQHGINIGGCGDSSVRLRTTLIFEKKHADILCDAILKVLNV"
FT   CDS_pept        complement(197175..199376)
FT                   /locus_tag="PAS_chr2-1_0108"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68711"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZN7"
FT                   /protein_id="CAY68711.1"
FT                   /translation="MDNYHRMIHIYSQLLDVEPQQDTAESYFRDFLTTPFLFTALNSTL
FT                   NNIDVRAKAKPAHLEILKNLIQHALEILKEQLDTRTQENEVTDWPLVNNVLNILRVILK
FT                   NVLTRKLSSNSSKKQLDNNQILVGIFGNVDVVESSARELIYFTDHFLSIVPNDKDSCHA
FT                   VIYSTRESSLELLDSLLVGFHDTMVLDLLFEKDTFFVGLLSILQDAGHSDADDTFDSVV
FT                   VMKVFRCLAILFSNKEVNHNIYKGLLNTHIISQNEKEINLIDKWLFQWFILATKCYEEF
FT                   SPDLLFQEEKRTSLFHLMTFNRFNFNSNTNTHYSQLLTDQLIPKFWDRQLERYKDSCES
FT                   NMENFNHSPLLPVPELLPVMVFFTALIAEDDFYCQLFATRRSDVDFLEVFLSFNSYVMT
FT                   FQHYSPTHKLVTRMSLQILHKLLISCSSKLVPYTINQRKIKPSYQRRPLINPVGVFDLH
FT                   EAKLDGEQLVSDPQFITNKCSIYYILDDVQRYSRYNLTQKLELDNYKLVNNIVLKSLQI
FT                   LSDNDLLNYSYKNSGAEGRYNWVDFWDTQFQVVQFISKLVSKHKMDVSNKQLGSIVEEI
FT                   LIIVEFVLNDWGKQQLFLGPHQLIEDTTSILLQLIYRILEHNSDLFYLIKTFELDISLL
FT                   NYRNILDVFELFSREFKINFEEEASATTSETSFAEVISKIKVFINTQPKGDKQSKILQI
FT                   NKDLFKFETTFEYLDDPNFRNNGTTLALKELLKPKKMTQ"
FT   CDS_pept        complement(199543..201117)
FT                   /locus_tag="PAS_chr2-1_0109"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68712"
FT                   /db_xref="GOA:C4QZN8"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZN8"
FT                   /protein_id="CAY68712.1"
FT                   /translation="MSYSATLDSESAISIYRAPKATFVKRLVQIGCAMFWCLLAAGPIF
FT                   GFAALKPVLIDQGIYHEKCKAEELTFGKLDEMLQSTISSKEKDLCPAQDLSLNFMFTLA
FT                   AVVTNAAALLVGHVLDTYGPRVTGITGAVLLALASLLLRDGDKLPFDGYRYGYSLLALG
FT                   GPFVFISCFQLANSFPRNSGLVLALLTGAFDTSSALFLFYRLIYQNDIIKNLTLHRFFS
FT                   FYLVVPAFILICQLTIMPKDSYKTSNTLAKITVEGIDETGIPITIDEASQLLPRETISR
FT                   RNSIRTIYEEEAENKLVKQTGIFGALHGKTVKQQIFTPWFYLMALFTSVQMLRINFFVA
FT                   TIRAQEQYFFDSKTAAVINQFFDVALPAGGIISIPFIGFFLDNFKTVTVIQLLLGISLL
FT                   IGILGVIANEACALLGIVLLVVYRPFYYTAVSDFCAKVFGFDTFGTVYGTIICLSGFCN
FT                   LIQKYLDTLMHDTFQMNPIPVNILLVSITALFGGLLVFFIIGQEKEIKKAQLILEAENA
FT                   DVVDMPN"
FT   CDS_pept        complement(201383..202243)
FT                   /locus_tag="PAS_chr2-1_0810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0810"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68713"
FT                   /db_xref="InterPro:IPR005645"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZN9"
FT                   /protein_id="CAY68713.1"
FT                   /translation="MNGRVLCLHGFAQNGPNFSAKASGIRKALKKFDIETVFLNAPLQL
FT                   KGADLPFDSASLGADSADSAEAPDFKGWWYTVDDFDIEPAFEAVRECCKEKGPFTGVLG
FT                   FSQGAGLAAILANKFSEIVPGHPGLKFGIFYSGFKVNNQKYWKYYEPKISIPTLHIFGE
FT                   LDTVVSEERSQRLIDECCVPETTLTLKHPGGHYVPNIKDLINKEVSWVLNALDLDPEEI
FT                   KANKNNKGKAQSVTGEKSKRQLKREQKAKQKESGTSTPSKETEEDKTARELGELNDEFD
FT                   KIGKI"
FT   CDS_pept        202765..204114
FT                   /locus_tag="PAS_chr2-1_0110"
FT                   /product="Fructose-2,6-bisphosphatase, required for glucose
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68714"
FT                   /db_xref="GOA:C4QZP0"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR003094"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR013079"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZP0"
FT                   /protein_id="CAY68714.1"
FT                   /translation="MAVYSVVDNLRVCVVMVGLPARGKSLIAQKLVRYLSWLSINTKCF
FT                   SVGNYRRKESVHPSADFFDPENEMGFLIRRQATDLAIKDMLEWFDNGDGVVGILDASNI
FT                   TNERRRQVLQIMRENQIEPIFLESYCDDQELIRKNVKDIQETSPDYKSIQEDYAIKDVL
FT                   ERISIYEKSYESIDVERDSDLTFVKLINVNTEIIINKIESYLESRIAFFVMNLHIKPRY
FT                   IWLSRHGESQYNLEGKIGGDADLSERGWKYAKKLPSLVEKYIPNHEKLTVWTSTLKRTQ
FT                   QTGSYLPYPKKTWKALDELDAGVCDGMTYEEIAEKYPDDFKARDEDKFEYRYRGGESYR
FT                   DVILRLEPIIMEMENLENVLIITHQAVLRCIYAYFMNVPQQQSPWMSIPLHTLIRLEPR
FT                   AYETLVTRIKADIPAVSTYKEKGTSKLGESTKNDHSMAGALISSSSSKDV"
FT   CDS_pept        204478..205149
FT                   /locus_tag="PAS_chr2-1_0111"
FT                   /product="Mitochondrial adenylate kinase, catalyzes the
FT                   reversible synthesis of GTP and AMP from GDP and ADP"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68715"
FT                   /db_xref="GOA:C4QZP1"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028586"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="InterPro:IPR036193"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZP1"
FT                   /protein_id="CAY68715.1"
FT                   /translation="MIKNLRLLLLGAPGSGKGTQTSRLLEKIQITPVSSGDLLRTEISK
FT                   KSSLGLLASKIIQKGGLVPDHLMIALIYREFQARNWLGQDCSWLLDGFPRTQNQAVALD
FT                   DKLTVAPINCVIELDVPEKVILERIENRYIHIPSGRIYNQQYNPPKVPGKDDITGEPLS
FT                   KRPDDNAEVFKRRLDNYHKEIDPLKEYFKNKGILHSIRGETSDIIFPQLYEYITSEFTS
FT                   K"
FT   CDS_pept        205915..206490
FT                   /locus_tag="PAS_chr2-1_0112"
FT                   /product="Small rho-like GTPase, essential for
FT                   establishment and maintenance of cell polarity"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68716"
FT                   /db_xref="GOA:C4QZP2"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037874"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZP2"
FT                   /protein_id="CAY68716.1"
FT                   /translation="MQTIKCVVVGDGAVGKTCLLMSYTTNKFPPDYVPTVFDNYAVTVM
FT                   IGDEPYTLGLFDTAGQEDYDRLRPLSYPNSDVFLICFSVCSPPSFENVKEKWFPEVLNH
FT                   CPGVPCLIVGTQIDLRDDKATLRKLQKQNTKPITPEQGEKLAKELHAVKYVECSALTQR
FT                   GLKNVFDEAIVAALEPPVYKKSKKCLIL"
FT   CDS_pept        206976..208646
FT                   /locus_tag="PAS_chr2-1_0113"
FT                   /product="Alpha subunit of chaperonin-containing T-complex,
FT                   which mediates protein folding in the cytosol"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68717"
FT                   /db_xref="GOA:C4QZP3"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012715"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZP3"
FT                   /protein_id="CAY68717.1"
FT                   /translation="MFDSTRSDTLFLGAQKVSGDDVRQQNVLATQAVANVVKSSLGPVG
FT                   LDKMLVDDIGDVVVTNDGATILNLLDVKHPAGQILVDLAQQQDREVGDGTTSVVIIASE
FT                   LLKRANELVKNKIHPTTIITGYRLALKETIRYINEVLSQSIDSFSKEILINIASTSMSS
FT                   KIIGSDSAFFSEMVVDAMLAVKTTNNKGETKYPIKAVNILKSHGKSSTESMLINGYALN
FT                   CTVASQAMVKYVKDAKIACIDINLQKARMAMGVQINIDDPDQLEEIRKREYGIIMERID
FT                   KIIEAGANVVLTTKGIDDLCLKKFVESGVMAVRRCKKEDLRRISRATGATFISSMSDLE
FT                   GEETFDSSYLGNASEVVQERISDDECILVKGTKTHSAASIILRGPNEYTLDEMERSIHD
FT                   SLSVVKRTLESGNVVPGGGAVETALNIYLENFATTVGSREQLAIAEFANALLVIPKTLA
FT                   VNAAKDSSDLVPKLRSYHAASQQALPTELKKKNYKNYGLDLIKGKVTDQVLHGVLEPTV
FT                   SKVKSLKSALEACVAILRIDTMITVDPEPAKEDPHGHDH"
FT   CDS_pept        208795..210153
FT                   /locus_tag="PAS_chr2-1_0114"
FT                   /product="Sterol regulatory element binding protein,
FT                   induces transcription of sterol transport and biosyntheti"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68718"
FT                   /db_xref="GOA:C4QZP4"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZP4"
FT                   /protein_id="CAY68718.1"
FT                   /translation="MANLKIPGSEQLTTNKVLKSSKGKRKYHNKSRKGCTTCKKRRVKC
FT                   DENKPICNKCEHLGLDCIYMSPPPKRLSSSTSDGSPAITVPLSSGPPLGATSNSPSNQY
FT                   TGNLNMLDLRLMYHYITKVWHTITAAGISDAKIWCEDIPMLAFNYPFLMHSILAFSATH
FT                   LSRTEKGLDQCVTCHRGDALRLLREAVLEISPANTDALVASALILIMDSLANASLPTST
FT                   SPKSLPASAWIFHVKGAATILTAVWPLNESSRFHKFISVDLSDLGDVDLMGDNANANHP
FT                   HDVKYSQLLCFDEELTDLFPVTYTSPYLITLAYLNKLHNERYKSDFILRVFAFPALLDK
FT                   TFLTLLINGDISAMRIMRSYYTLLRNFTDEMKDKVWFLEGVSKVLPVDVDEYSGGGGMH
FT                   MMMDFLGGPSTLNDNDTNDIADNIAQSGLLDTDNLPSSITDNLDIMHSSIYDE"
FT   CDS_pept        complement(210225..211856)
FT                   /locus_tag="PAS_chr2-1_0115"
FT                   /product="Mitochondrial cytochrome-c peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68719"
FT                   /db_xref="GOA:C4QZP5"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR002207"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZP5"
FT                   /protein_id="CAY68719.1"
FT                   /translation="MDLINSLIAPFRNFYQRLAIRLAPLGRVLLYPYVLFLAHLQSVHF
FT                   VVYVQAKNLELYYRREAQRFTSGSRRSTTFKDKSQELDQWKLDFGTSRPIAEEVKPLFR
FT                   ASVNPRDVMLKAWGRTDYYYDRYVVHTPFCIIVRLSGERNRYIYSPRPGTKLPFVLSEL
FT                   PEPDQYHFSPEATRSFNLNKAEVPKPVEKPLVKLFEREVIPEVVAKPDTPAIDKSPIVL
FT                   DADTGTKFSSSHTPLTGQLTVSKTGSPRNRRIKLVVNKKPKAPFIGSFYDYEHVRHEII
FT                   NCFDRPELDYGSLAPNIVRLAWHVSATYDQRTGTGGSNGCTIRFPPELTDPGNTGLHPA
FT                   MSALNLIQAKFPWISYADLYTFAGAIAIEYLGGPKIDWKPGRVDCTDQSLVPPNGRLPL
FT                   GSLGADHIRDVFINALGFDDRAAVCLIGGGHALGRTHAKYSGWDGKWTENPLQFSNQFF
FT                   LELLTHEWDECTVPETGMKQFCYEKKRLMMLNTDMALLRDPSFAKWVKIYGEDEKLFFD
FT                   EFSQDFAKLLELGVDRDSDGIARKKF"
FT   CDS_pept        complement(212008..213444)
FT                   /locus_tag="PAS_chr2-1_0116"
FT                   /product="Actin-associated protein, subunit of a complex
FT                   (Rvs161p-Rvs167p)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68720"
FT                   /db_xref="GOA:C4QZP6"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR004148"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZP6"
FT                   /protein_id="CAY68720.1"
FT                   /translation="MSFKGFRKGLVRGPQSIRQKLNMGQITEDPVYVDAERRFKELEDE
FT                   TKRLSDESKRYFTAVNGMLNHQIGFSKAIEEIYKPISGRVSDPSTLVVEGSPEGIEAST
FT                   QYREVVAELQTTLKPDLELIETRIVAPAQQLLDVIKSIRKMATKRNHKQLDLDRAQNSL
FT                   HKIQEKKEKTVKDEEKMYKAEADVAIAQQEYDYYNDMMKNELPVLFKLEAEFIKPLFVS
FT                   FYYMQLNIFYTLFQRMEELKIPYFDLSADIIEQFTYKRGNVQEQADAIGITHFKLGNAK
FT                   AKLEATKRRYAAAGGPAGAAGVAGAAAGSTAAGTEQLPQYGQTPEYGQTAAGAPAYGQP
FT                   SAATPAYGQAPAYGQAPAYGQAPAYGQAPAYGQSNSPYPPEKVGYGQPQGYQAPVTAAS
FT                   AASPIPSAVPSTPTAPTTAPGVETCTALYDYSAQAAGDLSFSAGQVIEVVQKTDANGWW
FT                   TGRLNGVQGVFPGNYVELNK"
FT   CDS_pept        214127..215635
FT                   /locus_tag="PAS_chr2-1_0117"
FT                   /product="GTPase activating protein (GAP) for Rho1p,
FT                   involved in signaling to the actin cytoskeleton, null mut"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68721"
FT                   /db_xref="GOA:C4QZP7"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZP7"
FT                   /protein_id="CAY68721.1"
FT                   /translation="MEDNPSAKKSLANWWKSFQRSAQSNKVPQDDERPRIRFRSRSSTA
FT                   IKTNSDYKQHIDDFFTKRKERDNYLTKGGVGDNLVFNVTLESSLEITSAKVALCTDINT
FT                   SVTYGRIPTLVVCCGLFLKQQGLDKPGIFRMPGAARRVRELQVLFSSPPTYGAKFDWNG
FT                   YTVHDAASILRRYLTSLSEPLIPLDLYEAFRSPILNRPLIVKYFKKKEQRRIERDKIMK
FT                   QKEGDEPRATRNAQNNQDNDDETPENMDAPLGTEDVEDHFVDASEEIVPDGQQKQKRKK
FT                   HKQKLIKEIHGALAEYVDLFSQLSLPSRQLIYYLVDLLQMVSTHSSTNLMSVRNLASIF
FT                   QPSLLFHPKHDLEPEQYILSQAVVEFWIEYSDRILRASTLLESQTTKKQKPPPIARSSL
FT                   PPVTQPEAKRNSLSSFLNLSYSGRRKHSKSMSSAVSPPDVISNLKHSNLSGASLEHTTS
FT                   FSSDYTHPGQAPSSVSDNPPSSVSNNPQSASLQTKPPNIMISSE"
FT   CDS_pept        215905..217332
FT                   /locus_tag="PAS_chr2-1_0118"
FT                   /product="GTPase activating protein (GAP) for Rho1p,
FT                   involved in signaling to the actin cytoskeleton, null mut"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68722"
FT                   /db_xref="GOA:C4QZP8"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZP8"
FT                   /protein_id="CAY68722.1"
FT                   /translation="METSTSPPRNSISSWWSNFKQRHSSNESLSIYTSNETPSKQGGTT
FT                   NTSPKRPQMRPKSRSSNYIPYRLSLHRNSKELDLSDEAKLKQHRNSFLNSRQQDFFEDS
FT                   QVFAVPLKQSLEIASAKINCGSSDYGLIPVVIAQCGIYIKKNGLDVEGIFRVAGSSRRV
FT                   KELQFVFSTAPLYGRKIDWESYGTTVHDAASLMRRYLNFLPEPLVSLALYEQFRDPIRS
FT                   RPRILNYLKNKSEKKDKEKSPEQEGEKDQQDREQTGVQAQSEQESKQQAKDIDEQNEEY
FT                   KAKEAKKAANEKKLKKSILAALKEYALLFNYLPKESRHLILYILDLLSLCTQHRDKNLM
FT                   TAKNLAAVFQPSILTHPDHDMSPEEYALSHAVLEIWIEFSYILIARLNDSPQEIIRLTD
FT                   TKGTKRDTIPSVTTSTDSTFLAPPPGQHRRQHSRSLSSVVPVNDRIYQNKQKPQLLDDQ
FT                   LQETTPEPQNDKESDDV"
FT   CDS_pept        complement(join(217388..218424,218703..219207))
FT                   /locus_tag="PAS_chr2-1_0119"
FT                   /product="Nuclear protein that acts as a heterodimer with
FT                   Aos1p to activate Smt3p (SUMO) before its conjugatio"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68723"
FT                   /db_xref="GOA:C4QZP9"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR019572"
FT                   /db_xref="InterPro:IPR023318"
FT                   /db_xref="InterPro:IPR030661"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZP9"
FT                   /protein_id="CAY68723.1"
FT                   /translation="MRWISNFPPPSKTFTERTMARDIQLIRILGEETYNKISNSKVLLV
FT                   GAGGIGCELLKDLLLMGYGEIHVADLDTIDLSNLNRQFLFRQKDIKKSKANTAVAAVAL
FT                   FKGNTRLEPHHGNIMDVSQFPLSWFRQFDIIFNALDNLEARVYVNRMALFINKPLIESG
FT                   TTGLKDSAEEFIDSVVEKIFVEDIVRLAKIDTLWKTRQKPIPLNYELYSKKLKELPTSI
FT                   ISDDQKIWTTEENLFVLIDSLKRLQARYKSEGVLDFDKDDKDTLDFVVAAANLRSFIFG
FT                   IETKSEFEIKQIAGNIIPAVATTNAIFAGFSSLQSLNVFSDDPVGNSRLIYDSEYINKF
FT                   VTQCPPLPGNSNCKACGIQRGIITVPSLDIQLGEIHKQLLKKFGYSDDVSIVVGNNRLI
FT                   YDYDFEDNLISSLKDLTIGSGSIFFVSDSDDDLQDIELYLEVAPQETDITLTDITIKKK
FT                   PLKKKESKEEVTIQDDQMEEIFDEDEILLIDEPAEKRPLEIEQEETYSKRKKSTI"
FT   CDS_pept        219568..220668
FT                   /locus_tag="PAS_chr2-1_0120"
FT                   /product="Subunit of mitochondrial NAD(+)-dependent
FT                   isocitrate dehydrogenase, which catalyzes the oxidation of"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68724"
FT                   /db_xref="GOA:C4QZQ0"
FT                   /db_xref="InterPro:IPR004434"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZQ0"
FT                   /protein_id="CAY68724.1"
FT                   /translation="MFRQYSRAIRSTPFTRSYATNVAQFLGQKNSNGKYTVSFIEGDGI
FT                   GVEISDAVKQIYSAADVPIEWESCDVTPLFINGKTTLPQQAVDSINKNLVALKGPLATP
FT                   VGKGHQSLNLTLRRTFNLFANVRPCKSIQGYKTPYENVDTVLIRENTEGEYSGIEHTIV
FT                   PGVVQSIKLITKVASERCIRYAFEYARSVGRKEVLVVHKASIMKLSDGLFVKTAEELAS
FT                   EYPEIKLSFELLDNTSLKLCTDPSDYKSLVMVMPNLYGDIMSDLSSGLIGGLGLTPSGN
FT                   MGDKVSIFEAVHGSAPDIAGKNLANPTALLLSSCMMLRHMSLNSYADKIENSVLKTIAS
FT                   GPEHRTKDLKGTSSTSNFTEQVIKNL"
FT   CDS_pept        220873..221508
FT                   /locus_tag="PAS_chr2-1_0121"
FT                   /product="Phosphoribosyl-glycinamide transformylase,
FT                   catalyzes a step in the 'de novo' purine nucleotide biosy"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68725"
FT                   /db_xref="GOA:C4QZQ1"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZQ1"
FT                   /protein_id="CAY68725.1"
FT                   /translation="MTPKILVLISGNGSNLQALINAKEQGQLKAEISLVISSSSKAFGI
FT                   ERARKHNIPVRVHELKSYYQGIPKEEKAKRAEKRNDFDQDLVKIILSEKPDLVVCAGWM
FT                   LILGEKFLQPLQEKNISIINLHPSLPGAFEGINAIERSYNAGQNGEITKGGIMIHRVIL
FT                   EVDRGQPLIVREIDVIKGETLESWEARIHSLEHQAIVDGTNKALDELK"
FT   CDS_pept        complement(221574..222371)
FT                   /locus_tag="PAS_chr2-1_0122"
FT                   /product="Endopeptidase with trypsin-like activity that
FT                   cleaves after basic residues"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68726"
FT                   /db_xref="GOA:C4QZQ2"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR024689"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035216"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZQ2"
FT                   /protein_id="CAY68726.1"
FT                   /translation="MAGLSFDNHQRNQFLSAKGFGSPKATSTGTTIVGVKFEGGVVIAA
FT                   DTRATSGPIVADKNCEKLHRLSPTIWCAGAGTAADTEMVTQLIGSNLELHAMSTERKPR
FT                   VVTALTMLKQHLFKYQGHIGAYLIVGGVDPTGAHLFSIHAHGSTDIGFYQSLGSGSLAA
FT                   MAVLESNWKEGLTKEEAMKLCTEAIEAGIWNDLGSGSNVDLCVMEVGKDAQLYRNYLKP
FT                   NVREAKVKSYKFARGTTAVLKESIYNLVDIEETVVPMEVDTEA"
FT   CDS_pept        complement(222543..225605)
FT                   /locus_tag="PAS_chr2-1_0123"
FT                   /product="Mitochondrial isoleucyl-tRNA synthetase, null
FT                   mutant is deficient in respiratory growth"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68727"
FT                   /db_xref="GOA:C4QZQ3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZQ3"
FT                   /protein_id="CAY68727.1"
FT                   /translation="MLRRRALFTVEGRRYFSSCLSRCYSVSSDSGSDVSHKYSSTLRLP
FT                   KTSFPNRSSSELISSKLLPQCTDDVYYGNLNNTDRELFILHDGPPYANGELHIGHALNK
FT                   VLKDIINRFNLIDGKRVFYKPGWDCHGLPIELKALEALRKEQNTRVKILKSQLKKTTNE
FT                   EERDNIEHEIKQVKRSKLTPSDIRTLARSFALATSEAQSKSFQELGVMGDFKNPYKTLD
FT                   PSYVINQLYIFKQMMDNGLIRRQEKPVYWSCENATALAEGELEYNDSHNSTAIYLKFPV
FT                   DTTDLKELSSLGNKVNLLIWTTTPWTIVANKAVSVNSKLDYTILKHQSEYLIVALDLAS
FT                   QVMSSKEGIEDTKIHLSGAQLLKTTYINSLTGGVKQPILDGDHVTNVAGTGLVHTAPGH
FT                   GNDDYWVCLKNDIAPYSPVDSFGRYTPDVPESCKDLIGLHVLKEGAPKVVEKLTNLGAI
FT                   FSIQKNYIHSYPYDWRSKKPIIIRSTPQWFINIDQIKERTLKTLQDVKFYPDKGFKRLE
FT                   TFIQRRQEWCISRQRSWGVPIPVIYEKDTGKEILNDEVIGAITKYIEGAGVDSWFDKNC
FT                   DMSNFLPESMKADSEKYVRGNDTMDVWFDSGTSWHLIEDFLKHNGQDINSRNYLADVYL
FT                   EGSDQHRGWFQSSLLTKMAICKDKEKTISPYRKIITHGFTLDEKGNKMSKSLGNTLKPQ
FT                   DVINGVKSKNIPALGVDGIRLWVAQSDYFTDVAIGPTILKHVAENLKKIRFTIKFILGN
FT                   LEGFSMDKSVPYQDLQLLDQYALSKLYSLQQICKESYSEFNFSKVVRNLNHHMNVELSS
FT                   VYFDLVKDRVYADAPDSASRRSVQTVLVAILQSYISILSPITPIIAQEAWNHAPRYVTN
FT                   DTKSPFSKGWHELPQSYRRADLELEFSQLFELNSTIKLLMDQGSRVDKSIRNTLETAVY
FT                   LNCEEGTPVWDLLQKHQSYLSDYFLTSQVFINQELPDFSVSYHYEDKIRLDCGTIDVHV
FT                   VQSSLHKCPRCWKYEVRPDHELCHRCDKVVN"
FT   CDS_pept        complement(225734..229303)
FT                   /locus_tag="PAS_chr2-1_0811"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0811"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68728"
FT                   /db_xref="InterPro:IPR013935"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZQ4"
FT                   /protein_id="CAY68728.1"
FT                   /translation="MTDPNSYIVPARVNIRLVPLGISLSTFEKYTKLLKEIFEIRLLDV
FT                   TPDRGTFNPQGFPYGRILFNYTTCRCDPDSLFLYDLEPFRKVFILVGVTDEKYIKDQAL
FT                   EDSLRLLKVQNPDVITHNLVVFGDEAKEDEQLNNLENVFFQKFRSLETIMCDISSNFLQ
FT                   SLSNYAASYKHVTLRSPGSIASGNITRITSSAVVTNIIEKQKKRFSVSFDQGFDRKLRV
FT                   KARQQKLLGNLYLLSGRLNDSLKEFCESIYGLKSCNDYLWLASSLEGMGVCCLLLSMIG
FT                   SSFTLPNHVLSILNTITKDSLLLNLVSSPSASPRSSLQSMTNINANTTTNTANSNKEFG
FT                   QERILELLTSVHDKVISYYKLSIPSADDYVPQIVYCETVLRYTKLCTMVHLNGKMDKNT
FT                   FPFLVNGKKAPIENFQPIVSESLDSISTFDRLSIVANLQELSDVEFEKLTLVQKCLIYS
FT                   SLVSIYGDLQYHRKKAFYLKLLLNTIHPSLGKLDVPVDTLSKYRELFEYLLTVYNIEQS
FT                   SSWLLLQKSILLVILSFSTKLDDRQLLSRVSYLLLNRFHEALSTKEQEHIFKTHLSNTS
FT                   EDQEFFNDHLLQNLGYPDNGNNYKISPSKDKTLVVQGESFVYNPYLKEKSNSPQRFIIM
FT                   KDEISQVSLTLYNPYAFELDIANIELTTVTRDIKLKILKVDFLKNEENSHFTAITLKPK
FT                   ASLNVLVIFIPLDIGTLEIDGFQANVCSCKQTKFKVVQGTENHAAANSTRSLIFDVMHP
FT                   QPVLSLTSVSLHNSSLMLLEGEETQFEANLKNYSSIPIGYLQYVITDSTYEPLLQILSN
FT                   RKLPVNEIYEIEYHLFEKKALKILNEEVLGEIESNKSVRLQVGILGKRGMKSANINLQY
FT                   CHKKGANMLRNLDIPINVTVFPSIELDAYDFYPLLGSSQSGLLNEQTGYLSKFLSRIVS
FT                   EGKKISDYCILSLDLRNSWNEPLKVEFSLATDVDCNFSIKETIPSFKTRKLLLPLKRFK
FT                   ISAEKLAEPIPNFREKQFIVDKISPGERKNMLQLFWYRYNLLQMIQGRWKNEPETRIGS
FT                   VDTRGLRLSTKMVNTLSVGEVDIDINLFQDSKEIEGDLVRPVNVHECYNVVVNIHNNSS
FT                   SALKGILRHVPYCMQTKKSIDQKVLFNGTLQYAITDPISTGASRSFTMGAIFVEKGFYE
FT                   WGVILDNDDNQYLETEPLKVIAR"
FT   CDS_pept        complement(join(229592..232116,232194..232197))
FT                   /locus_tag="PAS_chr2-1_0812"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0812"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68729"
FT                   /db_xref="GOA:C4QZQ5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZQ5"
FT                   /protein_id="CAY68729.1"
FT                   /translation="MVNFTVDQMRSLMDKVTNVRNMSVIAHVDHGKSTLTDSLVQRAGI
FT                   ISAAKAGEARFTDTRKDEQERGITIKSTAISLYSEMGDDDVKEIKQKTEGNSFLINLID
FT                   SPGHVDFSSEVTAALRVTDGALVVVDCVEGVCVQTETVLRQALGERIKPVVVINKVDRA
FT                   LLELQVTKEDLYQSFARTVESVNVVIATYTDKTIGDNQVYPEQGTVAFGSGLHGWAFTV
FT                   RQFATRYSKKFGVDRIKMMERLWGDSYFNPKTKKWTNKDKDAAGKPLERAFNMFVLDPI
FT                   FRLFAAIMNFKKDEIPVLLEKLEINLKREEKELEGKALLKVVMRKFLPAADALLEMIVL
FT                   HLPSPVTAQAYRAETLYEGPSDDQFCIGIRECDPKAELMVYISKMVPTSDKGRFYAFGR
FT                   VFSGTVKSGQKVRIQGPNYVPGKKEDLFIKAVQRTVLMMGRTVEPIDDVPAGNILGIVG
FT                   IDQFLLKSGTLTTNEAAHNMKVMKFSVSPVVQVAVEVKNANDLPKLVEGLKRLSKSDPC
FT                   VLTYISESGEHIVAGTGELHLEICLQDLQDDHAGVPLKISPPVVTYRETVTNESSMTAL
FT                   SKSQNKHNRIYLKAQPIDEELSLAIEEGKVHPRDDFKARARIMADEYGWDVTDARKIWC
FT                   FGPDGTGANLVVDQSKAVQYLHEIKDSVVAGFQLATKEGPILGENMRSVRVNILDVTLH
FT                   ADAIHRGGGQVIPTMKRVTYAAFLLAEPAIQEPIFLVEIQCPENAIGGIYSVLNKKRGQ
FT                   VISEEQRPGTPLFTVKAYLPVNESFGFTGELRQATAGQAFPQMVFDHWANMNGNPLDPA
FT                   SKVGEIVLAARKRQGMKENVPGYEEYYDKL"
FT   CDS_pept        complement(232523..235630)
FT                   /locus_tag="PAS_chr2-1_0124"
FT                   /product="Elongation factor 2 (EF-2), also encoded by EFT1"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68730"
FT                   /db_xref="GOA:C4QZQ6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002219"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011072"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="InterPro:IPR036274"
FT                   /db_xref="InterPro:IPR037312"
FT                   /db_xref="InterPro:IPR037778"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZQ6"
FT                   /protein_id="CAY68730.1"
FT                   /translation="MSDTSNDEVIKDILKKIERERNIAQGASNIRKKTNNAEIIQNCNT
FT                   SIREAQQNIEYLEQTLSKLQLEQHNRAARGSNQGELTQQKVLKTSPPTFTFLDLLKYDC
FT                   PSLGHRIHYMLQLLEFKLQVEKQYREANEKISRLYQVDGDRRSIAAAEGGKVESDMKIH
FT                   LMKMALKNYHDVHVNIDEVARDTEVMNTFRKKPLSGTLSITINSIRDILHVSSIFSKKL
FT                   ETLVSIRIDDVEKARTKPTKNQRVNDSFQIHVEKGNELSLIVYDKVGDTLTPVAMIWFL
FT                   LSDIVEEIRKKKVDRELNATGWMSASNLAGRPEQQQPQQLGSHPFDNQQGNLQSLQTHT
FT                   SHSNGDTDPAQLSASAWFVLAPAGQILLTMGFNKTNDAGQKKEFMGGLGRHGAIRQRKE
FT                   EVLEQHGHKFVPRQFYNIMMCAMCGDFLPYSGYQCEDCRFLCHKKCYQKVITKCISKSS
FT                   IDVDPEETKLNHRIPHKFEPFSNHGTKWCCHCGYILPWSRKNVYKCSECGVVCHAQCTH
FT                   LVPDFCGMSMEMASKILSTIKETTATRQQRQAMSMSSKSSGKSDTHISQKQLPPVPSAA
FT                   QRLSQSDEAPKTKPIRRPPPPPPPVSNEQRVLPQREEPQVEPERTPNQAIAEAGYALEK
FT                   QISSTSSSKETDHHHQHHHYHPQQQPQQQVKTVKTAVASDVSPTKVAVKKQEAARRSSE
FT                   RHHGRHRQKYGLDDFRFIAVLGKGNFGKVMLAESIHTGQLCAIKVLKKDFIIKNDEVAS
FT                   TKSEKRVFIIANRGKHPFLLNLHQCFQTENRIYFVMEYVSGGDLMWHAQQRTFSPSRAK
FT                   FYAAEVLLALQYFHENGVVYRDLKLDNILLTADGHIKLADYGLCKEEMWYGSTTATFCG
FT                   TPEFMAPEILKEQKYDKAVDWWAFGVLLYQMMLGKSPFKGEDEDEVFNSILTDEPRYPI
FT                   QMDRESVDILQQLLTKDPYKRLGASEEDAEEIKRHPYFHGINWDDIMQCKVPPPLIPTI
FT                   KDRHDVSNFDVEFTTEAPKLTPVNSVLSLSMQEQFRGFTYVNDDHT"
FT   CDS_pept        complement(236012..239695)
FT                   /locus_tag="PAS_chr2-1_0125"
FT                   /product="RNA polymerase II second largest subunit B150,
FT                   part of central core"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68731"
FT                   /db_xref="GOA:C4QZQ7"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR007646"
FT                   /db_xref="InterPro:IPR007647"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="PDB:5X4Z"
FT                   /db_xref="PDB:5X50"
FT                   /db_xref="PDB:5X51"
FT                   /db_xref="PDB:5XOG"
FT                   /db_xref="PDB:5XON"
FT                   /db_xref="PDB:6A5L"
FT                   /db_xref="PDB:6A5O"
FT                   /db_xref="PDB:6A5P"
FT                   /db_xref="PDB:6A5R"
FT                   /db_xref="PDB:6A5T"
FT                   /db_xref="PDB:6A5U"
FT                   /db_xref="PDB:6A5V"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZQ7"
FT                   /protein_id="CAY68731.1"
FT                   /translation="MSYDPYSIDDTITTEDCWTVISAFFEEKGLVSQQLDSFDEFMETS
FT                   IQDLVWEEPRLILDQPAQHTNEKDNINKRYEIRFGKIYLSRPTMTEADGTTHAMFPQEA
FT                   RLRNLTYSSPVYLDMEKSMFTSIDDEGNPNATLDWQQVHEPIKDGVEEGNKVHIGKVPI
FT                   MLRSKFCSLRTLDEVDLYKMKECPYDMGGYFVINGSEKVLIAQERSAANIVQVFKKAAP
FT                   SPISHVAEIRSALEKGSRLISTMQIKLYGREDKGTGRTIKATLPYVKQDIPIVIVFRAL
FT                   GVVPDGEILQHICYDENDWQMLEMLKPCIEEGFVIQDKEVALDFIGRRGSAALGIRREK
FT                   RIQYAKDILQKELLPHITQEEGFETRKTFFLGYMVNRLLLCALERKDQDDRDHFGKKRL
FT                   DLAGPLLANLFRILFRKLTREIYRYMQRCIETDRDFNLNLAVKSTTITSGLKYSLATGN
FT                   WGEQKKAMSSRAGVSQVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCP
FT                   AETPEGQACGLVKNLSLLSGISIGSPSEPIINFLEEWGMEPLEDYDPAQHTKSTRIFVN
FT                   GVWTGIHRDPSMLVSTMRDLRRSGAISPEVSIIRDIREREFKIFTDVGRVYRPLFIVED
FT                   DESKDNKGELRITKEHIRKIQQGYDDDAMNDDSEEQEQDVYGWSSLVTSGVIEYVDGEE
FT                   EETIMIAMTPEDLQTRSLEQKEIDLNDTAKRIKPEMSTSSHHTFTHCEIHPSMILGVAA
FT                   SIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLAKTQAMEYL
FT                   KFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKRFGISIV
FT                   EEFEKPTRATTLRLKHGTYEKLDEDGLIAPGVRVSGDDIIIGKTTPIPPDTEELGQRTK
FT                   YHTKRDASTPLRSTENGIVDQVLLTTNQEGLKFVKVRMRTTKVPQIGDKFASRHGQKGT
FT                   IGVTYRHEDMPFSAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVGSIRGYEGDATPFT
FT                   DLTVDAVSNLLRDNGYQSRGFEVMYNGHTGKKLMAQVFFGPTYYQRLRHMVDDKIHARA
FT                   RGPVQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAAGFLKERLMEASDAFRVHVCGIC
FT                   GLMSVIANLKKNQFECRSCKNKTNIYQLHIPYAAKLLFQELMAMNIAPRLYTERSGVSM
FT                   RS"
FT   CDS_pept        240254..240898
FT                   /locus_tag="PAS_chr2-1_0126"
FT                   /product="Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68732"
FT                   /db_xref="GOA:C4QZQ8"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZQ8"
FT                   /protein_id="CAY68732.1"
FT                   /translation="MSAPRGLATVSPLSRKWYDLSQKAIEQGKPHFRLGQKKIYFPSAR
FT                   VILLRPNAKHTPYQAKFVVPKSFNKLDLRDYLYHIYGLRAFNITTQLLHGKFTRSLPMP
FT                   FRARRRSPQIKKMTIDMQDPFVWPEPQNSYLQDELDLSEESKQYFQDRTSPGADKNKRS
FT                   LAFGGIIDPEPAAENFVPKKLSRQMKNKKQKALEQEKRQSQEELIRQYISL"
FT   CDS_pept        complement(241114..241869)
FT                   /locus_tag="PAS_chr2-1_0127"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68733"
FT                   /db_xref="GOA:C4QZQ9"
FT                   /db_xref="InterPro:IPR004345"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZQ9"
FT                   /protein_id="CAY68733.1"
FT                   /translation="MLGLLLGLIGWVISVGFPLVKSYQSIVTSSKESTVNWLIYWIIYS
FT                   INLYITSCGPFQLIFGYVPFFSVVNLYFHCWLVLPLIDVSKYNTLKENEVLSSLLQNHM
FT                   VNGGDKRVNGALLLWFLYLDPMLESGLQNLDLNSDNIWNQLQSLLVRLAQRYTPGAPSP
FT                   AAAVPEKQANQASKFSPLLEFGKLAMLSESLLKYPLSLIDGEKTSTASSTVSSVAEFDI
FT                   VNRDELEGENSPNNNSPKQDNWFWKTKSE"
FT   CDS_pept        complement(242072..242320)
FT                   /locus_tag="PAS_chr2-1_0128"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68734"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZR0"
FT                   /protein_id="CAY68734.1"
FT                   /translation="MKLGKNYDPAVFPLILVPCFNRNDGPHAEKSSPDVRLVSGWLKST
FT                   PHIYVHQGKTSNPRSYRFRGVYTDCSGSTEIITVQKH"
FT   CDS_pept        243124..244884
FT                   /locus_tag="PAS_chr2-1_0129"
FT                   /product="Proline permease, required for high-affinity
FT                   transport of proline"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68735"
FT                   /db_xref="GOA:C4QZR1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZR1"
FT                   /protein_id="CAY68735.1"
FT                   /translation="MPFQNIKNKMFDKKTSTTVSVHEEEALESGNSSINNSGVQQLSYD
FT                   GTDYKPSEAPEVDEDDINNVHRGMKSRHILLIGIGGCIGTGLFVGTGANLAKTGPAPLL
FT                   MSYLLMSFAIWSVMNNLSEMATYLPLKGVSISGFVSRYADDSLGFACGYNLFYTFAIMV
FT                   ATEVTAVGLIIEYWNDDIHIAIFMTVFLAAIVILNFLPNKYFGEMEFWFALIKVLCILG
FT                   LIVTGIVIFFGGAPSRDRIGFRYWKNPGAFAERITPGAGGRFLDVWTALILSGFSFILG
FT                   PELIITAAAEAKRPRYNIPKVANSFIWRIMFFYIAGSLVVGCTVPYNHPRLLSGGSNAS
FT                   ASPYVIAIQSAGIKVLPDIINACILTSAWSAGNAYMFSGSRMLLQLAKVGQAPQIFNRV
FT                   NKYGVPWTCMILVSAISCLAYLNVSAGSAKVFTWLSNLCTISGFISWLCSSVAFLRWRK
FT                   AMILQGRWDSRPYKTALQPYATYYALFLLGMVVLTNGYDVFIKGRWDTATFIAAYVTIP
FT                   PFVILWLGHKFFFNKHKRLLRPVSEIDLVTGLQAVEAEAEKDFFEIEQERATSTAFNNP
FT                   FLRAFHYILY"
FT   CDS_pept        complement(245149..246549)
FT                   /locus_tag="PAS_chr2-1_0130"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68736"
FT                   /db_xref="InterPro:IPR022617"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZR2"
FT                   /protein_id="CAY68736.1"
FT                   /translation="MDPPKKKKKASSLKGDFFAFQDDTFGFPKKKRKTSKTKRTKDQEG
FT                   SSESKTDANLNLLSPKKNSNRRSTRKSETTEHTPAGPQIVDIDEKSDATDKNNDTDNEC
FT                   VTPPPIIEHEMPLFDYDLTKEVSTTPIPVEAEPDVPKIIDPYKSVKCLVSITNQMHYFE
FT                   NSTVDLMVKCGTSFGKIMDTALKQLNSDLDSFKKYQPTLVLNNEHEIKRHLKVSSLITS
FT                   NLLSPQASDNDVLKLSLTLMSSQQYELMNLQREMRLQTLSTKNDLQNIEKITPIEDDLN
FT                   DDSEYFTIGLQCAQDDISKVIMVCSNTPLKRVQEYYLLVMGYPRALSTNLSYQEMPISR
FT                   YSTIEESEIRKNTILHIDYEEKDLQALREQTEDHEESLLIDDIVKDEKKTDRQFFIHMK
FT                   SNDGKEPIKLSVSKNTPISFIKDYYLTTQGLPSSTKVQLLFDDESLNMSSKVGDTELDE
FT                   DFLIDVVI"
FT   CDS_pept        246793..247311
FT                   /locus_tag="PAS_chr2-1_0131"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68737"
FT                   /db_xref="GOA:C4QZR3"
FT                   /db_xref="InterPro:IPR007763"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZR3"
FT                   /protein_id="CAY68737.1"
FT                   /translation="MNKLMDNLVPVWKQYLYTWQSLRNIPFRKKWFIGYDLSGNTYWEF
FT                   IVERNSKNYRRKMVPYQRKDFMHDYYESVPPQWQQWLRFVKQHPPTLTELIADRQRQEA
FT                   IKELAKNADRRWQLETQKQEDYDNWKLNKELNRMNVRQTPGGRPPPFSGKSTHSNDDPI
FT                   SSANVKSNR"
FT   CDS_pept        complement(247387..250269)
FT                   /locus_tag="PAS_chr2-1_0132"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68738"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZR4"
FT                   /protein_id="CAY68738.1"
FT                   /translation="MDTKIQHIFGCSSKKTSQFAVCQSKNLIGYVTSGGVVVSEVDLKE
FT                   NAVKSQRFFCANNKKSKSSRQTLESNDSNANAYLNLAINSGLLDDDTHVESDSLEYYTR
FT                   DGLSISHASDSASFTPTNTNVSKLTHKVRVISCIDISSDGKLLAVGEEGYQPRVLVYSL
FT                   EPNSTNSPLFCISDHRFGINLVKFSPKNDKLCSLGISNDGFLNCWKLRPTSSSNKVLFL
FT                   GSNKCLSTINGLIWKGNDIVVTFGLRHIRLWNCSFNDSIELCKEIFEKAPPTSPTKPHV
FT                   QLIKGKNVILKDFINSNFLSCSWFNEDELLVLTDRSEIACFNLYDDPIQLQKLDVHLAE
FT                   TTNQIYLGDSLYYNSGELIKSMELESIKIAEDLTIQPTPYSPRKTQVRDGLISLLKFGD
FT                   FFACLNDKDEIYLIHKDGTLACVIADAMFKCSVDFKSIGKKGLNLSSSGELVQFDFDSH
FT                   NFKSITLLRFQQPGTDSLEHEFSCFEYSCKNREIFFGDKFGLVYFFNDGNLVKSIKAHE
FT                   SSVNQMVYAKLGADAHLLVTVGRDRMIQLFFKQGSPWELFQTLSIHRGNLSQAIIHNER
FT                   LYVCSHDRTISVHELKFKDQLSVNLLKVISLKSTPLYMEIVDNELYVSTNDRSVMIFNL
FT                   HSFEVFKTLKLHSALNNDSLLIEKFFVAQQDDTKLLVTCSSTDKSISIFTLSGDLLNSH
FT                   WAHGDAVVSMTRLQDSLHFCTISGNGCCFFWSLSFGPLKVAVKNEKMDSSLLESPTTKV
FT                   ARRIVNSPRSPPKSPQPKTLVSMAGSPSVKTDNTLHRLSPTKRLYPNGRVPLGSSSILN
FT                   SQTVVKNISPTKSSNVFADKGRDKEQHINTSPQKTRPKSLILTTPKNRTRGRLVKPSIS
FT                   EAAEKLISQLKEFQAEFETVEPLTQSTITALRLELERTLSFVNDDGDTEHTSNDDTSER
FT                   DVQADNSSLLESFSNQLVALVEKKLQINGA"
FT   CDS_pept        complement(join(250525..250893,250962..251103,
FT                   251180..251403))
FT                   /locus_tag="PAS_chr2-1_0133"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68739"
FT                   /db_xref="InterPro:IPR025340"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZR5"
FT                   /protein_id="CAY68739.1"
FT                   /translation="MPYGYDWPDELYGYWCNSGYESEPDTDEIARAEEFYDEREDYIDK
FT                   SLFPLEFEPPACVTEKKVDLADFGSLNLLNKINEDIIATVFYYHDSENIGDSKISFRNA
FT                   AVSPNVTVVDGDRVMARRTLIFPNVYQHRVEPFELADKTKPGHRKILCFLLVDPNNQQT
FT                   VATDKVPAQQQNLSGDKITSSVDRTSYIIPTENLDLTDSAFQYTISSDEAKKVREKLMK
FT                   GRTPEEEDERGGSTAYTSFFIP"
FT   CDS_pept        complement(251553..251921)
FT                   /locus_tag="PAS_chr2-1_0134"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68740"
FT                   /db_xref="InterPro:IPR025340"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZR6"
FT                   /protein_id="CAY68740.1"
FT                   /translation="MGPNENVLLLDRALDEDFTESLKKLVYEKLEDVPEDSKDWRPGSD
FT                   NQVLDLVHPSLYPLQYGKTKVMTGNLFEVSKMIVPKDIPTYTNCLGKDYLSEIYQWLPS
FT                   IFHVSKKDGGTMWTYNLY"
FT   CDS_pept        complement(252727..255516)
FT                   /locus_tag="PAS_chr2-1_0813"
FT                   /product="Cu(+2)-transporting P-type ATPase, required for
FT                   export of copper from the cytosol into an extracytos"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0813"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68741"
FT                   /db_xref="GOA:C4QZR7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZR7"
FT                   /protein_id="CAY68741.1"
FT                   /translation="MFQTKVTITGMTCSACVNSITQNLQSLDSVEEVSVSLMTETGTIV
FT                   HGDGISPKDIIEVIEDSGFDCELISSDPVLSEPEKASYQNETTVKLQVIGMTCTNCSDT
FT                   VESMVSQLDGVLSAHVALVTEECVVRYLPRQVGIRKIVETIENCGFDVLLLNNTLVDKE
FT                   SQLNILAKVKEIQYWRLTFVQNLIFGVPVFFLGHIFPMITHKNVKLFNGLTLTDFIQLV
FT                   LASYIQLWLARKFYTNAYNSLRHGTGNMDLLICLSTTIAYGYSIITLLHAILGANHTQP
FT                   SVLFDTSAMLFIFISFGKFLENKAKSHSSTALSKLLALSPTSCLLIENFSSEKDIESTS
FT                   LVTKEIVPELLQLNDMVLIHPGSRIPCDGTVVYGKSDVDESLLTGESLPVLKEEGAKVI
FT                   CGSVNNSGVLYVKVDKLSSDTELQQIVDLVKDAQMSKAPVQRFADSVSSIFVPTILSLS
FT                   VLTFIVWFMVVKCRSFSSVPTFFKDGDHISIERVFKVAISVIVVACPCALGLAAPTAIM
FT                   VGTGVGATNGILIKGGEVLENASSIECVLFDKTGTITTGLMQLSRYSLNPTVSNISESD
FT                   LWHIIGRLESNSEHPVAKALSKISMEKSVESKPEITVSNVDIQVGAGIKADVTINGEVL
FT                   KVSIGNEKICSTIQSNEEICGTHIYVLINEVLQGYVELSDMVKSDSAQVVSYLMSQGIS
FT                   VALVTGDNQATAEKVASKVGIFKSNVFANVSPSEKAGIVQEIRSEFGFKIAFVGDGIND
FT                   APALVDADIGIAIASGTDVAIEAADIVLLSNDSNSISGLISALSISRATFKKIKMNFFW
FT                   AFIYNAFMLPIAMGVFLVPFGLYLHPMVASAAMAFSSVSVVLNSLLLKLWKKPDISSFK
FT                   FSAPNTSNDLDINTDLETGSLIKRFQKSTPSKKYFNLLDKLKFWSSPTRKESYELLAQ"
FT   CDS_pept        256230..257894
FT                   /locus_tag="PAS_chr2-1_0135"
FT                   /product="Helix-hairpin-helix protein, involved in DNA
FT                   repair and replication fork stability"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68742"
FT                   /db_xref="GOA:C4QZR8"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZR8"
FT                   /protein_id="CAY68742.1"
FT                   /translation="MCMPEDQGRGEPSRTMDLPSDLKHLFLKWLEDDCIVQIQLGSKRA
FT                   LQLTRAMENLKRTDEAIDNVNKLKTVRYIGPKITEFLNKKLLKYCNDNGYRVPDWCKTA
FT                   ETTTSSRKPATQKVAKPSTSTGLTGALPGGRSKGRRKYVPAKNSSAYAILISLLVNDSA
FT                   QTGVQKSTVIAVASKYCERSFTTNPATGQFYSAWNSIKTLMNHELVVESTTKRPALYYL
FT                   TDEGKLLATTLVQEMPEHQRPQIDGNDEDYDARQSTPAAYFASCGYQEWSDFTIKMIID
FT                   NREIRSQTERDFFQNKMSDANVPIEIRPLPVGDVLWVARSEAGEEVVLDTIVERKRLDD
FT                   LVASIQDGRFLEQKSRLKETKLKNIIYITEEFTSTNLGQMAGAVQTSLSMIMTNFQFRL
FT                   HRTKDADATCKFLSILHRSVCNRFQNKPIICINAMKLDDNSLPAFQDSLMKFRKEMDKD
FT                   GCYIYINYSIFHSIFGKSSLVSLKETYIKMLMTTKGVSLDKAIQIQRHYPTPQSLIKAF
FT                   RESKDPKLLSQHFKQEIITHKKVTAILSEKIFQTWGI"
FT   CDS_pept        258071..259696
FT                   /locus_tag="PAS_chr2-1_0136"
FT                   /product="Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68743"
FT                   /db_xref="GOA:C4QZR9"
FT                   /db_xref="InterPro:IPR007603"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZR9"
FT                   /protein_id="CAY68743.1"
FT                   /translation="MSEKYSRPAQPPPTYNQPGGGQSPFNEPYYPQQGVNSSDYHQQQR
FT                   PDYDPESQFPPEKIVGSGKPDNAETFDDSFKVKNKLNDWPFTILFIATLAGFVVVAGIV
FT                   LSAWASNYSTSGSGIYDSGASFTLNTNTVVLFAFVIVISLVLAVLMLCFARIAPKRFIQ
FT                   VGIVLNVVLGLASSIYYLAVGYYSAGVVFLVFTLISAYCYWSMRGRIPFSATVLTIVID
FT                   VMKRNPSTLMTSLIGIIVSGAFAALFSATVVATYMKWTPSDENGNCSFNEGSTSCSRSK
FT                   VIGILVFVFFAGYYITEVIGNVIHVTISGVYGSWYYLSRSDQGMPRFPALGAFKRAMTW
FT                   SFGSICFGSLIVALLQLLKTIIQILKNDAMQNGEGWQTIILCCADCILGLIEWAVRYFN
FT                   HYAYSFVALYGESYMKSARATWDLFRAKGLDALVNDCLIGAGLSFFALFVSYLSALFSY
FT                   LYLRYTAPGYNSDGSFYAPVIAFTFVIALQIVNIASSVIRSGTATFFVCLARDPEVFQI
FT                   SYPDEFSRIFADYPQVMNKVAARQ"
FT   CDS_pept        complement(join(259820..260768,260875..262673))
FT                   /locus_tag="PAS_chr2-1_0137"
FT                   /product="Nuclear import receptor, mediates the nuclear
FT                   localization of proteins involved in mRNA-nucleus expo"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68744"
FT                   /db_xref="GOA:C4QZS0"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013598"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZS0"
FT                   /protein_id="CAY68744.1"
FT                   /translation="MTMTLDKLNQALTSMYGSTDESTQHAADKFLLEFQKSPEAWTIVF
FT                   QVLNNDNDPPMTTIKMFCAQTLRSKINYDLFQLPKENWQGLKDSLLQLIVKYDSKAKAI
FT                   ETQLCVSLANLALQYVEWSNAMDEIISVLSSGSMASLLEFLKVLPEELSDVNKTPLTDE
FT                   EFSLRTTQLITDNVERVLLILKKFSDVKDSNGGRENSMVLDCLNSWIKEVSVDQLLKVR
FT                   SLSDMIYQSIHNDETFDTAVECLCTILRETTDVEDLTIVQTLYQQLLSLKDVIQESWDD
FT                   PEKMEGLTRIFVEAGEAWHVLIPKLCEDFKPLVEILLQLTSYEDDLDTVKYTFFFWHQL
FT                   RQIIIIDKYAEARILFTPIYTQLIHVMIKHLSYPIVEPNTTDSSLLFSTKQQEDKFKDF
FT                   RYEMGDVLKDCCAVIGASNALSIPLNQIQSNVNSNQPWQSIEAPIFSLRAMAEQVRSTE
FT                   NKLMPQVMQLLIKLPENPKIRYAVTLVLGRYTEWTSKHPEYLEGQLSYITDGFQSNNNQ
FT                   ITIAASHALMFFCQDCSSLLIGYLEQLFNFYNNVYSAGTLDIKSLYEVADGIAHILQEE
FT                   GDPEKLMQLTAMFWKPTIEKLSSLPSNPIAKLVIEQGWPIVTKLLNKFGKSTPITERAL
FT                   KFLNKSMSSLSTYLEPIIPQMAELLVSGFQTYREGAYLWVSGIFIREYGDEHVSAQIKE
FT                   NVWKFSLQQAASFIQFLEQNQSEITNYPDLVEDYFRMMADILMFFPIHLIQSELLQPVY
FT                   NSAIMALSTFSQFEPLIATLHFLIDLYSWGFETPPVSLLETDVPPEIRRIILSFIESTG
FT                   GPLTKVLLNGLVYRFPVDCNHDASDLWTKIIRLVTINGQNGDLVLQWLNEALSSLPEGT
FT                   VNEKERSKLLTTVQAAINSKDFRRVRASIRDFINWYSRKNFERS"
FT   CDS_pept        join(262820..262846,262920..263159)
FT                   /locus_tag="PAS_chr2-1_0138"
FT                   /product="Core Sm protein Sm E"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68745"
FT                   /db_xref="GOA:C4QZS1"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR027078"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZS1"
FT                   /protein_id="CAY68745.1"
FT                   /translation="MSSSRTQKVMVPPINLMFKFLQQQSTVQIWLYEQNNTRINGIIKG
FT                   FDEFMNVVVDEAIEINLKTQKQRKLGRLLLKGDNITLISTLSN"
FT   CDS_pept        complement(263321..264184)
FT                   /locus_tag="PAS_chr2-1_0139"
FT                   /product="Mitochondrial ribosomal protein of the small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68746"
FT                   /db_xref="GOA:C4QZS2"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZS2"
FT                   /protein_id="CAY68746.1"
FT                   /translation="MGKNVIKHGGKSGILPPAREIFKQPIKPITIKKNPNTGYAPNIPH
FT                   PRGSTREAIVPKVVTIEEKISKTAPEPKKIYSSEELSKLSADQQWKIKNSKLRRDYLKE
FT                   SYYQEEKNLEHKEKIQHLKESKAKEEAAAASHYEVSEAFRLTLPSMEQFLEGPIVRQRT
FT                   KEEKRLLKLKREHNRLQRELAIKEQKASDLLRLCSSAKNFIVTEEELERRVEELYRTGP
FT                   KAYFNGSNMNSFEDQQALDIEKTVQEKLFGTVNEGPGISTIEDILSGETEKLKNAVEDK
FT                   VKQNDK"
FT   CDS_pept        complement(264385..266421)
FT                   /locus_tag="PAS_chr2-1_0140"
FT                   /product="ATPase involved in protein import into the ER,
FT                   also acts as a chaperone to mediate protein folding i"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68747"
FT                   /db_xref="GOA:C4QZS3"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZS3"
FT                   /protein_id="CAY68747.1"
FT                   /translation="MLSLKPSWLTLAALMYAMLLVVVPFAKPVRADDVESYGTVIGIDL
FT                   GTTYSCVGVMKSGRVEILANDQGNRITPSYVSFTEDERLVGDAAKNLAASNPKNTIFDI
FT                   KRLIGMKYDAPEVQRDLKRLPYTVKSKNGQPVVSVEYKGEEKSFTPEEISAMVLGKMKL
FT                   IAEDYLGKKVTHAVVTVPAYFNDAQRQATKDAGLIAGLTVLRIVNEPTAAALAYGLDKT
FT                   GEERQIIVYDLGGGTFDVSLLSIEGGAFEVLATAGDTHLGGEDFDYRVVRHFVKIFKKK
FT                   HNIDISNNDKALGKLKREVEKAKRTLSSQMTTRIEIDSFVDGIDFSEQLSRAKFEEINI
FT                   ELFKKTLKPVEQVLKDAGVKKSEIDDIVLVGGSTRIPKVQQLLEDYFDGKKASKGINPD
FT                   EAVAYGAAVQAGVLSGEEGVDDIVLLDVNPLTLGIETTGGVMTTLINRNTAIPTKKSQI
FT                   FSTAADNQPTVLIQVYEGERALAKDNNLLGKFELTGIPPAPRGTPQVEVTFVLDANGIL
FT                   KVSATDKGTGKSESITINNDRGRLSKEEVDRMVEEAEKYAAEDAALREKIEARNALENY
FT                   AHSLRNQVTDDSETGLGSKLDEDDKETLTDAIKDTLEFLEDNFDTATKEELDEQREKLS
FT                   KIAYPITSKLYGAPEGGTPPGGQGFDDDDGDFDYDYDYDHDEL"
FT   CDS_pept        complement(266745..268784)
FT                   /locus_tag="PAS_chr2-1_0141"
FT                   /product="Member of the ChAPs family (Chs5p-Arf1p-binding
FT                   proteins: Bch1p, Bch2p, Bud7p, Chs6p), that forms th"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68748"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR015374"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZS4"
FT                   /protein_id="CAY68748.1"
FT                   /translation="MSYVTQGSIPEVLEKYANQSLEERTNCLPAIQDLGPPDLVQLVKL
FT                   NHHSHKEISTFFYITGTNVTSSSSVAAVLNSFAMIISESPQLWFGKHKPWRVIQATFCS
FT                   YNVFSKTDAVVTVHIPGSAESHMVSSTGEKIKETEQLWLETFISSMIRSIITADDDDAE
FT                   FASIVELRKVNPLLNDESVTLFLEGFEALFWDGQKTGCHANLQLPTLLENYLVDTFFKV
FT                   LQLTRRFDQGVEIVNRLIEQDESCRVLLAKVYMLSNQEIKAMDIICQGIKINPRDAALL
FT                   TLQAEICMGKSRHDLAIHAATRAVESSPSEFKCWATLAKIYINVGNFEEALLTLNSCPM
FT                   VTHKDRYHLKRVFNPLKQDLHLPLPVDVTIDEVTTLNPADVTQEHKTVDASLLNLPAAS
FT                   LKSTFAEAYGLLTEIVHKIGWEELLRYRAKVFVMEHEYKKEKSHSATSSTTLANDATIK
FT                   AINCGNGQQNGNAVNDDDFRAKRLCERWLDNLFMLLYEDLRVYTMYRAEHMHLTAQQME
FT                   FKKTTLEWELIGMVSWRLKHFKEASEAFKYALGLRFSVKACKKLIEFYLNERSRMNQPE
FT                   TSIALNNLNQSTLSIQEILKYRSFLDINLISNLVKLGVWNHRWYAEFSPKLIESLAVVV
FT                   ENGGLIKVENEVKATYFDSQDGVYDLMNEVFKFMKHYDYPGTDN"
FT   CDS_pept        complement(269079..269540)
FT                   /locus_tag="PAS_chr2-1_0142"
FT                   /product="Subunit (17 kDa) of TFIID and SAGA complexes,
FT                   involved in RNA polymerase II transcription initiation"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68749"
FT                   /db_xref="GOA:C4QZS5"
FT                   /db_xref="InterPro:IPR003162"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="PDB:6HQA"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZS5"
FT                   /protein_id="CAY68749.1"
FT                   /translation="MTNEQAAIPRDVRLLHLIFATQNIYSYQDHVPLQLMDFAYRYTTG
FT                   TLQDATIYSDHAHASGSHISNAGNAGTNAQLTTEDIRLAIAARTNYQFKPVPPKELLLE
FT                   LAAERNKKPLPAVIPTWGIRLPPEKYCLTGKDWVLEDEEEAVSYKKRKT"
FT   CDS_pept        269892..270434
FT                   /locus_tag="PAS_chr2-1_0143"
FT                   /product="Conserved protein of the mitochondrial matrix,
FT                   performs a scaffolding function during assembly of ir"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68750"
FT                   /db_xref="GOA:C4QZS6"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR011339"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZS6"
FT                   /protein_id="CAY68750.1"
FT                   /translation="MFRSVLRANTNIAKTAFQKPATAPLLRQALQQTRAYHPKVIDHYQ
FT                   NPRNVGSLNKNLPNVGTGLVGAPACGDVMRLQIQVNDETGIIEDVKFKTFGCGSAIASS
FT                   SYVTELVRGKTLEEAGKIKNSVIAKELSLPPVKLHCSMLAEDAIKSAIKDYTSKRRVTL
FT                   GPEADAKVNLESSVSAH"
FT   CDS_pept        complement(270685..271332)
FT                   /locus_tag="PAS_chr2-1_0144"
FT                   /product="Subunit of the RNA polymerase II mediator
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68751"
FT                   /db_xref="GOA:C4QZS7"
FT                   /db_xref="InterPro:IPR007018"
FT                   /db_xref="InterPro:IPR016612"
FT                   /db_xref="InterPro:IPR038566"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZS7"
FT                   /protein_id="CAY68751.1"
FT                   /translation="MNNTPLDELQWKSPEWIQTFGLRTDNVLEYFSQSPFFDRSSNNQV
FT                   LKMQSQFNEQFQIQLQQNPHFLQQELKKMKGVEFIVAYTQEPNFWVIRKQFRKSPNEAD
FT                   ALNDYYIIGANVYMAPVLNDVISSRLLSTTLALRKAMNTLHQMPKFSPTEGHYYHQDTD
FT                   PYLGDKSRPGTIINTPNIGTTVSNTNLNTPSDKEAADRNTNSSTLISLLNML"
FT   CDS_pept        271459..271860
FT                   /locus_tag="PAS_chr2-1_0145"
FT                   /product="Protein of unknown function, required for
FT                   survival upon exposure to K1 killer toxin"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68752"
FT                   /db_xref="InterPro:IPR019083"
FT                   /db_xref="InterPro:IPR039603"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZS8"
FT                   /protein_id="CAY68752.1"
FT                   /translation="MFRAIRSYSQVVKYNNKVIPAPSKSVPDVNTFLTKIGRNAEEHIE
FT                   IFENDWSKFWNAKSSDMKEWGIEPQTRKYVLAWKERFRQGQEPYHIAKGVKKNGGERNA
FT                   KLHNALKRFEKLKAERELREKYMSEHKNF"
FT   CDS_pept        complement(271895..272395)
FT                   /locus_tag="PAS_chr2-1_0146"
FT                   /product="Dinucleoside triphosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68753"
FT                   /db_xref="GOA:C4QZS9"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039383"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZS9"
FT                   /protein_id="CAY68753.1"
FT                   /translation="MSKVLFSNFNVTSQVFYRSKYSYALVNLKPIVNGHVLVVPLRVVS
FT                   RLKELTKEESIDYMETVQLVHQFIEKYYNADGLNIAIQDGNAAGQSVPHLHTHLIPRYY
FT                   PDGYGDGIYAKLEDNEQKLENNYRKFKVLSDEDRKPRTLEEMTAEAENLAKELETFKGN
FT                   LTS"
FT   CDS_pept        272450..272668
FT                   /locus_tag="PAS_chr2-1_0147"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68754"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZT0"
FT                   /protein_id="CAY68754.1"
FT                   /translation="MIRDLVMSHRYLSVIFQGKCWQVTPDGKRDEVRRWGHTNHSSVEL
FT                   LLNTKCSNVFFPEQSHLGLPSFKDGIP"
FT   CDS_pept        complement(272839..273009)
FT                   /locus_tag="PAS_chr2-1_0148"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68755"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZT1"
FT                   /protein_id="CAY68755.1"
FT                   /translation="MGKTGKAYIIRELSVNVHNSDEPFVQLGQLPLGKSFSTGYIAGGI
FT                   CDYRSFTCQTS"
FT   CDS_pept        273138..275783
FT                   /locus_tag="PAS_chr2-1_0149"
FT                   /product="Protein involved in DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68756"
FT                   /db_xref="GOA:C4QZT2"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008046"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027925"
FT                   /db_xref="InterPro:IPR031327"
FT                   /db_xref="InterPro:IPR033762"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZT2"
FT                   /protein_id="CAY68756.1"
FT                   /translation="MDETTILGDTPLDAVYSDRVRRFQDFLTSPDLGNMDNIKKMLTLG
FT                   QRRLAVSLDEIRETDKDFWLGLLNTPADYLPACQDGVREAIKSIYTPIDYPDIEITSDT
FT                   DFYVSFKGSFGDHQLTPRTIGSHFLSKMVSVEGIVTRASLIRPKIIKSVHYCDATGRFH
FT                   QREYSDQTTSFNPITTSALYPTEDPEGNPLTTEYGFSKYRDHQTITIQELPELAPAGQL
FT                   PRSLDVIMDDDLVDLVKPGDRLQAVGVYRSLGGVGSNSSSFRTVILCNSVYPLHARSTS
FT                   VKSVERLTNSDIRNINKLSKKKNIFDLMAQSLAPSIYGHAYIKKAVLLMLLGGYEKNLS
FT                   NGAHLRGDINLLMVGDPSTAKSQMLRFVLNTAPLAIATTGRGSSGVGLTAAVTTDKETG
FT                   ERRLEAGAMVLADRGIVCIDEFDKMSDIDRVAIHEVMEQQTITIAKAGIHTSLNARCSV
FT                   IAAANPVYGQYDTNRSPQQNIALPDSLLSRFDLLFIVTDDISDEKDKAVSEHVLRMHRF
FT                   IPQGYSEGEPIRERRNVTLAVGDSSNQDEDDSDDRNKVYEKFSPLLHSGAAEMAEGSTS
FT                   SSKKTPKVLNITFLKKYIQYAKQRIEPQLTTECTKKVVEIYATLRNDHIVKNSPITART
FT                   LETIIRLATAHAKVRLSQTVEIKDVQVAEEMLRFSLLGETPATKHKSSPQKSPKKKRKT
FT                   TSPSKKKFQDDETELYSVSESEPEYAEDKDDGNEDADVADYQPRATTARTRSLQERLQS
FT                   AYDEEGEDEDMEEELVDVEQIREGLSQQTLREPSNEEDILQETNTNMDQPATISASRFS
FT                   KFKSLLSMLRSHYESTSEDGSAPVADLVTRVNQELSQEEQFDEQEAYLALEQMQEKNFI
FT                   QISEEKVYFI"
FT   CDS_pept        275961..276500
FT                   /locus_tag="PAS_chr2-1_0150"
FT                   /product="Flavin-linked sulfhydryl oxidase of the
FT                   mitochondrial intermembrane space (IMS), oxidizes Mia40p
FT                   as"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68757"
FT                   /db_xref="GOA:C4QZT3"
FT                   /db_xref="InterPro:IPR017905"
FT                   /db_xref="InterPro:IPR036774"
FT                   /db_xref="InterPro:IPR039799"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZT3"
FT                   /protein_id="CAY68757.1"
FT                   /translation="MTKDPQEEPSDDKPLFGSTGRKIIYDKDGKPCRSCNTLLDFKMAG
FT                   GSLMGALSTKKPSLAKDSVPETYKQEPPDVEQLGKSTWTFLHSVAATYPESPSPSQQDD
FT                   MRQFMNIFGKIYPCWFCAKDFQKWSSKNEPKVKTQEEFGRWLCDAHNEVNAKLGKPKFD
FT                   CNLWKQRWKDGWDEGK"
FT   CDS_pept        complement(276571..278661)
FT                   /locus_tag="PAS_chr2-1_0151"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68758"
FT                   /db_xref="GOA:C4QZT4"
FT                   /db_xref="InterPro:IPR003124"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZT4"
FT                   /protein_id="CAY68758.1"
FT                   /translation="MAGPPAPPPPPPPPGGPMNSSSPAAPPPARDALLGDIRKGAKLRK
FT                   AQTIDKSKPILDKKSGGFAGGTSSPAPSIPSGGPTVPTVPTGAPQLGDILAGGMPKLRH
FT                   VSRGNNHQTPAQPPSPTVPKQRPGRVSSNKTVPTIPGGVPPLPSAAPPILPTATAPPAP
FT                   SAPPPLPNSSVPAVPTPTAPRRPSTSSRNKSRVPSDAPPAAPPLPSSRAPPAPPAPPTS
FT                   QPSPATPAAPSVPGGLPFLADIQKNRSDKHVIDTSPETAQESSRGQAAKVSSSSAPPLP
FT                   SIAAPTAPAAPKLPNTVPPSHTPLNAPPLPNSGAPPVPPLPSSSAPPAPPLPSSGPPPA
FT                   PKLPNSGAPSIPALSKSNAPPAPSAPPAPSAPPAPPAPPAPPAPPVPPAPPAPPAPPTQ
FT                   SFGGSSSKTQSTPTPRTTPPVSGGLPFLAEIQKKRNDVHVVDGESGYSTMSNTPEPSSF
FT                   SPKVPHVPQVNAPIIPKQSAPKIPSLPNSTAPQIPHSTAPQVPSIPTPSIPTAPEIPSQ
FT                   AAPTLPPPIVKPAEIPTPVRTQKPPVRIPEPPSQSSLPPPPTPPSAPPTAAPELPNSPP
FT                   PMRNASGSVSRKAPPPPPSQSKPRIHSDSQSSANLKVDEQQHVGASLRAIDVSAYTIDT
FT                   SAIHKASNGQSQNSSRIEIDDSRFSFSNKDSLPKPRKFEGKEKLYPSGRGSSVPLNLAA
FT                   FV"
FT   CDS_pept        complement(278789..279775)
FT                   /locus_tag="PAS_chr2-1_0152"
FT                   /product="Protein that acts together with Ula1p to activate
FT                   Rub1p before its conjugation to proteins (neddylat"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68759"
FT                   /db_xref="GOA:C4QZT5"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR023318"
FT                   /db_xref="InterPro:IPR030468"
FT                   /db_xref="InterPro:IPR033127"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZT5"
FT                   /protein_id="CAY68759.1"
FT                   /translation="MSINSIKPFTEKKGPFTDDVYEPNTEETFNAIRSSKILVIGAGGL
FT                   GCEILKNLSLSGFQDIHVIDMDTIDLTNLNRQFLFRNKDIGKSKAKVASQFVMNRIPNV
FT                   QITPHFCRIQDKDDLFYRQFQLVICGLDSTEARRWINHKLVTLLDPNDFSSLIPMIDGG
FT                   TEGFRGQSRLILPTLSSCFECSLDMIPTNVTYPVCTIANTPRLPEHCIEWAHQLEWPKK
FT                   FGDKPFDADDPSQVDWMYKTSLERAKHFDIEGVTLSLTLGVVKNIIPAISSTNAIIAAS
FT                   CCNEALKLISNVNPILDNYMMYSGDESVFTYTFKHERKPSCPVCGGS"
FT   CDS_pept        complement(279913..281136)
FT                   /locus_tag="PAS_chr2-1_0153"
FT                   /product="Protein that stimulates strand exchange by
FT                   facilitating Rad51p binding to single-stranded DNA"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68760"
FT                   /db_xref="GOA:C4QZT6"
FT                   /db_xref="InterPro:IPR004585"
FT                   /db_xref="InterPro:IPR007232"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZT6"
FT                   /protein_id="CAY68760.1"
FT                   /translation="MSFDDAELKRISKELDKQLGPEFICTRPGQGGMKVSYLSGTTAIS
FT                   LANHIFGFNGWHSEVKSTTVDFVDTQHGKISMGLSSVIRVTLKDGSFHEDIGYGSVENA
FT                   KSKAIAFEKCRKEAITDGLKRVLRCFGNALGNCLYDKEYLRKISNVKTQAITFNEGDLM
FT                   RHNQLEARTLKQEAKLLEINQKKAKNSSKSRINVPPKHFGDNEDDDSHLFSDEINIDSE
FT                   DFMNEIDDYEMDLLMQKNSQREIENVNDDEIENKGDAVDAVTKSNIENQFIAPNSPQIM
FT                   DNMVLTPDKIPAKVEFVSAKVAEKVQNNSPLNVEEKFNPSFQSPSLRRTVDPTKSMPIR
FT                   RTMVQTSVLSQSKQGPKRMIGIPPDTAKRHKLGSQNQNTANDKPEEKQLSRFNSTKAPG
FT                   KENSPASN"
FT   CDS_pept        281363..283225
FT                   /locus_tag="PAS_chr2-1_0154"
FT                   /product="Nuclear envelope protein with multiple putative
FT                   transmembrane domains"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68761"
FT                   /db_xref="GOA:C4QZT7"
FT                   /db_xref="InterPro:IPR019049"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZT7"
FT                   /protein_id="CAY68761.1"
FT                   /translation="MTIEDAKPKLIYYKTIFEQVQRKRLSFVNRIVVLLTFFSSLFIGI
FT                   FAGSSLWFWPLKWLLLGVSLILVRHCKESTQTLENPGFKTFFRQILGQIFCADFVSHLL
FT                   AYGISGFTYWVILFSQKSDDLTYYIITPTRTVLPYINDQFVYFWFFFGTLVLWQSIQQA
FT                   VFLRNKLNFQIGVYRIEPRSEFNLINFTTVLSGSLTSSVLVSLSTPILYVLSRSSVYNV
FT                   LLYPFYWVLGLNHNRPHLNIGFGLFCSLFYHSLLLTLQWEFVNLVYDIYVRIGCIDKDK
FT                   ALSLQSADPVNTLLSGLKDVNHPFVQFTAFQELAYIATSSKPEDRKLFYSVHSKNSYVW
FT                   NTILEECTSYINENIKHIERRMVEFDDITKFLQPRPAEISGGLRRSELAVPPTIFGNSK
FT                   HQASSEGTPEYDSANEIFATPTSPGKLSSQFYSLAHDYNNIDNIHLVVQPIQKVLLGYY
FT                   QLLIQSSIGVPFRKTLSREAASRVKNPVLLGNIIIAFSTFLLHSQTEDKVGVVKGSLAQ
FT                   ALEILAKLISATGNFTDHPPLPPTMLETEQPKTHIIAIIHDLSMKQFFELAVKFNHVLN
FT                   DLILSPTVFKLAKWSIDTAIEEQKKQETLQKKQTLKATGVSILH"
FT   CDS_pept        complement(283299..285140)
FT                   /locus_tag="PAS_chr2-1_0156"
FT                   /product="Endosomal Na+/H+ exchanger, required for
FT                   intracellular sequestration of Na+"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68762"
FT                   /db_xref="GOA:C4QZT8"
FT                   /db_xref="InterPro:IPR004709"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZT8"
FT                   /protein_id="CAY68762.1"
FT                   /translation="MIRLLALFFARQILANEITDPTDENPVLVGPEAPEEETNPLTEEI
FT                   FSSWALFIVLLLVVSALWSSYYLQQRRVKSIHETVLSIFYGMFVGLILRVTPGHYIQDA
FT                   VKFNSGYFFNFLLPPIILNSGYELHQANFFRNIGSILTFAIPGTFISAIVLGVILFIWT
FT                   KLGLDGIDVSLVDALSVGATLSATDPVTILSIFNSYKVDPKLYTIIFGESLLNDAICIV
FT                   MFETCQKFHGQAVSVSSVLKGIGLFLMTFTVSLLIGVVVGVFIALVLKHSLIRRYPQIE
FT                   TCLVLLFAYESYFFSNGCHMSGIVSLLFCGITMKHYAYFNMSRRTQIATKYIFQLLAQL
FT                   SENFIFIYLGLSLFTEVELVFRPMLIIVTTISICISRWCAVFPLSRLINWTTRAKHKGG
FT                   SSAINYTQDEIPPNYQMMIFWAGLRGAVGVALAMGLQGEAKSSLLATVLVVVVLTVILF
FT                   GGTTAGMLETLNIRVGVIDEQESDDEFDIEAPKPMQLNQIIPGATTPVYSIYSDAAGSR
FT                   SRTGSQQSFYNNEDEDAADAPPDMNDDEMTSDLDDIPPMANQAQSSKINLQSMSFNNLL
FT                   SMDDHAKWFTHFDEQVLKPVLLDNLTENNNSKDKIED"
FT   CDS_pept        285505..286110
FT                   /locus_tag="PAS_chr2-1_0157"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68763"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZT9"
FT                   /protein_id="CAY68763.1"
FT                   /translation="MPDEVDLLQKEENELTREKEIGRILSTFKLDSYAILDLKPGCSPE
FT                   DIRKTFRKKSLLIHPDKTPNKRAPDAFDTLKKAHANLVDDSIREQLDSSYAEARRLLIR
FT                   ERKWNIDDARLNSSSFLVDWREKIKELLLEEELLKRLEKKRKMEEEGQVQQKKEEQLKE
FT                   TEGKRLQQQKWEDTRESRVQNWRSFVKKKRKKSKDVLA"
FT   CDS_pept        complement(286140..287756)
FT                   /locus_tag="PAS_chr2-1_0158"
FT                   /product="Anthranilate synthase, catalyzes the initial step
FT                   of tryptophan biosynthesis, forms multifunctional"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68764"
FT                   /db_xref="GOA:C4QZU0"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZU0"
FT                   /protein_id="CAY68764.1"
FT                   /translation="MSVSDSHLATDYFGTQLTKQIHPSAESFLDIVKNDRQSHSPETVP
FT                   NLYPIYKFIQSDFLTPHLAYIKLTNSSETPSPSFLLESAKNGDTVDRYTFMGHSPRKII
FT                   KTGPLEGAEVDPLVLLEKELKGTRQAQLPGIPRLSGGAIGYISYDCIKYFEPKTERKLK
FT                   DVLQLPEAALMLFDTIVAFDNVYQRFQVIGNVSLSVDDSDEAILEKYYKTREEVEKISK
FT                   VVFDNKTVPYYEQKDIIQGQTFTSNIGQEGYENHVRKLKEHILKGDIFQAVPSQRVARP
FT                   TSLHPFNIYRHLRTVNPSPYMFYIDYLDFQVVGASPELLVKSDNNNKIITHPIAGTLPR
FT                   GKTIEEDDNYAKQLKSSLKDRAEHVMLVDLARNDINRVCEPTSTTVDRLLTVERFSHVM
FT                   HLVSEVSGTLRPNKTRFDAFRSIFPAGTVSGAPKVRAMQLIGELEGEKRGVYAGAVGHW
FT                   SYDGKSMDTCIALRTMVVKDGVAYLQAGGGIVYDSDPYDEYIETMNKMRSNNNTILEAE
FT                   KIWTDRLARDENQSESEENDQ"
FT   CDS_pept        complement(join(287909..288466,288537..288983))
FT                   /locus_tag="PAS_chr2-1_0159"
FT                   /product="UBX (ubiquitin regulatory X) domain-containing
FT                   protein that regulates Glc7p phosphatase activity and"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68765"
FT                   /db_xref="GOA:C4QZU1"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR012989"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR036241"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZU1"
FT                   /protein_id="CAY68765.1"
FT                   /translation="MVDSETINKFIEVTGASAFQAIQYLEETDDFEAAVNDYYSSQLEN
FT                   EKGKGKSERPVNQTKASAGPKIRTFNDLNSNSNGDNNLFTGGEKSGLQVENPDKRGDPF
FT                   GLVNDLLKKAEETGQQPDTRPHEEAPARQFVGTGHKLGSTDSPSEDGFQVGDGDLYRYD
FT                   DPANARYLADLNAGRAPLALLDVEIGQEVDVTVHKKIEKNFTPPKKARVGFQGKGQRLG
FT                   SPVPGDIKLSQSPEVQQETQEEAEEEKQKEEAEQLGTGDSPVQIRLANGQRIVHRFNST
FT                   DSVAQLYAFVNEHSPSAREFVLSLAFPVKPIENNEDTLKDAGLINAVVVQRWK"
FT   CDS_pept        complement(289344..291650)
FT                   /locus_tag="PAS_chr2-1_0160"
FT                   /product="Cobalamin-independent methionine synthase,
FT                   involved in amino acid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68766"
FT                   /db_xref="GOA:C4QZU2"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZU2"
FT                   /protein_id="CAY68766.1"
FT                   /translation="MVQSSVLGFPRIGAFRELKKTTEAYWSGKVGKDELFKVGKEIREN
FT                   NWKLQKAAGVDVIASNDFSYYDQVLDLSLLFNAIPERYTKYELDPIDTLFAMGRGLQRK
FT                   ATDSEKAVDVTALEMVKWFDSNYHYVRPTFSHSTEFKLNGQKPVDEYLEAKKLGIETRP
FT                   VVVGPVSYLFLGKADKDSLDLEPISLLEKILPVYAELLAKLSAAGATSVQIDEPILVLD
FT                   LPEKVQAAFKTAYEYLANAKNIPKLVVASYFGDVRPNLASIKGLPVHGFHFDFVRAPEQ
FT                   FDEVVAALTAEQVLSVGIIDGRNIWKADFSEAVAFVEKAIAALGKDRVIVATSSSLLHT
FT                   PVDLTNEKKLDSEIKNWFSFATQKLDEVVVVAKAVSGEDVKEALSVNAAAIKSRKDSAI
FT                   TNDADVQKKVDSINEKLSSRAAAFPERLAAQKGKFNLPLFPTTTIGSFPQTKDIRINRN
FT                   KFTKGEITAEQYDTFIKSEIEKVVRFQEEIGLDVLVHGEPERNDMVQYFGEQLKGFAFT
FT                   TNGWVQSYGSRYVRPPVVVGDVSRPHAMSVKESVYAQSITKKPMKGMLTGPITVLRWSF
FT                   PRNDVSQKVQALQLGLALRDEVNDLEAASVEVIQVDEPAIREGLPLRSGQERSDYLKYA
FT                   AESFRIATSGVKNTTQIHSHFCYSDLDPNHIKALDADVVSIEFSKKDDPNYIQEFSNYP
FT                   NHIGLGLFDIHSPRIPSKEEFIARIGEILKVYPADKFWVNPDCGLKTRGWEEVRASLTN
FT                   MVEAAKTYREKYAQN"
FT   CDS_pept        292075..292746
FT                   /locus_tag="PAS_chr2-1_0161"
FT                   /product="v-SNARE protein involved in Golgi transport,
FT                   homolog of the mammalian protein GOS-28/GS28"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68767"
FT                   /db_xref="GOA:C4QZU3"
FT                   /db_xref="InterPro:IPR023601"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZU3"
FT                   /protein_id="CAY68767.1"
FT                   /translation="MSNYSQTRSQALQLENKTESLLSQYASFGQSSSSSATGEELSLEK
FT                   ALKDILERRQELVNALSRIADSDDTLAASKLQQLHRHKEILNDHKRDFGRIQESIQQER
FT                   NKLNLLFSVRSDIQEHKKRSHTSNVDSLNEEEYMRQERNRVDNVNSFADRLLSQAYETR
FT                   DEFSRQRHILNNAASRISESVSQMPGINVIVSKINTRRKRDSLIIAGLITMCIILLWLS
FT                   L"
FT   CDS_pept        293135..296476
FT                   /locus_tag="PAS_chr2-1_0162"
FT                   /product="Histidine kinase osmosensor that regulates a MAP
FT                   kinase cascade"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68768"
FT                   /db_xref="GOA:C4QZU4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZU4"
FT                   /protein_id="CAY68768.1"
FT                   /translation="MTELLELLKDPVRFHQDSESIRLKALAHITEQNTSIARLETQLES
FT                   AKSANKAFQQALGEIGTVVISVAMGDLSKKVQVHPVESDPEILKVKITINTMMDQLQTF
FT                   ANEVTKVATEVASGELGGQAKNEGTVGVWRSLTDNVNIMALNLTNQVREIADVTRAVAT
FT                   GDLSRKINVHAQGEILQLQMTINTMVDQLRTFAFEVTRVARETGVEGRLGGQARINNVE
FT                   GIWKELTDNVNAMALNLTNQVRNIANVTTAVAKGDLSKKVTADCKGEILDLKLTINQMV
FT                   DRLQTFALEVTTLATEVGTDGILGGQANVRDVEGAWKAVTENVNIMAANLTNQVRSIAT
FT                   VTTAVAHGDLSQKIAVEAQGEILQLKNTINKMVDSLQVFASEVTRVAKDVGIDGKLGVQ
FT                   AQVSDVDGLWKEITTNVNTMAANLTSQVRAFAQITAAATDGDFTRFITVEASGEMDALK
FT                   TKINQMVLNLRESIQRNTAAREAAELANSAKSEFLANMSHEIRTPMNGIIGMTQLTLET
FT                   ELTQYQREMLSIVHNLANSLLTIIDDILDISKIEANRMTVEQIAFSLRGTVFGALKTLA
FT                   VKAIEKQLDLIYQVDNSFPDNLIGDSFRLRQVILNLAGNAIKFTTHGKVTLTVKKAARI
FT                   VSNNDEKLLLEFCVSDTGIGIEEDKLGLIFDTFCQADGSTTRKFGGTGLGLSISKQLIH
FT                   LMGGEIWVTSGYGAGSNFFFTIAVSPAKIELSRQIEALAPFAQHQILFISTEHDEETRN
FT                   QIKEHIALLQLEPVVISSIDDAQYKDFVPYDIIIIDSIEIGMELRHLPEIKNIPLVLLN
FT                   PSVPSLNMRVCLDLGITSYGNTPCSVIDLASILMPALESRASPSNSDGSQSYNILLAED
FT                   NLINQKLAVRILEKHGHKVEVVENGLEAFNAVKKNRYDVVLMDVQMPIMGGFEATANIR
FT                   DWERKSNPVDVLGFRTPIIALTAHAMLGDRERCLKAQMDEYLSKPLKPTVLLQTISKCI
FT                   HNINQLKELSKKNVSSRNTTFSEDFDINAVMSPNSTGGQLYSVNNRVNEIHGNFLDGRS
FT                   NFAHIPLENRETVSTTTTLGATVAKAKKPSRNQPVVKPPSISAIYDASSIDELTGSSLI
FT                   AESSPE"
FT   CDS_pept        complement(296563..299844)
FT                   /locus_tag="PAS_chr2-1_0163"
FT                   /product="Catalytic subunit of DNA polymerase delta"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68769"
FT                   /db_xref="GOA:C4QZU5"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR025687"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZU5"
FT                   /protein_id="CAY68769.1"
FT                   /translation="MPEQLSQESEAKRVKLEDYHETAHSIPVANRDINGYQLPGHQSNS
FT                   FHTKMTSSQVDNEPSTFIKELEDMDNEATSKSEEIQIQNWSRPELPKFDPKKDDIIFQQ
FT                   LDAEEISHVNGHSSARFFGVTDAGNTVLCNVTGFDHYFYVGMPKALKESDLPGFTNYLK
FT                   DEYVGVNTIEISFKESIWGYNNNTKLPFLKIIMSNSRLISRVRTGFENGSIQYNDAFPP
FT                   NGSITFDNIQYLLRMMVDTKVSGMCWIKLQASKYTLVPPSQQVSTCQLELSVDYRDLVS
FT                   LPIEGEFSKIAPLRILSFDIECAGRKGIFPEPEHDPVIQIANVVSRTGESTPFVRNVFT
FT                   VNSCAPIVGSQIFSFEKEEELLRKWRDFIIKVDPDVIIGYNIANFDFPYLINRAATLKV
FT                   QDFPFFSRVKTSKQEIKDSTFSSKAYGTRENKVVNIDGRMQLDLLQFIQREYKLRSYTL
FT                   NSVSSHFLGEQKEDVQHSIITDLQNGDAETRRRLAVYCLKDAYLPLRLAEKLMCLVNYT
FT                   EMARVTGVPFSFLLSRGQQIKVISQLFRKCLELDIVIPNMKSDSVNEEYEGATVIDPVR
FT                   GYYDVPVATLDFASLYPSIMMAHNLCYTTLLNKPTIDRLGLVKDKDYILTPNGDFFVKE
FT                   DLRKGILPTILQELLAARKKAKYDLKTETDPFKKQVLNGRQLALKISANSVYGFTGATI
FT                   GKLPCLAISSSVTAFGREMIEATKQAVQERYTIKNGYDHDAQVIYGDTDSVMVKFGEND
FT                   LRKCMKLGEEAAAFVSTIFKNPIKLEFEKVYFPYLLINKKRYAGLYWTNPDKYDKMDTK
FT                   GIETVRRDNCRLVQNVITKVLEYMLELRDVEGAENFVKQTIADLLQDRVDLSQLVITKA
FT                   LSRQDYAGKQAHVELAERMRKRDAGSAPTLGDRVAYVIIKTSSTKNYEKSEDPLYVLEH
FT                   SLPIDTNYYLENQLAKPLTRIFEPILGERRAKALLSGSHTRTVFVAAPKTGGLMRFAKK
FT                   TNTCKNCKSPLTKSNCKSPNGNAALCNNCMDKAGSLYGEALSLMNSLETKFSKLWTECQ
FT                   RCQGSLHQEVLCSNNDCPIFYMRTKAKKDIIHQAEELERWNDMVW"
FT   CDS_pept        300074..303043
FT                   /locus_tag="PAS_chr2-1_0164"
FT                   /product="Ubiquitin-conjugating enzyme (E4), elongates
FT                   polyubiquitin chains on substrate proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68770"
FT                   /db_xref="GOA:C4QZU6"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR035983"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZU6"
FT                   /protein_id="CAY68770.1"
FT                   /translation="MFNFDGSTKRRNVNLSGRRNNLESREQLLHRAELERNRRKEAKLQ
FT                   DKSVRIIQSYIRTFLLRSHISLEFEKIWLHCGSDVTALNMFAFFCPNLVLKRDEAWLQV
FT                   QLDHVSKLLLSSHGSISFLLRNALVEVLFKTSKQGRSPLPMLKLVNSLSHEFAIEWIQR
FT                   KDLMEKLVDRLGENEELDLQVLKFTFNFRHNDMETFAMAFINIVQKANLNDEAKQLIRE
FT                   QFSRPSSFYLQLPNSLFFLYLLSVITIWKKYGGVENLDIFLAQELSSAVEKMQELKFCF
FT                   ENELSQDLSLNRDADLDGRKKLIITTGSKEALLYLYSPDYQTKISNLPNVSTEFLSNFY
FT                   YSLLVPIDTGSPQNEEILNSLLISVVVNGLPHGILHYWLQQIVSSDIFRMEDGNWELNK
FT                   PILTGCSVELWQTLHIFLDVYFYVLNMSSDSVIFDQDRGRLPRDEFLKVVSFLKGLCIT
FT                   LVLKDKELKPSLPSSTRVMYDKTLVVALKLLHQIYLRNLRLSFVSEEYWLCDLSLSIEQ
FT                   IVPVLYERDISISNNADFDLDPDTSEHLNLESDFSQLYGLNSTRYMKLPSSVLAALKVL
FT                   KFLPFMFSFTTRATILHQLIRQSQEIRDTYGGMNRIQGTISRDNIIEDGFALLSKLTGE
FT                   QLKNYLGIQFTNQFGAEAGIDGGGLTKEFLTETVKKGFATTNESGVEDLMLFKHSPRNE
FT                   IYPNPALYLKRTKGVDVHKDLEMIRYLGSIVGKCLYEKILVDLPFSPFFLTRWSVNQPY
FT                   KTMFDDLKYYDEDLFRNLNKLLSLNSDQVDALELNFTLTERFYYNGAFKTTTIMLLPNG
FT                   ANIPVTTANRLQYVFAVSNFKLYTSLRLQTDYFLQGLFKVIPSQWLEVFNPMELQILVS
FT                   GRDRGIDISDLRKNTVFSEYTENDQTIIDLFDILEHDFSNEERSKFIRFVTSSSKAPLL
FT                   GFSQLNPKFGVRNIGPFSDRLPSAFTCFNQLKLPDYGNRKVLKEKLLYAISSESGFDLS
FT                   "
FT   CDS_pept        join(303127..303144,303212..305095)
FT                   /locus_tag="PAS_chr2-1_0165"
FT                   /product="Protein required for mismatch repair in mitosis
FT                   and meiosis as well as crossing over during meiosis"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68771"
FT                   /db_xref="GOA:C4QZU7"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011186"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR032189"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZU7"
FT                   /protein_id="CAY68771.1"
FT                   /translation="MTSRIKALDIDVVNKIAAGEIIVAPENALKELLENAIDAKSTSID
FT                   IIIQDGGLKLLQMTDNGVGIYKEDLPILCERFTTSKLSTFEDLNSIGTYGFRGEALASI
FT                   SHISRLTVTTKTKDSACAYRAIYQEGRMVGEPKPVAGKDGTQILIEDLFYNVPSRLRSL
FT                   KGGNEQLSKILDVVARYAINTDGVAFSVKKAGDTLNLLAVRANNSTKDKVRTVFGSAVA
FT                   SELLPIAVEKSEEIGLLSCEGQITNTSYYSKKSVSPIFFINGRLVSCDPLKRMITQLYS
FT                   SFLPKGHKPFVYLRIDIKRENLDVNVHPTKREVRFLFEDEIFQVIFQSIQAKLGSLDHS
FT                   RKFVTTQSVLKHQYAPQEEITKKPQTLLRTDDLQSKITAFINTTNTESFGTIVKDRVTV
FT                   KLSSILELRQQLENKVSEDLTNMFAKHTYVGLVDPNRRLCCIQYDVKLFLVDYASISYE
FT                   LIYQIGLSDFNNFGTLYLESEKPITIRELLEIVYESIDTSVPPIDDVLEALFEMKDMLL
FT                   EYFSIELQGTEKDPILRSLPIVIKGYTPSIGKLPLFWYRLGTKVDWSSEKECLDGILRQ
FT                   IALLYVPEVSEAEGIEKILEDLIFPTIKSRLLAVDSLSKSVVEIANLPGLYKVFERC"
FT   CDS_pept        complement(305194..306237)
FT                   /locus_tag="PAS_chr2-1_0166"
FT                   /product="Predicted transporter of the mitochondrial inner
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68772"
FT                   /db_xref="GOA:C4QZU8"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="InterPro:IPR040062"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZU8"
FT                   /protein_id="CAY68772.1"
FT                   /translation="MEKYNTASLPLGFENDHYIKPHTILQEEEGPSNESSPLWHCIVAG
FT                   GIGGMVGDSTMHSLDTVKTRQQGAPTVAVYKNMTSAYATIFRQEGFRRGLYGGYGAAML
FT                   GSFPSTAVFFGTYESVKRLMIGRWNCNETATHLVAGFLGDFFSSVFYVPSEVLKTRLQL
FT                   QGRYNNPYFHSGYNYKSTAHAITSIIKSEGWQTLFFGYKATLVRDLPFSALQFAFYEKF
FT                   RSWALRVSSANHHDLSVLWELATGAAAGGLAGTLTTPLDVIKTRIQTQNAASTVSSSSS
FT                   GKPIILSSPSILSSLLMVYKHEGALGLFSGVGPRFIWTSVQSSIMLLLYQVSLRTLDDM
FT                   LEGTALD"
FT   CDS_pept        306431..307552
FT                   /locus_tag="PAS_chr2-1_0167"
FT                   /product="Putative metalloprotease, similar to
FT                   O-sialoglycoprotein metallopeptidase from P. haemolytica"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68773"
FT                   /db_xref="GOA:C4QZU9"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZU9"
FT                   /protein_id="CAY68773.1"
FT                   /translation="MLRRLRCGIRTYKVLAIESSCDDSCVSLIDRSAGAKPIVLDHVKS
FT                   TLNSVKAGGVIPTSAHLHHQKSIAGLVKQVLQKHNISGVNCPELVCVTRGPGMPGSLSI
FT                   GVDTAKGLSVAWGSQFLGVHHMLGHLLIPRLESNGEEPQFPFLSLLASGGHTMLVLSRS
FT                   LLDHEILVNTIDIAAGDALDKCAREIGIRGNMIGKELELFLNKNPQLSLKDIPWEMPQP
FT                   LKNKPKRVDTLGFSFTPFISGVKLSLERYHNNEVKDELMPAMGFRIQEAIFDHIIDRVL
FT                   VAYKVRPELNQIKTFVGSGGVVANQRLRVKLQAALKSHGVENFHFPPPALCTDNAIMIG
FT                   WAGIELYENGVTSELDVTPLRKWSVEGLEKSGF"
FT   CDS_pept        complement(307549..308694)
FT                   /locus_tag="PAS_chr2-1_0814"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0814"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68774"
FT                   /db_xref="GOA:C4QZV0"
FT                   /db_xref="InterPro:IPR014854"
FT                   /db_xref="InterPro:IPR027786"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZV0"
FT                   /protein_id="CAY68774.1"
FT                   /translation="MAETTENSEGPKGASPVADEDSDLGSDSSSKTSADSDSDSGTSSD
FT                   SSSGEESDDDDIGESEKDLLHKEMQSLQEHYNRLEDALKREKVQTIRDADLGKSIHHLE
FT                   EVHELFETAKGHNMVSFLPKDALIFKSISQQSSDTARNLKLGTSRKGLNPTMFNAKLTE
FT                   YLSYEQNQPTNPDMDDITEDIANTQFANYNWAKLGALSYLASRRSYTSNFLLGALSLEK
FT                   KKVRTHTQRTVDEVNETVTANRVTLNDIQKGDTDSSVKMMKQHFHVFAEKSKMKKVNLF
FT                   EYFIDPGSYARTIENMLYTSFMLNYGKIILVHGEDGIPYIQVADKDTIQKDSELYQKVK
FT                   DNDESHSQFIVRLEMDVWEALIKKYNITKPYVDPQLLSHED"
FT   CDS_pept        complement(308966..311476)
FT                   /locus_tag="PAS_chr2-1_0168"
FT                   /product="Protein that is processed in the mitochondrion to
FT                   yield acetylglutamate kinase and N-acetyl-gamma-gl"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68775"
FT                   /db_xref="GOA:C4QZV1"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR006855"
FT                   /db_xref="InterPro:IPR011241"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZV1"
FT                   /protein_id="CAY68775.1"
FT                   /translation="MFQTRFRSLPKLFGVYRRNNYSTRSTVIQLLNNIGSKREVEQYLK
FT                   YFTSVSQQQFAVIKVGGAIITQKLPELASCLAFLYHVGLYPIVLHGTGPQINELLENEG
FT                   VEPQYEDGIRITDEKTMSVVRKCFLEQNLKLVTALEKMGVRARPVTAGVFSADYLNKDK
FT                   YKLVGNISSVNKAPIEASIQAGALPILTSLAETASGQILNVNADVAAGELARVFEPLKI
FT                   VYLNEKGGIINGITGEKISIINLDEEYEDLLKESWVKYGTKLKIKEIRDLLMHLPRSSS
FT                   VAIINVDDLQKELFTDSGAGTLIRRGYKLIIRESLDEFQQPDLLRTALNRDSDISSGKT
FT                   SVASFLRELEGVSFKAYGDEPLEVLAIVKENKSGVPKLDKFLASKNGWLNNVTDNIFNA
FT                   IKKGNPSLQWVVREDDPNTAWFFSKSQGSFSKNGQILFWYGVESPEDVDSLIQNFSKNV
FT                   SYIQSTDSSNSKAASETRAYHTMRKASSQQIRSFATTCNSNPNPPIREGSNKKKAKIAL
FT                   IGARGYTGQNLITMIDNHPYLEIAHVSSRELQGQKLQGYDKANIVYENLQVEDINRLER
FT                   NGEIDVWVMALPNGVCKPFVDAIEHADGPKTSKIIDLSADYRFDTTGEWIYGLPELNSR
FT                   QAIVKARKISNPGCYATGAQVAIKPLVDYISGVPTIFGVSGYSGAGTKPSPKNDIKILN
FT                   NNLIPYSLTDHIHEREISAQLGHQVAFTPHVAQWFQGISHTISIPLKEKMTSRDIRNIY
FT                   QDIYQDEQLITVSGEAPLVKDISGKHGVVVGGFAVNAAQDRVVIVATIDNLLKGAATQC
FT                   LQNINLAMNYGEYEGIPDDLIIRG"
FT   CDS_pept        join(311994..312043,312094..312517)
FT                   /locus_tag="PAS_chr2-1_0169"
FT                   /product="Mitochondrial outer membrane protein involved in
FT                   membrane fission, required for localization of Dnm1"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68776"
FT                   /db_xref="GOA:C4QZV2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016543"
FT                   /db_xref="InterPro:IPR028058"
FT                   /db_xref="InterPro:IPR028061"
FT                   /db_xref="InterPro:IPR033745"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZV2"
FT                   /protein_id="CAY68776.1"
FT                   /translation="MTDKKIKYLPALEDANIPLTEQQLAILEKQVEAEQPNPTTQSSFN
FT                   YAWGLIKSDDVEDNRNGINILVSIFTNVPQRRRECLYYLSLGCLKLNELENAKRYVDGI
FT                   LAHEPDNYQALQLKQVIENKISRDGLVGIALFGGAVAIGAAALSTMFRYNRKK"
FT   CDS_pept        313058..314152
FT                   /locus_tag="PAS_chr2-1_0170"
FT                   /product="tRNA-specific adenosine deaminase, deaminates
FT                   adenosine-37 to inosine in tRNA-Ala"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68777"
FT                   /db_xref="GOA:C4QZV3"
FT                   /db_xref="InterPro:IPR002466"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZV3"
FT                   /protein_id="CAY68777.1"
FT                   /translation="MVLEPELPNSLADRMADAVFQVYERDKILAQNKAAKPVTRTSGVE
FT                   EWTVLASILMIHDNKVKPLTLTTGVKCMPDETLKNSRGRIVHDMHAEILSIRAFQRFII
FT                   QDMDFLRVLEKTQEGLKVKDGIEFALYISELPCGDASIKDAERWEYGFGIVDGKSKRVR
FT                   LSESVLLRGRSDVGDLGKVRTKPGRGDSFVSLSKSCSDKLVKIQKVGLFNGVVSQFVSQ
FT                   KHLKYLVLPHVPGSSESINRCFTRLKGERMTILTTSRDFVHRRKDGKLPCNISMIYLVD
FT                   QQLELLCKGIKNGTKGVSDKNSSMVSRYNLTKAIEKHLNREKLELATKSYYQLKKNGNR
FT                   YEQVEKSKAELGNWVPTYRDDFSL"
FT   CDS_pept        complement(314197..314685)
FT                   /locus_tag="PAS_chr2-1_0171"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68778"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZV4"
FT                   /protein_id="CAY68778.1"
FT                   /translation="MSEGASSSEQLIDAARRNNVDLLESIILENKDGITQLINTSQDVM
FT                   GNKALHLAAAYGAFEILDILLDQEGVELDSKNRLDENTPLHLAVKYSEEEPEHGTFIVE
FT                   ELIAAGADVNATNKNGDKPVDLVVNNPELTQILLNAEYASNVVIVDEDENAGPASDSD"
FT   CDS_pept        315460..320463
FT                   /locus_tag="PAS_chr2-1_0172"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68779"
FT                   /db_xref="GOA:C4QZV5"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR010435"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034187"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZV5"
FT                   /protein_id="CAY68779.1"
FT                   /translation="MFLKSLLSFASILTLCKAWDLEDVQDAPKIKGNEVPGRYIIEYEE
FT                   ASTSAFATQLRAGGYDFNIQYDYSTGSLFNGASVQISNDNKTTFQDLQSLRAVKNVYPA
FT                   TLITLDETFELADTKPWNPHGITGVDSLHEQGYTGSGVVIAVIDTGVDYTHPALGGGIG
FT                   DNFPIKAGYDLSSGDGVITNDPMDCDGHGTFVSSIIVANNKDMVGVAPDAQIVMYKVFP
FT                   CSDSTSTDIVMAGMQKAYDDGHKIISLSLGSDSGFSSTPASLMASRIAQDRVVLVAAGN
FT                   SGELGPFYASSPASGKQVISVGSVQNEQWTTFPVTFTSSNGESRVFPYLAYNGAQIGFD
FT                   AELEVDFTEERGCVYEPEISADNANKAILLRRGVGCVENLEFNLLSVAGYKAYFLYNSF
FT                   SRPWSLLNISPLIELDNAYSLVEEEVGIWVKTQIDAGNTVKLKVSTSDQMLPSDKEYLG
FT                   VGKMDYYSSQGPAYELEFFPTISAPGGDSWGAWPGGQYGVASGTSFACPYVAGLTALYE
FT                   SQFGIQDPQDYVRKLVSTATDLQLFDWNAVKLETSMNAPLIQQGAGLVNALGLFETKTV
FT                   IVSAPYLELNDTINRASEYTIQIKNENSETITYQVVHVPGTTVYSRSASGNIPYLVNQD
FT                   FAPYGDSDAATVALSTEELVLGPGEVGEVTVIFSTEEIDQETAPIIQGKITFYGDVIPI
FT                   AVPYMGVEVDIHSWEPLIERPLSVRMYLDDGSLAYVDDDPDYEFNVYDWDSPRFYFNLR
FT                   YATKEVSIDLVHPDYSIENDYEWPLVSGHNNYYGPVGYDYDYTSGQAFLPRYFQQRINE
FT                   LGYLSFSRFANFSVVPAGEYKALFRVLLPYGDFWNKEDWQLFESPVFNVLAPPNEENTT
FT                   EEPTEESSEEPTEESTSESTEEPSSESTEKSSEVPTEEITEDATSTIDDDEASTESSTE
FT                   EPSAQPTGPYSDLTVGEAITDVSVTSLRTTEAFGYTSDWLVVSFTFNTTDRDITLPPYA
FT                   VVQVTIPNELQFIAHPEYAPYLEPSLQVFYTKNERLIMTSQFNYDTRVIDFKFDNRDQV
FT                   ITQVEGVVYFTMKLEQDFISALAPGEYDFEFHTSVDSYASTFDFIPLIRSEPIKLIAGA
FT                   PDEVEWFIDIPSAYSDLATIDISSDIDTNDNLQQYFYDCSKLKYTIGKEFDQWGNFTAG
FT                   SDGNQYSNTTDGYVPITDSTGSPVAEVQCLMESISLSFTNTLAEDEVLRVVLHSSAFRR
FT                   GSFTMANVVNVDITAGGLAKRELFSYILDENYYASTGSEGLAFDVFEVADQVEEPTEES
FT                   TSEESTEQETSTEEPTEESTEPTEESTQEPTEEPTDEPTSESTEEPSEEPTSDDLSIDP
FT                   TAVPTDEPTEEPTEEPTSESTEEPSEEPTSDDLSIDPTAVPTDEPTEEPTEEPTSETTD
FT                   DPSIAPTAVPTSDTSSGQSVVTQNTTVTQTTITSVCNVCAETPVTITYTAPVVTKPVSY
FT                   TTVTSVCHVCAETPITVTLTLPCETEDVTKTAGPKTVTYTEVCNSCADKPITYTYIAPE
FT                   YTQGAERTTVTSVCNVCAETPVTLTYTAPKASRHTVPSQYSSAGELISSKGITIPTVPA
FT                   RPTGTYSKSVDTSQRTLATITKSSDESNTVTTTQATQVLSGESSGIQAASNSTSISAPT
FT                   VTTAGNENSGSRFSFAGLFTVLPLILFVI"
FT   CDS_pept        321077..323644
FT                   /locus_tag="PAS_chr2-1_0173"
FT                   /product="Non-essential glycogen phosphorylase required for
FT                   the mobilization of glycogen, activity is regulate"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68780"
FT                   /db_xref="GOA:C4QZV6"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZV6"
FT                   /protein_id="CAY68780.1"
FT                   /translation="MSERPKLHRRTLTGFTPTEIKSIDTAIPAKCRELWQKFGTQEFAT
FT                   KEEFQKSFINHVEKTLARSLYNCDVLAAYQATSDSIRDKLVVHWNKTQQLHTAKEAKRI
FT                   YYLSLEFLMGRALDNALINLNIKDLTSKGVDELGFKLEDIIGVEPDAGLGNGGLGRLAA
FT                   CFVDSLSTGNYPGWGYGLRYQYGIFAQKIVDGYQVEVPDYWLNFSNPWEIPRFEIQIPV
FT                   DFYGYVSTVKTPSGGFVKQWNGGQRVLAVAYDNPIPGWDTSNVNNLRLWSAKPTTEFDF
FT                   SKFNSGDYQNSVADQQSAESITSVLYPNDNFYKGKELRLKQQYFWVSASLYDIVRRFIK
FT                   SKRPWAEFPEKVAIQLNDTHPTLAIVELQRILIDLQNLSWEAAWDIVTKTIAYSNHTVM
FT                   QEALEKWPLELFNNLLPRHLEIVYEINQRFLNYVGEKFKDEDLLSRVSIIEESSPKNIR
FT                   MAHLAVIGSHKVNGVAELHSELIKTTIFKDFVTIYGSEKFTNVTNGITPRRWLRQANPK
FT                   LTELIASKLGGYTFLKDLNELKQLEQFVDDADFRHQWDEVKLHNKKRLAVLVKDLTGFS
FT                   VNPNVLFDIQVKRIHEYKRQQLNIFGVIWRYLQILATPEEERASKWLPRVVIIGGKAAP
FT                   GYYAAKNIIKLVNSVSQVVNNDKSVGDLLKVIFIPDYNVSKAEIICPASDLSEHISTAG
FT                   TEASGTSNMKFVLNGGLIIGTVDGANVEITREIGEDNIFLFGNLSEEVEDIRHEHNKGT
FT                   THIPQQLELVFNEILSGTFGDPIVFQELIDNVKYHGDHYLVSDDFESYLETQDLVDQEY
FT                   KNKEEWIKKSIISVANMGFFSSDRCIDEYAENIWNIEPITDQV"
FT   CDS_pept        323932..325803
FT                   /locus_tag="PAS_chr2-1_0174"
FT                   /product="Protease involved in the processing of killer
FT                   toxin and alpha factor precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68781"
FT                   /db_xref="GOA:C4QZV7"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4QZV7"
FT                   /protein_id="CAY68781.1"
FT                   /translation="MLKLLCLLLPLVAVSASPIDLGSQKDYLVLDLPGLSHLSETQRPT
FT                   MHAGLLPLNLSFVADDDTEYFFWRFSKQDVDRADIVFWLNGGPGCSSMDGALMELGPFV
FT                   INPKQEVEYNEGTWVEAADVVFVDQPGGTGFSSTTNYLTELTEVADGFVTFLARYFHLF
FT                   PADVYKKFTLGGESYAGQYVPYILKAIMDDLKSDSGQLPKELYLKGALIGNGWIDPNEQ
FT                   SLSYLEFFIKKELIDIHGSYMPGLLQQQEKCQNLINHSSGEASESQISYSACEKILNDA
FT                   LRFTRDKKAPLDQQCINMYDYTLRDTYPSCGMSWPPYLPDVTAFLQKKSVLEALHLDSS
FT                   ASWSECSARVGSHLKNKISVPSVDILPDLLQEIPIILFNGDHDIICNCIGTERMIDKLE
FT                   FNGDQGFTEGTEYIPWFYNEVNVGKVISERNLTYVRVYNSSHMVPFDNTPVSRGLLDIY
FT                   FDNFEDVEYNNVSGIATPVYDVDKNITYIDSNDPRLQNGPKSSSTDDSAAHGNPFFYYV
FT                   FELFVIVLLLCGLVYLYQYYSNSAPHSILADKHKKKSKNKSKNVRFLDDLESNLDLDNT
FT                   DDKKDNSVMSKLLSSMGYQAQEPYKPLDKGANADLDIEMDSHGTSEK"
FT   CDS_pept        326075..326635
FT                   /locus_tag="PAS_chr2-1_0175"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68782"
FT                   /db_xref="GOA:C4QZV8"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZV8"
FT                   /protein_id="CAY68782.1"
FT                   /translation="MSFEQPIYNDLDYKGFELGQDSTIDLSLFTNNQFFDLDVFADGVT
FT                   ELKPEVVDPSPQNDISVSQTPILSVESSPDNKVQKPLDDKRRRNTAASARFRMKKKQKG
FT                   KEMEEKAKQLTETVERLNQRIRTLEMENKCLKNLMSQRGAIEDTKDSSADPISKIAGST
FT                   SNYELLKLLKSNSNDDGFTMTHL"
FT   CDS_pept        complement(326711..328273)
FT                   /locus_tag="PAS_chr2-1_0176"
FT                   /product="ATP (CTP):tRNA-specific tRNA
FT                   nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68783"
FT                   /db_xref="GOA:C4QZV9"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZV9"
FT                   /protein_id="CAY68783.1"
FT                   /translation="MFRFVRSMSSQLSSIKLDDKESQICSLLKYFCNHYNTKLRKPNEP
FT                   DLQLRITGGWVRDKLLGRSSHDIDIAINTLSGESFAEKLVSFIKENHKDEIESILSSSI
FT                   HKINKNPDKSKHLETCTTKLYGIDIDFVNLRNEKYTEESRIPTIDYGTPQEDALRRDAT
FT                   LNALFYNLTTDQIEDFTEKGLIDLKQGVLRTPLEPSKTFLDDPLRCLRLIRFASVFGFS
FT                   VSEDALQAMKQPKIKEALNAKISRERIGVEIDKILVSKDPIRGLKILRDTNLLDAIFNF
FT                   GDLQDAVYELNPKVRERLNQVFTIYLPESASKISSLPQLIQQFPDDLKSVYSQLDLRVL
FT                   YLNLLLYPFAQLRLKFSTKPTKNTRYATEMIVRDGLKYSSKDSDTVSLIVDNYQEFQHL
FT                   VQRDVSTLPRSVLGMAIRKYNGQWELNLIICLLLSIFEGADSNAIEKYHSTYQHIKNQD
FT                   LSQVHSLRPLVDGKTLCKELGKKPGPWMKPLMDKLLVWQLDHPTEDSASYISRAKTVLD
FT                   ETL"
FT   CDS_pept        complement(328343..329179)
FT                   /locus_tag="PAS_chr2-1_0815"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0815"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68784"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZW0"
FT                   /protein_id="CAY68784.1"
FT                   /translation="MSSFRDTSYNSNNYSEFRPEYPPSFIESIFGYHQGDFDKALDVGC
FT                   GPGEATFHLARKFKNTIGTDISPGMVSQATSLKERRDVSNVSFQQSSSEDLPFIEDSSV
FT                   DLVTAAECAHWFNAPKWFNEMARILKPKGTLCYFGYVDPYFVDLPLGNELYHKYVYGED
FT                   YLGPYWEEPGRSILVDLFRPIDKQIPSDLFEDVIALRGNEPGSLVLERDFQLKDYFQYL
FT                   YTMSSAHKFVQQNPGKEDPIQMFRTELFERAGLEDSSVLRLKWLTTVTFLRRRSNP"
FT   CDS_pept        329702..330799
FT                   /locus_tag="PAS_chr2-1_0177"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68785"
FT                   /db_xref="GOA:C4QZW1"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZW1"
FT                   /protein_id="CAY68785.1"
FT                   /translation="MDIEDENHAKNISQWLEDNALSADSEYKQMSSDLEDSTMRFHNNQ
FT                   DQNEPGQEEAYGKMQQEAYNAHAAQIDDFIDIEGLEGGDNNALAYNDMLPTTSDLNFTP
FT                   LLSPNASSILTPSLPSQTYSFTPLTSPMIDAIPNLRTKRTSVESDHKYTGHKDSLRSSR
FT                   GTDIPPPMKKTKTPSSTPAFGPVTSRRSSPLLQPKKGSNNTTPVLISNNNSSFNQDFAL
FT                   PESSLPGPVTPLDLMGFKVQKQQSEDKGKSKSADKKATHKLAEQGRRNRMNNAIQELDA
FT                   ILPLEMRKYVTTPSKATTVELACQYIQSLLERIGELEKPPQSSPNDKTTNDSTLPANAS
FT                   PEDQADNNYNPANDTDSISPLEFEK"
FT   CDS_pept        complement(330889..334098)
FT                   /locus_tag="PAS_chr2-1_0178"
FT                   /product="Polyphosphatidylinositol phosphatase,
FT                   dephosphorylates multiple phosphatidylinositols"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68786"
FT                   /db_xref="GOA:C4QZW2"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR002013"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZW2"
FT                   /protein_id="CAY68786.1"
FT                   /translation="MRVLIHEKTRLIALVSSTHCLLIKYIKDKNQCAVDFVEKESFSPK
FT                   HMKPLSRNKAHGFLGLINVNEDVFLCVITGKTEVATPTDGETVNKIYNVEFHCLNRDAW
FT                   DFLELDGNGYPITTSDVNEEALRSRGSTEASDNHLSYEQNPTYELRRLLSNGSFYYSTN
FT                   FDLTSTLQSRDVNSDSLSFDSFHLDYMWNSYMMKEVVNFRDRLPTDSKKILDRNGFLTT
FT                   VIRGFAETFRTRIGHQKCNATIISKQSWKRAGTRYNARGIDDEGYVANFVETELILHSK
FT                   DFIYAYTEVRGSVPIFWEQDTALVNPKVTITRSLEATEPVFEKHFAALNGKYGPVHIVN
FT                   LLSTKPSEIGLSNTYRKHFEIVNKKGSPQAYLTEFDFHKETGKNYALATKVIPFLEESI
FT                   YDFDYFSYDVKNQKVLTLQKGVFRTNCLDCLDRTNVVQQVISNATLNMFLQRHNLNTNY
FT                   DSDLFNKHNTLWADHGDAISQIYTGTNALKSSFTRSGKMGIAGALSDATKSISRMYINN
FT                   FQDKAKQVTIDTLLGKMSNQVEVRIFDPVSDHVDNELSKLKSQFSAEDDIRIFTGSYNL
FT                   GGTAYADDFTDWLFPKENGGIEGAPDVVILGFQEVVELTASNILNSDSSRSHYWSEEIK
FT                   TQLNKISSSKYILLRSEQMTSLLLLFFIKEDKMPKVTQVEGCSKKTGLGGITANKGAVA
FT                   LRFSFGSTTFCLLNSHLAAGLNSVVERNNDFTTISQGIRFSRNKTIYDHDCVIWLGDLN
FT                   YRVPLPNELVRSSALNGVYDELLAEDQLKTEMVHKGAFADFYEMKINFLPTYKYDKGTS
FT                   VFDTSEKQRVPSWTDRILYRGKRLQQVNYNSVQSITISDHKPIYGTFKAHVTYVDERTK
FT                   LTLMRKIYDDYRRDPKSEASSASSNGDKFGDLIDFNDASSSSNTSIYTETEGKQVSQPV
FT                   PGHFPPPPPPPRNRVTPPQPSTPETPPPPGYALNMAPLIPSRANSGNNTRPSSPFEVST
FT                   DRAKAEISTKPVRPMVPDKPSSLKAMSPENTIQTVPPVQKAISTDSLNTASAAPPPPPP
FT                   RKQESINSSMSAFPVLMPKKK"
FT   CDS_pept        complement(334877..337441)
FT                   /locus_tag="PAS_chr2-1_0816"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0816"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68787"
FT                   /db_xref="GOA:C4QZW3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR025069"
FT                   /db_xref="InterPro:IPR027075"
FT                   /db_xref="InterPro:IPR035639"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZW3"
FT                   /protein_id="CAY68787.1"
FT                   /translation="MFSYTLLSPDNENTVIRASLLYFDPGINIFADPSWDGVADLSYLD
FT                   KIIPQINVILLSHPTADFIGGFVYLLQKYPVLKTLPIYSTYPITNLGKVSTTELYRAKG
FT                   LVGPLEGSIMEKSDIDECFDSIIPLKYSQSTPLTGIAQGLSVTPYNAGHSLGGTFWSIN
FT                   YNNEKIVYAPAWNHSKDSFLNSATFLQSNGHPIPQLVKPASVITGSDLGSSLSYNKKLE
FT                   KFFTLVDATIAQNGTVFLPTSMSGRFLELLHLMDQHLGNQPIPVLLVAFTGSKSLSLAG
FT                   NMLEWMSPKIIKDWEERNETPFDPSRVQLVDVDDLVQLPGAKVVFTADADLTIGSTAHS
FT                   TLASICIDEKNTIIFTERPTNSSFGASIYEIWEKLTLERNGKLEDGFPVPFEKLLTFSR
FT                   VTLKKLTGLELAQYTEIVNERKQEKRKKRQVEKMNTTILADKSIDINKPISEFDPAAVK
FT                   ALEEDEDEDEEEDKEDIGVEETANDERGNTTTTAVASTKKQEKDIYKIPLDFDVRNAKG
FT                   RNRLFPYHSRIQETDDYGIKIDHSDFVKEDKSEEFSRMLDNKLKRNNRGKGNGHMGDDD
FT                   DDDDDDDNDDGGENGPARKRRRNAKSVKETIYNFDPLVNPERLQLTSNMITARCGLSFI
FT                   DLSGTVDLRSVLLILNSLKPRNLLILPGRKSHREKTAESIVTSIKSKNSRNTQVYVTIP
FT                   DEAIEMESAQATLEVKLADTLESELQWQNIAGGYSVAYVNGVLETITDKKIESQTTENE
FT                   DEGDKNKDESHYQELVLNPLDQLSTLKSTAPLAIGDIRLSDLKTRLLGLQLKAEFKGKG
FT                   TLVINDEIMIKKLNDGEIMIDGTCNELFYVIRSAVQGMLAYV"
FT   CDS_pept        338334..339011
FT                   /locus_tag="PAS_chr2-1_0179"
FT                   /product="S-adenosylmethionine-dependent methyltransferase
FT                   of the seven beta-strand family"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68788"
FT                   /db_xref="GOA:C4QZW4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004557"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZW4"
FT                   /protein_id="CAY68788.1"
FT                   /translation="MLPTPLTKDLDFEKVYEPAEDSFLLLDVFEKEKPWLESYKWNSDV
FT                   PLVVEIGTGSGVVTTFVNQHIIPQGLFLATDLNPHCCNAVLGTHKRNIGKKGNLQVLQC
FT                   DLTTPLRRNQVDVLIFNPPYVPSETVPEVARDPDSEDWLDIALLGGPTGMDITEKVLDS
FT                   LYDTLSRNGVAYILFCARNHPERVMENFKAKETQRGNGWEIECVQHRKAGWEVLTVWRF
FT                   IRR"
FT   CDS_pept        complement(join(338998..340789,340887..343352,
FT                   343412..344025))
FT                   /locus_tag="PAS_chr2-1_0180"
FT                   /product="Protein of unknown function, essential for
FT                   viability"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68789"
FT                   /db_xref="GOA:C4QZW5"
FT                   /db_xref="InterPro:IPR007249"
FT                   /db_xref="InterPro:IPR040314"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZW5"
FT                   /protein_id="CAY68789.1"
FT                   /translation="MSPLGKGDVSARDKKYLSNVQKTIASFASVVEWADYISFLGRLQK
FT                   ALQSNPSKDTHWIPEAYQVSKLLSQCLSNTLPNGVHKKCLELYHDIFIMLGQEKLGQDI
FT                   SIWLPGLLPLMNYASITVRPQLIDLFSSFVAKIAPAYLHPVLRALLLGIWPALDDPTSE
FT                   CFESAFQLVDNLKKAVDDNEHFWKCLFLSIINSGDRKLGALFQNENILALLSSEARECV
FT                   NPEPGLLITAMCKGLQDESIFVQRGFFDLLTSRLELRSDVIQKLASQSDKEKLLLTATS
FT                   TVLKKDMSLNRRLWFWLLGPETSESSPTSRSEYFKNYGLEILTSSLLKLLDGNFTGESI
FT                   HAQKLQSFKISLAVLDKWEIAQFVIPRIFLPSLEACKETATPEILMGFGSLFDSVEAVD
FT                   IWSDFIKLIETKNYELMKFMLKNFNIDDEDMIVRHVPLVLITILISAGSAVDSEYGSWI
FT                   EIARIISNIIPARAYLPLEHADAEDQSVENIKENIDKFYSEKTDSLPYNPATVADITYN
FT                   LLKTLVSKQLNSSAGHLAFTSDLLADFVERLPTTEESPKLVNDQLIQQIVDLPFNNDLN
FT                   IDLSFGLIKLVPYLSSIATHFQLLQLLKKIIGSLWPIICDPRGIFQVEVVNSITKLEIF
FT                   VDPHCIEGELAYLFLSSEFPFPDKLRAVATLWTHTNTISGSSTDSILSRSLELVVDNLA
FT                   EKRSPRYVMVSKWIDNLLRSSSINRLYKNLVNPILTSNRFLSTGEITDEDDLALFAYQI
FT                   ETIINLLTLESSSIQDSFANELCVLDSDEEIHIVNTNNWNVDTYKMLLVNILKQFISIP
FT                   KVASDIQDYERCTISVVSLLELLIDGEEKVFSEIVEYLLEAIPSSPVIYLECLTKLLSL
FT                   AHSKHIGISIFEVRDDSCLFIDFLKQRIATSRDIVEIECLMQLVSQCSLFLNDSIFSIV
FT                   VPLTSTICRRLSDDFESYKSYVTGDIYSVDSKQLTPDLEQIIPLLMNGLEDLLTSTHGY
FT                   WKATEASESVDLSKNANDQGFFGSMINGVFQAGGNKDLSVSISDNSNEASSITDLGLTI
FT                   SYAASTLKYRPKKLLGTLYGLESIETLESLVSFRITNSSIFKLIHILDGAKHDLALQFL
FT                   LNSLTSRVFPNSLDEDQVSTLNIELTEHEIVTFILGYCQSLDNDSIEDIWLTFTQFLKD
FT                   VESNNVLYRQTLPGLIKITHSIGVKNTHTRFGEQKKIKRELSDHFVKLLNFSINARLDH
FT                   FEDIGDDSGKVLRSSELCEAMKDVSPKLTQLITDRDKLSGIVSSLISNVLQPIVKSKSI
FT                   PNIPDLVLELILAWTENGCLEFKSWKGFLGDVLNDTDFFKVQPSQREYWDRIFVKYIGA
FT                   ESEKMAELVTKFQSLNNSNNLFNWNDAEIRGRSLLVKRICYLILIGPQDTFMDSLKEIM
FT                   FRLNEIIKDSTMKPLLFLTLRILVLKFSPIHLSPYWTLIVSQMEELLLDVLEKSTLLDG
FT                   AVEKDHNHGNGKHKLRKEAARPELEIDLDSLLSGCKLLDVLIMMKPEEFQLSEWLFIQD
FT                   SALSQSDDKTDTAIPALIERLSHIKDLNRYSVLKSLNYELTEKTRRKPLLEGINTIDNI
FT                   GELKEFFDSLSFHDFECNYNINAPDYDAPIADSFADVFEASTFE"
FT   CDS_pept        344159..344926
FT                   /locus_tag="PAS_chr2-1_0182"
FT                   /product="Component of the ESCRT-I complex (Stp22p, Srn2p,
FT                   Vps28p, and Mvb12p), which is involved in ubiquitin"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68790"
FT                   /db_xref="GOA:C4QZW6"
FT                   /db_xref="InterPro:IPR007143"
FT                   /db_xref="InterPro:IPR017898"
FT                   /db_xref="InterPro:IPR017899"
FT                   /db_xref="InterPro:IPR037202"
FT                   /db_xref="InterPro:IPR037206"
FT                   /db_xref="InterPro:IPR038358"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZW6"
FT                   /protein_id="CAY68790.1"
FT                   /translation="MNNQSPYAPTNIHSERSVSLGLVRNSSISLDVPFKLYENSKEQHL
FT                   YEALSELYSIIVTLNSLERAFIKDTLYDNYEARVNRLISQYNAILKQEEVLSLFGSLEQ
FT                   FTTTYQLDAPYAKNRLEVGLPLQEPQLTYNGTGNVSITGTADLGAGAGAGTGSNYSSRA
FT                   VAEATGNFITCMDAIKLHYRTKEQLHPLFSDLIMSINKVLNNGEFEGKAKIVEWLIKLN
FT                   GLGIDESISEQESKTLLFDLDNSYKGFYSKLDS"
FT   CDS_pept        complement(344923..345594)
FT                   /locus_tag="PAS_chr2-1_0183"
FT                   /product="Acyl-protein thioesterase responsible for
FT                   depalmitoylation of Gpa1p"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68791"
FT                   /db_xref="GOA:C4QZW7"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZW7"
FT                   /protein_id="CAY68791.1"
FT                   /translation="MALGPVVIPALKGPAKGAMIIVHGLGDSGEGWRFFGELFGRYFPD
FT                   VTTILPNAPEMPVTVNGGYVMRSWFDIYEFGNPKAKQDADGILKSARVLQDLVKEQVSK
FT                   GIDPSKIVLGGFSQGASISLIAASTLDIKIGGVIAMSGFISIPKEVTPLITSANKSTPF
FT                   FQGHGTADPVIQFTYGEQCRDFFKSHGFTNYQFHSYEGMQHSTSDEELRHIYQFLSKAY
FT                   S"
FT   CDS_pept        345726..346304
FT                   /locus_tag="PAS_chr2-1_0184"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68792"
FT                   /db_xref="GOA:C4QZW8"
FT                   /db_xref="InterPro:IPR009851"
FT                   /db_xref="InterPro:IPR029012"
FT                   /db_xref="InterPro:IPR037202"
FT                   /db_xref="InterPro:IPR037859"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZW8"
FT                   /protein_id="CAY68792.1"
FT                   /translation="MATPPVPPLPSLPKEEVPAKIEFPLESVKGLDPSISSVPLSKLKE
FT                   LLDNQKLLKSYLLDSLQEFNQEIIHTLDENIRSLQNLLQQYEDNSKDIDQLNKSLDELN
FT                   VLFRRWKQTEIEMYTILQRYQPNSLSKKLFELLEQSHLESQQLVSKLEGSVQESDLQSF
FT                   IREYRAKRKLYHLRKEKYHRCQEERVRFV"
FT   CDS_pept        complement(346371..348464)
FT                   /locus_tag="PAS_chr2-1_0185"
FT                   /product="Protein subunit of mitochondrial RNase P, has
FT                   roles in nuclear transcription, cytoplasmic and mitoch"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68793"
FT                   /db_xref="InterPro:IPR013888"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZW9"
FT                   /protein_id="CAY68793.1"
FT                   /translation="MVFKTLASLSKQANKTAGYGIYHHPFFEPSYTKTQNICGFDNVIH
FT                   NDNKTSQNKTKYVAAVSTTANNLIIIDQKNGDPNDTKSRKLLIKKSTHKVSKNGHVSIS
FT                   VTQIDKAFSKLSIRKSNSALIRTFTISNNSLKHLESCKRFYSTDRAARLLDELNMNEET
FT                   NKLEQGKKSAQIEELEETAEPQQEEQSSTSGMEDEIRMIHSFVSQKRYNEVFALYLRAK
FT                   AKEIKLDRSVYTMVLRAITKRETNETVEEKLTHLLNVYSDLLTSNIKPNKDIYELVIGS
FT                   LLAGATKQTYEFTTGQDFLKIAIELLIITKDYNASFAPQLYRDLLTSLNMYKFNFGITN
FT                   NDLQNMCGSIINEPIYYMGLIKLCQLSQDSKGAIELYHTYQSQCNENKSLVNHQFEVYS
FT                   VLLQTLIGCHEKDMATKFLNNIIEEVRVKSGMSYQIKMLLSSYLIGLANINQIKECETM
FT                   LATINQISWLPDVSVKSLLFAVKKCLDNNQPELAWKFWNFAVTRSDFDSDQALKSEQLL
FT                   DEYVGTDVYNMLVVSLISSRDTNHIVKFCKEMIIKSSIRLEVQPLLSLIKYLRAYHLDT
FT                   VLLNVVVNQGNKSANLNQYLSIVIDSLPVPMVSQLMNTNFFKKCCEDYRLVKDNIYGIM
FT                   KAFKLMEDNNWQQQQTQDTTIMKKFRYYKKVISYELNEISNHYVEIPEELEQFKQYLAV
FT                   GSN"
FT   CDS_pept        join(349435..349459,349563..350884)
FT                   /locus_tag="PAS_chr2-1_0186"
FT                   /product="Alpha-tubulin"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68794"
FT                   /db_xref="GOA:C4QZX0"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR002452"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR023123"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZX0"
FT                   /protein_id="CAY68794.1"
FT                   /translation="MREVINVNVGQAGCQIGNACWELYTMEHGITPDGYLQPGLEKPKG
FT                   AEAGFSTFFSETGSGKYVPRALYVDLEPNVVDEVRTGPYGNLFHPEQLITGKEDAANNY
FT                   ARGHYTVGRELLDDILDRVRKMADQCDGLQGFLFTHSLGGGTGSGLGSLLLEQFSNDYG
FT                   KKSKLEFAVYPAPQVSTSVVEPYNTVLTTHTTLENADCTFMVDNEAIYDMCRKNLGIVR
FT                   PTFANLNNLIAQVVSSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAPVLSKQR
FT                   ATHESNSVAEITAACFDPSNQMVKCDPRLGKYMATCLLYRGDVVTRDVQTAVAHIKSKK
FT                   TVQLVDWCPTGFKIGICYEKPTQPASSELADVKRALCMLSNTTAIADAWNKIDHKFDLM
FT                   YRRRAFVHWYVSEGMEEGEFAEARENLAALERDYVELGSDSFPEEEEEY"
FT   CDS_pept        351089..351808
FT                   /locus_tag="PAS_chr2-1_0187"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68795"
FT                   /db_xref="GOA:C4QZX1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR003954"
FT                   /db_xref="InterPro:IPR009145"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZX1"
FT                   /protein_id="CAY68795.1"
FT                   /translation="MCTREIINNSSAFYRRIGACRHGNKCVKEHIHPTSSYCVVLRNFF
FT                   DFSLLKVANEGTEVADEGDKQKQQLSGDKKNEQNNGTEKVNQDTSTKDSTSPQNSEPER
FT                   NDPYTKLKEISESERFNKLLQDIFVELSLNYGFIEDIVICENNNVHLKGNVYIKFSTKE
FT                   SAANCNQELNNRWYNGRPIYSELSPVRSFEEATCRKHDFGRCERGDMCNYMHIKRAPPT
FT                   VTNNLFDSQLVYYDQQA"
FT   CDS_pept        join(351947..351990,352052..352760)
FT                   /locus_tag="PAS_chr2-1_0188"
FT                   /product="Alpha 2 subunit of the 20S proteasome"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68796"
FT                   /db_xref="GOA:C4QZX2"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR034644"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZX2"
FT                   /protein_id="CAY68796.1"
FT                   /translation="MADRYSFSLTTFSPSGKLVQIEYALNAVKQGVTSLGIKATNGIVL
FT                   ATEKKSASSLVNSEHQRKIAQITPDLGMTYSGMGPDFRVLADASRKVSHTNYKRIYNEN
FT                   PPTKILVSEVAKLMQEATQSGGVRPYGVSLLVGGYDDNNGFMLYQVDPSGSYFPWKATA
FT                   IGKNSNAAKTFLEKRWNEELELEDAIHIALLTLKESIEGEINGETVELSVIGNQNDDLL
FT                   GFKGAEGVHGPRFRTLSPQEINDRLDAL"
FT   CDS_pept        complement(352773..353555)
FT                   /locus_tag="PAS_chr2-1_0189"
FT                   /product="Protein required for respiratory growth and
FT                   stability of the mitochondrial genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68797"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR026285"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZX3"
FT                   /protein_id="CAY68797.1"
FT                   /translation="MTRYKKTLPYSYHSKPTKPMSFNIAVVYTDRLLLEHKDVWAKATE
FT                   HILTDELSAGSLDLRKLYVYLSQDLKFFEYGLRIVGRAISLCDDYPAANRLAKQAGFFA
FT                   NDENDYFVNVIKDLKEKLVSDSLFTSERIQEIDAMLFPDVAAYINFLKSFGTDPSITYP
FT                   KVITMMWVMEQVYLDWATRGVKNFQPDNLHWWYKGWIDLHYGDDFSSWTQFLKDEVDKC
FT                   YIKAFKENDAKTIEDIKSTFLKTADFEGKFFDETYHYV"
FT   CDS_pept        353842..357573
FT                   /locus_tag="PAS_chr2-1_0190"
FT                   /product="Putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68798"
FT                   /db_xref="GOA:C4QZX4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZX4"
FT                   /protein_id="CAY68798.1"
FT                   /translation="MKENDTPRVGISVRDLAVVTKKSRRAFFSSSSKRNDVPTSKVLLE
FT                   ATSFDIEPGTITAIMGGSGSGKTTMLNCLANGNENSGNINIQGTIAYNGKTNINTISHA
FT                   YVIQQDILLPNLTCYETLMYSAELRLKEPKEKLVEIVDQVILELGLKDCRNTLVGNDTH
FT                   KGLSGGEKRRLSIGIQMLCNPSVLFLDEPTTGLDAYSALLLIQTLKNLANQGKTFVLSI
FT                   HQPRSDIFFLFDNLILLSRGKTCYSGPLDKVIPYFEQIGYHVPKQVNPADYFIEIVSIN
FT                   MKDQETENKCWESLSKISDHWKDSHDFEPISVDPTFVSKVKSPVSFSKKIKILTRRDML
FT                   LSFRSPLILLSLLIETIAVSLICGWVFFIPGSSLRGIRTMTGALYTTNGLQPYLFLLFE
FT                   VYRLSSVDIKIYDRERSEGVVSAPSFLISRRISKFFTEDVWIPILESIIGYFMFGLRTD
FT                   SPRHFFIYFAAVYIAHLVSMCFAMACVSISREYALASLMANLNFTLQSMACGYLANSRV
FT                   IPVYVRWTKYIAYLWYGYGAVISNQFTGFRGECFQDTSQPNIDEVCAAYYGNNIIRNLG
FT                   FWPNFIALPLCVEVAMAFGFYLFAGLMLTYKTKSRSALSQEVSSSSKRKSLKSSTQDAT
FT                   KEAEVLVRDGLTITLKDASLKVRVRKVLERTSTEKEILHGVNAEFKPGQLNTIMGPSGS
FT                   GKSSLLNLISGRLHSNVTTSYTSIGDIFLDSQLASFQDMDEICSYVSQDGDHLIPSLSV
FT                   RETLLFAARLRLNLERHQVEKRVDEIILKMGLRDVATVLVGSEFVKGISGGERKRLSIA
FT                   IQLINDPPILLLDEPTSGLDAFTAGSILKVLQTLCDENKTVVLTIHQPRLDLFHSLGSI
FT                   LLLAKGGHVAFKGTPNEMLEHFESMGYPCPAFVNAADHVLDVISVNVQNEINETISRKR
FT                   VNLFLDEWKSRDNQETKLLAVNTFSMEDVAIKKRSSFMKGYTILLQRQALCIRRDTNIL
FT                   FGRIAQIAGLGIILALFYSPLKHDYTSIQQRLGALQQMTALYFIGMLNNIMIFPLERTS
FT                   FYTEYKDKVVSAESFFMAYLTLELPFELVSGAFFSVFMVMVIGFPRTPGLFFAMYYASI
FT                   CIVNCGESLGVIFNVIFDEVGFAVNIISIFLSIATFMTGVMSLNMGAFLRGINWLSPLY
FT                   YAVMGVLNLAFPPSLRLTCEDDFRNPDGSCIFSNGTDVLEIYQLKKNWQLLLGLLIVVV
FT                   FVYRGIGYVMLKLKVRGF"
FT   CDS_pept        join(357778..357834,357947..359236)
FT                   /locus_tag="PAS_chr2-1_0191"
FT                   /product="3-hydroxy-3-methylglutaryl-CoA (HMG-CoA)
FT                   synthase, catalyzes the formation of HMG-CoA from
FT                   acetyl-Co"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68799"
FT                   /db_xref="GOA:C4QZX5"
FT                   /db_xref="InterPro:IPR000590"
FT                   /db_xref="InterPro:IPR010122"
FT                   /db_xref="InterPro:IPR013528"
FT                   /db_xref="InterPro:IPR013746"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZX5"
FT                   /protein_id="CAY68799.1"
FT                   /translation="MSRPSNIGIKAMEIYLPGQAVNQAELEKFDGVAAGKYTIGLGQTN
FT                   MAFVNDREDIYSMSLTALSNLLKNYNIDPNSIGRLEVGTETLLDKSKSVKSVLMQLLGE
FT                   NTDVEGVDNINACYGGTNALFNSISWIESSSWDGRDAVVVAGDIAIYEKGAARPTGGAG
FT                   TVALLIGPDAPLSFESVRGSYMTHAYDFYKPNFTSEYPVVDGHFSLACYVQALDFCYKA
FT                   YSKKAIAKGIAANPVGPEAVGIKHFDYNVFHVPTCKLVTKSYARILYNDFRADPTRLPD
FT                   VDQELATLDYEKSLVDKAVEKTFVGLSKDLAKERLAPSLTLPTNTGNMYTGSVYGALAS
FT                   LLTYVGNDQLQGKRVGLFSYGSGLASSLFSLKVNGDLSSIIKVLNVKQKLKSRNIATPE
FT                   DYETAIALREKAHLQKSFKPTGSTDYIPNGSYYLVNVDDKYRREYQVKN"
FT   CDS_pept        complement(359322..361040)
FT                   /locus_tag="PAS_chr2-1_0192"
FT                   /product="Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68800"
FT                   /db_xref="InterPro:IPR018803"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZX6"
FT                   /protein_id="CAY68800.1"
FT                   /translation="MRIFHWILFFITTSLARQSILSNSASDNTPSLVEQYAHVVSEWDI
FT                   NDLKEYLKDSKASIDEKRSKDVEFLRSIAIENLVKTKKQTNSYWDSFKSLFSAPKSYLE
FT                   SPFNNDSGKTENVSDWIFETWSSSQLNNLLKDAGIKVQPYQSRSSLIDAAKKNYGKISK
FT                   KSKASGKYPGAWLYNKWSNDDLVEWLLDNEVIGQQEAKRLNKNRNALLKKVRDHIYSVS
FT                   SYYRDLRDSLIEDLDLDLEDVSQFKDDTINSWSESQLLDWLKIHKIKVDEQYYHNKDYL
FT                   SKKVSENKALLKDDVESWLSSVNKVVSPYLSKSTEQLEKAKKTAGKKSQEAGEFINDTF
FT                   LIDVSKWSRSRLTSYLKSRGIRIPLFATKSHLVKLVEKNRSTPPISWQKGVKDSIPDWI
FT                   FEGWSTAQVENWLKQNNVPIDKGVKKRDDLIKKAIEWYGDAAKTASKQQENIKNTASEK
FT                   TDDLKQAFQSLKTGANDWYESFYNYYNSWSEKDLKKYLKSYGIDTTGLSHTDLINQARS
FT                   VSERVLKGTPFDTQPSLVNRLSFGYFDKQTPFYYSLLSYYYQFKSYLATYIPFVH"
FT   CDS_pept        361644..363335
FT                   /locus_tag="PAS_chr2-1_0193"
FT                   /product="Component of the RSC chromatin remodeling
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68801"
FT                   /db_xref="GOA:C4QZX7"
FT                   /db_xref="InterPro:IPR003150"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZX7"
FT                   /protein_id="CAY68801.1"
FT                   /translation="MSYLSKSPRPESALSRKNPTNIIGSSVPEPSIIPKPIDIPTLDEQ
FT                   DQEYLKNNNYLKNESSFKYTGLPGLNNPGPNLQYRLKMAFKSGLSEEVDWAVDTCLQAS
FT                   VQQPGLLNLRANPWLIDELAANLSCSIFDPSETVNHNIERTLNVVVVLRNISQDTDNSS
FT                   VVALNPRVKEILLLILDNKIHLQVSMLDDLFEASKELLRYSVDLIETISSYISPAPKDD
FT                   PMFLSLISILLKSTDRSLVITTLRSLSRLMVRSNLTKPFGADDITDEVLDNVSSYLMLT
FT                   STTAVRDSFNDDLILASVDFLYQYCLPGGIRVLNLLKNEKRALLIKSILPRLLTYGLNF
FT                   QTEFTNELPMLKLNKRVRPPAPAHPPQLTADLYSAIDQLGEPARATVWMRCCYYAVEDG
FT                   EVTQISLWRSYEKQFGDSSSKRLLPAVDFIKNVSNAFPSSSAVVIKLDNDQRKFIIKGI
FT                   KPREYPVRVRVGEMEALRQPLPRESDKLAKDNIEASQESITLFNYSSNVSISLTEINTS
FT                   AALLLNCLTESETGGKLLEGSKELLLEKVLQVPSLLEHIQPSLMSL"
FT   CDS_pept        complement(join(363389..363831,363879..363894))
FT                   /locus_tag="PAS_chr2-1_0194"
FT                   /product="Subunit of the heterohexameric cochaperone
FT                   prefoldin complex which binds specifically to cytosolic c"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68802"
FT                   /db_xref="GOA:C4QZX8"
FT                   /db_xref="InterPro:IPR004127"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR011599"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZX8"
FT                   /protein_id="CAY68802.1"
FT                   /translation="MSQQKVDLTTLPPQQIFEFKRQIQQEVQHLQSSIQALNTAKAKFN
FT                   ECIANIDRVSKSPENDILTPLTSSLYVPGKIVDNDKFLVDVGTGYYVEKNVEDAKEFYK
FT                   LRIDKLNQDSEQLTQMIQEKINIMKSVDNVLKQKIQQEEKSRQQTTQA"
FT   CDS_pept        363991..364965
FT                   /locus_tag="PAS_chr2-1_0195"
FT                   /product="Single-stranded DNA endonuclease (with Rad1p),
FT                   cleaves single-stranded DNA during nucleotide excisio"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68803"
FT                   /db_xref="GOA:C4QZX9"
FT                   /db_xref="InterPro:IPR004579"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZX9"
FT                   /protein_id="CAY68803.1"
FT                   /translation="MSGADDGKDKTDTTSFEAILAGVKRLREQDQNKDAKQGSEKLKIP
FT                   LKRLPKRSLPTPKSDQIQNVKTTEDAAPVSSAPVTSTTTSKVIRMDNTPSNLAIRHQKK
FT                   TGKTTFNSIQVNKSQTGNPLLKHLKTVSWEFSSNIKQVDYLVNSQTFVLFLSLKYHKLH
FT                   PEYIMNKIKSMNGNDTSFTNNNLKLLLVVVDIDSHEDILRELTKTCVNNDLSLVLSWSF
FT                   EEAANYIVYLKQYELSDLSESTLINNSKQDSSSYNSLVKSVTSIRNITKTDAVNLISEF
FT                   GSLRELVNANPESMSAVQGMGDIKVNRWASVVEDQFVLNKEYT"
FT   CDS_pept        complement(364969..366051)
FT                   /locus_tag="PAS_chr2-1_0196"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68804"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZY0"
FT                   /protein_id="CAY68804.1"
FT                   /translation="MAPKIGTKSLRLLCSMEIARNCESLRLAHIDKECWNNLWKQIWEI
FT                   ILYNNMDSPYLFKLFATQFSQCTDFPCHTKLSIDFQHQYRRLVNQERDVVLHRHLLIGA
FT                   SPKHRIETICGNFHLASFINVHQSFSYGGLVSIKVRSQLSRESLILLSNLTSITHLDVS
FT                   GCRNVDDSVINSWCIAINVGKLPHLNCLVLNDCPITKSGFMKLLNLTRGDIFYLESHIQ
FT                   IDLKESLNEWNSSYQNTALLSLCSLDKWYHVNLLYYTAQKTLNFYLTRMKSTIVEDYRI
FT                   VEDKISPYSDIDKINTQLTSAWLHNLQRKLGNNPVYSYLLSQRVPPQPNKVIKVTKENK
FT                   LSVVPKRKVKITSLNSFFEI"
FT   CDS_pept        366517..368091
FT                   /locus_tag="PAS_chr2-1_0197"
FT                   /product="D-Arabinono-1,4-lactone oxidase, catalyzes the
FT                   final step in biosynthesis of D-erythroascorbic acid,"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68805"
FT                   /db_xref="GOA:C4QZY1"
FT                   /db_xref="InterPro:IPR006093"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR010031"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR030654"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZY1"
FT                   /protein_id="CAY68805.1"
FT                   /translation="MSFVPQELAGFAVPKVVHTTWAKTFVCHPELYFQPSTLEEIQLLV
FT                   KSALKHQKTIMTVGSGHSPSDMTMSDEWLLNLDKYSSILKVDEHDMYTDVTVEAGIRVY
FT                   QLNELLAKKGLAIQNLGSISEQSMGGIISTGTHGASPLHGLVSQQLVDITLVNGLGEVV
FT                   KCSPTDKPELFRAAMLSLGKIGIIAQLTIRTVPRYAIKSYQEVISFKTLLDIWETVWTS
FT                   DEFVRVWWFPYSKRCVLWRASKSVEEYKNPRSSWYGTKWGRLTYEFLLWVCVHVYPKLT
FT                   PIVERFIFSKQYGNKETLGHGTTAVQESVEGLNMDCLFSQYVNEWAAPLNNGPEILRSL
FT                   ERSIDTAAHNGDFFVHAPIEVRCSNTTYNNEVGEPDVSHRHIDTKGPVIGNNLRPYLDT
FT                   TPELSWVPKDKITNSQLTLYINATMYRPFRTSVPIGKWYRIFESSLEAAGGKPHWAKNF
FT                   IGSEEWAGGELKSDGYKDGEMKGFAVKMRDWYGDDLVKFNQVRREQDPNGVFCSGRSWA
FT                   VRNGIII"
FT   CDS_pept        join(368807..369535,369607..370068)
FT                   /locus_tag="PAS_chr2-1_0198"
FT                   /product="Fe(II)-dependent sulfonate/alpha-ketoglutarate
FT                   dioxygenase, involved in sulfonate catabolism for use"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68806"
FT                   /db_xref="GOA:C4QZY2"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZY2"
FT                   /protein_id="CAY68806.1"
FT                   /translation="MSITAKLSTVNLNTDKEAKQAAINDKKIRYGGDVVHFSPGTDIVR
FT                   EDGVLTVSKQAQAESKYPQWLPTWDPKLRFDDEPRFSHVDRGFFADPELKRLFPQGGDH
FT                   KLKNLTPKLGTEVEGVQLSQLTPEQKDDLALFVAQRGVVVFRDQDLRDRPLEEIKKFGQ
FT                   YFGPLHIHQTSGAPDGFPEFHIVYKRPGASKALENKISVPAWHSDTTYELQPPGTTFSV
FT                   LSKVQKQVETHCLLMQLKLTSAALSQGSIQRKNFTPETVHPLVRYHPVLGKRSIYANKV
FT                   FGTRIIGLKQEESDLILDFIQFFIAAALDLQVRANYKPGTVVAWDNRTVYHSPVFDFDY
FT                   DAPVRHCFRITPIAERPVGSKEEYESWSPNGEEKTVEEWEELYAGGVPDLKTVLSS"
FT   CDS_pept        371168..372085
FT                   /locus_tag="PAS_chr2-1_0199"
FT                   /product="Essential protein required for maturation of
FT                   Gas1p and Pho8p, proposed to be involved in protein tra"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68807"
FT                   /db_xref="GOA:C4QZY3"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZY3"
FT                   /protein_id="CAY68807.1"
FT                   /translation="MVEDKTELLKTPLHGVYIPCALIVFGVAIHDYHFIPHTLLVLGLF
FT                   VGIRLLIAYNKRASIQSDKWNDFELIDKTVVSKNSAIYRFKLYRDEEILDIPVGHHLAC
FT                   QINVDGKNEVRYYTPISSQFDQGFFDILVKSYKDGSVSKAFASLNQGQTVKFKGPVGRM
FT                   SYKNNMASEIGMIAGGSGITPILQVLSYITTTPEDTTRINLLFANEYENDILLRDEIDE
FT                   LARIYPFFDVHYTLTHPPENWDGDVGYVTKEMIEKYLPPPTKTSKIFISGPLEMKKLCL
FT                   ELTEELGFDKGKLNSDQNDQVFCF"
FT   CDS_pept        372275..374335
FT                   /locus_tag="PAS_chr2-1_0200"
FT                   /product="F-box receptor protein, subunit of the
FT                   Skp1-Cdc53-F-box receptor (SCF) E3 ubiquitin ligase
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68808"
FT                   /db_xref="GOA:C4QZY4"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZY4"
FT                   /protein_id="CAY68808.1"
FT                   /translation="MEEEEVNSLGNRIATASPLPDNVPVRGLPELPSEVLVTIFSFLDP
FT                   MTLDGLSLVCKRWKMVINDNELWRENFIKFFGSKQFQSLTRSTQWRTELLMRKELAQRW
FT                   IKGKGMYHTYAVRNGVITDIAADFRNDKLVLFSKNTGDLTITSLRSNKGETPITGVFPN
FT                   GTTSCELSKNAMIFGRWDGKVYLKLLNQKNVYLNDSISLKESTHEGIVTVTKINKDSIA
FT                   GKHGSVRAFSGDHRGRVIGWDLKNYQKVVDWPISNASITNIESNYQDCVIVRDQLGIIY
FT                   VIDHNLKDSKGPMRSPRIIKTEKIDENATFSMQVDFGDENIVISYENKVRVYSYSLHMF
FT                   GHFSELEVAEDDQVYRTVISQMNLQCCRKDDTLAGHDGLLCGTIFKSGKTVIWNVRSWE
FT                   DQQPIPIIHVIVPKFQHYVYLNEDSPRVVSLDINSSVIIFGSHNSYCSLYDAVSGEFMR
FT                   FVSRKLPRKILLHDQILPVTETLLDKEDNFATNGVIVMGNIIQYFQFGEQKNYDKFKKK
FT                   MARNSLKRAGVDDRKVKNRRHIKDDVEDFTFQQIQEQQKSELLDKYNGDSFEDEEEEMS
FT                   IAIALSESLKVKERAEGSEEEEEELKRALELSRSQSAILGDEVVGHEDPTLNSEDRELN
FT                   YALDLSKRETQRSNIFPDGEGSSSRIESDLDNTSNNDDEMELALKLSLIEH"
FT   CDS_pept        complement(374370..375155)
FT                   /locus_tag="PAS_chr2-1_0201"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68809"
FT                   /db_xref="GOA:C4QZY5"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZY5"
FT                   /protein_id="CAY68809.1"
FT                   /translation="MTETSKSSHYRKASFSPYEDTKSKLAADLEKLAASSEQGDDLSPI
FT                   NKEKKRVSKPKNKVRRRKFDSWDYVFIVIIMFASCGIIYNLFRGPRIIFTTQKDLDTAL
FT                   SEIVKPVVTYTNDGVPTSTDTAGQSLTNKDEDQTRFDVAKEFRAIGEISPLIILTTNDN
FT                   ESEQLKKTISLYSITPQPALVAVNRHPHVEKLTSYINSLAAPQGSSSSTSNLPEEAVPG
FT                   IVINGVPVASAKEIVLLHSAGKLNEFLSRKSQGRYRIEH"
FT   CDS_pept        375923..377083
FT                   /locus_tag="PAS_chr2-1_0202"
FT                   /product="S-adenosylmethionine decarboxylase, required for
FT                   the biosynthesis of spermidine and spermine"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68810"
FT                   /db_xref="GOA:C4QZY6"
FT                   /db_xref="InterPro:IPR001985"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR018166"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZY6"
FT                   /protein_id="CAY68810.1"
FT                   /translation="MTLHSVAVPDFINHELSTTLDSTNAFEGPEKLLEIWFAGSAEEME
FT                   DDGLRQIPLEDIESLLELVNCEILSKISSSSFDSYLLSESSLFVYPHKLILKTCGTTTT
FT                   LNCFDKLFDLMKTHLQWDLSSRSPYRIFYSRRSFMFPSQQKHVHQSWQSEVEWLNKYFG
FT                   KSSSKVYIVGDLSNDHWYLYLNGTDGSHMPSPPSSPNDFKGKDETFELLMTELDPVKCE
FT                   RFMTDIRVDQFSDVNLDIDDYGHVIGMKTLKETGIDSFFSKERSKHDAFAFKPCGFSSN
FT                   SIVDKDYYYTIHITPEEAFSYASFETNYPKLADKTQLINQILSFLNPGKFVMVFVQEVD
FT                   EDEVLSNDFMNLKRFNLEGYTKVDNIIYDLKFNYKLIYSQFEKIKQ"
FT   CDS_pept        complement(377117..379411)
FT                   /locus_tag="PAS_chr2-1_0203"
FT                   /product="Phosphotyrosine-specific protein phosphatase
FT                   involved in the inactivation of mitogen-activated prote"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68811"
FT                   /db_xref="GOA:C4QZY7"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZY7"
FT                   /protein_id="CAY68811.1"
FT                   /translation="MCSASLEGHPNLRSSSMENAYEESRTTSTPSPASPPLLLAPLIPT
FT                   LKVTEPESPQLKPALTDSPKTASETSLSTHRSSASMPFLSSMTKNKLTQTFKLEEDAVQ
FT                   PINGYEELVDLFDGKESVIVLDVRPYSFYLTSRLKGALNICVPTTLLKRKTFTMQSVIS
FT                   TMSQQHKEVMQSKLLDCSISSLDIIIYDESSSLDSCSFHLYETIKKFLQENSKTATDES
FT                   AKHFNLFILQNGFSEFQNRYKLFDPLHLIDTTPVLLSPSSPLSQNSQLTSPSVSPETAA
FT                   TTTAAGLGRISTKHTSIPAPLSGFSLPPNRFSGIVDESLLKKQSASNLQSENEDDLDQG
FT                   ELVVPEHIRDVPVWLLPFTDKIRGYKLAKKRFVKIEKIENRRLRNLISNTLNQKTQHFQ
FT                   QQNAISHNHKHFTNGSDDELNTPAGSCNICDKIDYSLPSEGLENGIKNRYSNIWPYEHS
FT                   RVKLSHSQSVSHLEKSNEYFNASYVTVPLISSKRYIATQEPLETTLQDFWRCCLNNKVP
FT                   MIICLTSSGLENGVPNSVPKYYHTQHFKDSNISVTLLKEEKNDDCSSIVRTIQVSKEDK
FT                   VHTVTQIEFQDWPDFGIPPSALSILKLIDLKNRLLQDKNLSTTSDKDSTIMVHCSAGCG
FT                   RTGTFITIDLLLDSLNRTLEDDAVLASPGCGLTTHSPFSQLSQKLFYDKTAEQADIEDK
FT                   AASAKDLQRFHHHNSILNFYKSDLDLVYKTVNELRRLRVSMVQNLSQYIICYEAVLKYL
FT                   ELKESDHQHNK"
FT   CDS_pept        complement(380191..381435)
FT                   /locus_tag="PAS_chr2-1_0204"
FT                   /product="RNAse"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68812"
FT                   /db_xref="GOA:C4QZY8"
FT                   /db_xref="InterPro:IPR001568"
FT                   /db_xref="InterPro:IPR018188"
FT                   /db_xref="InterPro:IPR033130"
FT                   /db_xref="InterPro:IPR033697"
FT                   /db_xref="InterPro:IPR036430"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZY8"
FT                   /protein_id="CAY68812.1"
FT                   /translation="MLFKFHSAYQMISELLQGVLDHTPNPIEVPQLPNQFPLSTDYCPI
FT                   DVPLTCSNKTEVKDTCCFEHPGGVLVLTQFWNYYPAIGPDKLFTLHGLWPDNCDGSYDQ
FT                   FCSNSDTITEVSGILRSFGEEELLEKMKQVWKNNNHNDEQLWIHEFNKHATCMTTIQSK
FT                   CYDQYEKHVNVVDFFRTTVAVFETVPTYDWLANNGIVPSTAQTYSRQQIEDTLTAQFGQ
FT                   PVRISCNKYGALDEVWYFHHLKGSVRMYNNSLPDLYPIPALAESRCPEHGIKYLPKDFK
FT                   PPAPTHTQPNLPRPTDGVYKHGYLKLSGQSGCLISTGKWYTSGTCATFQLFKAPFGGYN
FT                   LKSSKGFCGVTVDGELICHRGQQPIQFEFDKSKNQINYGGVHVWSAFNEPSRFEQIPIF
FT                   SGRKGSIVFKLILEE"
FT   CDS_pept        join(381807..381945,381993..383332)
FT                   /locus_tag="PAS_chr2-1_0205"
FT                   /product="Subunit of the Hat1p-Hat2p histone
FT                   acetyltransferase complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68813"
FT                   /db_xref="GOA:C4QZY9"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR022052"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZY9"
FT                   /protein_id="CAY68813.1"
FT                   /translation="MCKLDLQSFDVRCLLDIFSINSSFVSIHPHSPIMSATEITQQEEA
FT                   KITFEIHEKYRQQEKIINEEFKIWKKSVPLLYNFIYTSVTQWPNLSADWLTSVKQNDQS
FT                   FTVQFVVGSNSSSDEDYLALYQIDLPLSVTTTSAEQTVDEEDIKKAIEQDSKSNKFQLV
FT                   HKWPHPGEINKLAFNSDNLVATVTKTGSILVFDINNVSSSKPKFTLNFHKQEGFALQWN
FT                   PSNNQQLVTGANDGKIAVWDLSKNTTAPVQEFSPHSSSVNEVSWNSEYNFLIGSASDDR
FT                   SFQIHDLRSGETIIKVDDAHNGDVNAIKFHPVLGDLLVTAGQDTLVKVWSLSKLLSPAD
FT                   EPSKNDESTNDEIQEERDQAIRYLHGHFNSVTQVDFNPENPNYLLSSSCLDKRVMVWNL
FT                   ANLDEDFEEDEAEKNPEYNDPALIFIHGGHTSSLSEARWHPTLHDVILSCGEDNLLEVW
FT                   QPLLPREEDSSEEDEKIDENEQDEVTEDKEMKDV"
FT   CDS_pept        complement(383381..384529)
FT                   /locus_tag="PAS_chr2-1_0206"
FT                   /product="Subunit of COMPASS (Set1C), a complex which
FT                   methylates histone H3 on lysine 4 and is required in tel"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68814"
FT                   /db_xref="GOA:C4QZZ0"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR037869"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZZ0"
FT                   /protein_id="CAY68814.1"
FT                   /translation="MTEELSKEELKRLQKKFQEFEKAPKYNLNSEEVFCICRKPDDEGQ
FT                   LMVACDGCDEWFHFRCMKLDPKYEKLVANFYCVFCDRLFNKGKTLWKRKCKLEGCFNPI
FT                   ELSEEKKSKYCSEEHGLMYMKQALLDKVLKQEDLNGQRLLKLKEVSSILREVDDCKALA
FT                   KLGEELPIYSDFYPDAKLSPHLTEKVAAWDKQIQQVTTELERLDSRLRLVLALKEFLKL
FT                   LNENINIITIPDYIPGPRTKSSKSKSKNSKKSDICGFNRVILDLDRATDMDQFKAKISP
FT                   YLGKNAIDPEDFKKLYREIYPDDDDMVDSVGPENWLARFCLKDKRKCNKHHSWLNILAD
FT                   DYYLQTQLLEEKKKRLQDERQTLMTDYNIERWSNLEAKVASN"
FT   CDS_pept        384750..387287
FT                   /locus_tag="PAS_chr2-1_0207"
FT                   /product="Mitochondrial GTPase related to dynamin, present
FT                   in a complex containing Ugo1p and Fzo1p"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68815"
FT                   /db_xref="GOA:C4QZZ1"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR019762"
FT                   /db_xref="InterPro:IPR020850"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030381"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZZ1"
FT                   /protein_id="CAY68815.1"
FT                   /translation="MLPRSRHMVPMMRRTFGVRLIQHQIPKKQIQFGLIKTRPFSIYSF
FT                   GKFAGRVVKAPAAVGGGLAAAGSYVAYKVEQASSYTKDQVDRAKDLAGGLYDNISGFFG
FT                   KFGGNGSEGVPPDGNGSNAAALGGTAAAVGFKSDDDEDEETLYLDEDEDEEEEEEDSET
FT                   MDDEMLNLTRQMIEIRSILQSIDPNDNTLKLPSIVVIGSQSSGKSSVLEAVVGREFLPK
FT                   GSNMVTRRPIELTLVNSPDLAAEVAEFPALRMNNLTDFEQVQKILYDLNLAVPITEAIS
FT                   NDPIQLTIRSPRVPDLSLVDLPGYIQVEAADQPTELKRKIRQLCDKYLEEPNIILAISA
FT                   ADVDLANSTALRASRQMDPKGERTIGVVTKLDLVDGAEARGILTNRKYPLKMGYVGVVT
FT                   KVPQTSIFKKKTGYQAFIAQQNFESTFLKDNKDEFAGTSVGTRTLKKRLMRVLERSMAL
FT                   SLKPTYDRVQQELEEASYKFKVEFNDRSLTPETYIASSIDTLKGAVKEFSERFGRNEIK
FT                   SVLKNELDQKVLDLLASKYWNKPHDQSREIDLDLRDIVNASPTDVYWHRKLDLTTNSLT
FT                   KLGVGRLSTTLLTNALLTEIDNMIDNTTLRTHPMIKQVVRDAAEEVLNSRYYSTADQVE
FT                   NCIKPFKFEIELENSEWKQSRDHIIRLLNEELRSCDQYLQLLKKNIGSRKLTQIMTYLE
FT                   NKDNSIGETIERENIGFSPGILSRGRDALFLKDRASLLQFRISCLKSSQCKIKENKYKC
FT                   PEIFLAAVADKLTQTAVLFLNVELLSDFYYNFPRALDAKLSNGLTQEQIEAFAKEDPKV
FT                   KRHIELQQRKELLELATSKIEDVMTLQKHRTKH"
FT   CDS_pept        387451..388338
FT                   /locus_tag="PAS_chr2-1_0208"
FT                   /product="Protein of unknown function, localized to the
FT                   mitochondrial outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68816"
FT                   /db_xref="GOA:C4QZZ2"
FT                   /db_xref="InterPro:IPR012472"
FT                   /db_xref="InterPro:IPR039960"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZZ2"
FT                   /protein_id="CAY68816.1"
FT                   /translation="MSFPGKVELSPVQPLPLDIGIPVTPNEKELRERRRFSKLIPFLYT
FT                   VQKWSILPFGCFALLHIPAVVVMPSLSVNLAKQLFTMGRCVYQAPGLESLMIWGSLGVH
FT                   ILSGVTLRLLKIYRNYSYYGMVHKRTRRRKSLFAKENTDDLDPSFGMGGITSLLGLGFK
FT                   GSYISKILGISPLSFTGYLLLPVLAAHINDMRLLPASIDGDSNLIDVEYITQALAQHKW
FT                   TTSLGLLALVGLASYHTIGGMMRYLKLYSLRSRQWSYALVVGMFTVAGFSLRAISQLPL
FT                   IQGYVGKRYSVYLA"
FT   CDS_pept        complement(388384..390708)
FT                   /locus_tag="PAS_chr2-1_0209"
FT                   /product="One of two large regulatory subunits of
FT                   ribonucleotide-diphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68817"
FT                   /db_xref="GOA:C4QZZ3"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZZ3"
FT                   /protein_id="CAY68817.1"
FT                   /translation="MTKSKEAISFDEARLKRSLLKLSFGLNLKFVDIALVVEKVSLAII
FT                   ENLHLQDLLNLTSEILASLSTRHYDYSNLAARLLSNHLRKRLGDSFFANCERLAEHGFV
FT                   DKGLLTIARSNSEQLDGSIKPERDFDFDYFGYMTLQSIYLLKKDDLILETPQFLFMRVA
FT                   LGIHGEDLSSAIQTYDLMSQGYFIHASPTLFHAGTPTPYLSSCFLMGLQDADVNSVYQS
FT                   LHKIAMISNAAGGIGINVHDIPAEDACNRGIVPLIKVLNETARYVQQGSNKRPSAFAIY
FT                   LEPWHEEVFDLLNLRKNHGKEEIRARDLFYALWIPDLFMEKVEKNEDWCLFNPLHAKGL
FT                   NDVYGEQFNLLYAEYEKKGMYVRKIPAQQLWNAIVDAQIETGTPFMLYKDSCNRKSNQS
FT                   NLGTIQCSNLCCEIVEYSSRDQIAVCNLASIGLPKYVVDGKFDFESLKNSVRIVTENLN
FT                   KVIDISKYPVPEASYSNDLTRPMAIGVQGLWDTFMLLKIPYDSEEAAALNSQIFETIYY
FT                   SALETSMNIAKKDGPYKSFQGSPASKGLLQMDLWNVKEEDLTLDWKSLRSDIVKHGLRN
FT                   SLLVGPMPTASTSQILGFCESFEPLSYNFYTRRVSSGEYQVVNKYLIDDLINLGLWTDS
FT                   LRQEIIGNDGSIQEIDEIPQEVKSLYKTVWEISQRITINMAADRGRFIDQSQSMNLYLA
FT                   KPNRGKLTAMHFYAWKKGLKTGMYYLRTKAASSAIKFSIDISKRKRDGTYNTPTKRQAV
FT                   QSEALETTPSCQLNNCESCSG"
FT   CDS_pept        391953..392399
FT                   /locus_tag="PAS_chr2-1_0210"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68818"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZZ4"
FT                   /protein_id="CAY68818.1"
FT                   /translation="MQFKSLIGATLALSVVKATTELEPIFTNDVNVTVPTVPPEITSTP
FT                   DVSVPGNLTETGGLTNTTGTGGFTNTTATGTGGFTNTTATGTGTGTGTGTGTGTGTGTG
FT                   TGTGTGTGTGTGTTGTGTETGNGAQAVLGSSVLAAAGLFVAMLI"
FT   CDS_pept        complement(392460..393794)
FT                   /locus_tag="PAS_chr2-1_0211"
FT                   /product="Subunit of phosphatidylinositol (PtdIns) 3-kinase
FT                   complexes I and II"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68819"
FT                   /db_xref="GOA:C4QZZ5"
FT                   /db_xref="InterPro:IPR007243"
FT                   /db_xref="InterPro:IPR038274"
FT                   /db_xref="InterPro:IPR040455"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZZ5"
FT                   /protein_id="CAY68819.1"
FT                   /translation="MNEAEYKCQRCRLPLTIDGSLEDLSISQANLLTGRNGNFTKNTIP
FT                   LEDAVEEDLPKVPQSRLNLFKEVYQKMDHDFTNARDEFVVLNKHNDNSDVNVEYDYEEN
FT                   NTISRRINTMTNIFNILSNKYEIDFPVCYECATLLMEELKNEYERVNADKEVYAKFLSK
FT                   LRKQDAGTNMKERTAQLLEQLEKTKQEERDKEKKLQGLYDERDSLEKVLASLENEMEQL
FT                   NIEEQQIFELENKYEYELMEFKNEQSRMEAMYEDGLTQLDNLRKVNVFNDAFNISHDGQ
FT                   FGTINGLRLGTLDSKRVSWYEINAALGQVVLLLFTLLSRLELELKHYKIFPIGSTSKIE
FT                   YQVDPDSKPVTINCFSSGEQLLDKLFHSNKLDPAMNAILEITIQIADHFTKQDPTNELP
FT                   YKMENETISNLNIKPSKRKSNEEWTLACKHLLTNLKWIIAFSSST"
FT   CDS_pept        complement(393967..396336)
FT                   /locus_tag="PAS_chr2-1_0212"
FT                   /product="Protein O-mannosyltransferase, transfers mannose
FT                   residues from dolichyl phosphate-D-mannose to prote"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68820"
FT                   /db_xref="GOA:C4QZZ6"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="InterPro:IPR036300"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZZ6"
FT                   /protein_id="CAY68820.1"
FT                   /translation="MCQIFLPQNVTRCSVSLLTMSKTSPQEVPENTTELKISKGELRPF
FT                   IVTSPSPQLSKSRSVTSTKEKLILASLFIFAMVIRFHNVAHPDSVVFDEVHFGGFARKY
FT                   ILGTFFMDVHPPLAKLLFAGVGSLGGYDGEFEFKKIGDEFPENVPYVLMRYLPSGMGVG
FT                   TCIMLYLTLRASGCQPIVCALTTALLIIENANVTISRFILLDSPMLFFIASTVYSFKKF
FT                   QIQEPFTFQWYKTLIATGVSLGLAASSKWVGLFTVAWIGLITIWDLWFIIGDLTVSVKK
FT                   IFGHFITRAVAFLVVPTLIYLTFFAIHLQVLTKEGDGGAFMSSVFRSTLEGNAVPKQSL
FT                   ANVGLGSLVTIRHLNTRGGYLHSHNHLYEGGSGQQQVTLYPHIDSNNQWIVQDYNATEE
FT                   PTEFVPLKDGVKIRLNHKLTSRRLHSHNLRPPVTEQDWQNEVSAYGHEGFGGDANDDFV
FT                   VEIAKDLSTTEEAKENVRAIQTVFRLRHAMTGCYLFSHEVKLPKWAYEQQEVTCATQGI
FT                   KPLSYWYVETNENPFLDKEVDEIVSYPVPTFFQKVAELHARMWKINKGLTDHHVYESSP
FT                   DSWPFLLRGISYWSKNHSQIYFIGNAVTWWTVTASIALFSVFLVFSILRWQRGFGFSVD
FT                   PTVFNFNVQMLHYILGWVLHYLPSFLMARQLFLHHYLPSLYFGILALGHVFEIIHSYVF
FT                   KNKQVVSYSIFVLFFAVALSFFQRYSPLIYAGRWTKDQCNESKILKWDFDCNTFPSHTS
FT                   QYEIWASPVQTSTPKEGTHSESTVGEPDVEKLGETV"
FT   CDS_pept        complement(396410..398140)
FT                   /locus_tag="PAS_chr2-1_0213"
FT                   /product="Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68821"
FT                   /db_xref="GOA:C4QZZ7"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4QZZ7"
FT                   /protein_id="CAY68821.1"
FT                   /translation="MLARKVLARQCLVVARLCAGRFASSLCGCSCRGLMRPPKFNSSKS
FT                   LSRSMTSSSLFESPNCPSCGVVLQTEHPDKDGYCLLPKGERKVKNYQNELKEKLFLNVK
FT                   REELADRLGHEVDSESLIIPKEMYQKPRTPKRLVCQRCFKSQNYSLIDHSIREENPEHK
FT                   ILDEIPSNANIVHVLSAVDFPLGLSKELVNRFKPTQITYVITKSDVFFPDKLGLQRTGA
FT                   AYFEDSLVKLVGADPRKVVLVSGKRNWGLKQLLSTLPRGPNYFLGMTNTGKSTLIRSIV
FT                   GKDYSKKQTENGPGVSHLPSFTRKPMKFKMDNNSLELVDLPGYTAPNGGVYKYLKEENY
FT                   RDILNVKQLKPLTSLKAYTETLPSKPKLFNGVRVICIGGLVYIRPPKGVVLKQFSLVNL
FT                   PSFMYSSLKKATSVIQAPPQALVNCSVVKEDSPDELVRYVIPPFYGLIDLVIQGVGFIK
FT                   LLPTGARNTRELIEIFAPKDIQLMVRDSILKYVYKTHAEHDSTNNLLHKKNIKARGQTI
FT                   LRRLPKKPVFTKLFPVPANVPSHELLTMVTGKDDLAEEDKEYRYDIQYPNRYWDETICK
FT                   "
FT   CDS_pept        398658..402401
FT                   /locus_tag="PAS_chr2-1_0214"
FT                   /product="Mitochondrial protein required for assembly of
FT                   ubiquinol cytochrome-c reductase complex (cytochrome"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68822"
FT                   /db_xref="GOA:C4QZZ8"
FT                   /db_xref="InterPro:IPR013136"
FT                   /db_xref="InterPro:IPR018501"
FT                   /db_xref="InterPro:IPR028941"
FT                   /db_xref="InterPro:IPR028942"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZZ8"
FT                   /protein_id="CAY68822.1"
FT                   /translation="MVLFKRKQVEVVPPQQLPDDLDTEIWYIPQTGEWFLNYDEYLDRM
FT                   DYYSQKKFACEITGNSSFDFFEALKYEQEEMQAVENKFPEPVREPILRYVQFSLIPRLD
FT                   QLVDDVYLHFKKEFFPGDLVNVKSAGSNRYKGIIREKARFAPITLPDGTVREGYCSYRV
FT                   GLSNSDGEVTVNENQVSRDRNAFTKWYVKTFLKLTLTRSQRSGAPWVVKDQYAAKYRIP
FT                   TEYPEELKKFEEEEEEDEKPSRKRRKKVSTQDSKKRVKSEFPNIFENLKETPPALSSED
FT                   TESLQRWKDRWNEVLSRCNYYLDLSADDSSDVEPRTKLNQLLGFAGVSRQLVFDPNTTN
FT                   IIVTMRSYHPKTQYEPPDMFSYVESRHIKVWHYEKVFRFLKSLNVTMRKVRQQEKSTKA
FT                   RTESPATLIPSNTAFMSINQSANGTKDQNQSTLQPSKGSVEDLALPFQIIKDKPVTKQL
FT                   DGIDHVDELMETWAFINVYREALIIDTFTLDDYITCLKWSNRSRKSSLLEEIFCSLLSC
FT                   IIDTNYTKPKSNDPHHGLLITLPESLTDLLDDGDSTKEFQDDIKQENANGIVNGTENGD
FT                   AVDPSIKNEKSDEEDDHESNASSTINHNAYQLLNYRKRPWQEILRDRNFKDGGWQIALV
FT                   GVLSLVDHLPEYQADIEQVYEILAPEDLGVSPASVETRFYENLGINLRIKVLSIVCSLL
FT                   IDSTTIRSHIDNCLEEAAKLRRERLEKMREYKLASDEAQALHKECMLILCTADTSLETS
FT                   SAPQREDKKQKSRARSSDKVPLKPTDKELALAKADPKFLKLLTSRTDAMVKAQSANKEK
FT                   RQLEKRLNEIDLQRIRCIGFDRSYNRYWWFENNGLPTLKNVHTTSDDEEEDGDDKEDAI
FT                   EDDEDLEDVAEETYLVGRLWIQGPTDEDRRNLLLFSDEQLERWNNLVEQLEKDKEKEKI
FT                   TNDSFLKTEETNSNVKVEDSTTVADDSPELASKEEKTSVIDEAISKFFEFDFQENGSVQ
FT                   RPSGRTIIDEYGAPCIQEFKFIDRKILQETPDLLLSKENWRYIDTSEDIDKLLKLLNQY
FT                   GIREGNLHKQLTILEHLIKGSIEARRKALYLDENSEEHVRLRDIIENTVIPEQTAEENE
FT                   EKEDPEVLELESSDNAENDDLVELEADSDSDSAVLPTRSRRSKAVRNTRGTRGSRKTPV
FT                   IHTELDFTRKKAHYATRQTTKSQEREEKIKMVQEAKHQLEHLKEDRMITRCLEWVNSSA
FT                   IEELGHTHLNGPKKKSTNKKRR"
FT   CDS_pept        402551..403519
FT                   /locus_tag="PAS_chr2-1_0817"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0817"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68823"
FT                   /db_xref="InterPro:IPR007129"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="UniProtKB/TrEMBL:C4QZZ9"
FT                   /protein_id="CAY68823.1"
FT                   /translation="MSSFLTRRSPCFVNSLRALRRYQSVKVDGKLNLKTTPTELATSST
FT                   LPNIEKEHLPKRDIDPKRKLEVNKKETTGYVIPKWQEALGEAFIGVFKVDMDKIRSGSI
FT                   GGSKYYYMCKDQGLQFKNEPLSDTAKFYYETLGLNRSFSQWFQITALHVWLLFVRMRAM
FT                   PFKYGKLYQQKLVDRLFKDIELRLSEEMNVMSGSIRDNYLKDFDSQLRGIVMSYDEALI
FT                   SDDATLAAALWRNFFNGDKNVDLVHVEAMVRYIRMQLYVLDKTSDREFGFGDFQFVKPN
FT                   EVVEPLTKENEDLLRKKVREKYEPLEGKQLPSNRSVLSLEE"
FT   CDS_pept        403744..404439
FT                   /locus_tag="PAS_chr2-1_0818"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0818"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68824"
FT                   /db_xref="GOA:C4R000"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C4R000"
FT                   /protein_id="CAY68824.1"
FT                   /translation="MKLTPDVVQNASIYTDPEKQRVLMLRNKNIFMIENLGVLNNNNST
FT                   IIEAIDFTGNDIRHLGNIPYSPRLKTILIAKNSVRSIQSNLAQNVPNVESIVLINNKIK
FT                   SLTSLEPLVQAKRLKNLYLMENPVTSHKYYRLWVIWRISSLKILDFKKIKDKERTQSSE
FT                   LFGQHDSPTELANEILKDAISNGPATQEESNETFTLTEEEREELKTQLANATTLAEISK
FT                   IEQLIKQVS"
FT   CDS_pept        complement(404484..408575)
FT                   /locus_tag="PAS_chr2-1_0215"
FT                   /product="DNA binding protein with similarity to the S.
FT                   pombe Snt2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68825"
FT                   /db_xref="GOA:C4R001"
FT                   /db_xref="InterPro:IPR001025"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR029617"
FT                   /db_xref="InterPro:IPR034732"
FT                   /db_xref="UniProtKB/TrEMBL:C4R001"
FT                   /protein_id="CAY68825.1"
FT                   /translation="MSSGARPKRSASLKVNYKEATEKEYDAMLHKSISKSPSKRQKKVT
FT                   PPSTANTSETPNLDTANPSIYVPIDEEVPLNWQPPVKKQDRFNNVLDLEGAIISENTLI
FT                   LKNRQPISKGQCIYMISEPAGEPYYIGRILGFEKKENFTDNPQDAKNFMFKINWYYRPR
FT                   DLVKRSTDSRLLYATMHTDNCPIQSYRGTVTIKHKSEIANLDEFKQTPNCFYFEKLFDR
FT                   YMIKLYDVLPTKSLDHLPENYYRALNKRFEYVFVETGKAQTLLSAPKNCEKCYQWCSNM
FT                   DSVHCLNCEKYYHMLCLDPPILSKPKRGFGWYCAKCSRDMEVELSERRGKLLEDSVDDD
FT                   KDDEVEDDEKNEVERQSTPSSLPHYEEAAIQFLENDSTHSLEERRKLEEWPYRYLGVHA
FT                   KLEDALDLQDRPYPRAASRLGAKHQCNYIPDWFGHPLKYYDKLDDDGKVVDSHKKKQRY
FT                   FKSKSKVSPPPISVIEDANVLKVPDEYKGQTPDTYPPWLLPRPRGYIERGGDDTAVLMW
FT                   RQPKDQSDMVESYIEKCSEVSDKLGLYRKTPNFMDAILKFLMDSNYDPIKAFEEVKKLT
FT                   RDSVKEPTLTPEELEKFEAAVKKYGSELYPVYQAVGTQKCPDIVRFYYLWKKTPNGHRI
FT                   WDNFEGRHKNKIKAAIKTTKGTPEDINDSGDDSAFDSKKIKAQRFECKYCHSNHSTQWF
FT                   KVSGAEISENGSRIALCMRCARLWRRYGVVWEEPNEKPTPKAGAAWKKKIESELVRDNE
FT                   AIIKAREMYRQHPRKIGSKRKADDYESPTTKQNGSVKRSKQDKEKNKTEQIKLESKKSE
FT                   PKKADNKKAATKKTESKKVVTNPEQKQKVKRKKVEKKSPDPKLKGDSTKPLTKKSRSKD
FT                   STKQDKSSLATTTKVKANKEPKDSNKLLKIAPKKLPPQKQPLVSDKAIEEAKLPFAVSE
FT                   LASFLPWRKLFNRYASDYEISNLTLDTIKRIMKSIRPGNPIEDNKKVWKLLKSAQLPGL
FT                   TSKNMSLPLYDLQSRPCSVCRTFDDINEMLICINCGLNVHASCYGMDTKIEGNSFQMES
FT                   GYYNYKWCCDPCSNDLHPLISTYYSCMLCNAREIDHDACITGQPNAIPDCLKRTTSDDW
FT                   AHVICALFTKGITFGNPAAMQPIQGVEAVLHKNTNLSCGICGVRGGGMADCHLCKKEMH
FT                   LTCAVDVAGCMFGFLIDNSSDNRDAIKISDEVCGLPSQCLICNSHPISTLPKNFVPLRA
FT                   HGTLLNQIGKPFVLVLSQFLKVSKSADSLQLHSKIIQREIAPDLTEKRIVLNPSPLFQN
FT                   ILNSVSPESKNNSVKLSCQRCNGIQSPIWYPYHEDSQAENNSKVECHSCHYGPQQNREI
FT                   PNLKRFTERLDLSRLQIVND"
FT   CDS_pept        408874..410301
FT                   /locus_tag="PAS_chr2-1_0216"
FT                   /product="Alpha (guanylyltransferase) subunit of the mRNA
FT                   capping enzyme, a heterodimer (the other subunit is"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68826"
FT                   /db_xref="GOA:C4R002"
FT                   /db_xref="InterPro:IPR001339"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013846"
FT                   /db_xref="InterPro:IPR017075"
FT                   /db_xref="UniProtKB/TrEMBL:C4R002"
FT                   /protein_id="CAY68826.1"
FT                   /translation="MVEMEERDVPTIPGEPLGQEMTRFLKGVVSTITRVPPTTFPGSQP
FT                   VSFQRVHLEDNLMNKDYYVCEKSDGLRCLLLTLLHPETGDEGTFLITRANEYFMVPNFH
FT                   FPLSPNDFSKPHNGTIVDGELVLSRTPEGTKQLRYLIFDCLAYNGESVMNKLTPKRLYY
FT                   ASELFYKPYRKLREKHPVDCQNFPFKLYFKDMTEPFKISKIFQQLHNLSYVSDGLILTC
FT                   SETPYVVGTDSTLLKWKPAEENTIDFKLLLEFPKYEDEDVPEGPDRVYPDYDSKPTIYL
FT                   YEWVGGQSAVNSTDPEKYEADFSKHQEFGQLTLTDEEWQELKESGERFNGRIAEVNQDK
FT                   SKHWRLLRFRDDKLNANHYTVVGKVIQSIRDGVTKEELIQAQEQIRKNWEIRQRRRKEM
FT                   AAGAAANGGQTSHRSAPAPVKPPTQQRPQPVPQQKPTTELKRPLEDQESSDDALDEFPT
FT                   YDRSPSPDYSRKKVKGE"
FT   CDS_pept        complement(410448..412007)
FT                   /locus_tag="PAS_chr2-1_0217"
FT                   /product="Mitochondrial ribosomal protein of the small
FT                   subunit, has similarity to mammalian apoptosis mediator"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68827"
FT                   /db_xref="GOA:C4R003"
FT                   /db_xref="InterPro:IPR017082"
FT                   /db_xref="InterPro:IPR019368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4R003"
FT                   /protein_id="CAY68827.1"
FT                   /translation="MSTELSLVIVNRCIYFKPSPLGHPPATCLYPILRHPPSIFAYNYY
FT                   VCHYLSLPSFTTSDQILLFPYIISCTTQYLPTNRSYRKVFLHSTMFRGIRALHTSAASL
FT                   AEKKVSLSFRKEAKGFVKRSKGPGNHKNFINVSSTTLLKKSESHLPDLKPQNLTKNVVT
FT                   NFPNDSVKALHHLGSFRKGQFNEAFSRPVSLVRDATIRLEKILQKALTTDSTNTRIAII
FT                   GESGVGKTTTLAQFQSMAKSHKAIVFAINNADNFVDGSSDFGPSALDTVEYRQPMVTRK
FT                   LIKKFFKANKDELNIPLTEDIKFATVKSFGERKGKQQDLAFKAKENTLFDVLNHAVHYR
FT                   GDLSHCLHFTFSQLSASNVPVFLTVDNFTAFTQNPITAYRDTKNNRIYFDRFEIPSLIL
FT                   RYIRGDDKFNKGGVLISSSGKHKSNDTLSVALGDKSYEPYAKFGDFDRKLAATLQNLEK
FT                   FEVPSLNKEEVGSLLQYYLDQGIIHNEKTDEINFESFRDNKFFYSSGNPRELLKSCTLN
FT                   YY"
FT   CDS_pept        complement(join(412670..413062,413158..413169))
FT                   /locus_tag="PAS_chr2-1_0218"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68828"
FT                   /db_xref="UniProtKB/TrEMBL:C4R004"
FT                   /protein_id="CAY68828.1"
FT                   /translation="MSTENQEIKEQIDATNQEIVNNAQEAAEPATEAVAESSTQAEATG
FT                   EVTSEHAKSLKEKTEEFLDHSKKEVEHAFETAKEKADELVKGAKAKKTEAAESNAETSE
FT                   AATESADKVEEKGIKKYFTKFKNVIKKVAN"
FT   CDS_pept        414155..415510
FT                   /locus_tag="PAS_chr2-1_0219"
FT                   /product="Protein kinase involved in regulating diverse
FT                   events including vesicular trafficking, DNA repair, an"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68829"
FT                   /db_xref="GOA:C4R005"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C4R005"
FT                   /protein_id="CAY68829.1"
FT                   /translation="MDLRVGGKYRIGRKIGSGSFGDIYMGKNLISGEEVAIKLENVKAK
FT                   HPQLAFEARVYKALAGGLGIPFLRWYGQECDYNAMVIDLLGPSLEDLFNYCNRKFSLKT
FT                   VLLLADQLLSRLEFIHARSFIHRDIKPDNFLMGVGRTGHLVHVIDFGLAKRYQDPRTNF
FT                   HIEYRENKNLTGTARYASTLTHLGIEQSRRDDLESLGYVLIYFCRGALPWQGLKALTKR
FT                   QKYDRILDKKLGTSVEALTRGLPVEFADYMTYVKSLRFTDKPDYIYLKKLFRDLYVRQR
FT                   FTKDYLFDWSIYKFKLKHPGLTKGENDTQTDEQQQQQQQQQVQQAISQQKQQQLQQQDQ
FT                   QQPQQQAQPQPQLQQQAQQPQQQPQQQQSQPQQQLQRDSVQQGLNSDVHMYPMYPDQNN
FT                   QMSKTPSTQQKPVRNISSPGLKMNIHSSAAKDADYSQFNNPSNETPKVNKWL"
FT   CDS_pept        complement(416390..419308)
FT                   /locus_tag="PAS_chr2-1_0220"
FT                   /product="Karyopherin with a role in the assembly or export
FT                   of 60S ribosomal subunits"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68830"
FT                   /db_xref="GOA:C4R006"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C4R006"
FT                   /protein_id="CAY68830.1"
FT                   /translation="MDLGGLVQLLQVSADESRGINSKQAEEQLKQLEQVPGFHYNLQTI
FT                   YLNTNYPLQVRWLAIICFKNGVDQYWRPTRKFAISKQEKDSIKSRLFELLEVNGNQLTI
FT                   QNAQAISRIVRYDFPHEWPNLFEQLEGLLNSTNYVYLHNILVILNQIIKTVGSIKVGRA
FT                   RATMQAKVPILTPHLIKLYEQFFQSWSRDFNLASVEVGYLSLKCIRRIIDVVSEFHDRD
FT                   DDVKHFFNLSLRHLRLLLNERDRQEISIVERYIKCYTKIYLSVLNNNPTSFILLDGASD
FT                   ILITMLSILENKADLIYNSREDSDETSFWEQLAINSLLMLKKLVNFVYRKGALTLKKQH
FT                   DKAEVEKAIRVLTTKFFTESLVANLIDLIIKNYLRLRPEDLELWSEDPEQWANDELTNS
FT                   WEYQIRPCAENFFRDLVTHFQETRNFVLVRINEFDPSPNSNLSEVLTKDALLSAFQLSS
FT                   ASLANDVNFDNLLTSVFIPLVEQNQPILVRRILLIISEWISINCSKQSRQLVYKLLLSL
FT                   LQSSQDRIVRITAVQTLRYAIDDYDFDRTDFQPYAEHVIAHLIGLVSEMTLTESKLNVM
FT                   NVLSILLEQCNSIIPRDSLFDVLSLVTKVWGNSETILKAAFLRLLKNVCACLKSDVTET
FT                   YSITLPLIETCCSESSEKYTVLSEDGYELWLEVLRSIPEPIPSRLVDTFSLIVPALLNS
FT                   TEILPTILSIIRSYILLDPTLFEHDTGLQIFKIMGQYLPNMRDDALNIFMSILDIFFLQ
FT                   LQRTHNQLESSLLTTQFMESGLLESLLTFALNTDEAVITSNKVLIPLSRFLYIGPHLLK
FT                   EMINHISRHQNTQIFDQLYSLMLKRIDYLGDPRNRKSFLLALLSPYLTIEMDSDFEFLI
FT                   SNFAPLMAEVTKQFEEINETPSGDCQVYHRSYSYEGLEFLPQDRNELLRVNKLLELDPI
FT                   HCLPLKEQVSKVLNHLKQVLGDRFDEVVKTLDPSSLDQLKRL"
FT   CDS_pept        complement(419464..420696)
FT                   /locus_tag="PAS_chr2-1_0221"
FT                   /product="Nicotinate phosphoribosyltransferase, acts in the
FT                   salvage pathway of NAD+ biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68831"
FT                   /db_xref="GOA:C4R007"
FT                   /db_xref="InterPro:IPR006406"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="UniProtKB/TrEMBL:C4R007"
FT                   /protein_id="CAY68831.1"
FT                   /translation="MAIVSLLDTDLYKITMQAAVHKNFLSVPVKYKYTNRTKALSLNKE
FT                   AIAWLKPQILALGDLRYSSDEIEFLKTNYGYLPAEFFAFLKDFKLDPEKEITLINEDDP
FT                   ENFGLEIAGTWVQTIPYEIPLLSLISEAYFKFVDVNWNLDGQFELAYEKCKTLISNGCA
FT                   FSEFGTRRRRSFETQKIVLEGLLKCANDNPDLKHFFLGTSNVYFAKQLGLTATGTVAHE
FT                   WMMGIAAIHNDYINANKLAMDYWIKTVGSDHAGLALTDTFGTEAFLRHFVPPYSDYYIG
FT                   VRQDSGDPEQYAKLIATHFYEKLGLPKYSKSICFSDALNVEKCLRYKKTAEALGLKVTF
FT                   GIGTCMTNDFKNSPPLNIVIKLLEADGNHAIKISDNIGKNMGDPATVKRVKQELGYIEK
FT                   DWEEDETKRWK"
FT   CDS_pept        complement(421264..423555)
FT                   /locus_tag="PAS_chr2-1_0222"
FT                   /product="U3 snoRNP protein, component of the small
FT                   (ribosomal) subunit (SSU) processosome containing U3 snoRN"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68832"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C4R008"
FT                   /protein_id="CAY68832.1"
FT                   /translation="MTVGSWTFTEHGGGRLIERGSALSTDGRFMFVVSSDSLRVFNVDN
FT                   RIGVRNVKFSEMTVRGDFPELDITKKLVRMLVSSDILHFVFSDGHHLWLNWKEFMSGDL
FT                   ELKVEKFQVPGTVLDVLHYKDEFYTIIGKRNKGHNRQVVKDGEVLYTVESVRLHNKSLY
FT                   DRKIVFLTTDHKVTVIDLETNTSSDVKFSYRRDVMSVAVAEKSDMVALGTATGIIHLVE
FT                   SNTERLLKWHIDQVKAMEFTVDEMYLVSGGVEKVLVFWNLSTGKQQFLPRLNGVIVDID
FT                   LSNPELYTLTLISNSIVEFLVISSIDLASRISVASVKNRFKGLNKKKSTDKDVTKLGFD
FT                   ITTDFEVVKDQLFFPLRSQIQVYDYIRNEQQALQTVAPVSQIGKVRSELAIQDPKVKCF
FT                   AVSENGKWMCTFDSVPTPSADALLSTGEQTYSLKFWKHVPGDAMYGSWELTTKIIDPHA
FT                   QKPVSEIIPAPSSLYGGDAFVSVDGKGNVRLWRPRALDPNAVAAANNKALQHTEWTLRK
FT                   AFSGFESSSESVHASWSPDGSIIALSHETNVLLLEVNTSQMDPIPLPSLVQNRITGLKF
FT                   VDDGNLLLLTKRSLANFNILTWSKTPLNLSLDFPAKGQSLVAVDQAKRIIAVVLNYYNH
FT                   DKDIQSKVYLFKADSLVPIGEVSLSKGISGIRYSSYNDTFVVVDTSSMIFTLSNKDLPK
FT                   FNQDSDYVTEINTLVGIAQSNHKVLNNVENSMDLLTESVMLNANSFDKILENTEGLTVT
FT                   NLFERVLKVI"
FT   CDS_pept        423742..423960
FT                   /locus_tag="PAS_chr2-1_0223"
FT                   /product="RNA polymerase subunit ABC10-beta, common to RNA
FT                   polymerases I, II, and III"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68833"
FT                   /db_xref="GOA:C4R009"
FT                   /db_xref="InterPro:IPR000268"
FT                   /db_xref="InterPro:IPR020789"
FT                   /db_xref="InterPro:IPR023580"
FT                   /db_xref="PDB:5X4Z"
FT                   /db_xref="PDB:5X50"
FT                   /db_xref="PDB:5X51"
FT                   /db_xref="PDB:5XOG"
FT                   /db_xref="PDB:5XON"
FT                   /db_xref="PDB:6A5L"
FT                   /db_xref="PDB:6A5O"
FT                   /db_xref="PDB:6A5P"
FT                   /db_xref="PDB:6A5R"
FT                   /db_xref="PDB:6A5T"
FT                   /db_xref="PDB:6A5U"
FT                   /db_xref="PDB:6A5V"
FT                   /db_xref="UniProtKB/TrEMBL:C4R009"
FT                   /protein_id="CAY68833.1"
FT                   /translation="MIIPVRCFSCGKVVGDKWDAYLRLLEEGKQEGDALDELKLKRYCC
FT                   RRMVLTHVDLIEKFLRYNPLEKKDFDS"
FT   CDS_pept        424210..425187
FT                   /locus_tag="PAS_chr2-1_0224"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68834"
FT                   /db_xref="GOA:C4R010"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="UniProtKB/TrEMBL:C4R010"
FT                   /protein_id="CAY68834.1"
FT                   /translation="MKAIICPGQGVFNVKTLLRLSKHIKSSTYHTEFVRHVDNSLKLPI
FT                   KKYLLTPDELTPNDLNNLQKTSYQQPLLLLASYLLLELNNYKITPGNTDFMVGHSMGEL
FT                   TLLTLQKKISIEGSIKLAYTRGVLMESVVEKLENPTEFKLYALMIKPKDFRFIQDTLEL
FT                   NPHVNISNINGFNQIVISGRESKCLQLFEQFKLDKISFKPIDLKVSIPFHNPVLDPVIP
FT                   KLSLYITTHQLFDNSSLSIPSISNLNGQVVKETQTFVDNFIQTTNKTVNFLGCLETLIK
FT                   ESQDDQLEIHNISAVSTNLVKSFAKQKGLKNITNIDLEEHYWGT"
FT   CDS_pept        complement(425204..426742)
FT                   /locus_tag="PAS_chr2-1_0225"
FT                   /product="Zinc cluster transcriptional activator involved
FT                   in conferring resistance to ketoconazole"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68835"
FT                   /db_xref="GOA:C4R011"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C4R011"
FT                   /protein_id="CAY68835.1"
FT                   /translation="MAADQPEEKTTKAKEKESSKDEVETKKASRKEGAPRRPRRQKVQV
FT                   ACVYCRRSHMICDDSRPCQRCIKRNIGHLCRDEQNSKRLKRKSSQEEEQSDSHQQTMSP
FT                   MMQSSLSMSPPAVSGSMSGQIPLPMSMSMPQQTNSQMNSSDPNVVVTGYNKPQSANSLN
FT                   GSHTKLSTLNKQPFFFSEHAGSEFSSLNEFLSMIDDPDMINHINYNNDPILQNFDSTTN
FT                   LVNHFNQEANNGNINTGNVQEISAETSAPPLEVAYDNSQVYPNFTYPQQQQQQQQQAPA
FT                   VKNNDEYNQPVISDTARDKFFLTAADPTTEISPEERLKQVINAKLEAGLLKPYNYAKGY
FT                   ARLQAYMDNYMNITSRQRILKPLSTFRPGFRAIAKTLKDIDLILVEEHFERMLLDYDRV
FT                   FTSMAIPACLWRRTGEIYRGNKEFASLVEVSIDDLKNGKLTIYELMTEESSVNFWEKYG
FT                   SIAFDKSQKAVLTSCNLRTKDGRKRKNCCFSFTIRRDKHNIPSCIVGNFIPISP"
FT   CDS_pept        427098..427886
FT                   /locus_tag="PAS_chr2-1_0226"
FT                   /product="Mitochondrial inner membrane protein required for
FT                   delivery of copper to the Cox1p subunit of cytochr"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68836"
FT                   /db_xref="GOA:C4R012"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:C4R012"
FT                   /protein_id="CAY68836.1"
FT                   /translation="MLHPGSSNMISSMMAPAFQAIRQPLKRGNTGVNSFRSMRCQSTQP
FT                   KSRMPKMSTQEFQQLYRERQQEKLRMKNRSIGLYASSLGMVFLTLAFGSVPLYRAICQK
FT                   TGWSGTPMTDVSKMTPDKLIPVDTSKKIRVQFTAETSGILPWKFVPQQREVYVTPGETA
FT                   LAFYKARNESAHDIIGMATYSVTPDHVAPYFNKIQCFCFEEQKLAAGEEVDMPLFFFID
FT                   PEFMNDPTMRNIDDIVLHYTFFKANYGQNGQLMTSPLIPR"
FT   CDS_pept        complement(427947..430154)
FT                   /locus_tag="PAS_chr2-1_0227"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68837"
FT                   /db_xref="UniProtKB/TrEMBL:C4R013"
FT                   /protein_id="CAY68837.1"
FT                   /translation="MWILIQDGQEHLLIPGKVYKLGRGSRTSEQSIIDFQCPQPYVSKL
FT                   QLTISVDQPSSQEIQDPKHISRLLIQNVGQGKVHYSGKIYKAKKDPVDIPVDYNQESVT
FT                   LELGNLTKEYISVRFKWVNTVLWYSRSDNEDRLDELFHLARSLDIRLVTNYVDNVTLFL
FT                   QGSQHTSKLAKALIKAIPIVKFDYLKVLFERKGKLEDSFELPNVENYVPEATLRFNRGR
FT                   YELFQGLYFLVSRKDSLFLDFVALAKGKLVVLDLEDPPEILSEKFGLKKLDPQKIICFK
FT                   PSNEIEREDEHHKMKKLASYLGVKLVGNPQVMESILKVDSSMLLTKEPLNLDKKRQISE
FT                   VSPPETNTTQPKRSRFKRREIKPLDAMELLSQQVLSQQHEKKPIESAQRGEEPSVATVK
FT                   KESRFRRNRMKQIALEDMIDVSQPNILSTQHDDQEETQIEELNKPLGKATGQTTEVKLT
FT                   TPIQEDQMVVETELPVKEHSIADGSGLVSQHEPKATPEPPSSLVSTTAQVSKAKKPKTY
FT                   KYTDSQIDALNPNASSNNQQKLSSMIMQAKELKLKESIDDDIQELLEETTNDTREKLKI
FT                   HSDETLFRKEKASVRSHVDKSPFHPEWKGRVNFKKFKRKDLQGSLISTKIYVPLVDCQI
FT                   EKENEKEKVLTKELEFLNELNQPIQDLDSQFPDISGKHKGKRMFVAESDEESEMETEQF
FT                   ESRPRTKTRSSITSRNKPAEPDVIESDDDDDEPKFRFTTPS"
FT   CDS_pept        complement(430224..432434)
FT                   /locus_tag="PAS_chr2-1_0228"
FT                   /product="DNA helicase involved in rDNA replication and Ty1
FT                   transposition"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68838"
FT                   /db_xref="GOA:C4R014"
FT                   /db_xref="InterPro:IPR010285"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028880"
FT                   /db_xref="UniProtKB/TrEMBL:C4R014"
FT                   /protein_id="CAY68838.1"
FT                   /translation="MLSLFLEPGVRSTLNLGVRAVAQMAHHCMIYNNIKFRLLWSVEGC
FT                   MSPVDFSCWTQCPNGAFAPTARSTFLRVCFHLRICKVMLTKKKKDKNQPSINAFFTSRS
FT                   KNDRFSALKRFKSDLGPPKSSQHSSQEASTEDVIDLSEPQVRPSSFLSQEKRQAFDEVP
FT                   SNILPNLSQKTANNFKKIRIQKQENSVLDKQYGAPLKAASDQRKLPWEVPQFSWSRKKD
FT                   ASSGIKNPRMASKAIPTIASKISLTKEQEKVLSLVVDDGLNIFYTGSAGTGKSVVLREL
FT                   VQRLNNLYGPDKVGVTASTGLAAVNIGGQTINRWAGIGIGKQTPVALAGLIKKNGNTYA
FT                   RWRNVKVLIMDEVSMIDGVLFSKLNEVAQIVRKNQLPFGGIQVVLTGDFFQLPPVPDKD
FT                   TKMTYCFQSECWDSVINKTILLKQVFRQTDMDLIDMLNALREGHVYPEIIQQFSKLGKE
FT                   VVYTDGIEPTELYATRNEVEAANKSRLAKLEGPLVTYTAKDVSDRPDTPPYIMKLLNDV
FT                   MAPSGLQLKEGCQVMMLKNKDEELVNGTLGKVQCFMTSDMWHYIQTQLTTVDLLQEDVI
FT                   KELNLVSKFMNNPQPDESLFRQLDTVSPHRKQIMDELITIARTRSDEVLPLVQFAIGSR
FT                   RARFELIQREEFPIDVKNNNVRITRIQLPLLLSWALSIHKSQGQTLDRVKVDLRRTFAD
FT                   GQVYVALSRAVSKERLQIVGFHPSKIRASAVVKGFYEKLESV"
FT   CDS_pept        complement(432543..433868)
FT                   /locus_tag="PAS_chr2-1_0229"
FT                   /product="Protein binding phosphatidylinositol 3-phosphate,
FT                   involved in telomere-proximal repression of gene e"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68839"
FT                   /db_xref="GOA:C4R015"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="UniProtKB/TrEMBL:C4R015"
FT                   /protein_id="CAY68839.1"
FT                   /translation="MSSNLKIDSSIRVIDEQSADFDQDSPVLSFKKQPIKTRTASCSTI
FT                   SNLTPDFNSYHLTLKGSFRDSSEVSSTQDKTQPAQTDNNPDDLDYDAKIRAPKMSSQSL
FT                   FKSNPIKIAQHEPFQCCDISQNSKDQATKPGSVETSQTDNKEFSRNTSNLSNDSLTSAE
FT                   TKVAEEVTDKTNSTFTPATFDINQPLRRHSIDEISSDLSNTLPGFSTNASYSRLDNLQN
FT                   AQNGNNPMSFSNRGSRNGISGPIRQINEPKTPNYVPAVLRPSSSHSLVVGNTPQFQLGS
FT                   SSPLPDEEDDNSSYDDDKLYHYSSSENHANAARFPYTMVPIKSHWLQNNKRSSCMDCQV
FT                   KFSLLFRRHHCRHCGDIFCSNCLTQRASLNLMAKFDLVHGMKSKVCNGCAKSWNQYLVK
FT                   QYNNNVGSSVSKLQVKQTVPDEDPQRERMGSIVPSDWTWSSF"
FT   CDS_pept        435007..435960
FT                   /locus_tag="PAS_chr2-1_0230"
FT                   /product="Mitochondrial ribosomal protein of the small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68840"
FT                   /db_xref="GOA:C4R016"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="UniProtKB/TrEMBL:C4R016"
FT                   /protein_id="CAY68840.1"
FT                   /translation="MLRASCKVFTRRQSTSLLPQFKIKDLEFLRDKGITGLYSSKGLNN
FT                   VWYDKADYCRENLNQLLQQSVNKNALLSCFLNKSLDKGSIHLSDTSDSIDRLNQLISTA
FT                   AQSCEGSESFTVDHEIYNLSTQLYNHHFAMSSLNSGGNESNRVYKPDASELLKTHPNTD
FT                   VSISLSHDAQLLKQIKSSFGSLEQLKTLLINSSLAIKGNGFTWLIALFSKSDSKLFLDD
FT                   LYVVNSYNNGTPSDRLKNGQLDDFRAFIKEGNSNSEFVKDYHQNDSFDFVPLLAINASP
FT                   YAYLSDYGVFGKRVYLENVWNCINWPTVASRWPKEA"
FT   CDS_pept        complement(join(436024..437113,437437..437696))
FT                   /locus_tag="PAS_chr2-1_0231"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68841"
FT                   /db_xref="InterPro:IPR013226"
FT                   /db_xref="UniProtKB/TrEMBL:C4R017"
FT                   /protein_id="CAY68841.1"
FT                   /translation="MTSLYTHQNSSRASSGSARRVSSYNPFRLNGNNQSSSSVGESNDP
FT                   TFKAWRDNVAQLEDLSDEATETVFVDMGLERPQLTSTNSSNQMNKYSNNPFAEDLLQSN
FT                   SGGSANTPIRQQAPPINRDSKPPKESPELPPSYEEVAGSSPTKEYPPEKPLGSQEERRS
FT                   TRSHNYRSHSHPRREDDAKQHSQHRSGRREREKEKERQRYIERDRQRSTKGRSKKDKDP
FT                   LKPSKNLDTIDKLDVTGFFGGGGFHHDGPFDACTPHRNTNKKAPPVMAFPVDGPNSTIK
FT                   GMGPLHSKEEQMDIVFGISEQDPLYAGSKNASRARGMSSNQRLSQPMYQNGNSTSTSLP
FT                   SVIKHDPSVVQFDTNVKAEPVHGQTTLGLGSSTFLDGAPASKDAELQDHAAKSNELSRK
FT                   KSLLRRMKAASPPTARRTSEDNNIYHKEGEERNGANGLLKRVRSLKVSRK"
FT   CDS_pept        438097..440043
FT                   /locus_tag="PAS_chr2-1_0232"
FT                   /product="Cleavage and polyadenylation factor I (CF I)
FT                   component involved in cleavage and polyadenylation of m"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68842"
FT                   /db_xref="GOA:C4R018"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR008847"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C4R018"
FT                   /protein_id="CAY68842.1"
FT                   /translation="MADNTKKRRLSNDVIGQLQDDLKQSPLNVNTWDTLIDKVIAKDKH
FT                   EQVIQVFEDCLVYFSYLGYFWNRYATYLLERLEFDKTKEIFNRCLPKVANVELWRSYIR
FT                   YVRRTNSIITGGEEARRLIIKSFEISLENIGMDYNSDVLYDDYIEFLNEWQPINPNERN
FT                   HRNDLLRGLYRSLIKSPVKDLERYWTDYTNFENEANPNKQISRKLVNEISGEYMNTRIK
FT                   LSDLVNKIKGIPKADRYLMNNEFDFSKVGSLSLVIAWSEWERTNPFNLEKNVVKKRVNL
FT                   SFQKSLQLYPFIPKLWYNYFTYLMDQQQDPSTEATNGESNQAQQAQELIVTVKQAISLN
FT                   PTSFILSTLLSDLLQSDGKDVDTIKKVYLDLIEALQKYYNTDQVEDSIVNRSITEAYIL
FT                   LMNMLKSSKDGRSEIRKVFSQARKFENLTYHCYVQNAYLEYYTFNDVKVAKKIFDLAFK
FT                   KFNDNISFLNYYLNFVISIKDFSQAKVVYETFIKSNQDSLDREKLFKVYQSFMQFESQF
FT                   GDPISLRNLEKRLSNQFGLDSLYLAMINRLSPFCSPSNLLELEPPFNSVKQIDEKQGSL
FT                   DSILSTPVSASTSIEDPTNRPKNGPKKQKIDDNLVIKDDIYNLLRILPKKTFFKDVPIL
FT                   NEKLVEVLTSLNL"
FT   CDS_pept        complement(440217..441098)
FT                   /locus_tag="PAS_chr2-1_0233"
FT                   /product="Cytoplasmic RNA-binding protein, contains an RNA
FT                   recognition motif (RRM)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68843"
FT                   /db_xref="GOA:C4R019"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C4R019"
FT                   /protein_id="CAY68843.1"
FT                   /translation="MTEEASAAEPLPESVDKNETLIEDKAGEAVNPPLPPTPESNDVAV
FT                   AEDLENTVENSLQELNIDNSSATLKEDSATSEEGTANEAPAPEEKEEPVVVTPEENEIS
FT                   PKPEPTPKLKLGEFQPANQADIDKRSVFVGNVHSSADPEELVQIMTKAGVVNRVTILLD
FT                   HYTGHPKGYAYVEFEEEASVPKAIELFHQYVFKEKELNVVPKRTNVPGLAKRHPRGAHR
FT                   GSHEGYKGSETGRGRGRGRGRGRGRARGRGSGRGRGGRLDSNDTDGQGLWDSGRSNASS
FT                   ETKTEAQLESND"
FT   CDS_pept        441282..441959
FT                   /locus_tag="PAS_chr2-1_0234"
FT                   /product="Constituent of 66S pre-ribosomal particles,
FT                   involved in 60S ribosomal subunit biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68844"
FT                   /db_xref="InterPro:IPR019002"
FT                   /db_xref="UniProtKB/TrEMBL:C4R020"
FT                   /protein_id="CAY68844.1"
FT                   /translation="MVSVRRRKSNHSGTSKVSVRVKDKQRRHIATNKVLRAHWDSKLTL
FT                   SQNYAKLGLRLKLGKPTGGVEKPLAIDKGLDGKKHDKSQREDENIDDFYNSEGEIDPAK
FT                   IPEGRAHIVRDESGEVVKIVYGTKVSGMFEQGPSEKEEPAQESVVINELMEKAQSRPEK
FT                   PPKRLTELEEIWVDGLQKKYGNDYERMKWDRKLNPMMLTPRKLEKLFERKLQVEDYDRR
FT                   HTA"
FT   CDS_pept        442707..444437
FT                   /locus_tag="PAS_chr2-1_0235"
FT                   /product="Na+/Pi cotransporter, active in early growth
FT                   phase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68845"
FT                   /db_xref="GOA:C4R021"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:C4R021"
FT                   /protein_id="CAY68845.1"
FT                   /translation="MSLVALHQFDYIFAIAMMFAFLDAFNIGANDVANSFSSSVSSRCL
FT                   KYWQAMILAAIMEFLGAVLAGARVTDTIRKRIINVHAFDDDPAMLMLTMATALVGSSVW
FT                   LSIATYVRAPVSTTHSIVGGVIGAGIAAKGAGEIHWGWSGFAKIVASWFIAPCVAGGFA
FT                   SVLFLFCKFSILERKHDARNALLFAPCIVFLTFAVLTMLIVWKGAPNLNLDDLSTGATV
FT                   GSIFGVAGVATIIYITFFFPFLKRRIIDEDWTLKWYQVFYGVKYWFMSKDSIPPKPDNY
FT                   DFFIDYYEGRRYEGGEQDSAIVADAKEEATIGELKLSDNSTSNSNADENRLVHESKLEP
FT                   KEDTKTKWSKLVKSPKQWPYLAWLIISHGWTQDVIASQKNGGRLAGDLQGMHGRAKYYS
FT                   NKVEHIFSLFQAFTACTMSFAHGSNDISNAAGPLSTVWVVYTTNDVVAEPPIWILCYTA
FT                   AALVLGVWIFGYRLMANLGNKLTLQSPSRGFAIELGAAITTVFATQLEIPISTTQCAVG
FT                   ATVFVGLCNRDVRAVNWRMVAWCYLGWVFTLPCAGLISGIIMGIIINAPQWGGQYELTP
FT                   "
FT   CDS_pept        444624..445025
FT                   /locus_tag="PAS_chr2-1_0236"
FT                   /product="Sulfiredoxin, contributes to oxidative stress
FT                   resistance by reducing cysteine-sulfinic acid groups i"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68846"
FT                   /db_xref="GOA:C4R022"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR016692"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:C4R022"
FT                   /protein_id="CAY68846.1"
FT                   /translation="MSLQTNNLSNIQYLPLSSIKRPITPVLDYAKIDAMESTLRGVPMA
FT                   SSTCPNISEITAGELPPIDVLCVRHEGKTHYFAFGGCHRFQAYDRMQQKEGDETNEKSP
FT                   VLVRCKVLPATVKQLKLYLGASVESVLNE"
FT   CDS_pept        complement(445015..445986)
FT                   /locus_tag="PAS_chr2-1_0237"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68847"
FT                   /db_xref="GOA:C4R023"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:C4R023"
FT                   /protein_id="CAY68847.1"
FT                   /translation="MKEKYVGNVNISRILSQPAKSSSKQSTTKPLYKGPTKQSKSASKK
FT                   SIASPKSLTNDLNLKYNPKHSLSQKIIKPDQRVQSYTANLFSNARFKLDWSIYEFKNLP
FT                   HNRQAEEFDAEQDVEEASKPQKKITPIYDPRDYKDLPEVLFLGRCNVGKSSLINSLIDK
FT                   PLARVKRFAGLTPCLNTYNIGNVVRLVDSPGYGVKGKQWQGELTMQYIRERQQLRKIYL
FT                   ILNAHLGINEFDEMILSQLVESKISFDLVFNKVDKISPAQRRTHCDQIVEQLLKTSQIS
FT                   KLMRPTLHFVSCNDDNTRTLSGISDLQLNIVLSSGISGRFTR"
FT   CDS_pept        446662..447666
FT                   /locus_tag="PAS_chr2-1_0238"
FT                   /product="Mitochondrial malate dehydrogenase, catalyzes
FT                   interconversion of malate and oxaloacetate"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68848"
FT                   /db_xref="GOA:C4R024"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4R024"
FT                   /protein_id="CAY68848.1"
FT                   /translation="MLSTIAKRQFSSSASTAYKVAVLGAAGGIGQPLSLLMKLNHKVTD
FT                   LALYDIRLAPGVAADVSHIPTNSTVTGYTPEDNGLEKTLTGADLVIIPAGVPRKPGMTR
FT                   DDLFNTNASIVRDLAKAVGDYSPSAAVAIISNPVNSTVPIVAEVLKSKGVYNPKKLFGV
FT                   TTLDVLRASRFLSQVQGTNPASEPVTVVGGHSGVTIVPLLSQSKHKDLPKDTYDALVHR
FT                   IQFGGDEVVKAKDGAGSATLSMAQAGARFASSVLNGLAGENDVVEPSFVDSPLFKDEGI
FT                   EFFSSKVTLGPEGVKTIHGLGELSAAEEEMITTAKETLAKNIAKGQEFVKQNP"
FT   CDS_pept        448275..449840
FT                   /locus_tag="PAS_chr2-1_0819"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0819"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68849"
FT                   /db_xref="GOA:C4R025"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C4R025"
FT                   /protein_id="CAY68849.1"
FT                   /translation="MTSPPHNPLAKINQWKDSAWSHMSTKLHVNSSSPINDEILDFDDQ
FT                   VTQSPHDTHIDPDNSLCFKDTTTELDVTLDDFDMSVDTSDIVAHALPMESDFDPAGGGD
FT                   DDGGGGGVAGDEYTSNNEPLHNQDHDHVHPHDHLHHHDHAHHDHHSDNLHSHNVHPFQI
FT                   SQSNSSSTISSFDSSAPTYSDTLPTNSLPSSMSPSNTRTPARRRSVSATPQTASHGFHQ
FT                   QPLVMPQYQTPIKKTDSLTPRRLKSRSLSRLSLDHLRSPAGNPFYTPPAFLSPKLESPY
FT                   SSRDTPQQEVVMISPSQLSLSLNRKSRSFTAPAGIPKKLRTAPSFSFADLPPQPLPQSH
FT                   SMYHVQGGSHNSVPKSAPAAFNSMQRSRSSTNLSAIALSKESSLSRRNVTALETPFQVR
FT                   QTSQQLQKASTVPNMHSEVNMTVPEHREVFHEEIEDTDKVKEIEEEKKKKKFSCPVCHA
FT                   RFQRPEHVKRHMRSHSSEKPFVCPEEGCGTRFNRKDNLKAHLKKIHSLHKNQVNQKVDG
FT                   KEYE"
FT   CDS_pept        complement(449957..450454)
FT                   /locus_tag="PAS_chr2-1_0239"
FT                   /product="Integral membrane protein localized to late Golgi
FT                   vesicles along with the v-SNARE Tlg2p"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68850"
FT                   /db_xref="GOA:C4R026"
FT                   /db_xref="InterPro:IPR019365"
FT                   /db_xref="UniProtKB/TrEMBL:C4R026"
FT                   /protein_id="CAY68850.1"
FT                   /translation="MAFTDYLNFKGLGEDFKSRNFSIYGQWIAIINIFFCLALGIANIF
FT                   HFSLVILFSIISIVQGLVVVFVEVPFLLKICPMSANFIEFINRFKQNWPRAGFYAGMAL
FT                   VQWLSIIVQATSLIVVASLFTLSAACYGYAALAHQEFRNSNVVGDFDVEALPAEAVVRN
FT                   IL"
FT   CDS_pept        450719..452740
FT                   /locus_tag="PAS_chr2-1_0240"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68851"
FT                   /db_xref="GOA:C4R027"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR008913"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017921"
FT                   /db_xref="InterPro:IPR037274"
FT                   /db_xref="InterPro:IPR037275"
FT                   /db_xref="InterPro:IPR039512"
FT                   /db_xref="UniProtKB/TrEMBL:C4R027"
FT                   /protein_id="CAY68851.1"
FT                   /translation="MSRGNDSDSDDSLTNSLEKVGRFTLPTLSLSLDTAGYQSYISERR
FT                   NKVNHLINDLTRGFSMQRALERFQPVTDILNENINLVLDAEHDDHENEEESIVDPPGVT
FT                   KAKERQQPVIEDLVLPQDFNRNRSTSTTLRTPVRSRSNTQQDTFKKLYDEIKIINGASL
FT                   NDDAFLRKKIKLILGLPTITDKQKSLLVQKLMSKSYFEQQQKRLNRENANMNNSDTEDS
FT                   YDDSDSDEGEDEVILTVNDKKPSYHDESAQIFGCTHYQTNCKLECSVCNRWFPCKFCHD
FT                   EVVKDHQLMRNETKHVLCMFCGTPQAPSQYCIEETCGNMLACYYCDKCKLFDNNAEKDI
FT                   YHCDDCGICRLGLGLNQDYFHCRGCNACISIDLKNQHKCIENSTHSNCSICGEYMFSST
FT                   KPVVFMSCGHAIHQNCYDEYTRHNYKCPVCQRSIVNMDAQFRVLDTEISERPLPLPFGN
FT                   WECIIKCNDCGAKSKTKYHILGLKCDNCKSYNTSQLRLIKPELKSQYDDYESSKSPKVD
FT                   LRSSFVHNSLNTNFQYDQVDTSEYVADVEDADYDGDQTETIGSHFAATLNRFTNSSLSD
FT                   TAQRFINDRLNLLTRKQSNSSADESMDEDYVDSFIRIRNNFDRYTSIGDAFRDWLESAK
FT                   ESFSVNGTDFEYPNTSAYESEPDTMIGANNSDDNFGGF"
FT   CDS_pept        complement(452768..454573)
FT                   /locus_tag="PAS_chr2-1_0241"
FT                   /product="Component of a complex containing the Tor2p
FT                   kinase and other proteins, which may have a role in regu"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68852"
FT                   /db_xref="GOA:C4R028"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C4R028"
FT                   /protein_id="CAY68852.1"
FT                   /translation="MEPKERLRNAVKEGNEFLVTRILKKFPDLLDNIDPANGWSNLHYA
FT                   SYHGNYLIATKLLKGKEKYHEYEYSYDSEEVLVTFKNETCLHLAAMNNHEQTLHLLLQH
FT                   LPNCIDNRDIDDQTPLHIAAAKGNTSCLQLLLDLHASINVQDKNGNCPLHLASIFGHLS
FT                   CIQSLSFYNADMGLKNADGYTPLDVCFSFEIQKQLEHLKENAPTLPPFPSKISEESLAS
FT                   PSLSNFIIQRPSATKPESPQSKSTLPHLPSVTTARKFSSSSQTTLNSSATSTETKSARG
FT                   ERPVSRLEKQISVPSFHNGDDFKRTQSFTSLYKVGSGSYSDLGETQSKMLPIIKPINEK
FT                   KQATPYLLINTGSANSLSNSSSTIQAGPRARRTVESPMTPKEKISNLMPIIKNTVNESN
FT                   NNHNQISVEKLSPTSKSRRVRSNSNLSNLSLKTSHSSLRKLRSQSISNAFHKLTHTEPR
FT                   HRRTPSMNSPSEHDNAKATFLFNPNISTHSFESISEGYNSDEEEEEEFTQVPADKDLVT
FT                   LDNYYEDATHPETELNVPEQVEARRKLNLKIDTLYKHKNHSLEQMDERMLVSPTTTNSF
FT                   SQSLRPSRVLSIPIANLSKKRRDQG"
FT   CDS_pept        complement(454732..456021)
FT                   /locus_tag="PAS_chr2-1_0242"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68853"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4R029"
FT                   /protein_id="CAY68853.1"
FT                   /translation="MSQAVRAGSRLKPLYPMVTELSYKESFKQWFERKSLADYEARVLS
FT                   YLPFFPDSDGVREAKTLDVPVDAKGNKIHELYIENKQKAPEERHLVIVHGFGAALGFFY
FT                   RNFNGLSLIPGVKIHALDLLGYGLSSRPKFPSLDVTKEEDIHKAEDFFVDSMEAWRKER
FT                   NIDRFVLVGHSLGGYLSSCYSLKYKDAVEKLILVSPVGIERSEMSLTEINRPPAVQAQD
FT                   IARKSSPNIEEELLQSQEQSQQHHQNVSDSASIASTESRNNDERMQQARTRPQLRKFLV
FT                   KMWENHCSVFSIVRAAAPFGPKLVSLWTFSRFGAIEDPQELMDIHRYSYNTFVAKGSGE
FT                   YSLTVLLAPGAWARLPLLDRLPGNITIPTLWLYGENDWMSKKAGRQCVSEINSQGEKSA
FT                   KFRIIDGAGHHVYLDNPTDFNQSVRKFVGW"
FT   CDS_pept        456146..457477
FT                   /locus_tag="PAS_chr2-1_0243"
FT                   /product="UBX (ubiquitin regulatory X) domain-containing
FT                   protein that interacts with Cdc48p"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68854"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR021569"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:C4R030"
FT                   /protein_id="CAY68854.1"
FT                   /translation="MSLNVTYQLRSFRVKTTPGTILNEVLTNACDHFDLDASSYQLYHG
FT                   TRLLDLSLPVRLTGLAQGAKLELKVGKAVGNVTLRFSIVGRTLNVDPKSLVLTVKSSNT
FT                   IRSVLVLLGKNIGLDLSSENFTIQSFSLRISPGPDFDKPLSSLGLSSGNSVMRLVFEAQ
FT                   GPTTKSEKKVSSPSSSALPTSAPATETHQDIKDTPNHDSTVVKDTAAGEKSTKAHIFQA
FT                   QAFKPSSNRIHSSQDDDEVYELSVDQALKYQAILSKQAHASPMMRRLAEEKKKNAKKID
FT                   NCHIRIRFPDHSNLELTIDASITLKQLCSILTTDFLSLNEEEKNAQNAFNLYIPHPHQI
FT                   LNTTANMNKRLDSDLKFGPRILLLYESANKVSKISYLKPEYLKDAKSIEDAPDVLRDRE
FT                   IEMGVDSTPVSQSPVSAVDQSSFESPTNSSLKKKVPKWLKLGKK"
FT   CDS_pept        457588..459966
FT                   /locus_tag="PAS_chr2-1_0820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0820"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68855"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C4R031"
FT                   /protein_id="CAY68855.1"
FT                   /translation="MNSVCRIRSFIPARSIRTRAVRNPLKNSKATERPPVLKTKPENLK
FT                   QLRSKRRNALKKDPSIPSFVKPAEQIRRELTAEFDRLGQEVDENFIKGVIEQSKEDEIK
FT                   LRESNGDLSILDEKDDFLSLFDRVMDQCALELSENVDLQQDAYQLDPNATLEDSVFKLA
FT                   EDFETIVKASQSSLPLFVSILKILSINSKRNLIPIELASKAFELSTQIYDPKHRTNLIY
FT                   YSGNLIYSHPRVRADPINESLYMEALLEHRQFLRCEYLFTSRLNQTDVQGQRFWLENGM
FT                   KMYLRSFKVSKAEELAAKVLQEHMYLHPSVIVQFIDVFSRLEQYGQVLKWTNTLNTIRK
FT                   SFGKGAGVVKTVNPLDLGLVDDANIIMNYWNQRDPITHNDLRKVAVSLINAGYYELLFR
FT                   VIETYASRYPTTLKLFKGVVGKCKYSVAQELIELTTKLSEPFIRDSLSKALEKNLEFQK
FT                   RNAKQAMIHDTLLGNINIEGLRDGTSNNQEYLTEKDCNRLIKRMLSSNRPNYQLVENFI
FT                   EEMINSYKLEKAGKSHGFIPPINAHIYATLIKYFGKVTNRNIEKLELVLQELESLEVPM
FT                   NAYCANQIILEYTGRRRFERAFAFIDQVLNSDFPRTNKLYETMLQSHRDFVTFSHKYGL
FT                   NKRPNHNQLRRIFVDFYNSDKGVSFTKQVVSIINCFIYTSDFISSVGMLQLFGSLKMKL
FT                   NARQVDLLLKTLIKNLELCPHSDDLDTYVEKLKQFTTSNTKDLEWKDVATIIIEAFQLN
FT                   PLLTEKSQAAYEKELGTFQHLLSLESLSIDEIRVDGFCI"
FT   CDS_pept        460074..462425
FT                   /locus_tag="PAS_chr2-1_0244"
FT                   /product="Mitochondrial translation initiation factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68856"
FT                   /db_xref="GOA:C4R032"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:C4R032"
FT                   /protein_id="CAY68856.1"
FT                   /translation="MYSIKTVRSVIGTTGWLKRPCFGCNSASIRTAADLAMLNKLRSKK
FT                   RINRNPLPTTVDPQKGQPETGNKGVPPHTQSKIASEHKVVRNGVKKVEDKFQKKPHSKS
FT                   QGNSRSRKISKEEEKALKEISTEFETHRTEASKSASKKKRSPNKPKTAVERPKIPLTLP
FT                   SFLTVSNLSTILRVRNEDLLTKLKELGFENMTYNYILDSETAALIADEYGFEATTNDNT
FT                   SVDLFEQPECTEQKLLVPRAPVVTIMGHVDHGKTTILDYLRKSSIVNGEFGGITQHIGA
FT                   FSVKTPKTKKMITFLDTPGHAAFLKMRQRGADVTDIVVLVVAADDSVMPQTKEAIKHAK
FT                   NSGVPIIVAINKCDKPDANPDKVVADLAGHDIDVEDYGGETQVVRVSGKTGLGMEDLEE
FT                   SIITLSEVLDLKAQESKTLCEGWVIESEMKKGLGNTATFLVRRGVLERGKIIVAGNTWC
FT                   KVKIMKDEHGKVLKKAGPSTPVEVIGWKDLPEAGQLGLEAKDEALAKKVILNRMAREEK
FT                   FKEAQDIEKINEMRQSELREANKRQKIEELAKNGLSLEDIRKLDSEEYKDLLDETKQEC
FT                   EIVPFIIRADVSGSSEAIAESIDGLGNDEVKSKVLYQEVGPPTETDIERAETSGAIIFA
FT                   FNLKTPKDIILKAERRGVHIKSHNVIYHLIEEVTHELQSRLKPDIKVEVLASAKVRAVF
FT                   SITGKNKKEFKIAGCKVSQGIIKRNSQIQVTRNGQMIYRGHIDALKHERDDVAEVKKGM
FT                   DCGVSLGRWQNFEEGDDIEVYEEKEVPRYL"
FT   CDS_pept        complement(join(462568..463782,463843..463860))
FT                   /locus_tag="PAS_chr2-1_0245"
FT                   /product="Essential protein, constituent of 66S
FT                   pre-ribosomal particles"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68857"
FT                   /db_xref="InterPro:IPR007019"
FT                   /db_xref="InterPro:IPR029188"
FT                   /db_xref="InterPro:IPR029190"
FT                   /db_xref="UniProtKB/TrEMBL:C4R033"
FT                   /protein_id="CAY68857.1"
FT                   /translation="MSNSLEERLKSHASSFDGLLSLIPAKYYYEDSNKSNEIREQGKQK
FT                   KKPISEVRQDKKKKLDPAFHSENVETATVKDVMRNREKAGKGAVIPGNKKIQVDAQDTS
FT                   ETDEKDNDNNHNILDAELEKDREVPAPLKTQEPATIFDDEGNEIKSKEMSSEEIAQQKA
FT                   MKEKRLSELRNKLTAKINNMREKRKAPGTNAKGAPMSREQILAERKRKDELKKKRQQQQ
FT                   KEKEKEKEKEEDSDSDDDDEEKIDADVMFNNIKFTDGEKVSSDLSSLRKVKKKGPSHGD
FT                   FKAHLQLLERQKEKFSKLDKEQQAQIQEKARWNKALAGIEGKKIKDDEKLLKKSLKRKE
FT                   VKKRKSEKEWKDRKETIEITQKARQDKREENLRLRKENKGKKRKDQTRLKKFSGIVKPT
FT                   RAGFEGKHKRK"
FT   CDS_pept        464078..465238
FT                   /locus_tag="PAS_chr2-1_0246"
FT                   /product="Subunit C of the eight-subunit V1 peripheral
FT                   membrane domain of vacuolar H+-ATPase (V-ATPase)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68858"
FT                   /db_xref="GOA:C4R034"
FT                   /db_xref="InterPro:IPR004907"
FT                   /db_xref="InterPro:IPR036132"
FT                   /db_xref="UniProtKB/TrEMBL:C4R034"
FT                   /protein_id="CAY68858.1"
FT                   /translation="MAEPLGSYLLISLPKTQNLLHDETQDWLETNVNGGKVSVTNVDVP
FT                   EFKIGTLDTLMQQTEEISKLDNQLNQAVNKVLEIIQTVFDKNPAFVEQAKQVEGRSVID
FT                   YLENFKWNTSKYRTDRSIRQLIDTISLDGLNLDNDVKATFQNYNSAKSNLAAAERKRTG
FT                   DLTVKSLHDIVDETDFVLDSDHLQTILLVIPKNLVQSFLNTYETVVPFVVPRSAKRITA
FT                   DSEFVLYSVILFKKYVPEFLAAARENKWITREFNYDEESIKLLRNEYNDASTQEHSLRN
FT                   DLIRLVKAAYADIVSSWLHIKILRTFIESVLRYGIPPDFSYFLLKLPHKAIEKGKSQLV
FT                   EKFGYLGGAAVGVDRRGKIVKDSLHEYASLVDTDYQPFVLYELEIN"
FT   CDS_pept        465428..467215
FT                   /locus_tag="PAS_chr2-1_0247"
FT                   /product="Kinesin-related motor protein involved in mitotic
FT                   spindle positioning"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68859"
FT                   /db_xref="GOA:C4R035"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:C4R035"
FT                   /protein_id="CAY68859.1"
FT                   /translation="MSSNVPRTPPLQRRMSNRSSYKSPMESPLKMMKTNSSKRSPIKTS
FT                   SADYTKVVVRFRPSIFRHGESQEIVDDNLALGKKTDSQLITIEPHQSVYISGTSFSGRF
FT                   TFDRVFGPETSQTEVFDYSINETVNDFCNGYNGTIFAYGQTGSGKTHTMLGNMDSPSEY
FT                   GVVPRVADKLFEQIANGSPSSEYTVSIGVLEIYMEQLRDLLNPDNSNNLCIRDSGALSE
FT                   GVTVQHLETRYVSSKDELLGAVILANKLRTTGVTDANADSSRSHAIFQIKLAQRSLDDG
FT                   VVKISTLFLVDLAGSERIARTGATGQTLEEAKKINTSLSALGNVINALTDGQSTYIPYR
FT                   DSKLTRILQESLGGNARTTLIVNCSPDQVDEGESVSALRFGARAKRIQNKARVNQEIAS
FT                   TELQKRLVTLESENAALIHRVAELEEQSKLKEIQQEATNTVTVDATKIKRLESSVSQLA
FT                   IRLKQNEAITEELTQELDRARAINERRKIKIEQLEKAMQAQHEDMIMETDKFANKLSYL
FT                   KARITSVKRMNQTQVPYNEDGLQPAVNIYESPTTLEENEEGLESLSINVCRSPVQFSNK
FT                   AGLHLNIVKPMRGGSAKPA"
FT   CDS_pept        complement(467254..468543)
FT                   /locus_tag="PAS_chr2-1_0248"
FT                   /product="Catalytic subunit of Nem1p-Spo7p phosphatase
FT                   holoenzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68860"
FT                   /db_xref="GOA:C4R036"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4R036"
FT                   /protein_id="CAY68860.1"
FT                   /translation="MNAIQFLSSRVHGGSLQEKQPQKETTLDLDVDQTEDSDIVTRVDY
FT                   PEIPVVKTSVTLWQTLVSIIWFFPNLLVFSPLKFIISIVLFPFRLLSKDATGGAPIEEE
FT                   FPEDDSIISQSSENIADSSYSLLDTIAESDDIEVEFPQQEIDTMKSPMTSDEATPSPLR
FT                   APTTRHTDANTIQSVKKAPRKKTKFVFPILLINNSFNLNKPPELPKKVLVLDLDETLIH
FT                   SLSSHNSSVLGKAKGQMVEIKMSNDMIALYYIYKRPYVVEFLKLVKQWFSLVCFTASIQ
FT                   EYADPVIDLLEQDVSFTEKNQSSSKKLFEARYYRNNCVWEKGKGYIKDLSILLSPQEPL
FT                   LSPPSTPRQGKSRRKSIPAKDSLANYVIIDNSPISYCKHNFNGIMVEGWINDPNDTELM
FT                   NLLPLLNSLRFTSDVRSILCLKDGEKALNE"
FT   CDS_pept        469206..470018
FT                   /locus_tag="PAS_chr2-1_0249"
FT                   /product="Hypothetical protein, peroxisomal 2,4-dienoyl-CoA
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68861"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4R037"
FT                   /protein_id="CAY68861.1"
FT                   /translation="MVNLDVNGKSVVITGGSRGLGLHCAEVYVLNGAKRVVITSRKEDQ
FT                   CMKAVQYLKDLSTTANPEVEIDFIAADLSTDEGAKRLKSEYQQRYGDRLNILVANAGAT
FT                   WGANFEDHSRKAIDKVLGLNVAGVFQTIQLFGEFLEKAGTPKDPSRVLIMSSVAGLTTS
FT                   FPAGGTYGYLASKAAVSHLGKTLAVELGPRNITVNVLAPGFFPTKMSNGLLDVVGDQMV
FT                   KNNPRRRLGEKEDIQYLVLYLSSSLSNYVNGAVIPLDGGSHLVGLPKL"
FT   CDS_pept        complement(470086..471573)
FT                   /locus_tag="PAS_chr2-1_0250"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68862"
FT                   /db_xref="InterPro:IPR018829"
FT                   /db_xref="UniProtKB/TrEMBL:C4R038"
FT                   /protein_id="CAY68862.1"
FT                   /translation="MPPPPAIVSTKVFEKEGVKIVLIADLRGKLTLLNELADIHNADLI
FT                   IHTGNFGFLEQESVDRIHESYLRHIVEFSPLLREETILRISKLSKVTGDNVEHLSNQDF
FT                   NLKILLKDEKLSELQDFIRGDYQLKIPVYTIYGMCEDLVVLNKFKHGIYAVPNLHVIDH
FT                   DTLYKVNVPRLGHSILLTGIGGSLSYHKLFHQGTSFDSNDITSDPNLASIIDTNPNQLL
FT                   PISGDPGNIWITFMQLGKLINTIIEYSTKNPTDYNKAIKFFITHQSPTREPILEHLSIF
FT                   FKMDYTISNSLHFKYSSSYNELSINPNFESFKIKFNDSRNKLATIWKNIHTKYESMLFN
FT                   LNDPLMIRSLGLALEVFDKIPITTKSSEVIYPLQLNRDNEHSTNDADDSSSSTEDEMLK
FT                   TKELNSIIRQLNDLYYVSFQNSWHFNLCDLSLGQMILNLDEEGRIQMESKCEGFNFNYR
FT                   LRDDFNTVRDDEADKRPVGSFRGRGKPRGRGRGRGKP"
FT   CDS_pept        complement(472242..472952)
FT                   /locus_tag="PAS_chr2-1_0251"
FT                   /product="N alpha-acetyl-transferase, involved in
FT                   acetylation of the N-terminal residues of histones H4 and
FT                   H2"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68863"
FT                   /db_xref="GOA:C4R039"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039949"
FT                   /db_xref="UniProtKB/TrEMBL:C4R039"
FT                   /protein_id="CAY68863.1"
FT                   /translation="MQDDLEKWITSSLESRDVEPQPDIIAKRDLIANEILPDLIDNMAK
FT                   AAGAPSTSIINASRFKIFTPRRENAPSIAKAIRLIDRGLGELYIKVNGPHWLEHKVEEA
FT                   TESGLIYLAVEDEALGELRGFVSFMHDLDNSLPVLYLYEIHVAEQFRNLQLGSQLLTLF
FT                   HTVGERIVRDWKSSISLVATSLTVFSDNTRALSWYKKQGYKIADHSPQDRQLRNLTRKP
FT                   QYYILIRWLVRAGE"
FT   CDS_pept        complement(473174..474193)
FT                   /locus_tag="PAS_chr2-1_0252"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68864"
FT                   /db_xref="GOA:C4R040"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C4R040"
FT                   /protein_id="CAY68864.1"
FT                   /translation="MSQGWYQNFDMSKTPAQEQPSHEDGNVDQRPRQASRKVQRQSQSH
FT                   IQTSQQPQLPCINQPQLLDSFAQSLDSQANSYLYTGNQNDPNQVSHVPQSSEYMDLQPS
FT                   NRPYSPASLLYLHPPVSRQFVSSSQEDAEPTSSSGQSSSNCTAIDQQHRFQIANSRNVF
FT                   NSSEGIPMVPVQEVRMAPPVSGPDSRPQGFGQDQPYNPQLFGYYPEGLPTQQFPSSIVN
FT                   LVNPPPFDEVMKNLPNPVAFDDLGLEGQKTVPSSTRTHSQTPSLRIEERIGNQCPHCKK
FT                   KFRRPSSLQTHIYTHTGEKPFQCRWPNCDRRFSVRSNMVRHYRLHKKVNKQGSDEKEQ"
FT   CDS_pept        475115..475798
FT                   /locus_tag="PAS_chr2-1_0253"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68865"
FT                   /db_xref="UniProtKB/TrEMBL:C4R041"
FT                   /protein_id="CAY68865.1"
FT                   /translation="MNGDQLRSFTFDNGSSKPASINEGDPLAAPGSPVNSVDSDKDLIF
FT                   ERMVQDPLTESPVLQCPRCGNHTSKCHHNSILKLPQHFNTENFIPAALDSTTSLINSQE
FT                   DMDLDLSTPPRRPSVVSLSQAFPNSYDGTGPASSVNLNAGGPVMRTSPSSPALSRNQSF
FT                   CSYADMIKREDQEGNVHRRPSIQQTLSGRKLPALLRRSTTASVGSDEQLSLDGTLSLRR
FT                   KVIRS"
FT   CDS_pept        complement(475856..477196)
FT                   /locus_tag="PAS_chr2-1_0254"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68866"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniProtKB/TrEMBL:C4R042"
FT                   /protein_id="CAY68866.1"
FT                   /translation="MSDNANETSSSLLDNVYLDSSDLLIARYDKWILALAFFENFFARY
FT                   DSILSSTAKDYGKLVKHFSTDTLPQFEVSPSSNIAGAVYGSVNSEADPNKNVTGVNSFI
FT                   ELLKFRSSEDQGKIAGLETSIREQIIPEFKKYSADLSAKKKDLTADASKQRKELKKLGL
FT                   HLSSSISKLQHSTQVFESASGTGKMDYKNDPYMLKRAVSLHGTELIAKEHNHMDFLKRE
FT                   ELSLMTLEKRTLEFIQLIFADVSNRITAADSVFSRSFDSLSKTLSSIDLEYEWKQFSEV
FT                   NKQRLVTVEGNDDISGANISADNKKRGLSDLSFPNDHHPATEPILEGILQRKEGKVNKK
FT                   YVSEYYVITKTRYLYEFESNAPKNSTQPNTVLYLPECTLKSLNGPDNSKFKIEISGKDA
FT                   TQAFSVIKSTLILKTSTYDEMRTWFNVLSEVSGLMQTQEESRLDSPN"
FT   CDS_pept        complement(477349..479547)
FT                   /locus_tag="PAS_chr2-1_0255"
FT                   /product="Protein of unknown function involved in
FT                   maintenance of proper telomere length"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68867"
FT                   /db_xref="InterPro:IPR024391"
FT                   /db_xref="UniProtKB/TrEMBL:C4R043"
FT                   /protein_id="CAY68867.1"
FT                   /translation="MAIFGSRLVRKDDKNASGLGGPSPSNTNLHSSPVKLSISLESPPV
FT                   VLYGQPHESTGSILSGLLSLDVLSYTQIASPTMSGSNSPGILTPVRSTSSLNVLTPTTS
FT                   LTMSQDYSKLDSIEIVNVTLSFVQTITYGKPLAPPSNTLQNCPDCKQKKLELARWDILA
FT                   QPTSFAKGAVHAYPFSHLLPGALPATTLLGNTNTVIKYELVADAEYLNARKKPEYLRIK
FT                   LPIIIKRSILRGPDRNSLRVFPPTDVTATAVLPNVVYPKSTFPIELRLDNVCTKYRRWR
FT                   MRKLVWRMEEHIKVRAVSCEKHETKLKVLQDYANKQHHRFKRPHNTGGQTFTHLSVGTA
FT                   SGHDINTNGPINPVRTVTTEEEVAITPAAGGIDHVALTQEALAQEQAREYESRYGGSAA
FT                   NSNSENHNNNTNSSNTENSNIPIDHFNDERGSNKPVLFLEEIRTISQGEIKSGWKSDFS
FT                   GKGVVELVADINIMNLSSIALDSSLSNLSSVTSQNCNQPMFNHDDLFVSSMANCSCDLS
FT                   EKELGVFVSHLLVVEIVVAEELIQRKGVTHTHRGSNSQAKSPSVRFGGVNGGGNAFEQT
FT                   HSSEPADDTDELRFQLSNNSELPVSEVTSEQDNDSVVGIATGVARVLRMQFKVLLTERS
FT                   GLGVSWDDEVPPTYENVSALSPPTYDQARKPEGPMTGEDLTPPTHPAGAHTRERETPLN
FT                   SSPSMVTPGVLYGIGDTPGVSIDGVLQLDDAIQELKLS"
FT   CDS_pept        480498..482750
FT                   /locus_tag="PAS_chr2-1_0256"
FT                   /product="Protein O-mannosyltransferase, transfers mannose
FT                   residues from dolichyl phosphate-D-mannose to prote"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68868"
FT                   /db_xref="GOA:C4R044"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="InterPro:IPR036300"
FT                   /db_xref="UniProtKB/TrEMBL:C4R044"
FT                   /protein_id="CAY68868.1"
FT                   /translation="MTGRVDQKSDQKVKELIEKIDSESTSRVFQEEPVTSILTRYEPYV
FT                   APIIFTLLSFFTRMYKIGINNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSG
FT                   YIAGYNGSWDFPSGQEYPDYIDYVKMRLFNATFSALCVPFAYFTMKEIGFDIKTTWLFT
FT                   LMVLCETSYCTLGKFILLDSMLLLFTVTTVFTFVRFHNENSKPGNSFSRKWWKWLLLTG
FT                   ISIGLTCSVKMVGLFVTVLVGIYTVVDLWNKFGDQSISRKKYAAHWLARFIGLIAIPIG
FT                   VFLLSFRIHFEILSNSGTGDANMSSLFQANLRGSSVGGGPRDVTTLNSKVTIKSQGLGS
FT                   GLLHSHVQTYPQGSSQQQITTYSHKDANNDWVFQLTREDSRNAFKEAHYVVDGMSVRLV
FT                   HSNTGRNLHTHQVAAPVSSSEWEVSCYGNETIGDPKDNWIVEIVDQYGDEDKLRLHPLT
FT                   SSFRLKSATLGCYLGTSGASLPQWGFRQGEVVCYKNPFRRDKRTWWNIEDHNNPDLPNP
FT                   PENFVLPRTHFLKDFVQLNLAMMATNNALVPDPDKEDNLASSAWEWPTLHVGIRLCGWG
FT                   DDNVKYFLIGSPATTWTSSVGIVVFLFLLLIYLIKWQRQYVIFPSVQTPLESADTKTVA
FT                   LFDKSDSFNVFLMGGLYPLLGWGLHFAPFVIMSRVTYVHHYLPALYFAMIVFCYLVSLL
FT                   DKKLGHPALGLLIYVALYSLVIGTFIWLSPVVFGMDGPNRNYSYLNLLPSWRVSDP"
FT   CDS_pept        482906..484210
FT                   /locus_tag="PAS_chr2-1_0257"
FT                   /product="Nucleoside transporter with broad nucleoside
FT                   selectivity"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68869"
FT                   /db_xref="GOA:C4R045"
FT                   /db_xref="InterPro:IPR002259"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4R045"
FT                   /protein_id="CAY68869.1"
FT                   /translation="MSTYRELEREEGDFSDKKLLTGWFSLTVGQLQYAAFMAVGIALLW
FT                   PWNCFLSASDFFGERLQEHKWLSANYSSSMMTISTLTSTLCNVFLSQKQSGVDYSKRLV
FT                   MGQTITIVVFAFMGLLCVWNTGLDPIIFFVLVMINVALSSVAVSLSQVGAMAIVNVLGP
FT                   IYANAVVVGNAVAGVLPSIALIISTALSGTHVAGKLQPKRDYAVMAYFLTACVVSGIAL
FT                   VLFGLAESHGPIDVVAAPVHTSSTADEAIEELGIPLEEEEYVPFSTLWAKLRFVALTIF
FT                   TVFGVSLVFPVFASSIVSANGINSRIFVPLAFLLWNLGDLAGRLLCAYPRFVTRSPIKL
FT                   FIFSLARFLYIPLFAICNIRDKGGLIQSDVLYLLFQLSFGISNGLIYSSAFMIVGDIAS
FT                   GENEQKAASGFTAVFLSLGLACGSLGSYLVVAFIL"
FT   CDS_pept        484340..484939
FT                   /locus_tag="PAS_chr2-1_0258"
FT                   /product="Protein required for maturation of mitochondrial
FT                   and cytosolic Fe/S proteins, localizes to the mitoc"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68870"
FT                   /db_xref="GOA:C4R046"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:C4R046"
FT                   /protein_id="CAY68870.1"
FT                   /translation="MRLALIPLLSAKSTFHIGTRALLTHSFNQSWPKQFLTRPYSEAST
FT                   SSTSFKKETFSQQPDDFAKTRLTNPQYSDNNGLLLVVAITPAARDKLLSIAKEENNPNV
FT                   ALRVSVSSGGCHGFQYNLELNDIKNYDKSVDSLFERDGAKVLIDKTSLEILRDSKIDYT
FT                   HELIGSQFKVVDSPYTATSCGCGASFDFDFDKLKQG"
FT   CDS_pept        complement(484926..485777)
FT                   /locus_tag="PAS_chr2-1_0259"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68871"
FT                   /db_xref="UniProtKB/TrEMBL:C4R047"
FT                   /protein_id="CAY68871.1"
FT                   /translation="MERALVNTTFRLNYILSIDGTTLEELREPENLTLLKTLIVDELKK
FT                   YELSLTSRSSRLPLSEQLDQEVEISPKTVQVSLNRQEIGGYNVLYLSIVCRGVIKRQVV
FT                   ILVMNPQKRGVIALSRCDTRYLGLIWSHLTSKMGQIVRPMDITSVFMTELFDKSMQEIP
FT                   SSNIFNIVGSLHLNFTVETLGNSLKNIIIDIPGDVLEKCDSKSYVQDIYSRLRKQLGID
FT                   LSQLELTTIRSNIFMITNTGRIRFNQGTSLDSSDKDTVAVWTMIDQLYTYAERLTAIPI
FT                   PV"
FT   CDS_pept        join(485907..487437,487502..489342)
FT                   /locus_tag="PAS_chr2-1_0260"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68872"
FT                   /db_xref="UniProtKB/TrEMBL:C4R048"
FT                   /protein_id="CAY68872.1"
FT                   /translation="MSFVNKENAQKSAGAAASFIGKGAKAGYSAIKNHKSGSSNKDSEH
FT                   EEHYSSVRPLESLTDPRTFQPPPKRSVGSYSGSIPPSFSAHSLAATSSAIPPPQATVQN
FT                   PAQYQLQIQPSMSAPQQQPGNQVYAAGNYQDPSQASQTYPGPPQLPGRQPSQNQIGGNP
FT                   QVPAQSQAESYISDSVTRTGQSAGSQYVQSQLQNSGYAEAQNPQIQKAGAAFGSFIGGQ
FT                   LAQQGQQQAKQQLQQQLQNFQNPQSTIQTPQSQDVSQQQSQFPQVQQPEQTPQAPSISQ
FT                   IQGPDQFQQPGIAQQATQQPNQFQQLGIAQQPNQFQQPAPAQQPIQQSAQFQQHLPAQQ
FT                   PNQFQPPGPAQQSSSQPNQFQQPGIAQQPNQFQQPAPAQQPGIAQQPKQFQQPAPAQQP
FT                   IQQATQFQLPSPAQQPSQFPEASPQQQVPQLQQGSQVPVSPQLQQASPVHQFSQNKQVH
FT                   SQDVREIQYQQRPQPQPPSNHQSQDVLNTQYQPTNQPSQMYPTASIQPPPTSAVPREPE
FT                   PLPQQSASVIASPPQSFAPPPVHVARGSSPSNHAQTELSPTISTAAPVQGVHSGSTAPP
FT                   PPPRNTFSLPDISTVGPPPPKPFRSAQEKEKLEQERRHQEEFNKMRNAHRTASSTSTPS
FT                   YVPKPNSPLKTEDTGEPAPLPPEKNASKDTTAFSPPPSTFRSSSSTKNHSVPVAAPKPT
FT                   VKTDIDDIASPSPPPPAPRKKFSSKESESLVLESHKKPPPKPSKPKSLANINSKQGELE
FT                   NNKQFANSEPIPDSKTSRAVPAEQDLVSEMERVMLNRRKKLQDQETATPDVSNKPSRPA
FT                   KPVKFEKISSPTQRQHHNIFETPNQSTKNTSGIHDAAPVKPTRPPKPTFSKPPKPLPAV
FT                   SKPKPYVRTKVPIPDSNQQLNLQLETGWYKRLDQIPPDAAGLIYRTSMGQIGGDYTRYI
FT                   SFRMKDLGTVQAEIKWSDSTAPIVTQKYTAPPTATQEQLFEGRNLFNEHVATWAESHEG
FT                   KCVGDGECWTLAKLALEKGCGKHAFVSEYYHHGALLFTKDASGVIKSNPTDSIARGDIL
FT                   QFYECTTKNNYSTTKLGAPHHTAIVVSCNSDGSLEIIHQNVNGVKKVMKQNLVLNVVEG
FT                   TMKVYRPVTKTWIEEL"
FT   CDS_pept        489797..491524
FT                   /locus_tag="PAS_chr2-1_0261"
FT                   /product="Activator of Chs3p (chitin synthase III),
FT                   recruits Chs3p to the bud neck via interaction with Bni4p"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68873"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C4R049"
FT                   /protein_id="CAY68873.1"
FT                   /translation="MSTHPYRQKIPQLPGSTGSFDRPDVTSTQSGVETASTEPNSRATL
FT                   ANLGSVSALPQLDVQQPVLPFTSQVSHNRSSSKPGSVTSRSNANSPAGSVSSHSPRSSL
FT                   SSPLIHPLNPEAQRATGSKVVSPNGSIGNLNEFGHKYRNSGSRLSINTSSSGHSSPMYN
FT                   IKPDHRTSSRSVDLGSFYQLDRSVSPAITIGTNMDFSQSLLANQQTAEHPSALVPRMKT
FT                   IEMYRKNARKSHDPAVLFQYAQYMLQTALLLDTESEEEGKLRKDFLQEAQHYLKKLADK
FT                   GYLDAQYLLGDAYSVAAFGKTDDKESFSLFQSAAKHGHVECAYRTALCYEEGLGTGRNS
FT                   RKAVEFLKFAASRNHAAAMYKMGLYSFYAKMGLPNNITTKKAGIQWLSRATMRATELTA
FT                   AAPYELAKIHYHGFEDIVIPDRKYALELYVKAASLGHVKSAAILGHHYEVGDVIPQDPD
FT                   LSIHYYNIAAMGGDCESMLAMCAWYLVGSEKLEKDENEAFEWAIRAAHGGLAKAQFAVS
FT                   HFLEQGIGCEIDFAQSKVWLEKSAQGGNSRAITKLKNLNSSSENSTKDSKKDKDCIIM"
FT   CDS_pept        complement(491647..493602)
FT                   /locus_tag="PAS_chr2-1_0262"
FT                   /product="Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68874"
FT                   /db_xref="GOA:C4R050"
FT                   /db_xref="InterPro:IPR018825"
FT                   /db_xref="InterPro:IPR018827"
FT                   /db_xref="UniProtKB/TrEMBL:C4R050"
FT                   /protein_id="CAY68874.1"
FT                   /translation="MKLSRLIVPICFCLSRGAIALSAYAHDGSHGGMDMDMDMSRNSVT
FT                   AETTETATHQLNGSADSETAIPSIEPVPFEGHHHHGLPILDTDLSPAERLYWENYNTTT
FT                   YFTVESNSRFFLYAHVISMVVTFVFLYPVCLVLNNVKNKWYLPALSVHAIVTVLSLISY
FT                   SIFIDSVPDLYPNNAYTKMGVVLFVFTVVHFVSAVIYQGSKFFAVLPSTPNDNSHAQFL
FT                   PLEDLSNKEHNKKHEVNSTSSTLFDYETRDSHSKQFRSQYRDSLNSSFQLDDREANFSI
FT                   DNSSNGTIHDVPSIPSQDHDSYSYKVDGALQRLFEVPWIARIAVSLGSVASVVFNLLNF
FT                   GIFFFFLIYFPTGVAVLNCLGMANTVFNLLAHFIKGGVFFSLGLLSLARYCGGFQKLGW
FT                   AWNYSFINRYEKKDSIWFRFQPRNVMITMEMLESSLILFYGCTNVFMEHLSNPGGEWAA
FT                   KDLQHVSIAFMYIGCGLCGVITELKLNNWRLIKFQSTVEEINNENEPIDAECFTNVTCG
FT                   FSPNPFPAFTIFWTGLLMSQHAQASELSTSIHVQWGSLLTYGSLFRIATMLYLMFNKTY
FT                   KGDLFQPSRPLTELVTSFCLLCGGLVFAESTDPIVLAMAYRGLTGMFTLNVSVGVVALL
FT                   MAWIMTVFSIKDHLKR"
FT   CDS_pept        494748..500015
FT                   /locus_tag="PAS_chr2-1_0263"
FT                   /product="Catalytic subunit of 1,3-beta-D-glucan synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68875"
FT                   /db_xref="GOA:C4R051"
FT                   /db_xref="InterPro:IPR003440"
FT                   /db_xref="InterPro:IPR026899"
FT                   /db_xref="UniProtKB/TrEMBL:C4R051"
FT                   /protein_id="CAY68875.1"
FT                   /translation="MFSALKTPFITTGRWADIKRVGNLYGYDPNSALDDESSLLNQKLA
FT                   EGGIFDTFDNNYDPYPTWASDDEVPISKLKIQIIFNQLQEIFHFQPSNIRNMFDYLMKL
FT                   LDSRASRMGPHLALQSLHADYIGGINANFRKWYFASQLDLDDSIGFENISYNGTAKRHS
FT                   PYTVPMLSVAQKRWTENMNALSPDDATVHLALYLLCWGEANNIRMIPECLCFIFKCCND
FT                   YYYSLDLSKSIPSPERPFLDHIITPLYQFHFNQMYAINSKGETIPRNIDHDKILGYDDM
FT                   NQLFWYRKGLERIVLQSSKRTILSFPPAERYIHLHNIEWSRAFFKTYYESRTSLHSVLN
FT                   FNRVWSIHVCVFWLYTSFNSPTLYTSDYDYRRDNQPTASARLAVLSIAGSICLFLNWIA
FT                   VIAEIKFVPRKWPGAESMIPKLLLLLILTLVQVAPIVYILFFNSLDYQDMFLLIISIFE
FT                   FILSIAIIFYFSIVPFGALFGSYMSKGERTYLPSKYFTGSVPKLKGKAELASIGLWVCV
FT                   FLSKFIETYFFLTLSIRDSVRELSTLEINTCIGETYFGDLLCKRQPLILLVLLFSTDLI
FT                   LFLLDTYLWFIIWNTLFSVCISFSIGISILTPWRNIFSRLPKRIYSKIINDNGSTSMKS
FT                   KQLVSQLWNSIIISMYREHLLSIDHVNKLIYQQIIVPGQQDTSEQILKEPTFFVSQEDH
FT                   ALKTSLFKGHKEAERRITFFAQTLSTPIPESIGIEKMPSFSVLIPHYAEKISLSLREII
FT                   KEEDENSQLTLLEYLKQLHPAEWVNFVEDTKILAEEINSSEDSFSKSSIKDRLIDLPYY
FT                   TVGFKTATPEYILRTRIWASLRTQTLYRTVSGFMNYSRAIKLLHDIENKDIADSSDSNK
FT                   RLEEASIMALRKFRMVVSMQRFHKSSPEQRESKETLLRAYPELQIAYLEERYCEDRGCL
FT                   EYYACLIDGSCEILEDGERKPKYRIRLSGNPIIGDGKSDNQNHALIFCRGEYIQLIDAN
FT                   QDNYLEECLKVRNIFSEFEELNSTDDPYCLDEDTNNPNPVAIIGAREYIFSENVGVLGD
FT                   VAAGKEQTFGTLSARTLALIGGKLHYGHPDFLNSVFMTTRGGVSKGQKSLHLNEDIYAG
FT                   MNALLRGGRIKHSEYLQCGKGRDLGFGSILNFTSKIGSGMGEQMLSREYFYLGTQLPLD
FT                   RLLSFYYAHAGFHLNNMFIFLTINLFILFSANLAALVKNSLVCSYHKNIPITDPKSPEG
FT                   CFNLVVVILWLQRCVVSIILVFFISFIPLFVQEVTERGIGKAVTRLSKQLASFSIFFEV
FT                   FVCKIYANSLLNNLSTGSAKYIATGRGFATTRMPFSVLYSKFSTVSLHEASILFFLLLF
FT                   TSISMWRTVLIYFWFTITALVISPFLFNPNQFAPQSFFLDYRKTLQWLFKGNSKWQQES
FT                   WIGYVRNNRALYTGSKRKEVKLGENIDLGYLNKPSIINLLLTQVGTHLLKTLIVFNAYL
FT                   FSNSQLNTGALRVNTIMRLAVCSLGPIAVNIVLLLLLQPLSLIIAPLVSSTCWKSFPSV
FT                   LAAITRILGLLNHILFFNLLWMFQNWELATTVLGFCCSCLIESLLFRLVTSLFLTSEFR
FT                   HGRTNRAWWSGKWITSGLGFNVLSQPVREYFCKVIEQSLFAADFIYVHILLFLQIPIVL
FT                   TPFIDSIHSLMLFWLPPSKQLKPQLFPMRNSKRKRTHAQLLSVLFLLILSLQVALIIGP
FT                   YIISIVYGNEVFRENMPEIFQQLFQPIAYKNPNLGLKSHSIITDISNMDTVNARKDNR"
FT   CDS_pept        complement(500020..500907)
FT                   /locus_tag="PAS_chr2-1_0264"
FT                   /product="Mitochondrial outer membrane protein with
FT                   similarity to Tom70p"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68876"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR025986"
FT                   /db_xref="UniProtKB/TrEMBL:C4R052"
FT                   /protein_id="CAY68876.1"
FT                   /translation="MSFSLKQKGNQAFADGSFQEAANIYQEALQLDPQNPVLYSNRAMC
FT                   YVKLNNWHQVLADTTAGLELRVNDTKTQVKLLWRKGLALSKLGNVSEALESFNKALELD
FT                   PNNATVKSELERLVLNKRRKHLQSENGSLLSLTIENYDVLPSEFTSNHIQEADTYQEKP
FT                   ASSSELFEGSSFNPPAFPSVYFLSRLKFLPASQKPPAYHYVLSFSPETYSSLFKEGGLD
FT                   SNFLDFFIEAVINNQIKNPDNVLQCLKIFSTCKRFSIYLSFTEANNITLMFEKLSNLSD
FT                   KQLFTTTRNIWGLP"
FT   CDS_pept        501107..502003
FT                   /locus_tag="PAS_chr2-1_0265"
FT                   /product="Protein that inhibits activation of Gcn2p, an
FT                   eIF2 alpha subunit protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68877"
FT                   /db_xref="GOA:C4R053"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:C4R053"
FT                   /protein_id="CAY68877.1"
FT                   /translation="MESEELIDEIGAIDVIFPNCVSKIKPSLYHVKVPQNEDIAFDLNF
FT                   PPNYPETKPKIETIKSAVPGLQDIRYFRSRLESLLDQVFVEQNVCLFEFISEVNNTVEE
FT                   LEAEWDQRNQHLKENSEPPEDDADVRISAISSQLQNSTINSSGSNGKMVKQDNDHDHLK
FT                   GWFISEPVVDRKSTFIGYSRAVHSEKEVLDCINELKMDRKIAKSNHVMTAYRIQAENGI
FT                   RYKDCDDDGETAAGSRLLHLLDIIDAWNVVVVVVRWFGGLHIGPDRFKHINSTAREALV
FT                   KGNLVEDNKKKTKKKKC"
FT   CDS_pept        complement(join(502051..502461,502549..502590))
FT                   /locus_tag="PAS_chr2-1_0266"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68878"
FT                   /db_xref="InterPro:IPR019324"
FT                   /db_xref="UniProtKB/TrEMBL:C4R054"
FT                   /protein_id="CAY68878.1"
FT                   /translation="MSNKGLSSRVLNMKFMKSSDEKAEEFKTARVTDSSEWSLPNASKM
FT                   KKKLRRVHVESVGYSDAAGFSSRRRVFGETDEKFGEEEVEKSDEETYSKDSVKTKKKKK
FT                   GLKESEGFLDDLWKKTQAKRKLSRKESQEDFLEDSHQDTSKKLRTE"
FT   CDS_pept        502751..505384
FT                   /locus_tag="PAS_chr2-1_0267"
FT                   /product="Conserved 90S pre-ribosomal component essential
FT                   for proper endonucleolytic cleavage of the 35 S rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68879"
FT                   /db_xref="GOA:C4R055"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007148"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR027145"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C4R055"
FT                   /protein_id="CAY68879.1"
FT                   /translation="MKSDFQFSNLLGTVYRQGNLVFINDGNTLISPVGNRVSVFDLINN
FT                   KSFTFPYEHRRDVAAITVNKQGTLLMSVDEHGRAILVNFKARIVLHHFNFKSPVKAIEF
FT                   SPDGHYFAVGCGKILQIWRTPNVLEDKQFAPFVRHAYYTGHYDDITSVSWSGDSQFVLT
FT                   TSKDMTTRLYGVDRDRMDEVRMTLGGHRDYVVNAFFDEAQEVIYTVSKDGALFRWEYTS
FT                   DPKSKEDEYEEEDEEDRSTDEDGILQKPKKPESWRIVARHYFFSHSKLKCAAFHPKSNI
FT                   LVVGFGNGEFRLYELPTFTLIQQLSMGQNSVNTVSINASGEWLAFGSSTLGQLLVYEWQ
FT                   SESYILKQQGHFDAINALTYSPDGSRVVTAADDGKIKIWDVLSGFCLATFEEHSSAVTS
FT                   VRFAKRGQVLFSSSLDGTVRAWDLIRFRNFRTFTAPERVQFGCLAVDPSGEVVCAGSLD
FT                   DFQIHVWSVQTGALLDSLAGHEGPVSCLSFGQEGEAATTLASASWDKTIRVWNIFGRSQ
FT                   QVEPFEVYSEVLAIDMRPDGKEVAVSTLNGQILFWNVESGNQTNFIDAKRDIQVGRYSD
FT                   DRFEAKNSKRGKCFSTISYSFDGLSLIAAGDNNSICLYDVKNSVLLRKFTVSLNMNLEG
FT                   TLKKLNSKNLIEGGPIDLLDRDGENSDYEDRVDLKLPGSHRGDPSVRNIKAAVRVTSIA
FT                   FSPGASSFAAASTEGLLIYSVDDSVNFDPFDLDIDITPASCLEMLEEKEFLIAVVMSFR
FT                   LNERYLIHRIYESIPLNEIDLIVADLPKVYVERFLRFIGELSLESQHIEFNLIWIKSIL
FT                   AAHGKYISAHKFEFSVATRMIQRFLARIAKDVVKTSVRNGYLAEFLLDTRTQQDSIRIE
FT                   EEKLTL"
FT   CDS_pept        505500..507026
FT                   /locus_tag="PAS_chr2-1_0268"
FT                   /product="Essential protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68880"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR019156"
FT                   /db_xref="UniProtKB/TrEMBL:C4R056"
FT                   /protein_id="CAY68880.1"
FT                   /translation="MEPIECLTVLSRILVTLGSNGDKVLKDYRHNLDLLSACLSHANSN
FT                   AGFRREVFQSQSVWVMLNQIFSFYLENSDTRVVQDEIWQYRTRTVRGISLLARSMITAC
FT                   TAQDSSAQPYVENTHRNISNVTRVSIAKLCDSSLSDSTRDLYVKLISSNFQFLTNLMNT
FT                   KLGDEYHGTIDYKLAQDLFRRIAHVKEPGDAPLDLEFAEHGLYLVNSLVDNKEFSFTLM
FT                   DDQETFNLFLSALLNSFEEFSTNAAIEIEAAKDQDLNAIELLIVSICSKIITKPRFVTW
FT                   IDTMDPFDGNMPNYLKLFQTIIVNRDSWSSDQLIVLITWLTTLFDRLNVDDNSVLTASL
FT                   NKVLVSTLDSIASICQYEEVRQYISEYHYFVKFLDLLKMLSIKVPRKALKDSASKIQFP
FT                   NTKSIIVEILTFLVHKNFKVQEAMRDFQGIEVILNNCNIDENEPFIKERSILCIKYLLE
FT                   NNQANQDFVAKLEAKKVTDDKVLSEAGYEVDIVDGKVKLKPPKPRSNPSE"
FT   CDS_pept        507151..508659
FT                   /locus_tag="PAS_chr2-1_0269"
FT                   /product="Threonine synthase, conserved protein that
FT                   catalyzes formation of threonine from 0-phosphohomoserine"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68881"
FT                   /db_xref="GOA:C4R057"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:C4R057"
FT                   /protein_id="CAY68881.1"
FT                   /translation="MSVYRSTRSSAEQQVSFEDAVITGLAKDGGLFIPSEIPSVPTDFL
FT                   SAWKDLSFQDLAFKIMRLYIKEAEIPDNDLKDLVERSYSTFRSEEVTPTVKLDSHDNLF
FT                   LLELFHGPTYAFKDVALQFVGNLFEYFLQRKNKGKAEDDPTRDTITVVGATSGDTGSAA
FT                   IYGLRNKKDVSVFILYPTGRISPIQELQMTTVVDDNIHTLSVNGTFDDCQALVKEVFND
FT                   SEFNDKWHIGAINSINWARILAQITYYFYSYLQVSQAVGHGRVKFIVPSGNFGDILAGF
FT                   YASQMGLPVEKLVVATNENDILNRFLTTGKYDKGDVKPTHSPAMDIVVSSNFERFLWYM
FT                   IKETIGKNDEKATGEILNNYMKELSTKGVFTVPQAVLDKATSILDSDRITNEETVSTIK
FT                   KIYEATSNNYIIDPHTSVGIATTLNQIKKDNDPSITYVSLSTAHPAKFSEVVDAALTSY
FT                   PDYSFEKDVLPEELKNLSTLPKKIKLIETATLESIKDTIVKTLS"
FT   CDS_pept        complement(508992..509882)
FT                   /locus_tag="PAS_chr2-1_0270"
FT                   /product="Plasma membrane protein with roles in the uptake
FT                   of protoprophyrin IX and the efflux of heme"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68882"
FT                   /db_xref="GOA:C4R058"
FT                   /db_xref="InterPro:IPR007568"
FT                   /db_xref="UniProtKB/TrEMBL:C4R058"
FT                   /protein_id="CAY68882.1"
FT                   /translation="MAFKLFNYNPSLPAAIAFAVVFGLLTLIHSFMVFHVGFKQNLTFN
FT                   SGRKKRLCCIMIPFIIGLVMESVGYVARAIATQNKDSVIVYCMQSTFILIAPVLMAATL
FT                   YMVFGELVKTTDTEKHICISMKYFTKILVAADIVSLLVQAAGGGLIAMDSARKWGKIIV
FT                   IVGLFIQIIFFGGFFVLSILYTIQVHKHAKRHISKYSHWMLSFVVLFVTSLLILVRSVF
FT                   RVVEFFGGYDGAIASNEKLIYGLDAVPILVGSVIFVFFNYSRLLCKYQTLNDGSDFLLV
FT                   DKILPSEEGSQKESY"
FT   CDS_pept        511580..512968
FT                   /locus_tag="PAS_chr2-1_0821"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0821"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68883"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="InterPro:IPR036885"
FT                   /db_xref="UniProtKB/TrEMBL:C4R059"
FT                   /protein_id="CAY68883.1"
FT                   /translation="MNRGKPVTREPQINPQSVSFKPTDLIIPESLQEMFPEQVDLFKNL
FT                   QDKEKQLDLLVNRKLLDLQDYQNNNINGVMEDSDKNEILRIFIYNISENQPWQLAKQSE
FT                   DQSEEAKAIAAGSAQADPSWTLRIEGRFLNDEAADNASRKKFSSFLSSISVELFKGATK
FT                   EKLDANNIIEWHDELQQIKSEIEREEQQFDGLDIKRVGSSIPGNPTEEVSCQILIQPKM
FT                   YPIKLSILSKDLVELLGTNEITQHDCFVKLFNYIQVNDLFQFDQDKNLQQQQNSILIKS
FT                   DDALLKIFQLEKFNVPQMLDIISTRLLKPVEPIKLNYTVNTLTNSTLGDMIIDLKINSD
FT                   LLNKSSAGGANKSVSDLINELMNNQANSIEVNKLNENISLTLQLLNYNKIKYDFYKKFS
FT                   EDPVKFLQKINDKNHEFLKIICSDSVGYNTNEYIDEEIFRKSEYYKDNIISEQVNLLLS
FT                   SGRL"
FT   CDS_pept        513024..513314
FT                   /locus_tag="PAS_chr2-1_0822"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0822"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68884"
FT                   /db_xref="UniProtKB/TrEMBL:C4R060"
FT                   /protein_id="CAY68884.1"
FT                   /translation="MIEDLIQISREYPEYFKKLTLEGDWEPEGDYRKAGLFCQTFEGKD
FT                   YNITISPQGWTVDDETYYPTFEALAHRISKSFSVKWNEELMKKLESVIESD"
FT   CDS_pept        513445..514629
FT                   /locus_tag="PAS_chr2-1_0271"
FT                   /product="Subunit of the Hat1p-Hat2p histone
FT                   acetyltransferase complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68885"
FT                   /db_xref="GOA:C4R061"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR022052"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C4R061"
FT                   /protein_id="CAY68885.1"
FT                   /translation="MSESLSLEETPQENEELTIEEEYKLWRKNCHYMYDFISETALTWP
FT                   SLSIQWLPQSFQAPSNAEITQSLLLTTLTSGKDTDYLKIAGTQLPDSLTGKKSEEKVKS
FT                   RLKVFKKYPQSTEINRARYMPQNPNIIGTINASGQVFTYDVKSLAEPVINEYIHHKESG
FT                   YGISWNRKKEGVFATSSDDKTVAIWNINHSKPLRTYEHKDIVNDVAFHNFDVNIIGSVS
FT                   DDKSLKIHDTRTQKTVNSEQVSEKGVNSLTFSTFSENLVAVGGEDFNVSLFDLRNLTRP
FT                   LHSMVGHTSTITSLSWDPHHENIVASGSADRRVILWDISKIGEEQLQDEMEDGVSELFM
FT                   MHGGHTGSIYDLSFNPDIPWTLASCSNDNIVHLWTVSRKVLGSGNEEVDLKSLE"
FT   CDS_pept        514834..515574
FT                   /locus_tag="PAS_chr2-1_0272"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68886"
FT                   /db_xref="GOA:C4R062"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:C4R062"
FT                   /protein_id="CAY68886.1"
FT                   /translation="MNRLLKRPLLTLEKPSCVRFTAISKRNRIKVQLLKDFPGVGVRGE
FT                   VVNVRPSLMINTLHHNNGACYLLPGQGPRIPVVEKKHEAKQKEPLSSQSETRTTKADSK
FT                   PTMTPDLLAKLTGLSFKESTSPSKAENSGSANELELATAIQDMPKVIFMRYATDDNGTL
FT                   KNEIRKDRLCEHLFKLTGFTIPTEFITIQYMSPNGPIDLDYMDFVGDYTLTFKLSSTFE
FT                   PIVKNAKIISSNIDLALQKDLIRP"
FT   CDS_pept        515647..516558
FT                   /locus_tag="PAS_chr2-1_0273"
FT                   /product="Protein involved in bud-site selection"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68887"
FT                   /db_xref="GOA:C4R063"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C4R063"
FT                   /protein_id="CAY68887.1"
FT                   /translation="MDFETETATSRTLDCLSCSSQVVHGHVGNSAIQFPLQLNGWNVDT
FT                   INTTQFSNHPGYGRFKGQKTSASEVEAIFLGLMNIGCHYDTLLLGYVADAGTLRTIGNL
FT                   FAEYSTNHGARFVLDPVLGDNGKLYVSEDLIPVYKEIIRSGKVDMVTPNQFELELLLGS
FT                   KINSLKELRNAMFQFQEEFRVKNVVVTSVSFPTGPNHDDSNIYLAGLCEDQWFYEKVPE
FT                   IDAIFSGSGDLFLSLLNHLYYHFPLQEALIKTASSVSKVLQLSYEMELDNPCKIFKLDK
FT                   LYVPHLRMVEARDILVLSVPNK"
FT   CDS_pept        complement(516567..517568)
FT                   /locus_tag="PAS_chr2-1_0274"
FT                   /product="Protein involved in postreplication repair"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68888"
FT                   /db_xref="GOA:C4R064"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR006642"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR039577"
FT                   /db_xref="UniProtKB/TrEMBL:C4R064"
FT                   /protein_id="CAY68888.1"
FT                   /translation="MDATVGNIGSISDPSDWLGTKVPKLFDLESMLSCHICKETLKAPV
FT                   MTQCGHCFCSLCIRRYLKVNQECPLCHEVQYESNLVKVLLLDSIGKWFISNRSQLLAKL
FT                   NADDDSVIILQEEKKRPKPQKPVYESRKKPKTAGFGKSVPSREEMVECPICGEFMSAEE
FT                   LQGDHIDICLVGKDNKDEKEEDSKEDREHHESAQKVPEKDIVVTIPKDQDFQVQKAVDM
FT                   KRLAKLDFASLSTNKVKEKLAQLRLPTSGTRAQLEARYVEYSNLYNSNLDSANPKDSVV
FT                   LRDKLEQWEALSEIDNNKSNHTEKFNRSAWVKTHGNEFRELIQAAKKTHFSK"
FT   CDS_pept        517738..518319
FT                   /locus_tag="PAS_chr2-1_0275"
FT                   /product="Subunit of the RNA polymerase II mediator
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68889"
FT                   /db_xref="GOA:C4R065"
FT                   /db_xref="InterPro:IPR019364"
FT                   /db_xref="InterPro:IPR020178"
FT                   /db_xref="UniProtKB/TrEMBL:C4R065"
FT                   /protein_id="CAY68889.1"
FT                   /translation="MTDYSKVPINSLESLRLRLTQAMHSLNKLNDSIHQSQTLPQWSSI
FT                   QNQLTVILSQLTSLSTTLETQREILQYINVYPLPEFPSTTHEGLLTTLLRKKNIPEVSE
FT                   WITQSLEESKDKNPSASDQFATWCAETSAQESENWIFTGFRTKYEIDNDIPQAPEYSLR
FT                   ESTSTNVSQDEVSTDDLNKLIYMGIDPRKQ"
FT   CDS_pept        complement(518367..520607)
FT                   /locus_tag="PAS_chr2-1_0276"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68890"
FT                   /db_xref="InterPro:IPR024312"
FT                   /db_xref="UniProtKB/TrEMBL:C4R066"
FT                   /protein_id="CAY68890.1"
FT                   /translation="MDPFSSPSLAQAESFSPPKPNSNITFRKDPKRIDHGLTSKIEARH
FT                   THIHSHSHSHINANFQSKNHTLRRESFSELSKSKSPFQRNLQLSSPSQRMPLTVPRNDI
FT                   VNLPSGIHLGAKAKIQLKSPKTTVKEDNPFLESSPAKRKSLDSVQRLTKIPKLDKPDEE
FT                   TPMRPTKPNPASPATEQQSRIIDALGDGEDYPIIDNPSSPLLNHSKIQSFEEEASDNSP
FT                   GVFNKSAMLDELDEDRRETLVSVHAEDEINEGEVEEPEREGEEQQDSILNELDDNEESD
FT                   EYTHLEEEDFESLGEIISNIKSVHEGNVIALESRLNDRVEENETLALELNSANQQLIAL
FT                   KSQLANLESDKINNESQITALRLEIEALNLSLAKQDKYKGVISSLILQLKDTKLKYQDA
FT                   FDIVCFYQKKFETDSAHNESVLAELNAKKSLIDQNLEKIQAQSREIEQLKEIHNDHLDD
FT                   SSKEIQSWKEKVKEITEQLDTQLQHRDQLLQDAEAEIKKLKATQEKLEGSLNESLNNAD
FT                   SLRSQLADLVNEKAQQQSQFESLEQNVESLKKELQVKSIELDSYETNNKELKESLESLE
FT                   TRYNSKLESQSSKINELETSQQDKLTELEESYKISMAQKEERIKELEKQLVEKQTFFST
FT                   GAQKGLVSELQQKIDDLQRELSTHDEQAEQKLQQLAQDLYVQYSAKHEQKVSVLKKGYE
FT                   TKWSSKLNKVTEEKNTLKQEVQKLKQKLTSEREEKTRLVKLWDELVDMESSK"
FT   CDS_pept        join(520940..520957,521023..521727)
FT                   /locus_tag="PAS_chr2-1_0277"
FT                   /product="TFIIA large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68891"
FT                   /db_xref="GOA:C4R067"
FT                   /db_xref="InterPro:IPR004855"
FT                   /db_xref="InterPro:IPR009088"
FT                   /db_xref="UniProtKB/TrEMBL:C4R067"
FT                   /protein_id="CAY68891.1"
FT                   /translation="MSNSEAARLYESIIEEVTAESRQDFEDSGIDESTLQDLRKIWRNK
FT                   LSESGVAEFSWTQNTKEEFSQQQQQQQQQLRSGDLQSNFRHQIDPLAGIQDIQIPNDIQ
FT                   LPTITPKNEDSGLEFPGMGQTDGAGKSYNFELHIDATPEQVEHMRRRLGKRQVDGPGSD
FT                   NDNVNDSDDINSDLDDTDDDEINSDDDNDEQEDNIMLCLYDRVQRVRNKWKCNLRDGIV
FT                   NMDGRDYTFQKATGESEW"
FT   CDS_pept        complement(521798..523720)
FT                   /locus_tag="PAS_chr2-1_0278"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68892"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4R068"
FT                   /protein_id="CAY68892.1"
FT                   /translation="MYSRRIWLATKIRPLRPVLRSQIRCINPFLPVDILDEVTNDDENT
FT                   IREKRKLKRLQDLDEKIKNKKDGPINEYQTPQEEERNRERQKKENRQENWERFGSFLFR
FT                   CFETAGITFSSLAVLALSGYMYHKIYNSQVLSKINSAFDEGDPTLQLSMYKRTDNNKYW
FT                   VARPQQLLLDDIVNGKIKGRYFLLVGEKGTGKFSAILQSIRSVKGLNCTVVDGHSDPEI
FT                   FRIRLGQALNFGYHEDYIGSLFSIRGPRDTTALLDIERAFKKLEMVALKRVKSAEEGVQ
FT                   VKPLIVVINNTHLIKDDEEGNKLIELLQQKAESLSGSGLATMIFNSDDYWVYERMKQLS
FT                   TRLEVINFNDLGREDTIKVLKAARMKHYNVYLPLETANKIYDLIGGRPQHLALVSANKD
FT                   PLLTSHQIIDREKTWFLNQCGLLGGDMDDDVMESGKLSTSAMLLMRELVQMDREKFSLP
FT                   LQNDDKIDHVLPSLPLWRARQVMTRPDYIQLFDNLNIFTIDCNSRVHADSVPMMRAFHE
FT                   IASQPGFDELLNETIERVSEIESLGRTRELVAKDLLLGGHYTVQEDKNNKLNIKLHGGT
FT                   RDLLESANEDDPIKMEDFSDGAHKKWWSKRMSHYRDSYKPEEVAELGLTRNPEEQNSSV
FT                   ELSKS"
FT   CDS_pept        join(524046..524129,524231..525805)
FT                   /locus_tag="PAS_chr2-1_0279"
FT                   /product="Triacylglycerol lipase of the lipid particle,
FT                   responsible for all the TAG lipase activity of the lip"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68893"
FT                   /db_xref="GOA:C4R069"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021771"
FT                   /db_xref="UniProtKB/TrEMBL:C4R069"
FT                   /protein_id="CAY68893.1"
FT                   /translation="MPQPSRAKQQTLQIKFWLFGLEVSYFVVNYVPAPIWKLMVLIFDV
FT                   FMFWFRKVYDVLSGRSATSRYKQDLQNAQSLEEWSYVASRLDSISGGELWRQNFISNKY
FT                   DYKLISERLHSLRNARESKDFPHLLTLLRSSLLRNFGGIAEKELYTRAYSGTKTLIETY
FT                   VAEILKCLIFINDFEYKDDFTNTVNSFNQLKLDFFHDVRQTYGSTALILQGGSLFGLCH
FT                   IGVIKAMYFKGLLPRIISGSGVGAVVAAFVCCLIDDHLLSHLVTLSKQMANLPDEVLDK
FT                   RSGKVVENVVVRGFSEDTLNFMKYTKSTIKHLTFEEAYLSTGKVLNIMVHPTNSSAPFL
FT                   LNYITTPNVMIISALYCSMGSGVLVENAHLYVKDINGEIKPMDYPEPCIFMTPHEANTY
FT                   MGVTYTRLTELFNVNHFIVSLARPYLAALVGNGLRHSSTWYPKRVLRTVMGLELQHRID
FT                   MLNRSGLLFGFIKRLAVDDKTPTTSTSEITIVPHLRTLVKDFTRIFDVSRSNENIPYWI
FT                   LVGERSVWPLFPILWTRTAIEFTLDDLYNNQRKMR"
FT   CDS_pept        526185..530594
FT                   /locus_tag="PAS_chr2-1_0280"
FT                   /product="Plasma membrane ATP-binding cassette (ABC)
FT                   transporter, multidrug transporter involved in multidrug"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68894"
FT                   /db_xref="GOA:C4R070"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034001"
FT                   /db_xref="InterPro:IPR034003"
FT                   /db_xref="UniProtKB/TrEMBL:C4R070"
FT                   /protein_id="CAY68894.1"
FT                   /translation="MERDTHEADPAQPVLSHNNSSGDEVLSYRAEDEQAQLEGVNLDRL
FT                   QSLTKQMSHVTASEMATMVDLNDFDLTRILAVFAEKAEQRGLPIKSTAVELKDVSVLGV
FT                   NDSASLLPTVSDLLYLPSTIARKIRNRKPALRHILKGVDFHTVPGEMCLVLGRPGAGCS
FT                   SLLKTIAGETSHFVRVEGDIAYNNIPQAEMVKRFKNELIYNPELDLHFPHLTVEETLSF
FT                   ALACKTPRIRIDDISRKKHVDNWLKILLTVYGLGHTRNTIVGNDFVRGVSGGERKRVSI
FT                   AEAMAANGTVYCWDNATRGLDASTALEFTESVRATTNLEQTTSFVTLYQPSERIYELFD
FT                   KVLVLYEGRQIYFGPADAAKQFFVDMGYDCPPRQTTGEFLTAVTDPLQRYPRPGFENRV
FT                   PINADEFQEYWRASSTYSDLQNQFQETLKAGLSETTKETFLKAAANEKMKGVSDNSKYT
FT                   VNYFEQLRLCIVRGFQRIKGDINYTIVMVVSALIQGLVVGSLYWNTPENSSGVFGRAGV
FT                   IFFAILFFVLMSLAEIANIFKDRPVLAKQIGYSLYHPSTEVIANALIQIPVKFIASLFF
FT                   SIVVYFLANMKRQPGPFFAFLLFVNLGSQTMAALFNLVAAVSPTLAVANAFDGLLVLSS
FT                   VLYTSYMIQRPSMVPWFEWFSYMNPMLYAFESMLTNEFHGSIIDCSDVDLIPNGPGYED
FT                   YPDQYRSCAITGANGRTYVDGDTYLDLSFEYSYSHIWRNMGILFLFYVAFLVIHSVMSE
FT                   IMNMSTSTADRLIFLKANDLPVEVAAALNGSASSNDEETGQDTSLNEKYELERDKSEVK
FT                   VSDKLLGSDEVFTWKDVNYVIPYQGSERTLLDHVQGYVKPGTLTALMGESGAGKTTLLN
FT                   VLSQRIDVGVVTGDMLVNGNPVSASFKRRTGYVQQQDLHISELTVRESLIFAAKLRRPL
FT                   SVPVAEKIQYVDQVIEILQMTKYKDAVAGELGAGLNVEQRKKLSIATELVSKPDLLLFL
FT                   DEPTSGLDSQSSWAIVKLLRQLADAGQAILCTIHQPSATLFEQFDRLLLLRKGGQTVYF
FT                   GDIGENSSVITGYFERNGARKCSPAENPAEYILEVIGAGATASITENWFDVWIKSPESQ
FT                   EVSQEISTLVTRAGNSTSSVDDAAHLGTFATPWHYQYQLVLQRTAQQFFRDMEYFMAKF
FT                   MLLLSGGLLIGFSFWDVKHTIVGMQNAMFAVFSAMILSAPLSNQIQSKAIASRELYEAR
FT                   ESKSNTFHWSALLLSQFLVEIPYSVVFSTIFYICWYFPVQLDNAPERAGVWWLHYCIFF
FT                   QLYYISFALATVYFAPDLPTANVILSFLFNFIFAFCGVVQPVDMMPGFWTFMNKVSPYT
FT                   YFVQSFLGNVLHGREVHCAANEMTYIQPPSEQSCGEYLTPFIEEHTGYVANPGAFEDCG
FT                   FCKFAVGDQYLSTVGIKYSYGWRNVGFYWVYIVFNLSAMLFLYYMFKVRKQSIFAPIIG
FT                   LFGRKQKD"
FT   CDS_pept        complement(530639..531454)
FT                   /locus_tag="PAS_chr2-1_0281"
FT                   /product="Subunit of Elongator complex, which is required
FT                   for modification of wobble nucleosides in tRNA"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68895"
FT                   /db_xref="UniProtKB/TrEMBL:C4R071"
FT                   /protein_id="CAY68895.1"
FT                   /translation="MSHQAQDFSLFRSGEVIPQALIDSQAFRSCFTYTDTQGTSSSWLT
FT                   TCFVENLIFGTCNINKDANSFKTSNFSLKNPRSRVVIVSFLHGISFYNKTWVKYLGVES
FT                   SFQGDENLSFFDLSTAEAPVDKLFKPVIAALKSSALPCTLILDHPELYFLTNQCSINEF
FT                   MSQISYINSLANVLVSTFADANLIDLNETDSSTITHRQTEFLTKLYHRSQGIISIRPLE
FT                   TGRADDVTGTITVSKGSISFEDEAKNLETNEQQYLYLVNKEGFVKVFFR"
FT   CDS_pept        531600..532940
FT                   /locus_tag="PAS_chr2-1_0282"
FT                   /product="Cytosolic ribosome-associated chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68896"
FT                   /db_xref="GOA:C4R072"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C4R072"
FT                   /protein_id="CAY68896.1"
FT                   /translation="MSLTLPALPSSVSTAASLGKYTAAVRKPIEPVGRHFLALYLWGHT
FT                   WSEFEKIQAETDVKKAEDVNEDAEFDIEQSEELIEHDPRDWKSADLYAVLGLNNYRYKA
FT                   TEDQIRRAYRVQVLKHHPDKMGEKGGLDKDGFFKIIQKAHETLMDPVKRQQFDSVDEEA
FT                   NIEPPAPKSKYDFFEAWGPLFASEGRFSKKQPVPELGNADTPKEEVDAFYKFFSNLDSW
FT                   RTFEFLDEDVPDDTSNRYHKRMIEKKNKAARQKRKTEDNKRLSELVRRAANEDPRLKAF
FT                   RDKEKEEKNKKKQEREAEAAKAAEEVKAKREAVERARAEAAKARAKSKAKPSYQPIQTQ
FT                   SKGKGKGKGKGKGKKSTVSKEQRTESKINIRNSVKDANYFGTELQSEIDHDINVFLDNF
FT                   EDEKSVEVSNAIAGATADAVKEIFDAAAKEYIEQGFITADDLKFFAK"
FT   CDS_pept        complement(533607..534428)
FT                   /locus_tag="PAS_chr2-1_0283"
FT                   /product="Putative tRNA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68897"
FT                   /db_xref="GOA:C4R073"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR040183"
FT                   /db_xref="UniProtKB/TrEMBL:C4R073"
FT                   /protein_id="CAY68897.1"
FT                   /translation="MKRKQNGQGKDRKKRYKPGANGIVEPGQYGIFATCVRGKERACLS
FT                   ELTELVLDKVDEYYGEDFYKQQKDEDENKEGETNEQEGKDESAVSIEESIRQELQEMGE
FT                   TKKGNTILINGVELGTECFVFVKMKKPLIPSQFATKLVQELFDNRRKATKFTLRLSPVD
FT                   GSCSGTLPELTKLAQRLLKPHFHQDKEVQKPLKFAIQVNRRNFSVLEKLDVIKTVASCV
FT                   GNEGGHKVDLKDYDVLILVECFKNNISMSVLDGKIYDKCKRFNLQEVLNVK"
FT   CDS_pept        complement(534510..535766)
FT                   /locus_tag="PAS_chr2-1_0284"
FT                   /product="Subunit of Elongator complex, which is required
FT                   for modification of wobble nucleosides in tRNA"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68898"
FT                   /db_xref="GOA:C4R074"
FT                   /db_xref="InterPro:IPR008728"
FT                   /db_xref="UniProtKB/TrEMBL:C4R074"
FT                   /protein_id="CAY68898.1"
FT                   /translation="MSFRRRQEVIGGAPSAPSPGVNSSRNPVLGAPSRGPLSPPSRAPL
FT                   RNTPHVNPTGPSPGLHNRASNNDMLTQHPGIRPSTITSQPTLSTGSADLDRLLAHQGLP
FT                   LGNSLLIEENGTTDFSSVLLKVYAAQGIVHNRTAGKLNTHVIVIGSDQHWGRQLPGLYR
FT                   GSSKEQKKNKVATNESKVTVGNINDSNLKIAWRYGLKKDSPSEELSDPSQTYPNYQHAF
FT                   DITSSLLPAPAANEMSFVPLNVPDYSKVMLHIQRIISQHQGKLIRIVLQSFLNPAMYPP
FT                   QLIQHNQSLNFIKSLRHLLHNSPNISLVSSVNLDLYPRHNALVTMIEMLFDGVIELKPF
FT                   PPELVQMMERIYKNQPAKIKQGFLNVLKLPVLSESGLMVIKEIEYCFKNGKKKFEIEEW
FT                   SIPIDEEEEERSTTKDIEF"
FT   CDS_pept        join(535903..537543,537585..538352)
FT                   /locus_tag="PAS_chr2-1_0285"
FT                   /product="Mitochondrial integral membrane protein involved
FT                   in mitochondrial fusion and maintenanceof the mitoc"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68899"
FT                   /db_xref="GOA:C4R075"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030381"
FT                   /db_xref="UniProtKB/TrEMBL:C4R075"
FT                   /protein_id="CAY68899.1"
FT                   /translation="MVDKTTPEDNKTVVNLDLDDKDSKNEHHSNGNAPTQLIFNGRDLE
FT                   GSTLVDGQHHHKIPPTMEGNSLTQDIDSHVQQLKYNDNRVALDRAINALVDILRQMVEE
FT                   NKSRPVLYPTTDNDLNVLKLNIKMEHSTVEDYSRLNKDSLAHLLSEKVTNVIRHLFSLK
FT                   DRIDDTASKVFVTGDLNSGKSTFCNALLRRKILPEDQQPCTNVFCEVIDPRDNNGLEEV
FT                   HAVPIGVTYNIRDESTYQIFPISELESLVYKSSLYSILKIYVHDQRPIEQSLLKNGVVD
FT                   ISLIDAPGLNLDSYQTTQVFSRQEEIDLVVFVVNAADLFTLSGREFITAAANEKNLIFI
FT                   VINKFDCIRDKQRCKERILNQISELSPQTHKDASEFVHFVSSEEVVNGLPGPSDDGDEN
FT                   NGPDNSGRPDPDFDHLEASLRKFVLEKRAVSKLLPAKTYLINLLDDLDTVFKLNERLYK
FT                   ENRNLLLSQLDEITPQYEKAMSSSSKISGHIDRLIETTATECYNFTRDAIKNTIDNIED
FT                   TPLIAFPGLNDMYRFTKETRMALVEKVLGSTFEIIRDVGRKALDDDNLLADKSLRDDYM
FT                   FTSKKHHQLRRVIDEEISIKDFFDPSYERFMQAIGLSGTFSSVSNTSSPSWWVLSGKQG
FT                   QIWKNSLSAVAVYSSTKIFHNGLFMVKNFVSIRDVFNWRFLQNVVTPLSIGMAIVSVSY
FT                   LVYDIPTAFQRKSIQRIKRHLGSTDYIHNNSSRVSKECTKVLNYASREVMNSFRTSIDT
FT                   TAAKKDKIISQLKDSEQSVQFYHRLFRSIRTQGEIVRGIKIDNFYSSVD"
FT   CDS_pept        538527..539465
FT                   /locus_tag="PAS_chr2-1_0287"
FT                   /product="Protein localized to COPII-coated vesicles"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68900"
FT                   /db_xref="GOA:C4R076"
FT                   /db_xref="InterPro:IPR002995"
FT                   /db_xref="UniProtKB/TrEMBL:C4R076"
FT                   /protein_id="CAY68900.1"
FT                   /translation="MSYRPQFQQNQGGPPYQHLGAPYQSYSTQQPSPNSLNGFFNQFET
FT                   ISNKIEEIVDKYTKPLKPFMPAIARFFIVATFYEDSLRLVGQWTEQVYYLHVYRRYWGW
FT                   FVKLFLTTNIIVMLVGSTLLIARKRSEIASSFLVAVVFFQGIVYGLFFDLGYFLRNVSV
FT                   IGGLLLAFSDSIVRDKRNLSMPGLPLMEHKDNKKYFLLAGRIMLILLFATFAFNSNWSL
FT                   GRILVVLVGFITSISIVVGYKTKFAAIVLTLMLMTYNVIVNHYWSFGYKDSRRDFLKYE
FT                   FFQTLSIVGGLLIIVSTGAGELSFDEKKKIY"
FT   CDS_pept        539591..540199
FT                   /locus_tag="PAS_chr2-1_0288"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68901"
FT                   /db_xref="GOA:C4R077"
FT                   /db_xref="InterPro:IPR007062"
FT                   /db_xref="UniProtKB/TrEMBL:C4R077"
FT                   /protein_id="CAY68901.1"
FT                   /translation="MTNKPRGILRNAPQDTNYDENAKVDEEFDRKKVLENTNINAKLFK
FT                   DAADAAQTKGDKIRQKLKEKKQQLEEEHLKWNEANLYMNEQEKCATMKIDEPKTPYEGG
FT                   VDPTGEYYQDDEEELDNFALGEPEFTVPKEEQEPFEPSEPSEPSSEDSETEHAPKETAQ
FT                   QKHKRFEEMRKQHYHLKGSVLGKPLSVSDEEEDETEESK"
FT   CDS_pept        complement(540321..540902)
FT                   /locus_tag="PAS_chr2-1_0289"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68902"
FT                   /db_xref="UniProtKB/TrEMBL:C4R078"
FT                   /protein_id="CAY68902.1"
FT                   /translation="MFYQDSIQSDDKETLRTSPLLYQFNDVKKVFDDIKISSKNLFKIY
FT                   ASKDSETFYDVWRINGDVPERSNTFYSQFPRKPSNLDTEHHYEYVHLNHYYIGRWLPDW
FT                   VLTLLFPMNSGVKLTGKGVPTRNECVKCQSLNGRLTWDKSGNWSCVDDTFVNNGEFFES
FT                   YREFLRWRGNHEKEGVYEHQTVPYTFIIRT"
FT   CDS_pept        complement(541229..541633)
FT                   /locus_tag="PAS_chr2-1_0290"
FT                   /product="Late endosomal protein involved in late endosome
FT                   to vacuole trafficking"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68903"
FT                   /db_xref="GOA:C4R079"
FT                   /db_xref="InterPro:IPR007262"
FT                   /db_xref="UniProtKB/TrEMBL:C4R079"
FT                   /protein_id="CAY68903.1"
FT                   /translation="MKINPLTKIISLATVLAAGFLLIVLAGAIYGNWSPVAIALVFAFA
FT                   HLPIAISNQLNVNFDDFLNESTAYALDFGKFLSAFLFVSGVALPILLFHSHILQFPAMI
FT                   LTLSGGILIYGTVFTFTEFFDAREDDVFDV"
FT   CDS_pept        join(541861..541863,541916..542746)
FT                   /locus_tag="PAS_chr2-1_0291"
FT                   /product="Alpha 6 subunit of the 20S proteasome"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68904"
FT                   /db_xref="GOA:C4R080"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035144"
FT                   /db_xref="UniProtKB/TrEMBL:C4R080"
FT                   /protein_id="CAY68904.1"
FT                   /translation="MFRNNYDNDSVTYSPTGRLFQVEYALEAIKQGSATVGLVSKTHVV
FT                   LVALKRNAEELGSYQKKIIEIDDHMGIALAGLAPDARVLSNYLRQQAMNSKMVFNRPLS
FT                   ITKAAFSIADKAQENTQQYGGRPYGVGLLVGGVDETGPHLFEFQPSGSVLEYHGAALGA
FT                   RSQAGRTLLERSLEEIKTASRQELIKLGLLALRDTLAQDKELTAANTSVSVVGIDEKFT
FT                   LYDDEDVQQWLDLLDSTANSRNRDTHDAPEDDNDNTTAPDAGVDTEGDVPVQDAD"
FT   CDS_pept        complement(542787..543392)
FT                   /locus_tag="PAS_chr2-1_0292"
FT                   /product="Ureidoglycolate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68905"
FT                   /db_xref="GOA:C4R081"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/TrEMBL:C4R081"
FT                   /protein_id="CAY68905.1"
FT                   /translation="MVYIHKSSAKTTIPTQPLTPASFKPFGSIICTDQQLDHPHKSAAN
FT                   QGTAIKLFQVSQIVNNYSSCPSGNPATINWNIFRCTVPNTLTKSDQGNRVYTGKVLERH
FT                   PYTTQTFLPMGISKEKDTYMVICALNDETTDQKLPDLSTLTAFICKGNQAVTYGAGVWH
FT                   APMIVLNETVDFAVLVHENDQPQENCEEVEYEGLQVLI"
FT   CDS_pept        543803..544252
FT                   /locus_tag="PAS_chr2-1_0293"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68906"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:C4R082"
FT                   /protein_id="CAY68906.1"
FT                   /translation="MPSGTSHWEQVEFSFKKHQKGCHLVTSEVLSKIPQLKDYTIGTLT
FT                   VFIKHTSAALTLNENCDPSVRVDMHNTLARIAPEDERLYTHNDEGPDDMPGHVKSSLLG
FT                   ASVTIPITNGRLNTGTWQGIWLCEFRDEVYRGRTAVATINGLKAK"
FT   CDS_pept        544698..546158
FT                   /locus_tag="PAS_chr2-1_0294"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68907"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:C4R083"
FT                   /protein_id="CAY68907.1"
FT                   /translation="MNLPIEIWSLISDHLDGNDLIKTRMTNHCMWQKLQDNELWRPKLE
FT                   DFYSLNKDCEYQQYQDKGQLFQLYAKKRSIKSQLKGWLLNLCNGTGQLKDFQYWRNDLV
FT                   PIFLQLQNEFQDIERLTERFFISNCLQVHRYSIFYQLLLSVCQKKKDLLLEDVFIAFHA
FT                   LHDSFYDNFKRRNQVYKRLTKSQIVEKNFLSNTQVVLTILQALRRSNLTLLHPLELSAM
FT                   AQKACLQLGIKTTIHKMFLEVSDPTYKSGSSFLYISKDQVLSYSRENMFRLLARRSINF
FT                   TDLEVSIPQFIERLCYHLNLSPFVVSLYRIFCQNDCSYFEFQTHKTIVGDFLRKQFQLH
FT                   LPVLQNLFPNFQDFGVVELDISSLQKDYVTCLYSYLYLTNQHSSTQFPIGSVIKTRNNE
FT                   SAAIIGNKVQRDFVGTNKVVIYYHCLTNKNAPVICQEGSIIRQKVEDVNELFPNLDELG
FT                   CFFKRYDKSSGMFVPNIYLERYLHISVK"
FT   CDS_pept        546255..546698
FT                   /locus_tag="PAS_chr2-1_0823"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0823"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68908"
FT                   /db_xref="UniProtKB/TrEMBL:C4R084"
FT                   /protein_id="CAY68908.1"
FT                   /translation="MSTLESQLKSTDGSVLVKTSTGKIKVRKGQTEEAFLEQKQQFLET
FT                   GPQINDYNWLIEDYDKRLEKFTQLAPEERKGKHFFDPLNKVDTEKIIRCLNLLYYEKRY
FT                   DECLQRCHFLIGIEDADIEKNKKFQLFKSDVASIKSACELKSS"
FT   CDS_pept        complement(546769..547137)
FT                   /locus_tag="PAS_chr2-1_0295"
FT                   /product="Subunit of both RNase MRP"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68909"
FT                   /db_xref="GOA:C4R085"
FT                   /db_xref="InterPro:IPR014612"
FT                   /db_xref="InterPro:IPR020241"
FT                   /db_xref="InterPro:IPR036882"
FT                   /db_xref="UniProtKB/TrEMBL:C4R085"
FT                   /protein_id="CAY68909.1"
FT                   /translation="MKRERIDGTLIKHPPMRKYKVTEEKNTFFVKSSTLYVSAIKQISK
FT                   KVEKLNATQAKNKVFIVKGMGKSIPKVLSIGVYFQLKNYRVEVFTGSVKVLDEFEKEDD
FT                   DSILSKRTVSSVEVRIIL"
FT   CDS_pept        547302..547787
FT                   /locus_tag="PAS_chr2-1_0296"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68910"
FT                   /db_xref="GOA:C4R086"
FT                   /db_xref="InterPro:IPR009445"
FT                   /db_xref="UniProtKB/TrEMBL:C4R086"
FT                   /protein_id="CAY68910.1"
FT                   /translation="MFPPTLLELKANKPTTMMLASPPSLIPQQGIEKAKPKSVNLQLNK
FT                   LKYKKAWELAYSPAKNIPMNLIMMYFSPNSLQIISIMMTINLFTTPLKDIFNCNEIFEK
FT                   SVDVSVIDTYDLIMMKLFFIVCHFGTLLVGMWKLNNMGIIPTKADFIGSINNTLETI"
FT   CDS_pept        complement(547796..550216)
FT                   /locus_tag="PAS_chr2-1_0297"
FT                   /product="Essential 113kDa subunit of the exocyst complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68911"
FT                   /db_xref="GOA:C4R087"
FT                   /db_xref="InterPro:IPR007225"
FT                   /db_xref="UniProtKB/TrEMBL:C4R087"
FT                   /protein_id="CAY68911.1"
FT                   /translation="MLTHSNEVSKESLLLHSLSSDDYIENIGPIIRTAIKNNGLDNLIE
FT                   TLQETVCDKEQQLQEVSVKGSSDIKLAVGSIIEVKKISDDLRYKVLEINDDLESTGKVL
FT                   NEKNKVSIKYKKLYNKINETIFVLKSCLQILELTNKIIDLIGKKSFYHALKNLQDLVNI
FT                   HLNEIETFEFTKKIISSVPTLHKMIKEDSFSFVKKWLGNLERHFHTIGDDCFQQLQALN
FT                   SYWAETRSQNPILAQYSINSPIELSVRPDKFKTFDPFSLNNITLDSVYDSMMVYDTINE
FT                   LDELKEQFKKEWLIKKDRLVYPMYNSNPSQEMFLDRNQLRDFIYSLIGLLVCDRLIGVK
FT                   THFKLRSSNESREMFVTICKRLVPILKKHVDEKITTLDDIIFFKKLICCSIQILEQCDY
FT                   PIENLYSILLCILQRYMKIITNNFKIELVKNMNADDSMPLVVKDMESYKSISIISWYRH
FT                   TPSNNRFPKQLPFSSIYPMTCLQIQNLIKEVNEFIDDFYSYQGREILRITIETIDSVLN
FT                   NIVIKNLRHKIESTIKEVIAQNLINLEFFSTSVREIENLLSYSSESRSIDSIHLTAYDN
FT                   FLATRKLAEDKLFEMVDTKVEDLLDFVDYNWRTKEQNPEPNIFIKDIGQFLQMMFTSTF
FT                   SNLPRTVKSLLLLRTFDLLSSYFLDFLKRSSLFTKEAIYNFDMDITYIESIINELNGQN
FT                   QNQPADEDEEKSIEEHSIPTSVSLQSTFIELRQLINLLKSGTLDEFREQSIRMRKYDRI
FT                   KPEDAISAIHKLEREPEIGEEANELQQNSAIASISGSGRFARFGYKFKKSTAG"
FT   CDS_pept        550402..550995
FT                   /locus_tag="PAS_chr2-1_0298"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68912"
FT                   /db_xref="GOA:C4R088"
FT                   /db_xref="InterPro:IPR034627"
FT                   /db_xref="UniProtKB/TrEMBL:C4R088"
FT                   /protein_id="CAY68912.1"
FT                   /translation="MNRVIIVGQKKTAKIALLRSLFEGVTERSDGDDNSGLILSNVPLS
FT                   TRYYSCNLDFMVDEYDDSKEWEDWCEEILSVEALELREAINGIIFIFDFSSKSILQDLT
FT                   KLSKVYDQIEQDFLLRNKDSIQWEGIKLAVGFSRSPVAQQLLDEVYDASLEKGIELVDL
FT                   SIASQENAYGEATGIRRVKEILETCSWPDVVKLR"
FT   CDS_pept        join(551196..551246,551294..551737)
FT                   /locus_tag="PAS_chr2-1_0824"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0824"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68913"
FT                   /db_xref="UniProtKB/TrEMBL:C4R089"
FT                   /protein_id="CAY68913.1"
FT                   /translation="MIRTFVRNISYKPQPQLFIHELPSLNKAKLSFHENPNKLEVGIIN
FT                   NVQGKSLENLKILPKDFEENKEFLSKLQEIIKNNIQNDFAFIVEAGAYPSSHLPIYDFR
FT                   LPPSHGRIPEVENVFGYVKVSDDGVIEPGSYQSNNMYRLLSGTDGPINLSDYLLEQIQN
FT                   S"
FT   CDS_pept        complement(551747..553456)
FT                   /locus_tag="PAS_chr2-1_0299"
FT                   /product="Protein involved in proteasome-dependent
FT                   catabolite degradation of fructose-1,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68914"
FT                   /db_xref="GOA:C4R090"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR006595"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR024964"
FT                   /db_xref="UniProtKB/TrEMBL:C4R090"
FT                   /protein_id="CAY68914.1"
FT                   /translation="MSLGNDRESKRFCVPSYLRKLKKGKELLQKSTSITESDNGIERTQ
FT                   QFTQNLAKFGILGNNPSQLMQNEDYTSHLVNLFQERQQVAGNPPLSNTDSSSANGTSNA
FT                   NDDEELINEIDSPMEKMVYEELMYKKDSVAMLPTTWNIPGTSTFTESENGLNLSTNFDP
FT                   IENPRAHSATSNNGRSATRADMSVPVDCGIYYYEIEILVGLREADISLGYLQYGEDSSS
FT                   ANISNAPGFENGTYGYNGKEGQILNLSNSIHTKYGTTFGLNDTMGCGINYYTETIFYTK
FT                   NGVFLGDAFYGISSTRAHYPIVGMGVGNQIRTNFGFTGNFLFDIDNYVQDFYRSCLKYM
FT                   TSSNTLDFNALNCDLQELKIPAVLSKDPSYCLNKLIHSHFERNGWQDCVDDLREDTSLE
FT                   FEQSNTAYPKIGARGKIKSLIESGEIDEAIANIKQHFPQLVSSVSLSFNLMLLKLINLV
FT                   KKDNVNGIIAYSKELFSKFDTIPQFDRRIKNVLTLIAFKDPMDSNYSCLLDPIENYKVS
FT                   ELFNRLAIASVSNNQVNPKEPFNEIRLKALEKLNKLDNHTRILGDKDEFFDF"
FT   CDS_pept        554946..561179
FT                   /locus_tag="PAS_chr2-1_0301"
FT                   /product="Voltage-gated high-affinity calcium channel"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68915"
FT                   /db_xref="GOA:C4R091"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="UniProtKB/TrEMBL:C4R091"
FT                   /protein_id="CAY68915.1"
FT                   /translation="MTDKHRKNNSFESGGAISSSSSLNSRGSSTTRHNAGNQDIPHVSI
FT                   DDTDSGRESRSPRRFQKQISPFRSPRLGFLNNLHSPKLKTKFEPAYHELEDQDDGNDND
FT                   VSRTMPTLRIDTEYSETGSNPFLVADEQPKSPSGSFLHSPILENAQSSDVLNTGLELAL
FT                   GERLGKGAWLPTAENADETQDQDFTNYQEHSIPDDGSQAQKYDQSSSLSPYENIEMASL
FT                   NSKLSNIETRVESNSSKPSSPKLDTSPKKVTSAVRRLSLRVSGKDDLEESQNMRTSGDM
FT                   PQIYLSDTSDSNDYLQPAVSKSDFLSVHPESTRGSFLPTDGKQDGLSSIGSAKEEVQKH
FT                   EDEHEEICLFGSTLRLFDNDSRVRQRCAKIVMHKYFDPVVVFLIFLVTVLLSYQLWIPE
FT                   VRGYHHAEEYTSVDWVLVFIYVLFTIETVLKIITFGLVDDSQMYEALNITMKTNQFWLF
FT                   WDRWDWKKLQFKSQTSSYRKTMSEPSEKFSHSSTKLNRAYLRVSWNRIDFVSVFAFWIS
FT                   LFLSINHYDLRNGIFIFRSLMCLKILRLVNLTHGTFTILKALKEAIPELIDVILFLVCF
FT                   WSFFAILGVQCFKASFRRQCVWTNPADPTDTFVNEMQFCGSYLDNGRTMPYIYSNGESS
FT                   GIAKGYRCPQNSVCVSDVNPYGGVLSFDNIAHSFEIVFVIMSANTFTDLMYYVIDSENL
FT                   AASLFFIVTLFTLTVWLVNLIIAVIVHSFMRIKDNIKAQNKSRNADRLLISKTCKKQHE
FT                   TYSKTKRILYYSKFEPLFCLLIVCNIAIRAKFDNASIVYRFDCAVTIVLLLEIIARFCI
FT                   FLPKWRIFFYSYANVIDLLLAVITALIIIPPIRTNLNIAYDWLSFFFLFRIYRVVMMIS
FT                   YIKMTWYRIIVNLQSIIDLSIFYFVLLFLVSIIVTRLTEGILPEEEIEENMLTLYNLPN
FT                   SFISLYIITTTEDWTSILYLVQQYSPNTSTAVFVACYLIFWFFFSNMLIFNIFIAVIAK
FT                   SLEVSEMDKRKLQITSFYNKLKRHLNEQKYTGLLSSFKRKFTKKSDYKDKEEFDEALLL
FT                   LLLNGKLNEYLMVNAAQKPESNRIYNYISKFSFVQKIEKFLTSCFQNPFYNFDSFHNGY
FT                   KKRDDLTFAEASQFLMDQKQLLANERTKYLKENPFYNTSLYIFAPNNKLRMKCQRIVRP
FT                   TNGKRIEGVQPNEKLKDTFLFVSFLVTIMMVVSVCIVTPLYRREYAFYSSDWGWPTYLD
FT                   CAFTIFFTLEFIVSVIADGLAFTPHAYLRSPWNCIDAAVLITLWINFISELQHSGPASR
FT                   VVNGFRALRAFRLLTLSSTAKETFQNTMISGFWKILNAAVVSMTLLVPFSIWGMSIFKH
FT                   RLGYCNDEESTMAECMDEFANEVFNWEVLSPRVYVEPPLYLDDFVTSFKSLYEIISLEG
FT                   WVDLLEDVMNITGLGLPPSHFADPFNGLFVVLFNFCSTVFILTLFVSVIISNYSKNTGT
FT                   AYLTEEQKSWYEIEKVLGTVKPSKRRDASRFGPVTRWSYRLVVERNVYWKAFLNTCLFV
FT                   HTIALFCEIYPSPAMLNDFRYAAYLICSIAFTINVILTMVAIGPKDFFTSRWNLFKTVV
FT                   VIGALLTSAIAYDLPRNTVFANINKLFLISLLFFVIPRSDRLNQLLKFASASLPALLSL
FT                   AYTWGVLFLVYAIAMNQIFGLTRTNENSSNNVNFRTVPKALILLFRMSFGEGWNYVMND
FT                   FAVEAPFCFYSSNVYDSDCGSKSYAYFLFMTWNILSMYIFVNMFISLVVDSFSYVYRSS
FT                   GPLSNVTRGELRLFKQAWLPFDQRGTGYISEERLMSFLRKPKGVFSYHIYDERYSVTTL
FT                   SKRWFVQHNASDPYDVFIDYGAMSTDITHLSQMRLKTQNRIQTYERMVEYFRLINRRNN
FT                   FKGIDFTSTIRRLALVTLFEESSCLKLEDFLTHFMTNQKCDLAIKEKRVIETLKMVICR
FT                   WKFKMKDYDALRSMVLEDELNTAFIKQEFIPTESENPFEETESNKLQGEYPKPDIQAQP
FT                   YPKFDYHNTFDRYDPYNYASYGYRGDEHGFSQDIRLRNLTTSNDETTVNPFVHTSVEAD
FT                   ENDSDKKTTTSVKETELASRTSSSST"
FT   CDS_pept        complement(561226..563451)
FT                   /locus_tag="PAS_chr2-1_0302"
FT                   /product="Putative catalytic subunit of a class II histone
FT                   deacetylase complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68916"
FT                   /db_xref="GOA:C4R092"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR017321"
FT                   /db_xref="InterPro:IPR019154"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:C4R092"
FT                   /protein_id="CAY68916.1"
FT                   /translation="MEILKEEATESNGKRKLEEESDALQLSKQEGEGHLSGLPPSGKWD
FT                   DNQIVNGSVIVPVVEPKLRYITLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR
FT                   IYKILAENGLITDPTLSGIDQIGDYMLKIPVREATAEEILLVHSEEHLKFIESTSSMSR
FT                   ERLLEETEKGDSVYFNHDSLLSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPD
FT                   SPGGFCLFSNVAVAAKNILRNYPESVRKIVVLDWDVHHGNGTQKAFWEDPRVLYISLHR
FT                   YEQGKYYPGTKAGGADQCGENEGLGKNINIPWPVGGMNDADYLYAFRKVVMPVCREYAP
FT                   DLLIISSGFDAAEGDIIGGCHISPAGYSQMTHMLKSLARGNVCVVLEGGYNLDSIANSA
FT                   LSVTKVLLGESPEEPKVTVPSAHAIEVIDDVIKIQSQYWKTLQPAYTGICFTNPSIMGN
FT                   YSLLVNPATEKKVLSDLAVNPRLCDAVRNSQAQYLSSKFGFINLPVVSGKGLTSPSLDN
FT                   QVLSTKDIFQANTIIIVIHDPSDVWARQDPRSGLLDLSGSMIVDTSSKFVEWAVNLKYG
FT                   VIDINVPLTLTGKDDETYNNVTASQELLLYIWDNYIQYFPVTKIALVGFGDAYNGVIHL
FT                   CGHREVRSIVKASINFLDRTPLRAIVSSIDESVTDWFYKNSLVFTSTRHPCWGEQGTSE
FT                   MKRPRKKYGRVLKADIDGLPNIVDERFEETTDFILDSIEEYEDESSN"
FT   CDS_pept        complement(563827..566202)
FT                   /locus_tag="PAS_chr2-1_0825"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0825"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68917"
FT                   /db_xref="GOA:C4R093"
FT                   /db_xref="InterPro:IPR007365"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR036757"
FT                   /db_xref="InterPro:IPR039373"
FT                   /db_xref="UniProtKB/TrEMBL:C4R093"
FT                   /protein_id="CAY68917.1"
FT                   /translation="MSYQQLAGEDPPRLPPDYNDIERFNIEEPESEQERRSLREVTRDM
FT                   ADQLNSKLVIPITRVLDPVYEYYSIASMKFDSYLAKVGNPLIVKRLFFVFLVALLMYVI
FT                   TITGLYDNAYGSYTGEFRSNDALFAFLDEQVSGAQLEEQLEYISSMPHAAGTAGGLSLA
FT                   RYVDKFIADCGLDLRDFFEVRPFINYPNEVSLKLYNEKEEEKFTAKLKERGIKEEGGDD
FT                   MQLISFNYNSMYGEHRGNLVYANYGLSRDFNYLKDKNIELKDSVLLIRNGVVPAFQKVQ
FT                   YAEVFGCKGVIFISDPDSSSGYDMFSIEREDVGVSNFAPGDILSPGFSTAKSDHQYHWD
FT                   DSPGTSRIVTIPISWADAIPLLKSLDNVGEKVPESWNLNIKGEKIATFTGGSTKSQVHI
FT                   VNHPIMKEQKSIWNVLGKIQGREQDEEAIVIGAQRDSSCFGACESGTSTSILLSLIRIF
FT                   GEMSRRLNWKPLRSIYFASFDGTNFNMAGSTEWVEARSRELRRQAYCYIDLSDAITGNQ
FT                   LDIKSHPLLKTAIESALFQVTDPISNETFSQLKTKISPLDGLKRNYIPFTSYEAIPSLD
FT                   IGFRSPEGYPKGSCLDSFERFKEKQVDPDMQYHETLVKIIGRIMIHLTNEPSIPFDFGA
FT                   YANELAGIKEDVNRYYKDVLGDANTLNFQSLDSSLGQLRHVSDQLSEWITGWSNDVGLS
FT                   GGLESTLLAINRWTWNNRQSLFEKKLRSNYGIPRRPWFKNLIYGQQYIIPDHPENYLYS
FT                   TFPGVRDAIYNKDAESAQQQLEDIAKSLSNVCEDFLSR"
FT   CDS_pept        566442..567752
FT                   /locus_tag="PAS_chr2-1_0303"
FT                   /product="UDP-GlcNAc-binding and catalytic subunit of the
FT                   enzyme that mediates the first step in GPI synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68918"
FT                   /db_xref="GOA:C4R094"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR013234"
FT                   /db_xref="InterPro:IPR039507"
FT                   /db_xref="UniProtKB/TrEMBL:C4R094"
FT                   /protein_id="CAY68918.1"
FT                   /translation="MNIAMVSDFFYPQPGGVELHMYHLSQKLIDRGHSVVVITHSYGGR
FT                   TGVRVLTNGLKVYYIPFAVVMMQCTLPAVFSAFPILRNIFIRENIEIVHGHGSLSFLCL
FT                   EAIMHAKTMGLKTIFTDHSLFGFATVSSIVGNKLLTFTLTEIGHVICVSHTCKENTVLR
FT                   SSLDPNKASVIPNAVVASDFTPEPNFRDENTITIVIISRLFPNKGADLLTAIIPRICAY
FT                   HEKIRFIIAGDGPKFIDFEQMVEKYQLQDKVQLIGSIKHEEVRNVMVKGHIYLHASLTE
FT                   AFGTVLVEAASCGLFVVTTNVGGIPEVLPNHMTAYALPEEESIVSALTSAIDKISAGKI
FT                   HTSGFHNQVKEMYDWRDVAQRTELVYINVKRTTKPTTTLERIKKYYIHGFWGGKLFVLC
FT                   LVVDIFILTVLDFWYPRDKIDRAAKWPHGQKYAKPQS"
FT   CDS_pept        complement(570082..572415)
FT                   /locus_tag="PAS_chr2-1_0304"
FT                   /product="Kex2 proprotein convertase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68919"
FT                   /db_xref="GOA:C4R095"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034182"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C4R095"
FT                   /protein_id="CAY68919.1"
FT                   /translation="MYLPALRLACWILIGLRSTEALETSEREIFALKLDKSWLPTFLET
FT                   FQDKFRYERQINGLDDYHVFSHSKNEEFQLENFKVKTLLTRDNANLHSELISHNVDEVH
FT                   MLRPSHYLHKRAPVVMDKSEELREQIAKDFDIDDPLFAKQWHLFNPRYPGHDVNVSQVW
FT                   YDGITGKGVVTAIVDDGLDMDSKDLKESFCEEGSWDFNANTRLPKPRLRDDHHGTRCAA
FT                   EIAAKKGNKYCGVGVAYDSKVSGIRILSDKITPEDEALSLIYGLDVNDIYSCSWGPADN
FT                   GITMQGPSSLVKEAMLKGVQDGRKGKGALYVFASGNGASSGDNCNFDGYTNSIYSITVG
FT                   AIDIKGLHPPYAEACSAVMTVTYSSGSGEHIHTTDINDKCSDTHGGTSAAAPLAAGLYS
FT                   LVYQANPDLTWRDIQWLTVLTAVPVNEQEPGWQKTAIGKMYSHKYGYGKIDAYALVNLA
FT                   RSPDFPYLKPQSWIYGTEVHESLNTSEANGVLTSKYELTQEAKDLMNFEKIEHVTVTVD
FT                   IKAAERGKVLVELISPSGVVSELAPYRRMDKDKEGFPNWTFMSVAHWGEDGLGEWILKI
FT                   TNKEGNSVVLNSWQIKFFGESQDPEKAEKFSLTKKYDEILVNPPSSSTSTTVDTSSTEA
FT                   TFSSSSVSEASATETDVKETSTTGDEDFENEEGSYKHSNSSHITEYLAFLLGLGFLICI
FT                   IFLFTNRNKLERRQRRNRRDEYEFDLIPADDDFDTEEDQEANSQFTLDSDAELMFEDTS
FT                   QREASPHEYQDSLGSNEHPKRAAL"
FT   CDS_pept        572844..574355
FT                   /locus_tag="PAS_chr2-1_0305"
FT                   /product="Nuclear architecture related protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68920"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="UniProtKB/TrEMBL:C4R096"
FT                   /protein_id="CAY68920.1"
FT                   /translation="MSAILRADDLNDFIMPGVACIKPVESGKKGSGEDLEIQIDSEGNA
FT                   LEVTKEGHERKLDKAQISLSDCLACSGCITSAEEVLIAQHSHKELLNALETDGNRKVFV
FT                   ASISHQTRASLASAFDVQIEAMDKVLIYLLKNVMKFKYVIGTETGRRLSHIFTTLDLQN
FT                   RSPHSEKPLINSTCPGWVLYAEKTHPFILPRISTIKSTQQITGHLLKNIVSKDLGIEKS
FT                   QIYHLSVMPCFDKKLEAARDSDVPDVDCVITARELVQVIEELNIDLQTILKESVLDNTD
FT                   IYSVYRSSSPPGWYQPEQSWLNNKGSASGGYAMQYLLDVQQRHADSEIITIEGRNSDIY
FT                   EHRLVLRDGQVVASSAVVNGFRNIQNLIRKLKPNHKATGGGISARRRSRKLKEDQTGDQ
FT                   GQSNAVVDPSKCDYVEIMACPGGCINGGGQIAAPADQNSKDWINKATTKYYNVPDTEYS
FT                   DIQLYDWVKQTVLSYDIEMDRLIHTTFKQIERPTDTTSIALGSTW"
FT   CDS_pept        574659..574865
FT                   /locus_tag="PAS_chr2-1_0306"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68921"
FT                   /db_xref="UniProtKB/TrEMBL:C4R097"
FT                   /protein_id="CAY68921.1"
FT                   /translation="MSRRFYRKFDRKLKLRRSWAHTEISQWNGKTHLGPALIGGRSSRK
FT                   QVDPDLFEKLNVILENRKQKRSV"
FT   CDS_pept        575422..577782
FT                   /locus_tag="PAS_chr2-1_0307"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68922"
FT                   /db_xref="GOA:C4R098"
FT                   /db_xref="InterPro:IPR000269"
FT                   /db_xref="InterPro:IPR015328"
FT                   /db_xref="InterPro:IPR015798"
FT                   /db_xref="InterPro:IPR015800"
FT                   /db_xref="InterPro:IPR016182"
FT                   /db_xref="InterPro:IPR036460"
FT                   /db_xref="UniProtKB/TrEMBL:C4R098"
FT                   /protein_id="CAY68922.1"
FT                   /translation="MKFGNLLSFTTLVGLAVAVPDFYDKREAVSTKEAALLRRGASQCK
FT                   TNENVNIEAPKPNIWDSLSNDELNQVVDLLNETYNLTEIMDADFYSNYVLTIETLRPNK
FT                   SDALVFLDEDGDIPDRNAKTLVYFGEGEEGYFQELKVGPLPVSENTTIEPLSFYNTNNK
FT                   STLPFKYGFGDSVLNTAKNQFITDNLNTTVLRDVIVDLIGVTFEEITCWATDPQIFDPA
FT                   TETTVAYGTCYILTPNDAEDLVPIGFFYKFDMTGRDVSQWKMLEFIYNNKVYTSEEELY
FT                   EATQKDDFVRLPKINVDDLSWTVIQRNSSSPVRHLDDRRAPQLVETQGRRWAFDADEEY
FT                   FTWMDWGFYTAWSRDTGISFFDITFKGERIIYELSLQELIAEYGSDDPNNQNTFYSDIS
FT                   YGVGNRFSMVPGYDCPTTAEYFTTDYYENNHHYNRSLSYCVFENMEDYPLLRHTGGTYS
FT                   TVTQNPTLNVRFVATIGNYDYNFLYKFFLDGTLEVSVRAAGYIQAGYWNDQTSSDFGLK
FT                   VHDVLSGSFHDHMLNYKVDLDIAGTKNRATQYVMKNVDVEYPWAPGVVYNTKKIAREVI
FT                   EKEDFNGINWPENGQGLLLIESAEETNSFGNPRAYNIMPGGGAVHRIVKNSRLAPETEN
FT                   WARSNLFLTKQKDSELRSSTALNSNALYDPPVNFNAFLDDESLDGEDIVAWVNVGLHHL
FT                   PNSNDLPNTIYSTAHASFMLTPFNYFDSENSRDTTQQVYYEYDADTKESTWEFYGNDWS
FT                   SCDLEIQEPNFDDFTYGEETRINKKTTNAYEIY"
FT   CDS_pept        578841..580355
FT                   /locus_tag="PAS_chr2-1_0308"
FT                   /product="Glucose-6-phosphate dehydrogenase (G6PD),
FT                   catalyzes the first step of the pentose phosphate pathway"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68923"
FT                   /db_xref="GOA:C4R099"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4R099"
FT                   /protein_id="CAY68923.1"
FT                   /translation="MTDTKAVEFVGHTAIVVFGASGDLAKKKTFPALFGLYREGYLSNK
FT                   VKIIGYARSKLDDKEFKDRIVGYFKTKNKGDEDKVQEFLKLCSYISAPYDKPDGYEKLN
FT                   ETINEFEKENNVEQSHRLFYLALPPSVFIPVATEVKKYVHPGSKGIARIIVEKPFGHDL
FT                   QSAEELLNALKPIWKEEELFRIDHYLGKEMVKNLLAFRFGNAFINASWDNRHISCIQIS
FT                   FKEPFGTEGRGGYFDSIGIIRDVIQNHLLQVLTLLTMERPVSNDPEAVRDEKVRILKSI
FT                   SELDLNDVLVGQYGKSEDGKKPAYVDDETVKPGSKCVTFAAIGLHINTERWEGVPIILR
FT                   AGKALNEGKVEIRVQYKQSTGFLNDIQRNELVIRVQPNEAMYMKLNSKVPGVSQKTTVT
FT                   ELDLTYKDRYENFYIPEAYESLIRDAMKGDHSNFVRDDELIQSWKIFTPLLYHLEGPDA
FT                   PAPEIYPYGSRGPASLTKFLQDHDYFFESRDNYQWPVTRPDVLHKM"
FT   CDS_pept        580596..582104
FT                   /locus_tag="PAS_chr2-1_0309"
FT                   /product="Protein with similarity to mammalian
FT                   monocarboxylate permeases"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68924"
FT                   /db_xref="GOA:C4R0A0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0A0"
FT                   /protein_id="CAY68924.1"
FT                   /translation="METPSYPLKAKTKDEGEIIVRDIILTNHEETQGHSSAVDRFSIVD
FT                   DHGSRTSQNSPESLDLIFEVDAEEDFPDGGWDAWLVVIGALCGCTPILGLINSIGPIES
FT                   YISTHQLEKTSTTVIAWIFSIFTAVGYMSGILVGVLVDEFGVKLPMLMGSIFHLMGLVA
FT                   TAECKTVYQFILAFSVCTGMGTSLCLTSNMAVIPHWFKRNKAKATGIATIGGSLGGVVF
FT                   PLMMKGLYDKVGFQWTMRIVGLVCFALNMMAFFLIKTRLSGKTGVFDIPEFDENGQKFS
FT                   FVRKSWLRFEQFSVYVTKLIDFKAFKEAKYTCCVIAFALSELMLVCCMTYLMSYFIKRG
FT                   HSSATAFNMIIIVNATGILGRFVPGIAADRYGVYNVMIGMLVTLGIVQFVLWLSLGQHL
FT                   WSLYTFSVLFGFFSASVLSLSPVCLSAISPTKDFAKRFSTAFLVVGFVSLMGLPIGGAI
FT                   IDNASISNYNNFIVYTGILCAASSVFWALTRYAIRRTWKINIKV"
FT   CDS_pept        582195..582368
FT                   /locus_tag="PAS_chr2-1_0310"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68925"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0A1"
FT                   /protein_id="CAY68925.1"
FT                   /translation="MLKQLWLKYNQLPFKVRMYIGISTMAVAYFGDRISSQIIENNKLE
FT                   ARAKEELRRSAK"
FT   CDS_pept        complement(582573..585695)
FT                   /locus_tag="PAS_chr2-1_0311"
FT                   /product="NAD(+)-dependent glutamate dehydrogenase,
FT                   degrades glutamate to ammonia and alpha-ketoglutarate"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68926"
FT                   /db_xref="GOA:C4R0A2"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR016210"
FT                   /db_xref="InterPro:IPR028971"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0A2"
FT                   /protein_id="CAY68926.1"
FT                   /translation="MVDRLQVSNLTLNNNFSSRSFDNLSDDELKKSGYNPLPFEGKLDQ
FT                   IEKVQDALDEAGFIPEPLIESEVRWFYESLGIDDVYFARESVQGIVSHIHALYSAKLES
FT                   YSRGENENPTLQHKREADDHAVYFDSSDPKSPQFKLINYEERIDDRYLDHGVDSPGYRL
FT                   ESFSSAVGNVRCYFVYKCSFPKAAPAAESESLDLTKISDETFLKICSNHTKRLYSEIIN
FT                   DVAAVDGPIIKHFGIKSTGEHRVIIGYRQNSSPRYNSALTSLCQFYGLKVTRKYVEQFS
FT                   NGISIISMYITPPDAGDSSFIQFPIDQVVKEASLLYTIPHNIFQEEFAKGELSIQECIY
FT                   AHCGVIFVTHFLNRLGTEYQSLLEILNPNKNLLHFEILSKIKDRLRTETFTQDYITEVF
FT                   KKQTPLVKKLYRSFADVHYINSKLEKTLSYKRLEAIEPIKSESDFENLLNHACSQNQRH
FT                   ALILRALFSFNKSILKTNFFLPSKIAISFRLEPSFLPALEYPNKPFGMFFVVGSEFRGF
FT                   HIRFRDIARGGIRIVKSRSVENYNVNKRNLFDENYNLASTQQRKNKDIPEGGAKGVILL
FT                   DPQAQERPKECFIKYIDSLMDLLLLDHQDKSNGIVDLYNKPEILFMGPDENSAGYVDWA
FT                   TLHARKRGAPWWKSFFTGKSQTLGGIPHDEYGMTSLSVRAYVNKIYEKLDIKDLSKITK
FT                   LQTGGPDGDLGSNEIKLSRDESYVAIVDGSGVIVDENGLDKAELLSLATKRKMVDQFDR
FT                   TKLSPKGYFVSVDDVDFKTPDGKIITNGTVFRNTFHLKIAEVFGKDRLKLFVPCGGRPN
FT                   SIDANNVHFLIDENTGKSYIPFIVEGANLFISQAAKVQLEKAGTVLFKDASTNKGGVTS
FT                   SSLEVLAALSFDDEGFLSNMCLDPKTGVKPEFYQEYVKQVQKVIVANAESEFESLWALN
FT                   KETGKPLSDLSNDLSIAINDLADQLSSSEELWNDDLSFRNAVLQDALPPLLLEKIGIES
FT                   IVNRVPVNYLKALFATRLASRFVYTRGIDANPARFLEFISSLKREYKSRGL"
FT   CDS_pept        complement(585982..586200)
FT                   /locus_tag="PAS_chr2-1_0312"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68927"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0A3"
FT                   /protein_id="CAY68927.1"
FT                   /translation="MTHRLDSTMAIWGIRTLARALIFQDKRKCHGSRERHSYCKPRPSN
FT                   LSYRLPVTQLSLGNSSPSSGLQPAKPN"
FT   CDS_pept        complement(587014..588096)
FT                   /locus_tag="PAS_chr2-1_0313"
FT                   /product="Bifunctional enzyme with alcohol dehydrogenase
FT                   and glutathione-dependent formaldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68928"
FT                   /db_xref="GOA:C4R0A4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0A4"
FT                   /protein_id="CAY68928.1"
FT                   /translation="MSVMKALVYGGKNVFAWKNFPKPTILHPTDVIVKTVATTICGTDL
FT                   HILKGDVPEVKPETVLGHEAIGVVESIGDNVKNFSIGDKVLVSCITSCGSCYYCKRNLQ
FT                   SHCKTGGWKLGHDLNGTQAEFVRIPYGDFSLHRIPHEADEKAVLMLSDILPTAYEVGVL
FT                   AGNVQKGDSVAIVGAGPVGLAALLTVKAFEPSEIIMIDTNDERLSASLKLGATKAVNPT
FT                   KVSSVKDAVYDIVNATVRVKENDLEPGVDVAIECVGVPDTFATCEEIIAPGGRIANVGV
FT                   HGTKVDLQLQDLWIKNIAITTGLVATYSTKDLLKRVSDKSLDPTPLVTHEFKFSEFEKA
FT                   YETSQNAATTKAIKIFLSAD"
FT   CDS_pept        complement(588280..588885)
FT                   /locus_tag="PAS_chr2-1_0314"
FT                   /product="Protein that binds tRNA and methionyl-and
FT                   glutamyl-tRNA synthetases (Mes1p and Gus1p)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68929"
FT                   /db_xref="GOA:C4R0A5"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0A5"
FT                   /protein_id="CAY68929.1"
FT                   /translation="MSFRYLKRHFSTATNAIALLSRPEFKIGRIVDVVKHPNADKLYVS
FT                   SISVGNNYASGTSNTLTVCSGLVDYFSVPELLQRRVVVVTNLKPSKMRGVTSEAMLLAG
FT                   EKSGKVELVEPPMSGREGESLHFEGVEITSEESANQLHLPAKRLKKSEWSQLAEGLQTN
FT                   DQREVVFHSQIGSKRIYALVGASTEKCTLATLAQAVVR"
FT   CDS_pept        complement(589060..590061)
FT                   /locus_tag="PAS_chr2-1_0315"
FT                   /product="Omega class glutathione transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68930"
FT                   /db_xref="GOA:C4R0A6"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0A6"
FT                   /protein_id="CAY68930.1"
FT                   /translation="MELFSRSCFRQVRNMSKIDIQKFHNAKGEFKRQDSSFRSVIGKDP
FT                   KFPVEPDRYHLYVSYACPWANRTLIARKLKGLEDYLDYSVVHWHMDSKGWRFPSNDDPC
FT                   EGATPDKLYGYKRLSELYYRANPNYEGRFTVPVLWDKKQHTIVNNESSEIIRIFNTAFN
FT                   ELLEKDGKHEQAKLDLYPESLQAQIDQTNDWIYNNINNGVYKAGFAGKQEVYEEEVKKV
FT                   FAHLDKVEDELSNDGQEFIVGDQLTEADIRLFVTIIRFDPVYVQHFKCNIGMIRFDYPN
FT                   IHKWLRRLYWNYPELKDTVHFDHIKFHYTKSHPQINPLGITPVGPLPNILPL"
FT   CDS_pept        590434..591303
FT                   /locus_tag="PAS_chr2-1_0316"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68931"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0A7"
FT                   /protein_id="CAY68931.1"
FT                   /translation="MNGLGIHVREHSGEQQDDLLPSLPASASQFEPPLEALESKTSNYS
FT                   SAVSLAQIPLDTSTSGIDLSDIKVSSPTLDESSTFDEKIDGDRTLSKRFRTSFAKLRIQ
FT                   SKVVPAHETDDTHTLKKMRSGLLRKWISHDNTGTDYDTPLSQTNSKPRSSPTLVTQTIN
FT                   VPSRSSSPSFHTIASTSATTSDFKGFETSPVISVNEKFFGTTSAIATHSTLQNTNEKVF
FT                   VNIFDELQFWKKLRSDKARGFEITESRLKSSGWSSSQDIEELRRHKEASLHIYDEKIKS
FT                   LEERLQGD"
FT   CDS_pept        592019..594529
FT                   /locus_tag="PAS_chr2-1_0317"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68932"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0A8"
FT                   /protein_id="CAY68932.1"
FT                   /translation="MSSTKTENAKESLRRGTSNFWIRRYWASFVRFPILNKPLNQVRSV
FT                   GYSYLKNSLISLDLVSTLRRLFVHADLIPYDENHNFFISAFLSSLIMIVEDYEYVVGNR
FT                   PTTYHVAIPKEISSKKPVLKLHPDFIKSRNCNLYFDEEFYHFLTFLTLEKANILWEAFM
FT                   NLKGDHTLFQSQLTSHDKLVFMRIWRDYLSTLDIFREFHSIRCIILSHDFLQKEDNLGQ
FT                   LEFWDKIQKDFSSFVYFNDSRKPWYSPFSLNVRIQKLFSIYSDSFSVGTSFGESKGQHG
FT                   QRRLSRSSKIVASPYVTPKFQGLTFTIPPFFPLHYWRQYVMEVYISKSFKQENVPPLMK
FT                   TGHIIIDHSNSTVDVEAIRHRYGLSTFRSTTNSYVESLFYSDRLDLFYLPLVELNTKIL
FT                   YVLGYLADPSDVLSDSDPDDDSIKVIVEELSDMNVEEMVARIQSLAKPKFLKTFNVDDL
FT                   IQYLADFYEFLLHVELPTKLEIEARKIHELVESSCITGEILELCFIFYGECMTFGLSVW
FT                   FIKCLDIIGEDLMKFEAVVFNEIHCTKELPLKEAYPYLHYVMEKFTFEFTHDNHIQYFV
FT                   NLFSYFTVSQKENTWQKFNHVPEQLQAFEKRFRSVCDDIECMVMTLSIVQLIHFYWNES
FT                   GVNFSCNWDHTAKTIYTHIQNCNDIQQFSSLKNGLSGEIVDLFQLQFSADETKSIQRSE
FT                   FDPQFLSSYLVNADHTSINPKQSVKMIVMQKLVELFVLSTQSTKQDQFYRLLKKVFHLS
FT                   DTLRLQFLGTIFEMSCILKTSLTLYNSIYEQVYEMHFNTHSLTTTLIDFPRIQQQRHKQ
FT                   KDLKFQSVKLSPTSGSNGLEDARD"
FT   CDS_pept        594670..595809
FT                   /locus_tag="PAS_chr2-1_0318"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68933"
FT                   /db_xref="GOA:C4R0A9"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0A9"
FT                   /protein_id="CAY68933.1"
FT                   /translation="MISLIQLLNTSFLLLLLVPFGADFGVKLTSYQLNKPTRLTLLLVA
FT                   LINFRHRLVYYAQSLLDLLFGTSPDLSKSPKIKEIYVHPVKSLRGDSVQEWEIDQHGLK
FT                   CDRMYTLGIFRDGKFKAVTQRECQKMTLVYCDIDKENKCFKYTWDLGNGPGSFTLPMEP
FT                   DIASVDSQKPVELWGVNFETYVLPDMIPSKFFEDLGMDKDTQILYSPKGKAVKTNAPQF
FT                   NNQYRFSLFQDYYPLLMVSDKDIDDLNVRIKAKGGNLVCSARNFRPNMVLERVGKLFDT
FT                   DTWDKFSVYTKDGKVHHWSVTSKCPRCPIPNINTETGVNDNKSIVSRVLSTYRRVDFGS
FT                   VYDSFFGMSCVQHDYNYSISVGDAVVVKSRRINHYECIG"
FT   CDS_pept        complement(595815..598016)
FT                   /locus_tag="PAS_chr2-1_0319"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68934"
FT                   /db_xref="GOA:C4R0B0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0B0"
FT                   /protein_id="CAY68934.1"
FT                   /translation="MGAIRARTACQKCRSLKHRCDFRYPRCSRCEKSKIECMVHHPVTK
FT                   LLMSRTDYEKLLSSTSDTDEITPLNDSNSVLPKESSELRGGSLVATVQRRKLAEAELFE
FT                   KLPQLSVLSLVPFHFSNPDEPTSTLASLSVVNLPLKEELLLVIEYFFKDSMSHLHLVDR
FT                   EWVLDVTNKVYKKLNQFQGLSSENAILYLLNCKVSALELYVLYTILTLVVSQKLSQLEN
FT                   SETILSSDEYHKSAQYFLRHILLQLTKDSKPPIIQQTETLRCLLLMSLCGFYKSMETDI
FT                   YSILNVCGRIVIEMSLYLESSLLSLEQKLPINTESPDLFQHEETIRFRKLFWAWYCQER
FT                   LVNGLSSRPYMVNDFDITALLGPLESNESYYPLCSLVKLRKIQSQIWQTLYRPYIVNPF
FT                   LKSTSRAWISSRHNQINDWFSTVYTNKEMGIKKNDVLFMYYSTLNQLYRPCIQHTKLST
FT                   GDFIILHNSTLNLLRLYDQNLTSNYRFPSSFRFGGFYDTAILYFYSVCSDTLPLTSSEL
FT                   LLELDTMMDLFHNDNHRPVAFGLQMTQMIVIFRLIYKHTKILLDRRVKPAKNPPPRRLS
FT                   PSKSVTPPLTGSTNREENDDAKSIGTRISLIDVLAPEEPESKALTSRFLPKLPQYDDPM
FT                   NRTYDSEYARHLIPVKTKSSRSEKRIDNSDELLELYIVGLIKDLKELPTNPLSEMVLSA
FT                   LTDNTTEDNPKERFTSFWWKLLNEVFQPSQLFTGKYPYN"
FT   CDS_pept        complement(598214..600403)
FT                   /locus_tag="PAS_chr2-1_0320"
FT                   /product="Protein containing a UCS (UNC-45/CRO1/SHE4)
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68935"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024660"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0B1"
FT                   /protein_id="CAY68935.1"
FT                   /translation="MDQLTELTATIDEYLESKSKDSREKVKKLVKQPAYIKLWIFDPDY
FT                   KKTVSLLQALLADEDPFLADFVLSHFCSGFTDLLKWYKKNGSSTISTNHVVTYLQLFNN
FT                   LIDTNFHSIKEDLEGPVMSMLYLLNDALVRPDILLVLAHLKQVDKRISDYCEFERTAEY
FT                   YVDSFLNDVGLQELNSFLYECVSHLIVIFPETVSKYASNESFLRLLTTDISRLTTLNAA
FT                   ELENSSLLLKILYMLSNLCIDESTRNLIHSHYSQLLSKLLTVSFSKNERAQLILTLTAL
FT                   VIVKTWHMPSMGDKSTQLTMTYDIFIAGVITDASTEILDLSLEGLTYLSIKVEAKRMIR
FT                   NDDDLLITILQLLKEKKNLNLAYGILSILENVTSTKTPDESISKVLEDTEKDDPTEILN
FT                   FIFHILAHQDLMSSLLALFKDEASTSLVHNSIINLIHNIVIFKETRSIVFEQKGLDILF
FT                   SHLISTKDNQAQLESQMVCIESVSKILLTSNPEVVVEKYDLIPVAFLVQLVQAYDHQKY
FT                   QTRYKTIFAMHLESQVANQAVFEVIISLTNLASVPNMDLKKTISNAVLPSLPNFLISEI
FT                   SSIRQSMLELLSNLSDCPDCLQYVFNWSKPDTKKNYDTLLDLLYHLSTGPSQSAILSFF
FT                   ANASVYDLVADVLVENKDFIHYLSKVLDKQRSEEPIVERTLFILINCGQISTSKLREAL
FT                   PKTFNDVLNEVLRNIRSTELRKMCLEVARLSKGEN"
FT   CDS_pept        complement(600554..601339)
FT                   /locus_tag="PAS_chr2-1_0321"
FT                   /product="Subunit of the NuA4 histone acetyltransferase
FT                   complex that acetylates histone H4 and H2A"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68936"
FT                   /db_xref="GOA:C4R0B2"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR024610"
FT                   /db_xref="InterPro:IPR037996"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0B2"
FT                   /protein_id="CAY68936.1"
FT                   /translation="MDAATVLEQYTQDLSNLPSELAHLLEELRDKDMTLYQIRKRTQGK
FT                   DNQLHKYIKQHGSLVKHPKEQQLYSKINEDFTKAKALQEEKILLSNTALLLISKHLVRL
FT                   ESDIEKLESEGLLAPDDMIEEDKNMSDGMSSLTPVPPSQSSTPGVVPKKRQRNGVSRTQ
FT                   SRFESPPLSSSAPTRTHRKKNASELNQTGEEDELYCFCQQVSFGDMIACDNPDCKYEWF
FT                   HYDCVGLTAQPPSGIWYCPDCKNDQSVRKRDRKKKKVET"
FT   CDS_pept        complement(601428..602216)
FT                   /locus_tag="PAS_chr2-1_0827"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0827"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68937"
FT                   /db_xref="GOA:C4R0B3"
FT                   /db_xref="InterPro:IPR025187"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0B3"
FT                   /protein_id="CAY68937.1"
FT                   /translation="MKKFLLKFITKKFFGETKLNRFGFDDPYYEEVQLDPTDPNSKVIR
FT                   SYIQPPVGLSDNDTKLFQKIQRRSYRLDYLFNICGVKFGWNGVISVVPVVGDVLAAINS
FT                   LLIYRLIFQLDNPVPWDIHFFILLNIIADFLFKLIPIVGSFVDIGFKANSRNAALIEKH
FT                   LATVAKANQFFNDVDSESASTKSLVSWQTSSVTGIPDIVGSLRSRIFGRGAKVEEKPIE
FT                   SIDLGVSSKSVLNKPRPRVNSTGGISTARAVDSPQKTMLK"
FT   CDS_pept        complement(602354..604051)
FT                   /locus_tag="PAS_chr2-1_0322"
FT                   /product="Calnexin"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68938"
FT                   /db_xref="GOA:C4R0B4"
FT                   /db_xref="InterPro:IPR001580"
FT                   /db_xref="InterPro:IPR009033"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018124"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0B4"
FT                   /protein_id="CAY68938.1"
FT                   /translation="MKISTIASSTLFAVGALAESEPAEFRPLEAQLDKSSFFEQFDKEP
FT                   KLGDTWKISHAVKNEEFTYVGEWAIEEPVVYPGFKKDRGLVVKSEAAHHAISAQLPQVF
FT                   DNTDNTLVLQYEVKLQQGLNCGGAYVKLLSAEGLNKNEFSNETPYQVMFGPDKCGTTNK
FT                   VHLIIKRKNPATGEYEEHQLATPPMGRIVKTTSLYTLIIKPNNDFEIRINGEVAKAGNL
FT                   LNEKLIKPPFGAPKEIDDPEDQKPEDWVDEDMIPDPDAVKPEDWDESEPLRIVDPEAVK
FT                   PENWNEDAELYIPDPEATKPEDWDDEEDGEWVAPVIPNPECADIGCGPWKAPYITNPNY
FT                   KGKWSPPLIENPDYKGPWSPKKIANPNYFEDKKPANLEPIGGLGFELWTMNADILFDNI
FT                   YLGHSIKEAEFIGNETFVPKLELEEAESAKNAPKPDFEPETPPETGLDSTGNIFTDVFD
FT                   TVFQTVLEYYVSANAFLNDVVQEPSVLLERPGEAVYYLVTFFSGFTFLVAVWSGLIFAL
FT                   TGAGKKPETSAKTPTKSTQKIEEVTEDETEKTDSSSAAKNSTKATKRT"
FT   CDS_pept        604352..604924
FT                   /locus_tag="PAS_chr2-1_0323"
FT                   /product="Essential Hsp90p co-chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68939"
FT                   /db_xref="GOA:C4R0B5"
FT                   /db_xref="InterPro:IPR005631"
FT                   /db_xref="InterPro:IPR028882"
FT                   /db_xref="InterPro:IPR036714"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4R0B5"
FT                   /protein_id="CAY68939.1"
FT                   /translation="METTCGLPVLPQKISVNFMLRETVDDLGLSKSVTFFLLNSPIMLR
FT                   LFQRTQFQGSKTCPRVFSKSFHSLPFLRQELILKVEPLKRDNESEDVKRRRLVYQSRKR
FT                   GILETDLLLSRFAKRYLPTMSVEEMEEYDDLLNELDWDIYYWAVKNYEVTPLPEKWKDS
FT                   KILAKLQEMSANNEGEILRMPNLDDSP"
FT   CDS_pept        605174..606667
FT                   /locus_tag="PAS_chr2-1_0828"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0828"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68940"
FT                   /db_xref="GOA:C4R0B6"
FT                   /db_xref="InterPro:IPR004918"
FT                   /db_xref="InterPro:IPR013855"
FT                   /db_xref="InterPro:IPR013873"
FT                   /db_xref="InterPro:IPR013874"
FT                   /db_xref="InterPro:IPR038189"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0B6"
FT                   /protein_id="CAY68940.1"
FT                   /translation="MPIDYSKWDKIELSDDSDIEVHPNVDKRSFIKWKQRDIHEKRLQR
FT                   NTEIKTLKIQREMYTQLNKRVDSMLSKLDLNQIADESTRNSFLASNFDASEKCTIEEDQ
FT                   QNNPTYNEMVEDLFTQITEDISKEGKDAKNGSIIVDKLKEHRAKIDAVLKEIDPKLDQL
FT                   LQEKALHISSEDIHEGFDSVIINKSATSKIASSRSPGETVKTTTIETINNPQPTVPLPD
FT                   ITKAPSQELSTLGELDVLDETLEFSKIDVSQYRAIARFLDQHPYIISEQQQQALTMKAF
FT                   DAQLEGNSQRAFQIVHQALVIQYVNQLCGARPKSEILPSYKPQETAIKLFIGKLTDKNH
FT                   PARKAFEEDVKRTFTHILERCKILAEENKAMGEEQVEQIQLRSMDEGTELMVTIPQENT
FT                   PEYEAFLKIPKVMQDALRTSSIDEVNKVFSNMSVPEAEKILELFDQSGAISVAQLLENE
FT                   EEFDKLKHTMGDQSIDQEVDNLALNDKPNEEAKTEDVVD"
FT   CDS_pept        complement(606751..609225)
FT                   /locus_tag="PAS_chr2-1_0324"
FT                   /product="Oligomeric mitochondrial matrix chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68941"
FT                   /db_xref="GOA:C4R0B7"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0B7"
FT                   /protein_id="CAY68941.1"
FT                   /translation="MLKARTVKPNQLRLNALRAKVPRILLASSLSTLSLRTSSNTLAVR
FT                   PVQPKIPFARHNVNHLRLRTPMSIRFASSGGPQINMNGQQEEELPALQKYGVNLTQLAK
FT                   DGKLDPVIGRDEEIRRTIQILSRRTKNNPALIGNAGTGKTAIMEGLAQRIIKGEVPESM
FT                   KDKEVVALDLGSLISGAKFRGEFEERLKAVLKELDEAHGNIILFIDELHILLGLGKAEG
FT                   SIDASNLLKPALARGQLQCCGATTIEEYRKYIEKDAALARRFQSVLVNEPSVQDAISIL
FT                   RGLKEKYEIHHGVRITDSALVTAAVYSNRYITDRFLPDKAIDLVDEACSALRLQHESKP
FT                   DVIQQLDRQIMTIQIELESLRKETDPISVERRDKLDEQLKLKKEELERLTQVWEDEKNS
FT                   LEKIKTAKEELEQSKLELERAQREGDFGKASMLRYSKIPELEQKVSATAQRVKEGESET
FT                   TTNLLHESVTSDDIAWVVSKMTGVPVQSLMKGEKDKLLYMEESIKSRVIGQDEAIHSVA
FT                   DAVRLQRAGLTNEKRPIASFMFLGPTGTGKTELTKSLAEFLFNDENAVVRFDMSEFQER
FT                   HSLSRLIGAPPSYVGFEEGGELTEAVRRKPYAVVLFDEFEKAHRDISKLMLQILDEGNL
FT                   TDSQGHKIDFKNTIIIMTSNLGQDLLLADTELENVGGKVSEKTKNEVIQVMKQNYPPEF
FT                   INRLDDVLVFNRLSRESLRKIVDIRLSEVQDRLVDRRIELKLTDAAKEWLTEKGYDPLY
FT                   GARPLNRVIKKQLLNPLSIRLIQGEITNNSTVKVDLVDGDLQITSEKNEAEAETVRKED
FT                   GDEPAEYEIIKD"
FT   CDS_pept        complement(609467..610468)
FT                   /locus_tag="PAS_chr2-1_0325"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68942"
FT                   /db_xref="GOA:C4R0B8"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0B8"
FT                   /protein_id="CAY68942.1"
FT                   /translation="MFTRLGRFAGVQRSFHTYSARKSSVSSLNQVVKKEILERENVSEE
FT                   HVLNMLRTCSIMKGKISQGEQIDSLIEKIFDAPNVKITPNILRKFWLTKPSFANIECSI
FT                   QSYYDKNKDLSINREDAMIPFRQFLWDGEVDKALKIVDLTTAHSRYISTQKSKMRSYLI
FT                   RYAGSCFGLIGAIEVLTRIFFADVGSLGKVYAMVLAYIGNTSFLASLAFTGKNISQDTG
FT                   PLRWRPGTLQNYWYQHNDELMMCSKVLEVDAEIHGSEGFATKEIIQNFFDRKMIPNEPE
FT                   QEIMMQQYWLGGGDGFEWVEPDQDPLDFLWKQHLEKLKGQALPKAEQKLSIG"
FT   CDS_pept        610645..611541
FT                   /locus_tag="PAS_chr2-1_0326"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68943"
FT                   /db_xref="InterPro:IPR013911"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0B9"
FT                   /protein_id="CAY68943.1"
FT                   /translation="MGVILPDDGKQSGGQPNRRAKVLSRFLPPEHQRPSIGLFLGPFTP
FT                   AADNEIALWTCIGAQLFSGLALLRMSRRFVFSPDQSVRRFLFKTFHNVVGAALIFGSGL
FT                   EGTRMLLPEDPWKEEARKARILAQLKGEPVSWWYGPKSFIPSGRLEYTKQMQFHNFEVM
FT                   HKSPEKIARALMIKDKLKEETNTLYSSIHEKAEQQTIRLSKDLQNNVPLKGVTSYVPQF
FT                   STSNTDTKLYLKNVSLKTHADLEKVWAEHNPWDILEEKISPISVIALPKFNPIISEVEP
FT                   DKQQPSTGDIKYISDRK"
FT   CDS_pept        611713..614208
FT                   /locus_tag="PAS_chr2-1_0327"
FT                   /product="Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68944"
FT                   /db_xref="GOA:C4R0C0"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR011678"
FT                   /db_xref="InterPro:IPR026895"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0C0"
FT                   /protein_id="CAY68944.1"
FT                   /translation="MNGKHLLLQVLLVQLVAAVLDTQVGYIDWLVTSTGSFLDLSSCLF
FT                   NYEQIYCLTEANDLIGLDSDAQITYRLHLDGPDQGKLTKLNNKKFGSVRGNYLDIFNEK
FT                   GHLLHTEKFPSPIVDVYLDNSLLAVDLEGVVREIDLSTHSSKEVATLQSLACAMFSKVD
FT                   DKVTIAFKGSNSDFVKIAILEDKVSTISTNISSVVHIKNNLLETDEGIYSIEGSTVKKI
FT                   LDGTAYLTDIGAISVDTVKNSVRSSGNSFEPQSKILKVHAEDEFIVVLTVDEVLEIDLE
FT                   TFDLSSVKENSLTEEYLNSVDYEIFFKNQEVQLIIQDRSARELIITNGVIQKVLDLSLN
FT                   DVVDYSIVTLQPQLKAIEDEIIEEENSTFFKAYTSRLFNTLAALKENIKKREFTSLFQY
FT                   DTSGQDQSFGLDKRLVIGCSHGKLSAYHLLTKTPQLSWEIQLPLIDEVSSFNEGEVSVL
FT                   SGTTVFTIDAETGDILSETVATAEDPQKEFDIKSDDRTISGLKLINNEYSSTWTFKASP
FT                   EEKILKVVRREDDNSNVASAGHILGNNSVLFKYLFQNLISAVLLNEHTNDIRFVILNAI
FT                   TGQQVYSDVHSGIDSNTNVNLIYDENFIVVSYFGSDPIPEQHIVVYDLYESLTPNKRVE
FT                   PKDGLVSNFDTDTPIPQISSQSFLFPSRINFIAASRSKFGIASKWIISVLENGQIFAIP
FT                   KVVLNSRRVVGRDLTSTEKQEYGMSVYSPFISLPENIFTISNIRNLVLDNNSNTLPSGK
FT                   PILTVEPTGLASTSFVCLINSFNVYCTQISPSKKFDMLRENFDQYKLLLSIFGLLAIVL
FT                   LVRPYVYSRNVQKLWTTKI"
FT   CDS_pept        614395..616143
FT                   /locus_tag="PAS_chr2-1_0328"
FT                   /product="Palmitoyl transferase involved in protein
FT                   palmitoylation"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68945"
FT                   /db_xref="GOA:C4R0C1"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0C1"
FT                   /protein_id="CAY68945.1"
FT                   /translation="MVAPIPFKKFRFHRYDRYTAGSRWLYETRYHFNFWSYNLKTCAGL
FT                   LGVCIYITMILTMNFLYENGTRMDFPVDVELDPFFLKEQLYMQLQATYFNQTNIVVNKT
FT                   IGVNPFYQTMPEASQLSSIDRIAMLTEPVVRDENIHVPKLPLKLNYFDYKTASLQQSII
FT                   STFKGRMGHLNKFLEYKITTQYSLRVPELTHQPTEVKISDKGILYELVWNGGDEKKVED
FT                   RGSAAEYFQSLGVPPEHFLIFKGSKTAPAHFNFSKPQWTLHDLGSHMIREYSYLNHEKT
FT                   AAMQTLADLIIFFSKQRFNLTVTNYDLVVKSLEDSIEKHRSKIILGRDLYFFSVIGCVG
FT                   ICASIILITILLDFLNRSASKSYLKTLCWGIRVVQILLSILCLYGVSAGIVYTALFTQA
FT                   IESVDNDSFSELSRLLNSLELTAKFKVLKGFTNWFDFLFFRLLSTVFSFVIPTLAFIYF
FT                   LQCEFHDLQVRLNYKMIDKYSYYVHKEAARSLLRHDLRAMDKEDDDYDNRQIYLYQDKQ
FT                   KRFLPVWIYLKNPKQYQRIINEFSKDREKHPIYTEMQLEKNILNYRVLAADYKLKPGED
FT                   IRSLPC"
FT   CDS_pept        616284..618443
FT                   /locus_tag="PAS_chr2-1_0829"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0829"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68946"
FT                   /db_xref="GOA:C4R0C2"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0C2"
FT                   /protein_id="CAY68946.1"
FT                   /translation="MNEAEPLDKTSLNEDKIQDSLFSNENPTTLTGSEEILLKETEDAE
FT                   IDLNLIARFKHACVIGDLKTVQDILENGLLSVDELDDENLTGLHWAGLNNRYSVCKYLI
FT                   EKGADLSLVGGELSATPLHFAAQRGHVYIADLMLSHGANVTAKDSQGADILQAAVLSGN
FT                   VLLVIYLLNTQDQCNINTHDKNLLTPLHWASYRGDALTVDILLKHGADVTMVDNKGFTP
FT                   LYWALTRPDIRIIKILVAYGSSLHVETLEGQKNAFKIAQEMETESLLLAALKLNDQNPD
FT                   GSPTKHYLTEKQAKSITFFTPYLVLFAALHLVKFQSSLWLLNLAILVVVAFAAVKLLNV
FT                   FAFPVYLRVHGPLLKSPYLAGTFSATAFWAIFTWLVRILPFTLFESFVINVIFAAMSGL
FT                   MILTFYKTLMLNPGYVPLPLEKSEIKKTIEDLLELHKYDTRHFCIKSFIRKPKRSCYSE
FT                   FQKRTVARYDHFCPWVFNDIGVRNHKPFIAFSVSLQVAILCFIILTIEYFDEMKLTNEK
FT                   EIKHSCSFLGEDLCKGYRGAPFTFNVLVWVTFQFIWLSMVNIVQFIQIFKGLTTEEAKN
FT                   FSNPDRMNKPWENFGSVPPEFWNDGSTLDPLEVEGPDFENSHEACQSPMERIKGGFNKC
FT                   FKLVGIDQLLGMAREVVKNTHRQRYTDFGWKQNMIDFWFLRDEDEGLSMETLFRIPIKG
FT                   EGNLNGKLVDYYTLWELPGENSEPV"
FT   CDS_pept        618580..620355
FT                   /locus_tag="PAS_chr2-1_0830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0830"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68947"
FT                   /db_xref="GOA:C4R0C3"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR006642"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="InterPro:IPR021565"
FT                   /db_xref="InterPro:IPR036531"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0C3"
FT                   /protein_id="CAY68947.1"
FT                   /translation="MIGRRVLGQVPNEGELSPTASPNGAESLSCPICNENMINLGQLNQ
FT                   HLDDTHTNNDPSESVNIGPYLEKDLKNWFRTKVVDRANSLHPLISSKLNTMDVVDNMGY
FT                   FTISDSATSSAPNSTTNSRISSPGLETSEISRSHWKKPKGNDFCHLKECKRRLNIKNGI
FT                   VNCRKCGFLFCNEHTYYRIKVNQTLQYDPLGGQFVRCCITCFTNKPFFNNFEGFALDDT
FT                   KTFQELREKRLESDRLKTIVLEKRLRKIFAFVYDRDNPSKVNNSEVTNYVKQIIHWQTD
FT                   NELNNCPLCFKQFGRFLMRKHHCRLCGEIRCDDGCSLDIPMNYLKQLFDQSPETNEQYD
FT                   QNHPTEDDTIVFDKVSLRICKLCKNRVFHRRLFTQNRSSSTGIDDLLSTIRLVNIYKEK
FT                   IHQLLPGFEEDLQRLQTIDSASNSNQILPTKELEDDEQFLKMLVEKRYKIMSVFNKIDK
FT                   IAKGLKLTIDQNDTLLSLKKPLAEGMTIDQLKIARSIYMQLASFLQENMLKLQKVPNLT
FT                   NKPSTENEGLSKLEIREYRDKLMVLQEQHYLINSMIDDSKKKRKFDDLKILDENLADIE
FT                   TEIQTISRKLGDDSF"
FT   CDS_pept        complement(620382..623015)
FT                   /locus_tag="PAS_chr2-1_0329"
FT                   /product="Transcriptional activator of proline utilization
FT                   genes"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68948"
FT                   /db_xref="GOA:C4R0C4"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0C4"
FT                   /protein_id="CAY68948.1"
FT                   /translation="MAQGFPVQRIKLKEQIDTTPVGVIGRLHYACLRCKAQKIKCSGDK
FT                   PSCSNCIMARKGSECSYPNKDRKVIILESQLDKLTDRIKYLETVIVDLVKEPDSNSIQI
FT                   KRELERRDRIPDSNLNGDSVYNPSIKSDVDSKTDDETEMQYLQARSTPSIPFIGAEQRR
FT                   KNNQSDTLSADSGKEFEDLSMKLDSAISLSFGDNDGNAKSNNKVSKFLKSHSKYYLPDS
FT                   QFKKPIDNQTSLILPSQAYALKISQLCLDFFQSQQLYCFDHSIFVPHFYKLYEDGATDN
FT                   QLLLVQLLLSLSIGEQIYYSLVSNKDPDFVINKQLYFQQNNLDSNTPGLRFFKQAMEIS
FT                   NYIEEDPSLTNIQNCLLIAYYSQSLNRITTSYAYLGLATRLCLVLGLHTKYVNTTNNDV
FT                   IYNEKRKRVWWTTFILDSFATSRVRLPQHITFDQTDIELPTENFLDLGDGFDGTILQRQ
FT                   VQLGKFAGKILSLIYNHSKRSYFGDKNTVMLHRETTEDIINNTLACLKLLEEHFERNLK
FT                   EDFIQLNRDIASNNNDTKRPLIHLFLKFNQYIITTTRPLVLVIFKKYLVETEQTRQITS
FT                   RCILAACHSIDLLYQLRKIEGLPIFDYWDTHFCFSSVLILMMAIFTGKSYSQLDKGVEL
FT                   LKYMANCGNHVAKDNFIKLRNIHKLFEQIGLPNRTTVDLTLLDDDINDSSNSSETASIK
FT                   LENQDNVKLVLNPRQGPTITPSLNEFLIPEPSDTTNASSGDNVFSFNGSQFNKINSTAN
FT                   SSYNDLSYLSTTMNSDLANQRYHFTPYTEANSNRQSFGLPPSGEYENGNRNPKNNTNGN
FT                   PVDINYPNVYNQSINQGEQRPTNEIFPDFLSNINSWEYNPNFIFEPVIQQMNQDQQAEI
FT                   NNAQSL"
FT   CDS_pept        623299..624333
FT                   /locus_tag="PAS_chr2-1_0330"
FT                   /product="Probable cochaperone, regulates activity of Cyr1p
FT                   (adenylyl cyclase)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68949"
FT                   /db_xref="GOA:C4R0C5"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR007699"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0C5"
FT                   /protein_id="CAY68949.1"
FT                   /translation="MTLESLISSGVELIEQGNYLKAIDQFSRALQLSDSSFKAYLNRSI
FT                   AYQRSQKLDLALKDVDQAIHIAKDLRQSQEYISASYFRKAIILYLLKNYAESYQNILLA
FT                   QKYHCSDITFPSWKSKIEAKLDSEKSKPVQSVPDSSKAEKPSANEKPLQPTTPSIASKP
FT                   RIDWYQNSTEVNISIFVKKIDKSSLKVDFAKDSLEVSFPLPDSGEDYTYKIEKLFAKID
FT                   PSQSSYTVFGTKLELTLQKIEPIQWNSIEFDQQRQPSTTHEESTLAYPSSSKKKIDWSK
FT                   LGDDEDEAKDDQSPDAFFQQLYKNADDDSKKAMMKSFIESGGKSLSTNWDNVENKDFSA
FT                   EAEP"
FT   CDS_pept        complement(624343..625902)
FT                   /locus_tag="PAS_chr2-1_0331"
FT                   /product="Mitotic spindle midzone localized
FT                   microtubule-associated protein (MAP) family member"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68950"
FT                   /db_xref="GOA:C4R0C6"
FT                   /db_xref="InterPro:IPR007145"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0C6"
FT                   /protein_id="CAY68950.1"
FT                   /translation="MMIQEKNGNLDMNTVDYIIEDTNFKHMSIPLLANLNFEIKALIGN
FT                   ATDKIKDLFQNKLSKYMSTFEVLNGYIPDDSLIQNLVSIRSTILHEKLPEVTSLLKEDL
FT                   SVSSLLIIQAFFNDSTISHLLLSDFEELECNLKLVLKEKDVREKKLAELKSQCQSLWAK
FT                   LDTEVDANYITEFLLSNNNIHQSSIENYQHELERLNELKLKNAAKFISILRKEIESYWN
FT                   LLMYTQEEKRNECPEYFVSESTRLDEDLLNKHQLYISENLNVKVEQLKPILNNVERLKE
FT                   LVKEKRELEESCKDSSRLLSRDSFKILKREEQIRTRITKHIPLLLEVLKPQLENYKQEA
FT                   GKSIIVDGVDVWETINELESKFFKSRIKRTPSRRLNKSAPSSSRSGDGNRRNSSTATTP
FT                   TRNKVIRSNSTLGVFRTHHNTNGKLLNLKDSYKSKQPGARQGPGPLRPININVNSRGAN
FT                   RMGKPKHVLKVRKPQLVVSKNVNVFSSPERFKDQTPVYLSSEDELDTENKLPAWNMDLE
FT                   TF"
FT   CDS_pept        complement(626058..626456)
FT                   /locus_tag="PAS_chr2-1_0332"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68951"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0C7"
FT                   /protein_id="CAY68951.1"
FT                   /translation="MDPTNIDSFLSRLKPDLVRLKSLRESLGTDSNDCKDEQTITNTIQ
FT                   NLISNTETIIKQINYELNVKLKNTAKIYNIIKNCQLSNTKEFVWNSDLLTTKFILDFNK
FT                   KHNEHPHEEIDLRQLLAPKKHFMTYETK"
FT   CDS_pept        626914..627924
FT                   /locus_tag="PAS_chr2-1_0333"
FT                   /product="Zeta-crystallin homolog, found in the cytoplasm
FT                   and nucleus"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68952"
FT                   /db_xref="GOA:C4R0C8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0C8"
FT                   /protein_id="CAY68952.1"
FT                   /translation="MTTIPKTQKVILFEETSQDLSVLQYKDFPVPEISADEILIKNKYA
FT                   GVNFIEAYFRSGLYPSKTPYVLGREASGVVVAKGDNVTKFKVGDKVAYLSPSTFAQYTK
FT                   VDGTTGIRILKLKDDASEEDLKLFGSVLVQALTALTFVYEPYNVKSGDFILIHAAAGGV
FT                   GQLLTQLAASKGAKVIATASTDAKLQIAKELGASFLINSSTEDIVEKVKEFTNGVGVNA
FT                   VYDGIGKATFEASFESLAPKGTFVSFGNASGAVPPFSISRLAPKNIAILRPQLFGYTNT
FT                   PETWEKYSKELLGLLSDGKLKFSITKVYSLKDYPKAAQELESRATTGKLTLEIPQ"
FT   CDS_pept        628025..628909
FT                   /locus_tag="PAS_chr2-1_0334"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68953"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0C9"
FT                   /protein_id="CAY68953.1"
FT                   /translation="MRLSYECLFSVFLVLAYHLKGTKATPPACVFECVSVVSNSCPKRE
FT                   TDTECLCAQKDSIIGCLVDICKPLDFSGARDHINETCLNLKEGNQHREKCQLSHEHDDS
FT                   CGGNLWDCELNHKHNNTCARNNPWNCDLEHQHNEFCGKKDPQCELNEDGICRNNSTYTE
FT                   NNLEVSLQLEDWNSDPDNESLEDVSEDSSSDEESTCSDEADSDCDSEYDPYEYEPYGYR
FT                   KRDMDKPISKSERPLLTRSKKQLDKQLRPSAKAAHANPIYPFKDKIPIQSLPKLNKLNS
FT                   VSNSVENSLESLL"
FT   CDS_pept        complement(628940..630862)
FT                   /locus_tag="PAS_chr2-1_0335"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68954"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0D0"
FT                   /protein_id="CAY68954.1"
FT                   /translation="MPLDPEIDPKVTEVGLNQSEAEQIQLAAMAAAAAGSPGRPDDYAS
FT                   FIEQAVAHQQAEQQHNQQQRHQDSQEPSNIVTLPSNLHQPMTTTELALKALNGSSNVTE
FT                   RTPGPFNDVKNDIPIPSRYDAESNDSHLDFVSMDPGTSKDQSINRPNLSSVSSPLESSS
FT                   DHNYSESIISKFRLDSLPVIGPGSRGGKVRLRGGKNPQLIRDRRTNHQLKGFKTIFENP
FT                   SSREIVTVIDDRNENYKDKSDTSKNTEEFIPSDPANHPRIILEDYNSIVTRGITTARDD
FT                   APKRGRGPSKKRLLEMGISVTPVVKKLRGRPKGSKNRATKSSFHLGTKEDLNLNPWDPA
FT                   ILSIAESVESGLEHHPIALGYPIRPTSIARDILYISGVIKQIRPDLPLSPQDFEAGLQL
FT                   NNKLTVDEPSSLANIAQLSLAQSYPLGNASETMKIVYGVLVGSILDMPQSTLDSGDYSK
FT                   YFQLLSERISVSGLELNGFNLDKPFLNQGLDDLSANERLKLLTSLAQLAAGKNFGDDFD
FT                   PVQQFEILRLGTVGTFYLAKSAGHFKMYTKLPAAVRVENIWASTVIVTESLTRKNDLWY
FT                   EVCENKEELSTFIAYLSFRLSPYSKQNMKEFSSLIPKRTIRNSALAGALTKFVEHLKDF
FT                   RKQLL"
FT   CDS_pept        631130..632167
FT                   /locus_tag="PAS_chr2-1_0336"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68955"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0D1"
FT                   /protein_id="CAY68955.1"
FT                   /translation="MDHLSSTKQFIDEALKTAEQGTLPKGESGHISGHDSDHLLVPEHM
FT                   NLHQFLPMGDVGEEESHLTAETIGCTRCKKQFEQGPRKYKLCPYCRKLQRERSRRWQQK
FT                   TKEKVGVCRRCGITMDPGESEQFVLCGKCRGSLRTKKRHRAEEGRCVHCSGENENSAYK
FT                   VCSRCRSNDKERRISLEKRGLCNRCATLLTDLERDHKVCLKCRNKKRYCKGAGRKSLHE
FT                   QVDVAEAAAVALANGTKNLSPSNSNLSSNSGAASLHLPDGMTVQEFLLSAQQHLGGGTG
FT                   HLHLLHPRSTHDPLSMGDANKVCLKCGIGISIDDVNNNGSSNFCGKCLESESNLFMNSE
FT                   SSAQH"
FT   CDS_pept        632469..632744
FT                   /locus_tag="PAS_chr2-1_0337"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68956"
FT                   /db_xref="GOA:C4R0D2"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0D2"
FT                   /protein_id="CAY68956.1"
FT                   /translation="MMNVKRRNDACYSQGGDHSPLLSSVKSAFSRAMREYYLMYYYMCP
FT                   FEVMSTDEAVILHIIMTCLFLLVGYSLVHLLDLVVALTRRLVTHLV"
FT   CDS_pept        complement(632841..633431)
FT                   /locus_tag="PAS_chr2-1_0338"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68957"
FT                   /db_xref="InterPro:IPR019560"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0D3"
FT                   /protein_id="CAY68957.1"
FT                   /translation="MNNDKETTDTGLRYAAYANRVRTILLAAHRYVAYTSDIGESFRPV
FT                   AHPYLVKSCYAISWSYILGDVAYEGWKANLKQNGQYSSHLKPWSSPSDYPEPDPTSAKI
FT                   YTEKPDFLDWKVLMVKRGLFQSIASMGLPAFTIHSSVRYSSYIFKNSKIHALRTYGPVG
FT                   IGLAVVPLLPYLFDEPVEHAIDYAFSEGKLLLA"
FT   CDS_pept        complement(633615..634349)
FT                   /locus_tag="PAS_chr2-1_0339"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68958"
FT                   /db_xref="GOA:C4R0D4"
FT                   /db_xref="InterPro:IPR019413"
FT                   /db_xref="InterPro:IPR025390"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0D4"
FT                   /protein_id="CAY68958.1"
FT                   /translation="MTLRIKIRFSNELPDLEVPSNFQVSLKELRSYVRSQYNQISNKRL
FT                   KFIYQGKVILANTDFDSLPHTNEEIFIHCLVGETLTADELADEGQWDTKQPIKSTEEAA
FT                   VGFDRLLSQGFSRQDVDELRSTFHSMYGSGENEDLRELEDNWIDSTVNNEFDEFSNVLN
FT                   NRNQNTQLANAPAGAAVNVNNHVPDTNRDLLIGTLLGCFLGVFALFLMRLDLGGIVNKR
FT                   TKTAIIAGVCINFSLGIIRMFS"
FT   CDS_pept        635048..635344
FT                   /locus_tag="PAS_chr2-1_0340"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68959"
FT                   /db_xref="InterPro:IPR019034"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0D5"
FT                   /protein_id="CAY68959.1"
FT                   /translation="MVQGAQKLAVKKKARVTKQQMNPRKAAPRIIKARNQTKGIKLTQK
FT                   LNRIHSASLVAQTERLVASRVGHLELVKGSRRQLEKAQKEKDKKKPNAAKASK"
FT   CDS_pept        635802..636761
FT                   /locus_tag="PAS_chr2-1_0341"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68960"
FT                   /db_xref="GOA:C4R0D6"
FT                   /db_xref="InterPro:IPR024382"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0D6"
FT                   /protein_id="CAY68960.1"
FT                   /translation="MFSLAVGALLLTQAFGYSNPAISQLNGDLHSNKISAESAILNLAD
FT                   YLDIDEDYRLEPDTVLLPELQRSPIDDELVIIISGVDDYADILPLQSSVDVGSGEISTF
FT                   IQFVNGISNKFDETVSRLIKQDVAKRDSVINHDLNGLKHVLASNANAIFRVDALSDFAR
FT                   TAGVDSESYKAAKEAITNVLRSTGREVLVVTTPPFDFAQEITKREVKGTFNSFSCFKTQ
FT                   DACIQNTNTCSNHGICSKVGDCYKCLCTPSKDAKGSTISWSGFNCAKKDYAVEFNLFLW
FT                   SGIILVALLVAGVKLLISIGNEPMPGVLLAATSAKKAN"
FT   CDS_pept        complement(636802..637986)
FT                   /locus_tag="PAS_chr2-1_0342"
FT                   /product="ER localized integral membrane protein that may
FT                   promote secretion of certain hexose transporters"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68961"
FT                   /db_xref="InterPro:IPR022757"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0D7"
FT                   /protein_id="CAY68961.1"
FT                   /translation="MSTEDEDIINNLEETEVEGLVEIFIRMNDEEDKDYCFQVSTNSTF
FT                   KDLLKIFDSLPLTLAPTCFQNLRPIGFQVSTSPGFLTASGGLLFDDDATNKKYLVNVAL
FT                   SDKIGDKVWPGQLIVPKWEFNSTAFLVIQSIFLLWLYTDLPDFISPTPGISLTSQALKA
FT                   GAYIAKLLHYDDFADLLLNELLTEESKFTQSLFFVFHVAKIGFLELLLYFGFYRPYSFD
FT                   ILHIFTPAPAPIDKETLRKIGWTGARKVSVQDYKSRYRDHQTKKVGSLLKAKELGLFEK
FT                   IIYGGVQLKDGEGWNTPLPTEDDKGAKSNTLDKLLQANGKFILNYDYIAHIGEYWETNE
FT                   LDVLLAKKDQCENEEELRQLDQQLNKAARDFRSYGPLECSEKVTKIVDNRMALK"
FT   CDS_pept        638596..640089
FT                   /locus_tag="PAS_chr2-1_0343"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68962"
FT                   /db_xref="GOA:C4R0D8"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0D8"
FT                   /protein_id="CAY68962.1"
FT                   /translation="MTPIKTDLEADRVTELETLLRPAVELIAQHIKDTDENDKPIGPYY
FT                   PNPRDLYQSLKLEADFNGGGKDDELVIQTVKKVLDSSVNTWNAGFMDKLYASTNVIGLV
FT                   SDLLLSALNTNSHVFTVSPAVTIIEKYTARQYAGLFGFLGPRAGGLTFPGGSWSNVTSL
FT                   QMARSSLYPDTKVKGNGNHHFAVFASSHSHYSVEKACILLGIGAENLFKCKVDKNGCMD
FT                   VTDLRVNIEKSIAEGYTPLYINATAGTTVFGSYDSFEDIHKIAKEYKCWFHIDGSWGGN
FT                   VIFSDREKHKMKGSHLADSITANPHKMLGVPCTCSFLLVPDVSIFQQANSLNAPYLFHN
FT                   KHEDDDENYDLADGTMGCGRRADSLKFYLSWLYYGSEGYKERVDHAFSIARYFTSKIVN
FT                   RKGFKLVGSPEPACLQVCFYYNPKNDFENGSENTNATRYIATELHKHGKFLVDYSPNPD
FT                   DVDNQHGEFFRVVFNSPILDDKTIDSLIDLIEQTGEEIV"
FT   CDS_pept        complement(join(640139..640454,640520..640530))
FT                   /locus_tag="PAS_chr2-1_0344"
FT                   /product="Protein required for assembly of cytochrome c
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68963"
FT                   /db_xref="InterPro:IPR018793"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0D9"
FT                   /protein_id="CAY68963.1"
FT                   /translation="MVASCKDQLKQVAICLQRSPCVMIERNTPKDCITDPVKAKDLPEL
FT                   CKAQLSTFLECKRGIVDMRKRIRGNAPLSTGKYDEQYEKLSTGDFDPREEMQKLDSLNT
FT                   HNER"
FT   CDS_pept        join(640879..643977,644045..645082)
FT                   /locus_tag="PAS_chr2-1_0345"
FT                   /product="Subunit of the RAVE complex (Rav1p, Rav2p,
FT                   Skp1p), which promotes assembly of the V-ATPase holoenzym"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68964"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR022033"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0E0"
FT                   /protein_id="CAY68964.1"
FT                   /translation="MNFLPGEPNRSIEAVRSCNWNDVPIISYCSGNNLIILTNNCARVQ
FT                   TIYLDKDPYSVDINKLNGKIAITLDNELHIYKPVISNYFQYKRSKNLADLRIEYQHELT
FT                   VTNDEDSSRINSICWSDHIDPTDDEDSSNRFLDLPDDLNTETSCEIVVGSMESLTLWRL
FT                   YYKNKRDHAHMTISARKLWFKVQPSPIYLCKVSPSSDLIVSCGIYDSFIKVWFRVSYGI
FT                   VKSEFDLTYLNNQVHVSQLRWKQEVTEASSNRDHMHTLYSIGVDSKMRVWSIFEIDGIH
FT                   SFYYSGSVDFKAEDEPSFILNIDGSITKRMIADLKRKKKQVSELLLEEDLELCMVIYSS
FT                   GKAELYSMEHLNSLPARPLSIEKLPIINGGILKFGENCLPKPFLLIYFQELTISSDNNL
FT                   KLVLHDLNKSTIRDVSLGNDFLLDVARSTDQPTSHTEKETLVPVGKLDHKFTGHMKSIR
FT                   RLIRSIDGSSVLSITRFNESYLWYPIRLSNGVTLSKKCTIRANIVVAVILAKSDIVIGI
FT                   SAGEISVWSTALVPTKTATKLTSLPIDEDLTPVSFFLLPEFNRGNKNLFHIIAIYDVNN
FT                   VKCWKFDLSSKELSKITIANIPFSSPNNSEIHLIQQIDPVGHSNRFTRTPKDILSIVDK
FT                   DGYVNIFGIKFEEGRYHWIRKFFFHSNTPNMTYIKGSSLHKVAIVNSSKKVLSIWDCKR
FT                   KFLEYQETFSEDLEIKDIDWTCTDYSQSILAIGFNKHVLLFTQLRYDYTNETPSYKPIK
FT                   NIDLSSMTTHDIGDSVWLEDGTIAIGCSNQFYVCDKSLDMNDAVTQDLIGSYNDAHVED
FT                   IFELCAFVNGPLPLYHPQFVIQSFFWGKYTFVEKLLVQMYNKLRELDLNPELDASIELS
FT                   RNFGSEKISDYVRDQENFSTDNTPQVSRTPSAVFDQNDLGEATRLKPDVSKVLLSKLVK
FT                   YRLPFLTGHQQITLASTIEILTDILEKYQDVLDPNGLRFFLGYKLFLLNSTKVNQVYDS
FT                   ITMRDVNFALHSDNKDVLLNMILDQQTNSKNKLTWKLARKIQTFYSIDNDGKRDPSTCS
FT                   IFYLALRKKQILIGLWKNSIGHPEQSKMLRFLSQNFKEQRWKSAALKNAFVLMSKHRYL
FT                   DAAIFFLLGDSLKDCVNVLVKKLEDVPLAIAVARVYEGNDHGPVLKELLTNTILVSSAV
FT                   KGDRWTTSWVFWKLSDRNRSIQALIKNCSELIEDDQILSEISKSQRSVTIKDTIIERVM
FT                   DDPVMMIVYDGLRKKHIDYFKGLTNINPRLEFEFILRVVAIYERMGCDLISLYIVKNFN
FT                   FMKRTEIITHIIEKDQKVIKNGNTTHVDNGHAQLEQATKNGNVEVSPKIEENNSAISST
FT                   SSDHTRRKSVGFSKKLQPPPTEFQEPDMSSFNFGF"
FT   CDS_pept        join(645192..645204,645256..645668)
FT                   /locus_tag="PAS_chr2-1_0893"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0893"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68965"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0E1"
FT                   /protein_id="CAY68965.1"
FT                   /translation="MSQDSDPILSRLPLVAIPGKYTQPKPITLPYEFIKLPDQLNKNMF
FT                   NSKKDRLKSLVSDCNDLEEKLKLLTRSFNDDISEDHKGYNPVAYDQWVKETNSLAPGYF
FT                   DDQHHLLQPKKPKQIHDNTSTMDNLSQHFATTTLSPK"
FT   CDS_pept        645915..648149
FT                   /locus_tag="PAS_chr2-1_0346"
FT                   /product="Methionyl-tRNA synthetase, forms a complex with
FT                   glutamyl-tRNA synthetase (Gus1p) and Arc1p"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68966"
FT                   /db_xref="GOA:C4R0E2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR018285"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0E2"
FT                   /protein_id="CAY68966.1"
FT                   /translation="MTEQVYGSLGSGLLDLSDNLKLSIATSLFSKACVLQDKDVTETVL
FT                   LKTKSGFELFEPNAIVRYLASSRIGLDAFKRSNLSHFEEVVLYNVLKSGKSLTEPLLEL
FT                   PPINTSSPEQVILFSSLYPIKDSLPKSANTWISEFASKVEKAVAHAISITKLERAKEEN
FT                   TGASHVEAEFVKPQDASIKPKPNERNILITSALPYVNNVPHLGNIVGSVLSADIYARFC
FT                   KARNYNTLFICGTDEYGTATETKALEENVTPRELCTKYHKIHSDVYKWFQIGFDYFGRT
FT                   TTELQTEIAQDIFMKLYNNGYLEEQSMRQLYCPVHNGFLADRYVEGECPKCHYEDARGD
FT                   QCDKCGTLLDPFELINPRCKLDNASPEPKNSDHIFLSLDKLEPPLREWVAKASEEGKWS
FT                   KNSRTITDSWIKEGLLPRCITRDLVWGTPVPLDGFEKKVLYVWFDATIGYISITANYTK
FT                   HWKEWWKNPDHVDLYQFMGKDNVPFHTVVFPASEIGTGDKWTMLHHLSTTEYLQYEGGK
FT                   FSKSRGIGVFGNNAQDSGIPPSVWRYYLASIRPESSDSQFSWGEFVSKNNNELLANLGN
FT                   FVNRLTKFVNAKYNGVVPDYDVSNCENYEVLVRDVNAILKQYLIDLEGVHLRKGLEVAM
FT                   QLSARGNQFLQDNKLDNSLYNDKPAKSDAVVAIGLNLIYLVGSVIYPYMPETTTQINQI
FT                   LNTASLRIPDEFGLFIKAGHCINKAQYLFKRIDEKKVDEWRALYGGKQVK"
FT   CDS_pept        complement(648239..649051)
FT                   /locus_tag="PAS_chr2-1_0347"
FT                   /product="Protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68967"
FT                   /db_xref="GOA:C4R0E3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022495"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0E3"
FT                   /protein_id="CAY68967.1"
FT                   /translation="MSVQLITTAQELLNNIPLNVISQGAEAIVFETQTHPFLPKSNQSP
FT                   TTKFIIKYRPRKPYRHPTLDLQIVSSRTQSEARLLHKLYQLGIKAPKLIAVDGPNGIIW
FT                   MESVGGTLPNGETSSLKNMLWFKEKSQEEREDQRNEPNIALDDEVKDIMSKVGGAVAKL
FT                   HLANIVHGDLTSSNIILDQHNDKWEPMLIDFGLSSYSLLAEDEAVDLYVLERALISTHP
FT                   IYSKSYNEWLLQGYERTFREAAASKKFTEISRRLQDVRLRGRKRSMLG"
FT   CDS_pept        649270..649977
FT                   /locus_tag="PAS_chr2-1_0348"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68968"
FT                   /db_xref="GOA:C4R0E4"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0E4"
FT                   /protein_id="CAY68968.1"
FT                   /translation="MAFLTKDFILTTNKEEYPKALKAKAQTKKDQAKLLQLDNWKEEVI
FT                   SKTLDHRYQKESHLFLTKEELIKLVEWKLEKGKFRPTLRKLVSSNDETVVKQVTGRGYD
FT                   IFIAYIQGKEEFLTSVKKSLDEFCKLKGVGPATATLILSLFPSVGDKKVVPFFSDESFM
FT                   YFNDIKIKYTLREYLDIYLPKVEAIGEETGINDLSIIEKFTWTLFMNGKTDSNTSNSKR
FT                   ASEDTAAPTKRRK"
FT   CDS_pept        complement(650011..650985)
FT                   /locus_tag="PAS_chr2-1_0349"
FT                   /product="Mitochondrial integral inner membrane protein
FT                   required for membrane insertion of C-terminus of Cox2p"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68969"
FT                   /db_xref="GOA:C4R0E5"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0E5"
FT                   /protein_id="CAY68969.1"
FT                   /translation="MFRRIPHLKQRIGPNVVRLIPRRCMSLQVVQQTLEFTTTNLQLIH
FT                   QYSGLPWWALIPITTFTLRSLFTLPIAVLQRKRLQKQSVLRPLVTAMGPLLRLKLAQQA
FT                   SISQKLQRESIDFFPTEATKLNYEKIMILAAKESRKRQKKLFRDHGVQIWKNAILPVFQ
FT                   VPLWVTLSWTFRNLTGWHSFEQGNKPLDSSLIHEGFFWLHDLTVPDPYMILPVVLGSVA
FT                   LINLEWNNKTLQMRSSSAQGKKVSLRPTMMDAIMNLSRFSIAFLMVISTQAPVGLSLYW
FT                   ISSNLYSLSQNMILDKYLPISYTPNERHTQGISYNKHNLISDN"
FT   CDS_pept        complement(651310..651654)
FT                   /locus_tag="PAS_chr2-1_0350"
FT                   /product="Protein that forms a complex with Spt5p and
FT                   mediates both activation and inhibition of transcription"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68970"
FT                   /db_xref="GOA:C4R0E6"
FT                   /db_xref="InterPro:IPR009287"
FT                   /db_xref="InterPro:IPR022800"
FT                   /db_xref="InterPro:IPR029040"
FT                   /db_xref="InterPro:IPR038510"
FT                   /db_xref="PDB:5XON"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0E6"
FT                   /protein_id="CAY68970.1"
FT                   /translation="MSTNKGVRERACMLCGIVLPGRVFMQNGCPNCDSVLNLRDSDQAT
FT                   VNECTSSSFEGLVAVGDNEHSWVAKWLRVDRFQPGLYAVRVDGRLPSDIVAALEQYGVY
FT                   YRPRDGSVID"
FT   CDS_pept        complement(651824..653512)
FT                   /locus_tag="PAS_chr2-1_0351"
FT                   /product="High affinity methionine permease"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68971"
FT                   /db_xref="GOA:C4R0E7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0E7"
FT                   /protein_id="CAY68971.1"
FT                   /translation="MVGLGKFSLSSNSNDSKGETLDNKESKDVNAVAPIDTDSESVNAG
FT                   ELVVLDKGDRRIGLISAAFLITNRILGTGIFSVTSTILTLSGSVGVTLILWVVGMIIAL
FT                   AGLYVYAEFGSYPSRLLQRNGGEKNYLEYVYKNPKFLVTCMYAMYVVLLGWASGNSVVF
FT                   GEYILNAANVEPTEWAARGIGIACVSFAFLINTLNVKAGLFVMNTLGFFKVAIVLLISV
FT                   TGWVALGGGINNSEFEPTGAFSNAFDGDSPSGYGIVMSLYNVIWAFVGYSNVNYSLSEV
FT                   RNPVKALKISAPIAVISLGVIYMFVNIAYFAVVPGDVIRSSGRIIAAHFFRIAFGETAE
FT                   RACSVFVALSALGNVISVIFSQGRIVQQLGREGVLPFSSFFASQRPFNSPFTGLFEHWV
FT                   ICVITIVAPPAGDAYNFVMNLISYPLNIINFFVAIGLLWLHYEARKGRREWTPVIKSPI
FT                   VVTFFFALASLYLVVAPYIPPTGGQNVYNDMPYWIHCVAAWGVFFAGGVYWVIWAKILP
FT                   RYGKYKLVSRDVLEDDGFWRNKFFKIPYGSELSEEEFIEEHQKNL"
FT   CDS_pept        653722..653862
FT                   /locus_tag="PAS_chr2-1_0352"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68972"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0E8"
FT                   /protein_id="CAY68972.1"
FT                   /translation="MASQMKTTIQKLGQSNENCNLQVQYKESTNDSSLTYQLEIIGEYL
FT                   K"
FT   CDS_pept        655271..655654
FT                   /locus_tag="PAS_chr2-1_0353"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68973"
FT                   /db_xref="InterPro:IPR024368"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0E9"
FT                   /protein_id="CAY68973.1"
FT                   /translation="MSAFQDYCIVCDRLCVHNEIYCSAKCQELDSTPITLQGKDDIPHD
FT                   HYRTKLEEKNNFNYLSPLLSGAVVSNDINHLDLNDINSKSNQRSINISTPSSRHVNLIS
FT                   QYLASSASVNYKKWLNNTNLISH"
FT   CDS_pept        complement(655934..658237)
FT                   /locus_tag="PAS_chr2-1_0354"
FT                   /product="Ubiquitin-protein ligase involved in
FT                   ubiquitin-mediated protein degradation"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68974"
FT                   /db_xref="GOA:C4R0F0"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR024928"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR035983"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0F0"
FT                   /protein_id="CAY68974.1"
FT                   /translation="MSALQPMKITVQVVGADGLYKRDVFRSPDPFAVITVDGAQTKSTS
FT                   TAKRTLHPFWNESFEFNCTQNSILAIQIFDQKKFKKKDQGFLGVINLRIGDVIDLENDI
FT                   SQSETLTRPLKKSNDNLIVSGEVFITLSHKGRGRQGGAASHMSPPNGPPAELLTPGPSA
FT                   NDAGSNPPGLISASNRQYSSFEDQYGRLPPGWERRTDNFGRTYYVDHNSRTTTWTRPAL
FT                   DQSEADRTNQRVNATEAERRQHMDRSLPGENSSSTTVGNLSSSGSVNASNNQTALSMAS
FT                   NGYTTFGLGELPPGWEQRLTAEGRPYFVDHNTRTTTWVDPRRQQYIRSVGPNTTVQQQP
FT                   VSQLGPLPSGWEMRLTNTARVYFVDHNTKTTTWDDPRLPSSLDQNVPQYKRDFRRKVIY
FT                   FRSQPALRILPGQCHIKVRRSHIFEDSYQEIMRQSPEDLKKRLMIKFDGEEGLDYGGVS
FT                   REFFFLLSHDMFNPFYCLFEYSTHDNYTLQINPNSGINPEHLNYFKFIGRVVGLGIFHR
FT                   RFLDAFFVGALYKMILHKKVILQDMEGVDAEFYRSLKWILENDITDVLDLTFSAEDERF
FT                   GEIVTVDLKEGGRDIEVTEENKMEYVELITEWKIHRRVEQQFKAFMDGFNELIPQELIN
FT                   VFDERELELLIGGIADVDVEDWKKHTDYRGYQESDEVIQWFWKCVTEWDKEQKARLLQF
FT                   TTGTSRIPVNGFKDLQGSDGPRRFTIEKAGESNQLPKSHTCFNRVDLPPYKDYGSLKQK
FT                   LTLAVEETVGFGQE"
FT   CDS_pept        659263..660846
FT                   /locus_tag="PAS_chr2-1_0355"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68975"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0F1"
FT                   /protein_id="CAY68975.1"
FT                   /translation="MSKTFHDKQSYLDNWTFQNPSSDSLGSSSSESLLDRACSTGNLKL
FT                   LSNYWKVPSSDDNYNYLTAFDVHNDKPTVAIASGLGNSNLLIGSMKENTGISSKYHLNH
FT                   HQSITLPNIHSLKWLNNSSPGDFDFLLSGHVSGYVNLTIIPDKEDCDFKSAEIIKRFNH
FT                   EKHMTTKDQIQSNIISSLELSPKAWKSCNLNSMFTVYKDKIFMWDCSRSRAPILMNHSA
FT                   GSASLHPSPFRDGILGVAGKFGIALNDLRIGKDSNPSYFVPKIADRQIPESQLVKWSDT
FT                   DSNILASSHGNVVMLWDVRMNDTQLAILEGHNDEVTSLEWGSNQDLYSGSKDGGIVHWG
FT                   LDLDLLQPVTKPATCTLKDGLSSIRLKQTEDRSIVEDLVSSINCGTFIPASNSNIVELA
FT                   QIKLNGRKRLLSIDDSLFLGMHDTLELTERMPVISEQEEDEISSSNTVFSNPNTPQTFF
FT                   SSSDTLVSAKNEQLNFDFKDRAFSKPTTNTEDTLSLKQLPDLPKSLYTVPQQKQRDTLP
FT                   QVNSMIPEVV"
FT   CDS_pept        complement(660898..661896)
FT                   /locus_tag="PAS_chr2-1_0356"
FT                   /product="Esa1p-associated factor, nonessential component
FT                   of the NuA4 acetyltransferase complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68976"
FT                   /db_xref="GOA:C4R0F2"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR008676"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="InterPro:IPR025995"
FT                   /db_xref="InterPro:IPR026541"
FT                   /db_xref="InterPro:IPR038217"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0F2"
FT                   /protein_id="CAY68976.1"
FT                   /translation="MEEPNPPKLEINGKCLAYHGPLLYEAKILKTHQANSTSIVGPEGK
FT                   EEIDSKGFSNFPEAFMGKTCFYVHYKGWKPKWDEWVTVERLLVLSTDNLQLQKDLRNRT
FT                   MQKLKKPQKAVTPKLKAKLIATPAASSEEKNANGKAKPKRIKDCVLPELLKQETKDAGF
FT                   EISVSVALKELLVDDWERITKENKLVDIPSRHPVKDICNTYQSFVLEGVAKHSAFYDNT
FT                   LDFFQGLRVYFNTTLASILLYQFERKQLKELMNTSTEPLDYSSIYGPTHLLRLLVTLPS
FT                   LISQTKIDSQSLDFFKTTLNQLLLWLHKNIEQYFVDDYINTSPSYEALARI"
FT   CDS_pept        complement(662140..663417)
FT                   /locus_tag="PAS_chr2-1_0357"
FT                   /product="Palmitoylated, plasma membrane-bound casein
FT                   kinase I isoform"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68977"
FT                   /db_xref="GOA:C4R0F3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0F3"
FT                   /protein_id="CAY68977.1"
FT                   /translation="MSAQSPNIVASHYRIDVKIGEGSFGVIFKGYDLLRNNQPVAIKFE
FT                   SRKTKVPQLKDEFTAYKQLNSRIEYHRRYQQGQTSLGGQDTDDENLDVVKYEGIPKVYY
FT                   FGNEGLYNILIIQLLGPSLEDLFDWCGRQFSNLTVAMIARQMIERIRLVHDNLLIYRDI
FT                   KPDNFLIGDYEGTGQDNLIYLVDFGMVKQYRNPNTGKHIPYREKKALSGTARYMSINTH
FT                   LGREQSRRDDLESLGHVFLYFLKGELPWQGLKANSNKEKYEKIGEKKRNTPLEEICAGF
FT                   PPQFRRYMEYVRSLKFEDTPDYAYLIGLMNEVVRIETEGIEPITPAPASSSSQAPSVDL
FT                   RYDWMRLNDGKGWNWATNKKTNLNGYSQPKKNRPTPVSNLPQRKRTDKKLTDSKFPNYG
FT                   SNYGSNNYARQQAETTERSHSYCCCW"
FT   CDS_pept        complement(663798..664970)
FT                   /locus_tag="PAS_chr2-1_0358"
FT                   /product="Cystathionine beta-lyase, converts cystathionine
FT                   into homocysteine"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68978"
FT                   /db_xref="GOA:C4R0F4"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006238"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0F4"
FT                   /protein_id="CAY68978.1"
FT                   /translation="MEEKFDIETELVRLGFEDQYNSCNPPLYQTATFRQDSLSNMGAYD
FT                   YTRSGNPTRTTLQNYLSRIMGAKATFAVSSGMSALDVIVRLLDPGDEVIAGDDLYGGTH
FT                   RLLTFLKNKKQLIVNHYDTTDTELMKQKITKNTRMIFLESPTNPLIKVVDVRSITAHAH
FT                   EINPNCIVVFDNTMMSPVLMSPLTDLGVDIQYESATKYLNGHHDIMSGVLATNSEKLAQ
FT                   DLYFVINSTGCGLAPFDCWLLLRGLKTLALRIERQQENAIKIAQFLITVPGLKVRSVAL
FT                   PDHPQYELHKSMAKGPGAVLSFETGSVETSSKIIEACKIWSITVSFGCVNSLISLPCQM
FT                   SHASIDPDTRAERDLPEDLVRLCVGIENVNDLIKDLAAALRVGGISVPAQ"
FT   CDS_pept        665380..666105
FT                   /locus_tag="PAS_chr2-1_0359"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68979"
FT                   /db_xref="GOA:C4R0F5"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0F5"
FT                   /protein_id="CAY68979.1"
FT                   /translation="MSLLRLLPKATKPLQQRIVTVTPKRFSHMISVHRDTPKDNPEIPF
FT                   EFTKENLERAKEIIAKYPPQYKKGAVMPLLDLGQRQLGFTSISVMNYVAKYLDMPPMRV
FT                   YEVATFYTMYNRKPMGKYNVQVCTTTPCQLCGSDGIMKAITEHLQIRPGQTTPDNLFTL
FT                   QEVECLGACVNAPMIAVNDDFYEDLTPERTVEILKGFQSGDIPKPGPADRHSCEPHSGP
FT                   KVLTNETPYHVKDFIRDDL"
FT   CDS_pept        complement(666916..668013)
FT                   /locus_tag="PAS_chr2-1_0360"
FT                   /product="Putative protein with sequence similarity to
FT                   hydroxyacid dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68980"
FT                   /db_xref="GOA:C4R0F6"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0F6"
FT                   /protein_id="CAY68980.1"
FT                   /translation="MSKPQVLFIGEPNRDLPEFHEFSAQFECIHYKITSKETLLEDLQG
FT                   KLSKVVAIYGSWLGFHPVGGLTEDIVQALPDSLKLVTSCSVGLDGWGSEQLAKRGIKLY
FT                   NCPSLGAEQVADLVLYHTLQSFRYFKVFEDNFRESGHTVKTRSLLQSASLDKQTGKVVL
FT                   NSTDSSDYAFGHRLGDSLPILTPFGKNAVVVGFGSIGSRIAKRLHAIGMNISYVKRTRL
FT                   SSEQEAQLLFPVKYYASLKEAAPVADLVVLSLPGTSETENLYNKEIIDLVPHRSRVINV
FT                   GRGTIVNEDDLLAGLRSGKLSFAGLDVYAKEPAVSRELIERQDVILTPHIGSSTVENFN
FT                   DTSIFCLRNIQDVILYGKEGLSRVN"
FT   CDS_pept        complement(join(668216..668676,668865..668889))
FT                   /locus_tag="PAS_chr2-1_0361"
FT                   /product="Subunit IV of cytochrome c oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68981"
FT                   /db_xref="GOA:C4R0F7"
FT                   /db_xref="InterPro:IPR002124"
FT                   /db_xref="InterPro:IPR036972"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0F7"
FT                   /protein_id="CAY68981.1"
FT                   /translation="MRKRDIHTMLRQCLPRVRPASRLFSTASILRQQTPKQFKTATSIA
FT                   EVEGLENLVGPGAKTGTVPTDLEQATGLERYELLGKLEGIEVFDETPLEAVRKGTMKDP
FT                   ILIDSYDDYRYVGCTGVPADSHNIEWLKPTTEKNARCWECGSVYKLNFLGSGKPHHH"
FT   CDS_pept        669261..669620
FT                   /locus_tag="PAS_chr2-1_0362"
FT                   /product="Non-essential regulatory subunit B of protein
FT                   phosphatase 2A, which has multiple roles in mitosis an"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68982"
FT                   /db_xref="GOA:C4R0F8"
FT                   /db_xref="InterPro:IPR000892"
FT                   /db_xref="InterPro:IPR038551"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0F8"
FT                   /protein_id="CAY68982.1"
FT                   /translation="MPKKRASNGRNKKGRGHVKFVRCLNCARCVPKDKAIKRVTIRNMV
FT                   EAAAVRDLSEASVYEEYALPKLYNKLHYCVSCAIHTRIVRVRSRSDRRIRAPPQRQRFS
FT                   NDRRVNPAEAAKKAL"
FT   CDS_pept        670022..671401
FT                   /locus_tag="PAS_chr2-1_0831"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0831"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68983"
FT                   /db_xref="GOA:C4R0F9"
FT                   /db_xref="InterPro:IPR000009"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR018067"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0F9"
FT                   /protein_id="CAY68983.1"
FT                   /translation="MEEHNWKFSQCFGDKGDVETITEADIISTVEFDHTGDFLATGDRG
FT                   GRIVLFERNESKNNCEYRFYTEFQSHDAEFDYLKSLEIEEKINKIKWLKRSNTSNMLLS
FT                   TNDKTIKLWKIFEKQIKMVSENNLSENSNLMNTGNETLSAANISSKLLSINNLKLPRLT
FT                   LHDTITSAQPKKIYANAHAYHINSISVNSDGETFISADDLRINLWNLGIADQSFNIVDI
FT                   KPVNMEELTEVITSAEFHPENCNLFMYSSSKGTIKLADMRVSSLCDNYSKVFEECIDPT
FT                   NHNFFTEITSSISDVKFSPNGKYIVSRDYMTVKIWDVAMESEPLKTINIHEQLRDRLCD
FT                   TYENDAIFDKFEVQFSGDNDSIMTGSYNNNFMIYPNAVSSSSKTVSENEIVLQADKSAF
FT                   KAKKLNSRRKEPSNGLSMMRKEMQFDDIDFKKSILNLSWHPRENSVAIAATNNLYIFST
FT                   L"
FT   CDS_pept        complement(671502..671867)
FT                   /locus_tag="PAS_chr2-1_0363"
FT                   /product="Subunit VIa of cytochrome c oxidase, which is the
FT                   terminal member of the mitochondrial inner membran"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68984"
FT                   /db_xref="GOA:C4R0G0"
FT                   /db_xref="InterPro:IPR001349"
FT                   /db_xref="InterPro:IPR036418"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0G0"
FT                   /protein_id="CAY68984.1"
FT                   /translation="MFRTAASSIGRRGFTTVKGDPAKAQAFKKHLDDVYHHSKGTTALW
FT                   KKISYFVALPAIALTAVNTYFVEAEHAEHRAHNRHLSDEEWPKAYPYQNVRRVDFFWGD
FT                   GDKTLFWNPDVNRHVKE"
FT   CDS_pept        complement(join(672021..672997,673096..673438))
FT                   /locus_tag="PAS_chr2-1_0364"
FT                   /product="Probable mRNA N6-adenosine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68985"
FT                   /db_xref="GOA:C4R0G1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007757"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0G1"
FT                   /protein_id="CAY68985.1"
FT                   /translation="METILPLLLGYGNSLLRFPVEGNVSSLFRLQSTLRWHEFLAGLIR
FT                   VNKLSNSLEFDTDIYKFYAEALTDVEDQSKSYNCSVRIKNINCLALEILEENLPGLNVS
FT                   TDLKENKKKPRALRLSNEKMKEETKEEPTFEICNQSKHAEILAGIDIDRCAESLKRSRK
FT                   TQLLKCLETKIHFVPIIKSHTDPKLGDCSYLDTCHKLKTCKYLHYYQTVPTLAANKPPP
FT                   PNSPTLEVLASYTKGEPISKTLCKQLPAQWINCDVRKLNFNRLGKFAAIIADPPWNIHT
FT                   NSIESNETELLKIPVDQIQDEGIFLLWVTVRSTSIGRAWLLENGYTVSSELIWVKTNQL
FT                   GRNICTGRTGHWLNHSKEHLLVGIKGRCTWLQRGLFDDIILASTRETGRKPDELYVMVE
FT                   KMVGEHARKLEIFGKQHNVRPGWLTIGNQLEGNNVVEDLI"
FT   CDS_pept        join(673798..673849,673909..674453)
FT                   /locus_tag="PAS_chr2-1_0365"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68986"
FT                   /db_xref="GOA:C4R0G2"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0G2"
FT                   /protein_id="CAY68986.1"
FT                   /translation="MGLLDLEQQLAFYRAYHFNKVNVAIHLVFVPTILFSTVGFLSAIP
FT                   LNQITPFDLSGVPFFGKLYNLGAFLIASFSIYYILLDRLGLVLTPLLLLISYSISTLYD
FT                   FYDKSEVVKGSLVLFGIGWAVQFVGHALFERRAPALFDNLVQALVLAPYFVAFEVVFAL
FT                   GFRKDLQKKMNNHAGKLMLEFRTREKGHPVVEKTD"
FT   CDS_pept        674845..678396
FT                   /locus_tag="PAS_chr2-1_0366"
FT                   /product="Cytoskeletal protein binding protein required for
FT                   assembly of the cortical actin cytoskeleton"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68987"
FT                   /db_xref="GOA:C4R0G3"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR007131"
FT                   /db_xref="InterPro:IPR029922"
FT                   /db_xref="InterPro:IPR035800"
FT                   /db_xref="InterPro:IPR035821"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="InterPro:IPR038159"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0G3"
FT                   /protein_id="CAY68987.1"
FT                   /translation="MTSVFLGVYRALFDYQAQNDEELTVHENDLLYVLEKSEIDDWWKV
FT                   KQRVIGVNVEEPIGLVPSTYIEPATPIGSAVALYDYDRQTEEEITFKENDTFDVYDTDD
FT                   QEWILVGLNNIHFGFVPANYIQISLGTTAPASNNPPILSPASFPPPPQRINNSSVPSLK
FT                   DAEPARNLEDDNAYEEEEDVPPPMPTRPTATTATSNISAPQDSESEEEPSSSSRRPSGR
FT                   SRADDDFVKGDYFTWDVQEINGRKKRKAVLGIGNGSIYVQAEGHSSKKWDIRNLTNFSN
FT                   EKKHVFFDFTNPSASYELHAGSKDAADAILSIVGDLKGASSMRALKEVKAASSAPKTKT
FT                   GKVSYNFDAESPDELSIREGDVVYILNDKESSEWWIVQDVNTNKKGVVPASYIELISGG
FT                   GSTLASIGSSISKGSKKAFGSSRKRKEKERKHLEEQRAAKRETERERQRLRSKEERDRL
FT                   RKLDEKERRKKQKATPQDEDQPETSKPNPHRVRTWIDSSGSFKVEAEYLGVVDGKIHLH
FT                   KTNGVKIAVAAPKLSLEDLEYVERITGMSLEKYKPKPKSSGSYSRPSKKPSSRESSPKE
FT                   SSRSGVKQSVPKIDPPKDPDYDWFQFFLGCDIDPNNCQRYSVVFINEQLDESSLQDLTP
FT                   SLLRSLGLREGDILRVQKFLDNKFGRTKAQESATNGGLFTKSDGTLKNNRSTDVLTSTV
FT                   VTRETLSPTKAEAKSKRIDDEAWALKPAAESSSQMDQFSRPVSAMSKQLTGSIQDLVNL
FT                   KPLGDNANNASVAHKAETPNTTQDKPSAPVLEPVKTGAARGPVQAQPTSGGFVTAQPTG
FT                   ALVAMPTGFMPITMVPVKTGGTIALQPTGGFVSLQRTGGVLPQVTGGLVPVQTGGLVMP
FT                   QTSFGVTPTLQPTGGILPAQRTGGLVPVQRTGGLIPVQQTGRLVPVQQTGGLIPVQRTG
FT                   GLVPVQRTGNLQPVPTTSFGSQPTGTFVPQSSFGNQLATNLNNPQTTFGSQPTGGFPQT
FT                   SFAQNQFRQSTGGFQQTPIVQQTGGFPQYSAGQQTVGFPQNSFGQQTGGIAQNSFGQQT
FT                   GGYQTGFQGNGSIPMPQSSFGASNLGFNGATQQNYNIGMGQSLPAASIPPLQPSYTSSL
FT                   NGMSNMLQNVSISQQPQQAQPMTTFGAPVAQPPLQAQPTGFGFGNSPYGGQNPLQSQPT
FT                   GKRANLSAATADNPFGF"
FT   CDS_pept        678663..680777
FT                   /locus_tag="PAS_chr2-1_0367"
FT                   /product="Essential protein required for chromosome
FT                   condensation"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68988"
FT                   /db_xref="GOA:C4R0G4"
FT                   /db_xref="InterPro:IPR022816"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0G4"
FT                   /protein_id="CAY68988.1"
FT                   /translation="MSQVAPQSGTQPTEQENFDFWIRMATDNKITSTNSWNFALIDYFH
FT                   DLTVLKEGNSINFQKASATLDGCVKIYSSRVDSIATETGKLLSGLTVNKLNEKQNEEND
FT                   SESDEDPIENTQGGDDRNENRPKAKKRNTAAVNTLVEFSKLQTKSIDTELTVDPLFKKA
FT                   LTDFDEGGAKSLLLNILKIDRDCRIVFDTSSERTIQTNEETQPLDMNSNDSIENKEIDV
FT                   NLLRRFLPDNLDKLHLCPSAPEIEKVLDEGAAPTTLLQRIEEDNAPDENEDNCFSGPLM
FT                   DMDDNFNEIPTIVHNNITSKYSLFSGNEESGPNITLNRLFDENFVSRTVDSEDTSNVHE
FT                   HNVLDHFDNMLRKTWMGPQNFKIAQLQLRHERTPQPVNTGIPTEDSNDLHGTVKRRKNE
FT                   FTIDFSTEDDIEDIFESSDNLLMPKSNWFSETHNLLPDDKNFTTKRMIHLFTKSDKVIN
FT                   SALFPKKKKMQQRSYEDEYQPADEEYFASKYAEAKNNRVKNLIQDDLKEIQESFDDQYV
FT                   GSPHGDRQYQEGENFDNEPDDYADNNFNDMDEAAEDDFNPSNLSYSKKGGFGSQLVTSV
FT                   GRFRPSSINFAKVSKRVDVKLLKDNLWETLTWAKSNIFQKPSQPSQPSQENDDPDDEEE
FT                   RVISEAENEPTHSELKFTDVVKQMTQKYSNEEKNEISTSFCFICLLHLANENGLTIENS
FT                   GDQSDLIIKN"
FT   CDS_pept        complement(680824..683175)
FT                   /locus_tag="PAS_chr2-1_0368"
FT                   /product="Isopropylmalate isomerase, catalyzes the second
FT                   step in the leucine biosynthesis pathway"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68989"
FT                   /db_xref="GOA:C4R0G5"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR012235"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0G5"
FT                   /protein_id="CAY68989.1"
FT                   /translation="MPSTGEIKNPKTLYDKVFEDHVVHKDESGSYLLYIDRHLVHEVTS
FT                   PQAFEGLKNAGRVVRRKDCTLATVDHNIPTDSRKNLTTLDKFIKQDDSRLQVKTLEQNV
FT                   KDFDVTYFGMKDSRQGIVHVVGPEQGFTLPGTTVVCGDSHTSTHGAFGSLAFGIGTSEV
FT                   EHVLATQTIIQAKSKNMRITIEGELDEGITSKDLVLHVIGVIGTAGGTGSVIEFAGKAI
FT                   EDLTMEARMSICNMAIEAGARAGMIRPDETTFKYIEGRPLAPKGEQWTKALNYWKTLYS
FT                   DEGAKFDYEIVIKAKDIVPTITWGTSPQDALPITASVPDPEKVEDPIKKSGMERALSYM
FT                   GLTPNVPLKDIKIDKVFIGSCTNSRLEDLRAAAKVVKGHKKSDNVKLALVVPGSGLIKL
FT                   QAEKEGLDKIFEEAGFSWREAGCSMCLGMNPDILDPEERCASTSNRNFEGRQGARSRTH
FT                   LMSPAMAAAAGIAGHFVDIREFEYKEDKSQPKIAIQSEEDAELQDAVYEHEKKPLAEGE
FT                   SKDELEEDEIKDIPPPDHTVQETPLKTSAPAVAAAMEKFLTVEGIAAPLDKANVDTDAI
FT                   IPKQFLKTIKRTGLKAGLFYELRFVKDDQGKDVETDFVLNVEPYRSASILCVTGDNFGC
FT                   GSSREHAPWALKDFGIRSIIAPSFGDIFYNNSFKNGLLPIRIDQDIILSKLYPVATSGK
FT                   KLTIDLPNQQILGPDKEVLVEHFEVEDFRKHCLINGLDDIGITLQKEEFINKYEEMRRD
FT                   RFSFLEGGSKLIVPARGTKRSRYGNKAQEW"
FT   CDS_pept        complement(join(683375..685636,685699..685749))
FT                   /locus_tag="PAS_chr2-1_0369"
FT                   /product="Ubiquitin-protein ligase, member of the cullin
FT                   family with similarity to Cdc53p and human CUL3"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68990"
FT                   /db_xref="GOA:C4R0G6"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR016157"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="InterPro:IPR019559"
FT                   /db_xref="InterPro:IPR036317"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0G6"
FT                   /protein_id="CAY68990.1"
FT                   /translation="MLGGNEIRKSKIRTPKKAFLSQVDYEKSWEQLDEAIKQIYQKNAS
FT                   TLSFEELYRKTYNLVLRKQGKFLYDNIYNSIKSHLENDVRPRMTQFMEDDKIDKAVLLQ
FT                   NMSTEWNDHLLSMRMISDFAMYLDRVYVKEAHLPLIYDIGLQLFRDYVILPNDNIVGKK
FT                   IIGLLLQSIDEIRSNKIVDKFLIKNIIFMFESLPDEAGNYYDTYVEPDFLEDSRLYFEK
FT                   VSSELLLEQNGSLFINNIIRLIEEEQNRTALYLPLSTLPKLVELMDKALIATNIEAVLA
FT                   FENEGLSKWVAAESVFELNSLYKLIGRIDEEYHILRTHLKRLLISFGEALDESTSKTIA
FT                   DGPDTPKKKATTHFVTIWIESILTQRDVYERILQNCFNRDIHIAKTIDASFALILNANK
FT                   RISEYLSLYIDHFIKQSLKEKSENESEEILTKAVAIFSFIHDKDVFEKYYKNHLAKRLL
FT                   NPKSNSYDIERNLISKFKSIAGETFVSKLSSMFRDINISKEESKQFQVQLQQDDILPLN
FT                   NNKKVSMDVNVLTHLIWPLPLTETNVQFPEILFNLKEQYAAFYAQKHQNRKFNWAPNFG
FT                   TVDMRMTYGRKTYEVNMPTYSAIIILALFSTDYKAQYTYAQIHQELQIPENDLKRQLLS
FT                   ISVAPKTRLLVKRPMSKEINPEDIFQINEKFQSPQIKIKVLTVSTASKLENDQQRSSTL
FT                   TEVNKDRKFETDAAIVRIMKARKTLTHNNLMNETIKQLANRFSPPPSLIKQRIESLLEK
FT                   EYMERDSKERNLYHYLA"
FT   CDS_pept        685937..687634
FT                   /locus_tag="PAS_chr2-1_0370"
FT                   /product="Component of the Swr1p complex that incorporates
FT                   Htz1p into chromatin"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68991"
FT                   /db_xref="GOA:C4R0G7"
FT                   /db_xref="InterPro:IPR027109"
FT                   /db_xref="InterPro:IPR032563"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0G7"
FT                   /protein_id="CAY68991.1"
FT                   /translation="MSSDILDVLSISGRSNLSNQKKKITKDGPTKKKKQTAMSRELFNL
FT                   IGQNTPPLAVEKTVKFKEKLNVNNKPTPWSYVEFSNDARESKDGLKLHHWIKGSSELAK
FT                   NSPYLFEKYNQKIQIPSFTKEEYDEFLKDLDLECREREKRDKALKEQEAKEAEKLEKEK
FT                   ENDKERVNGDELGKEEDNASDFVPKKENVNDQILPKIDEPQTNKKDDMESTEDVSKSDS
FT                   QEVSKDVNPSEEVEASWDYDETVHLFQLCEKWDLRWPIIVDRYEYDERSMEELKERFYK
FT                   VSERILRHKYRNVTMDDKTSLLVQTLSSFDKRRETERKQYLRRLLSRSPTEIAEEESLV
FT                   IEARKFELAAKKMLTERASLLRLLDSPQSTGSISQYLTSQGLTQLYNTLMSADRSKRRK
FT                   VETPTPPQIPPGASSSLHRTSMDLKRKAAKKIGPNALLENIKATGNSVPPSGNAPQSAA
FT                   IELINTKMTPEEKEAYGIKIHQEKLQPGVSLRSARLPTFKPATQAKIVVVLNELEVSPK
FT                   PTIPTAKVVAQYDNLLQTINVLLETKKQVNKLEVELNLLEGKEEDKES"
FT   CDS_pept        complement(687712..692589)
FT                   /locus_tag="PAS_chr2-1_0371"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68992"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0G8"
FT                   /protein_id="CAY68992.1"
FT                   /translation="MEVIPDSDIEIERIQLPTNVSQPKLRRRNLRRRTFSQRHVFTKDL
FT                   AELLGLATEEDFEKWEDDGLDDEEITQKLSRNYDRMRIKFEAKQVKRHPFKKSSFDQYV
FT                   VDFRNYQANNKSSRGFYELLQTIDTHKKQHDIPRLTSDEEEDGHDSKEKQDYPTTRSPQ
FT                   RDTLKVDLNVPIINLDTSSPIQHRNSINQPRLEATEENCSAPRDRNTLEHDTYELPPDE
FT                   PSEYTEPIDLDLHRVPSSPEVAKSTSTSRFRSRKFSQTHIYTTYNSVLLHLLTGDQLDE
FT                   LYEGGKSVKEINDILDHMYQQKYQRMEREDNLPKLYRQRPTFFDWLSNNERPTQHLVSE
FT                   SENDSEYSQNETDQSSLIGNDSEFESDTEQMDSSPKAVFRGREYRSLNDMTKGVLPASY
FT                   FKTSFYHDSIKRATTKSIQMNSKKRKINQTETNQPSISTFINDAYISDNSDLELNTNPF
FT                   VDSNDYNDHLTPAVDLTHYNTQDNVDVLEDNRPEIDFMLTRSSNGHNTANKTKSRNSTS
FT                   RHSPRITNRRSRKTKSFPAQHSVTTTVKQRSFINSRKKQSAITKSFKNQGQSVLECSAG
FT                   HLKKFVKDDRFEYNREPLITMNPFVSDVVYLPQPTRDIMAPIVLNDITNTGQSDLFLNS
FT                   KVMRSTLEIGEPTFYYGPDSDKLELKIQGNILVLSLLDKEGSISNINSFINSVLSIVKR
FT                   GHLMEIDYLCFVEGLKRLLEWTLYLSNSKTDTKPLLKTFLRLSELADKLPPTTGSITTL
FT                   GYLSLLFWQTFKLYSKFNGSESGATLSLQITFKKIVQCYFEAIIAFGIHKFHQHIKMDD
FT                   THLETLKIVHTILTKDDPFGFWMEINRALSSRLRSSPQETLDISSDITLLFVTYLDLPE
FT                   NWSLLFQLCKSFAILKWFSGDTPSNLLRQFHMLHQVKGWKITFDVVSVAYKIISANKFD
FT                   NFDCDDLNLELLNEVVSPEALVKDSTMVLYLRLLKLFKDTSPGKLELNSLDRIVPIGMI
FT                   KHDNHQILQNRINLLLTMTWLFGEHIDFTQNWLSILDASFDFKTQNSIQMITQAITRVT
FT                   EHNLTLGKPLSFDLISQFFKRFTDASRVTKFVYPKSLINELSAIVRKGYFSLTKNSLRY
FT                   RVIESIESIFLFPDHVFISLGVELFLTFLEPYFSSDEYDEGDMSFKLRDRIKRKFYGLI
FT                   SNDITEALKLGETKEEYFLLTQLYVKISVLLEIDSGKLLYLDWKCKGSVEELRKYELVF
FT                   YTSLLRYGDSKEVFQTGSQEFLKCIAYHVPRNDSMLFPFVNEINPFLHIPEADIFLVSS
FT                   IVFDNLRSQFGRAFLNHVFLQKVNKDDIMDILIDSIYQLHSTNHESDIATVSMHRDLIS
FT                   FLNRKASLQLRYNSRFCFLRNAFGIKAPDLNVVEFEQSFLEQNSDLKKIIFLEKELIHS
FT                   MGQADMHGLLRKMKKLFANYESPHKDYRNSRYYFLSLLICIHVKLIPKMTLNWVIVSLL
FT                   LEFLHEIILQKCTLTQPDVWCLCKLQYSFSELSNFRNSKYQYYEFSSLRYIAEILHVVL
FT                   GVFAGYQDQKDYCDLIKYAVRREYLYERIQVENTYLFASSDMISETSDLLSQSKDSMKF
FT                   DTRELLIDDQKIECEMAFARLEIALGELDQNVDVDVSPPSEITQFI"
FT   CDS_pept        692741..694888
FT                   /locus_tag="PAS_chr2-1_0372"
FT                   /product="Actin-and formin-interacting protein, involved in
FT                   actin cable nucleation and polarized cell growth"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68993"
FT                   /db_xref="GOA:C4R0G9"
FT                   /db_xref="InterPro:IPR005613"
FT                   /db_xref="InterPro:IPR022782"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0G9"
FT                   /protein_id="CAY68993.1"
FT                   /translation="MHILASSRSASPTGSTTMSDTSNGQRHSSHYSATSVLVNTKRLVE
FT                   TLTRWAKGTSSAADVSDAYVQLGNVFKLACRTFQQAGVDITNIGDIPRDLRVILQAAIY
FT                   EEQSQQTLDKYLPDIRKIITNLITKLKEKQQQMREIEDSKNLGRNLSAHSSQRSVSGPP
FT                   VSKAYSQRSSSSADNSPQSKDPLAKLQKEESLKRRASRRFSAYQYAKLANFVPEREYPV
FT                   PNPTGSKSPYQELSNPNSAARSLSKSPESVKSSSRFASSNVPALTSEVGQTNSPSGSKS
FT                   SHAPDGERVHIYLKLHQETKKANISIPTSLTSLRLLFIQKFSYSPGTDAFPDIYIEDPK
FT                   VSVRYELEESYLGDIQEGTILSLNVPDPTTILIKGLEAQLSSLKLQVSEVQTNVLSEVK
FT                   DIVATNNRNPSIAATDDSSSSKTMVNGAALSNADLDELVSIRQDLSKAKQVYSDNKNNF
FT                   TKTVHSLLEKLQQFQSANVSSSHSANRTIMINSQERLSVECETLLTKTDDLQDIIEGLR
FT                   KDVSTRRARPSKKNLQYVSKEIEEAKADLKKVSEYIANEKETWKKIWESELNTVCEEQK
FT                   FLNLQEELVEDLNEDLARAYETFSLVEECCEQLEKTPASKITPNLPIPEPGENLNNVRT
FT                   ALMSEVELLQPDHQNRVEAIERAERLREKQKQLTMVNEFQEELGGFVEGQKLKKSGGIE
FT                   ETEKIRKLKDEQNLKGNYGYL"
FT   CDS_pept        complement(694896..697181)
FT                   /locus_tag="PAS_chr2-1_0373"
FT                   /product="Reverse transcriptase subunit of the telomerase
FT                   holoenzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68994"
FT                   /db_xref="GOA:C4R0H0"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR003545"
FT                   /db_xref="InterPro:IPR021891"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0H0"
FT                   /protein_id="CAY68994.1"
FT                   /translation="MLLKRWLDERDIVLRGFQSSQLKRFLNVEVEHCPVDINVRLDNEL
FT                   DQLSHNEIIDYVIKQLIKANKQHCVSIGYKAGESVGAEYYCEASSFQVNVLKSSEWRIL
FT                   HESMGSPLFIDLLINYKGCMPHDSTFIQLFGPLDEVPSNKNSRNSQTFRLRNLLRFRQK
FT                   LSPIPETPLQLIRIMLVRGSEFDPNLEKARELCNRIYYKHSRCKYMYIYDSICSPKRER
FT                   CSDNFDYALEKKKVVKFVLVICDTIFPLELFGDKFNKRMAFKNISKFLLSSKEDSFSVN
FT                   DFANRIKLNSITWLRNNPQTGNRPCNKQEFRLKQNVFFHFIEWLFKTFLRNLVASFFYV
FT                   VERASSSEILYYDPRVWRKISKPYADSLFSKTFAKMQATNPNPSCQKSILRILPKKHDF
FT                   RPIAASASRDIHFILDMMARLRPTSKILQDLRPDFLKISPSQIPKTVYTFKQKLLRHHE
FT                   CLPQVYAIKFDIKNCFDSLPRQKILQCCQKILPERTFFLSSSYNYNETPNRLYSTQKLF
FT                   TDVNLSSDRTPDGLIHRNKVTKLNRTALLEIIKESLDQPLVSKAGTYQRKIGVFQGHSL
FT                   SSTFCDVVYDQLVLEYFANILDDENSLLMRFADDFLILSTSWTTIDDVRKRASLGFPDY
FT                   NAFTNKDKTIAHHNSQTFELMYCGVSINLQELTTSRISTDFPISNLPPFYSEKLFSKLL
FT                   TLFRFRVSPKIIFYNPPEAQWKTVQCAWDNIMLLLKKNKVRKFPVKRFCKDCNEYLRSL
FT                   NIEGSLQI"
FT   CDS_pept        697325..698242
FT                   /locus_tag="PAS_chr2-1_0374"
FT                   /product="Subunit of tRNA-specific adenosine-34 deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68995"
FT                   /db_xref="GOA:C4R0H1"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0H1"
FT                   /protein_id="CAY68995.1"
FT                   /translation="MKESPHKIDFKDGIFDNCLQKLIKDGIGQENMNMQEVWVMEINPK
FT                   DSSKVNGMLRELKNFHLLPFLKKFQKRTVESETGNSTVLDVLIGETSKLQSEEEVNALL
FT                   KVDGKLRRVNVPSNYPPTKELCTEWSKIWPIVWKGNPIVQELNSIRLDIQEISENLRKI
FT                   SELSVSPPLKDELPIFTMVADRKGKVLTIKQDERKNHQLHHSTMLAIRDVAKLQQNDPK
FT                   SYLLLDCVIYTTHEPCPMCCMALLHSRIERLVFLKDMTTGGLKFHEGYGYGIQTACTLN
FT                   WKFDAYRWCGDEIPVGIVDDLAYA"
FT   CDS_pept        complement(698875..699966)
FT                   /locus_tag="PAS_chr2-1_0375"
FT                   /product="Component of the RSC chromatin remodeling
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68996"
FT                   /db_xref="GOA:C4R0H2"
FT                   /db_xref="InterPro:IPR006939"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0H2"
FT                   /protein_id="CAY68996.1"
FT                   /translation="MAPVLEKPLFPQALSSSFASRTRNGETGIFISAAAPRSTKRNTAV
FT                   VNYAEFERDFEEDDKDEDFYDDLVDISLMANRSNNSNSHINVSSNFQGKEAVPTVGTTF
FT                   SDQQILYNSSLPELVIPIKINIEYNGNKIQDCFLWNINETLITPESFAAIFCNDMELPN
FT                   SCIQQIETQINNQIEEFSPFVTLQFPKDGVDSKHCVIQVSVNIGKQLYEDQIEWDLNND
FT                   SYTPEQFAHDVVSDMGLAPEFKPAISVAIHEQLLKLKKEYVENPQLNIFQQHNLPRYNQ
FT                   CYQKQPNIYDVSSDYQGLRYDKDAGEKWTPRVEFLSQWEIEKREIERERNIRRMKRESM
FT                   RHGEDRNKRRATRRKYDDDGLRL"
FT   CDS_pept        join(700204..700283,700502..701057)
FT                   /locus_tag="PAS_chr2-1_0376"
FT                   /product="Putative GTPase, member of the Obg family"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68997"
FT                   /db_xref="GOA:C4R0H3"
FT                   /db_xref="InterPro:IPR001326"
FT                   /db_xref="InterPro:IPR014038"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR018940"
FT                   /db_xref="InterPro:IPR036219"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0H3"
FT                   /protein_id="CAY68997.1"
FT                   /translation="MSFSDFSKVETISELNDLLADKSYIDGTSPTQIDVVVYKAFQKQA
FT                   PNFARWFNHIASFTDEFDTLPEGNAPAAAVAAELAEEEEDVDFFGSDDEEEDEAAEKLK
FT                   QERLAAYAAKKAAKGPGPAAKSLVTLDVKPWDDETNMQDLLDNVKAIKWDGLVWGAHTF
FT                   VPVGFGIKKLQINLVVEDEKVSLADLQQLIEEDEDHVQSTDIAAMSKL"
FT   CDS_pept        701666..703273
FT                   /locus_tag="PAS_chr2-1_0832"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0832"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68998"
FT                   /db_xref="GOA:C4R0H4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0H4"
FT                   /protein_id="CAY68998.1"
FT                   /translation="MFNRVFRRSFSNARYLRSSLESSVPDNAPTQKENMKWLGKVASMS
FT                   KKSDTELTNDQSTFTVEKFPNPTQESTTPEPYTIVKRPDSVEDPFFTISVPASNYFLNS
FT                   SAFSNLSYNQRPKAESSQPFSDIRVLKLRSGRGGNGAVSFLREANRSKGPPNGGDGGTG
FT                   GDIYVQTASHMHSLHKLSSRYLAEDGSSGEKNQLDGKRGRDVVIEVPVGTHIQWCPDPL
FT                   AIRKSQKQKRSLAFHIKAVGEDYLAYKPENIQFFRNSYQPGEGWIFKDRDQEYHMARDF
FT                   FVKLKKNMTAYDKEQTKAELHNDIFPLEGIDLDSPMKEPLLLLKGGKGGLGNMHFLTDD
FT                   IRNPRFSKVGRPGLEQTFVFELKLLADLGLVGLPNAGKSTLLRAISNARPRVGHWEFTT
FT                   LQPTIGTIPMGIDKEPFTVADIPGIIKGASENRGMGISFLRHVERSGGLVFVISLVGQN
FT                   PINDLEILLAEMTESRLHGKNILVVATKADVEGTKEKFQMLKEYTQEKKMDIVPCCAMK
FT                   NENIEMVIEMMAKCTGKY"
FT   CDS_pept        complement(join(703305..705572,705643..705768))
FT                   /locus_tag="PAS_chr2-1_0377"
FT                   /product="Component of the microtubule-nucleating Tub4p
FT                   (gamma-tubulin) complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAY68999"
FT                   /db_xref="GOA:C4R0H5"
FT                   /db_xref="InterPro:IPR007259"
FT                   /db_xref="InterPro:IPR040457"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0H5"
FT                   /protein_id="CAY68999.1"
FT                   /translation="MSFSRLRNSSQSRFFRSGNQADARYCIVSVFTSRPSINMTQMYDV
FT                   VKLVDQETKRIIPTTVNLTTAVNTKPYPLQDLSDLKEQEAFVVRDILYCLQGNEGDYVR
FT                   FSKNFNEQDLRSILEGPDYRIAKNLDVTLKDMTNRLLKYGKMYYSLTKFVEVYDSQFYG
FT                   ATMQRLCNEIRDFLKEHDQIVLELERRFMMDPHFSIGILNQLIEESGEKMRTLYEIITS
FT                   LNEVNRSNLATVDDVFKTMLKTIKEDLKHDDSLYMQTELNNKTRIIKGGIILRIVQDKM
FT                   ERIRGDQTRFEALKKTFDRISLPYIEMLHKWLTFGKIDDPFDEFFIVEQSSKNTLINYD
FT                   SKFLLRKNYIIRQFEHRELQRKVLLTGKYLDVLRCLPVDIVENDTSNHKIESLETDDLF
FT                   FYVEQKYLRANKLVTELFMKGYKFLTILEALKSTLLFSNGVFLNDFLAHSMSDMLRDKS
FT                   KASLSKIERNFEKTFRPQLMATPRSKLVGNLVNINVQSDNLYTFLESILNIQQIDAEEV
FT                   FNSSDLNSLKRYLNKTLTKNTAEVVISPLDNYLVYYLSLNIEFPFPLNLLLTNTIITQF
FT                   QLVGRNVMITNVVEKLLESSWKEINYQRFWCFNFPNRSIRKWILRLRYLHSNIKQFVSA
FT                   FHLYLSFDVIEGSFSEMETQYQHFASTADSDFEKYFVSLQKWLNTMMQNSLLMNETLVQ
FT                   ISRRMFEFVLTFHTFVMSLRKNLILLDENLFDQYASKLGEKQFDPEKNRERVIKMKHII
FT                   NEYEKKFESSLNTFVQALNYYSRLESSSFSVLAGYLDSILKNRK"
FT   CDS_pept        706001..707305
FT                   /locus_tag="PAS_chr2-1_0378"
FT                   /product="Putative ATP-dependent RNA helicase of the
FT                   DEAD-box family"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69000"
FT                   /db_xref="GOA:C4R0H6"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0H6"
FT                   /protein_id="CAY69000.1"
FT                   /translation="MVKFEELGVSKWLCESLDAMKIYTPSKIQEATIPKILAGYDCIGG
FT                   AKTGSGKTIAFAAPMLTKWSEDPYGVFGLILTPTRELALQIAEQYAALGASMNIKVSVI
FT                   LGGGDIVQQALELQRRPHFVVATPGRLADHILSSGEETIGGLRKIKFLVLDEADRLLSN
FT                   SFGSDLERCFKVLPPPEKRQTLLFTATVTDEVRALKEKPVPEGKLPVFVHEVESVDKVA
FT                   IPATLTTNYLFIPSYVKEAYLNAVLALEENADSTVIVFVNRTQTAELLRRTLRNLEFRV
FT                   ASLHSEMPQIERINSLHRFKAGAARILIATDVASRGLDIPSVELVVNYDMPADPDDYIH
FT                   RVGRTARAGRKGESLSFVTEQDVKRVLAIEERINKKMDKYELVTDNKVIETSLHKTGAA
FT                   KREALMAMEREGFGEKRKNNKIKNAKRKNSRLQSK"
FT   CDS_pept        complement(707331..709007)
FT                   /locus_tag="PAS_chr2-1_0379"
FT                   /product="Signal recognition particle (SRP) receptor-alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69001"
FT                   /db_xref="GOA:C4R0H7"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007222"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0H7"
FT                   /protein_id="CAY69001.1"
FT                   /translation="MSEQFLIFTPKGTVLFKDEDRKVPDRVVNGLISDIFISQRKTLTG
FT                   SVNNEEEFEDDDVGSYSLDGYTIKYVSSSQPTCYFTSCHSSLVNVPNEGQFLKDIQTLW
FT                   EELITADLDSGAFPDEQELRKFTSFYNLKKQELFKNVGVETAKSTSTSEPHSLSQNKLK
FT                   GKKPQLTQKKKARRWDTQGNPIEDDGLEESDLDFSSTTSEVGNQDVGHLVGDNYGKTKD
FT                   GKFLVSDMKEINDILSKQRDKSVSDESTGAFSFLSGLFSGKTVTEDNLTKTSKSLSEHL
FT                   INKNVAPEIAKKLVERINKSLVGTKVTTSIPKAARNALEKELLKLLTPETSINLLKEIQ
FT                   SKKAARKPYVISVVGVNGVGKSTNLSKLAFWLLSNKYRVLITACDTFRSGAVEQLRVHV
FT                   NNLKKLTEDESHVELFQGGYGGADLVSKIAKGAIQYAEENKFDIVLLDTAGRRHNDAQL
FT                   MAPLQGFVKAAKPDKIIMVGEALVGTDSVQQAKNFNGAFGPGRTLDFFIISKCDTVGDL
FT                   IGSMVNMVYATGIPILFVGTGQTYTDLRTLSVDWAVDTLMS"
FT   CDS_pept        complement(709187..710707)
FT                   /locus_tag="PAS_chr2-1_0380"
FT                   /product="Protein involved in nuclear export of the large
FT                   ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69002"
FT                   /db_xref="GOA:C4R0H8"
FT                   /db_xref="InterPro:IPR007064"
FT                   /db_xref="InterPro:IPR039768"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0H8"
FT                   /protein_id="CAY69002.1"
FT                   /translation="MSNYTHLEPTEQQGVATVLCCNCGVPMDGTTGLVMCYDCIKLTVD
FT                   ITEGIPREANVSFCRNCERFLQPPGQWIRAELESRELLALCLRRLKGLNKVRLIDASFI
FT                   WTEPHSRRIKVKLTVQGEAMTNTIIQQSFEVEYVVMAMQCPDCAKSFTANTWRAAVQVR
FT                   QKVPHKRTFLHLEQLILKHNAHVDTISIKEAKDGLDFYYAQKNHAAKMIDFISSVAPVK
FT                   SKKSEELVSADIHSGTSTYKFTFSVEIVPICRDDLIVLPKKLAHSLGTISRLVVCSKVS
FT                   NTVQFIDPNTLQIADINSNVYFRDPFPVLCNRTELIEFIVLDVEPTGETRGNYILADIT
FT                   VARAADMGNNDQEYYVRSHLGGLLNPGDSADGYFLANSNFNSDLFDELDSKNVLDVVLI
FT                   KKHFSRSARRAKKRAWRLRRMAKEHQDIVANDESRQAKQEQEKAERDYEIFLQELEEDP
FT                   ELRQTVNLYKADEPPAPENEADMDEDDDAPEIGVDELLDELDEMTLDE"
FT   CDS_pept        710882..711304
FT                   /locus_tag="PAS_chr2-1_0381"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69003"
FT                   /db_xref="GOA:C4R0H9"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0H9"
FT                   /protein_id="CAY69003.1"
FT                   /translation="MSERGQPGGPNPTIKDNRLVMNITTSEPRDLLMIERNCLSMVKFG
FT                   VVLSLTSIAMLVNFGFGKREKLEGDKKILFTIFGSIFMLLSLLSLVLGALNYYHSIGRY
FT                   TKEKVEVFNHIPITGFVFSCFVMIFTVSVVLLTQSL"
FT   CDS_pept        complement(711267..711914)
FT                   /locus_tag="PAS_chr2-1_0382"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69004"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0I0"
FT                   /protein_id="CAY69004.1"
FT                   /translation="MRGPSLSLFVPTKKFKGKDMTSEDRPTESLQFIEMLKSNDRKVND
FT                   EKLARFGLPPKEKLFKYEIVPQHEAETIFASKTKLMPLNILFEGNESLSPEATSPFYAE
FT                   SDPLTSYCSEGQNLPCKVRPCKTPFPSSPLPLSSSPSQQHNSDLISELEFSSEPQSQFS
FT                   ELIHSETIYTAETTFDSKPNLNESTDPLDSSQEHLISTDTVISSESIIPHSL"
FT   CDS_pept        712150..713652
FT                   /locus_tag="PAS_chr2-1_0383"
FT                   /product="L-homoserine-O-acetyltransferase, catalyzes the
FT                   conversion of homoserine to O-acetyl homoserine"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69005"
FT                   /db_xref="GOA:C4R0I1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0I1"
FT                   /protein_id="CAY69005.1"
FT                   /translation="MRNSMLRISRRCFNSSGLLLKPSPTRTRGAVQNLTDSLASNPQLS
FT                   FPCLDKQEKRSKTLLEDGPEPSYQSMKEHHVHKYKSEDPIFLDYGGYLPKFEIAYETWG
FT                   RLNEHRDNAILIHTGLSASSHAKSNALNLKKGWWEEFIGPGKYLDTTKYFIICTNVIGG
FT                   CYGSTGPSSIDPADGKRYATRFPIVSINDMVRAQNRLVSSHFGIKALHASVGASMGGMQ
FT                   SLAYAHEFPDQVNKIVSISGCARSHPYSIAMRFCQRQVLMSDPNWNRGFYYDSLPPHTG
FT                   MKLARQIATITYRSGPEWEVRFGVERTDPSKQPALCPDFIIENYLDHQGEKFCLQYDPN
FT                   SLLYVSKAMDLFDLGAIERQKAELSRSQAEAKFKGAYVPFEELQFEPSGSNCSLPSTPY
FT                   EEKPRKGRRATPEESRRDLLEGLKTLAHKDVLVIGVESDILFPAWQQREISDLLTEGAK
FT                   ELGLEGSNIRHVELGSDVSIFGHDTFLLSLDHIGKPVSEFLN"
FT   CDS_pept        complement(713722..714618)
FT                   /locus_tag="PAS_chr2-1_0384"
FT                   /product="Mitochondrial ribosomal protein of the small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69006"
FT                   /db_xref="GOA:C4R0I2"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0I2"
FT                   /protein_id="CAY69006.1"
FT                   /translation="MSLINRLTLFRPIMSVSAQRMTFATSSVAFEFHVLSKAQRKIRSE
FT                   TKKKQNRARQLAKLDALEKVDPVLGRADNPFITRIRAEVTEKDVLGKGYDFEEVEKLIY
FT                   GINQARLSKLENDYVRSVSNSQTETIKEVVIRVLSMRNSNNQDRKNLAVAFARKEFERF
FT                   PGDTGSSEVQAAVQTLKLYFLMDHIRQNPKDLDKIRNARMLAQQRQRILRYLKRDDPQR
FT                   YFWAIRKLGLTDEAVHMEFNFDKRYMQEYEIWPDRVLVKESKKQIEEKRRERRKAKKAM
FT                   RLAIIQDGVGESASKTV"
FT   CDS_pept        complement(714707..715444)
FT                   /locus_tag="PAS_chr2-1_0385"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69007"
FT                   /db_xref="GOA:C4R0I3"
FT                   /db_xref="InterPro:IPR019388"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0I3"
FT                   /protein_id="CAY69007.1"
FT                   /translation="MDIPKASVLLFFPLTLALGLVTRNLLLLFGALPTGGYLLDPSNLI
FT                   NGIFVGHAFEIFAALFGIVSYYTFQVYKMILPVSVDDKTNQKIISGQISKVVIITTWLI
FT                   VTKVWFFGDSLFDRLQEHTGATCQYPEGLEKLIARNDNYSSCERAGGLWTGGFRASGHL
FT                   FILTTVLGSLAFEWRSVFVKDPSFSRWGLIPTAIVMAFWILMFWVTSIFFHTVIEKVIG
FT                   IAIALAFLSILYISKACAYVNIN"
FT   CDS_pept        complement(715493..716332)
FT                   /locus_tag="PAS_chr2-1_0386"
FT                   /product="Protein involved in minichromosome maintenance"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69008"
FT                   /db_xref="GOA:C4R0I4"
FT                   /db_xref="InterPro:IPR018464"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0I4"
FT                   /protein_id="CAY69008.1"
FT                   /translation="MSFQDDIINDINSLKTEIAQLQAQYNSTSRELDDLRKGVPQQVQH
FT                   EHFESLLGNFINEPPQSKSAIKLMSRKKAYKQIHLENLYRMVGVTMFPVSNRDELLGIR
FT                   FDIFDGEQKKFTVPHYIILQKHSKTEQWKIHRTTIPRYVPLQSIAKQWLNQDLNKFAKL
FT                   VRKHLVHIQNKKSIVERVNGKLQGIATLEWDLDFTKIRLHVKEKFSLLLLCDLTNVVSV
FT                   VEYQVKPEWVQAVGEQESEGIIRRMKTLLKTKVVYLEVLGELFDPENQNKSYRSLLE"
FT   CDS_pept        716629..717216
FT                   /locus_tag="PAS_chr2-1_0387"
FT                   /product="Subunit of RNase MRP"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69009"
FT                   /db_xref="GOA:C4R0I5"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0I5"
FT                   /protein_id="CAY69009.1"
FT                   /translation="MNEIISDENLQKLNTEFEVLYLLYHRNSNQHKTAAWWSNFNLLLR
FT                   KLRCILTLSLDVQDLSKKTKLANKEELIREKLYTIVQISQYLASKTIASSYRQFYSVIA
FT                   LGQFITLGFTLIGLLARVYCILLSIRGVEGNVGFEKEIKMHVDNGDIIVHTQDLNLKEP
FT                   VAFDTLNEIKPKRTFKQEKRKKRKNAIDDIFG"
FT   CDS_pept        717482..718144
FT                   /locus_tag="PAS_chr2-1_0388"
FT                   /product="Subunit of tRNA-specific adenosine-34 deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69010"
FT                   /db_xref="GOA:C4R0I6"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0I6"
FT                   /protein_id="CAY69010.1"
FT                   /translation="MGLETHFNFMKKALDAAQIALDELEVPIGCIFVYKNKIIAQGSNK
FT                   TNATSCGINHAEMEAIDEIIAKYPNYKEILPFADLYVTVEPCIMCASALRQLGIRRVFF
FT                   GCANDRFGGNGSVLTIHSDKLNNKLDSSIYPVYPGIYAKEAVTLLRKFYLNQNEKSPNP
FT                   QTKKLRQLDMENFPRLQFEKYLTKEQFVDMYGESQLDVYVGESDEIVLQRPTKIPKI"
FT   CDS_pept        complement(718203..720188)
FT                   /locus_tag="PAS_chr2-1_0389"
FT                   /product="Sorting nexin"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69011"
FT                   /db_xref="GOA:C4R0I7"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="InterPro:IPR039358"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0I7"
FT                   /protein_id="CAY69011.1"
FT                   /translation="MSDQFTSIQWDRTEPEGDVPGDSNDHSQVQINSSINLIEEDQGQE
FT                   QEQDDLVTTNTVVRGGNDSDSNPNEQIPPRDVYIRSKVSQPLKESDGQNFYISYLIETE
FT                   TNEPGLAKTKLKVRRRFSDFNFLYNCLANDFPTSIIPPLPNKQRLEYIKGDRFGEYFTT
FT                   KRSIALNNFLNRISKHPLLKQAKIYHIFLEDSVNWNTFKQNLKISSNPNSTVGGGSTTS
FT                   ANANGELDSFSDYIMNAFKKPTYESENAKEFQEITDKSNKLQENINKIDKIYQRVVKRQ
FT                   SEISEDFRLFGDEFKKLNQILTEGSDTQFDKELSQQFTSFSENIYQISYDSFKLTRQVD
FT                   LHYLTSLKDLDHYISQIKNMIKFKDSKLLDYEMLQNYLNKAIAEKNHLMNGNNVSGSDG
FT                   AMNFISKKIGSLRGKTPGQTYSSGNETNDRINKLNEKIEFLEREVKETFELFHTFEKNL
FT                   ITEYQLFDRIKNDEITTNLHELSQYYLDYYNSVVNHWNDVEIPHSEHLTDELHVLQQSQ
FT                   LRKNLENISIDPKLDVNSKLFEHDDVRLNNDHIRSDLRSIKSQERKNEQVHKQDQEQGE
FT                   EQEHEQDQVQNQEQEQEPEELSREEAEVLETPVQAQEQEQQEPEELHASQTESHTQSEP
FT                   QNDNQHNFDDDGSDEGLVDVEGLEQW"
FT   CDS_pept        join(721942..723167,723229..724108)
FT                   /locus_tag="PAS_chr2-1_0391"
FT                   /product="Lanosterol synthase, an essential enzyme that
FT                   catalyzes the cyclization of squalene 2,3-epoxide"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69012"
FT                   /db_xref="GOA:C4R0I8"
FT                   /db_xref="InterPro:IPR002365"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR018333"
FT                   /db_xref="InterPro:IPR032696"
FT                   /db_xref="InterPro:IPR032697"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0I8"
FT                   /protein_id="CAY69012.1"
FT                   /translation="MTVYYSEKIGLPKTDPQRWRLRVNELGRQYWDYIEKEDLKNDPQT
FT                   PYVQYLLKGDEFECPIPEKPQSAFESARNCADFLALIQDESGVFPCQYKGPMFMSIGYV
FT                   VACYFTNTPIPDHVRTEMIRYVVNTAHPVDGGWGLHEWDKSTCFGTCMNYVVLRLLGLP
FT                   KDNPVCIKARKVLHALGGALATPYWGKAWLSLLNVYKWEGVNPAPPEMWNLPYSLKIHP
FT                   CRWWVHTRAIALPLSYISSYKSQMPLTPLLKELRNEIFLQDFDTIDFSKHRNNVCGIDL
FT                   YYPHTSLLDFANSILVGYDKIRPTWLLKESNDAVYELIKKELANTEHLCIAPVNAAFNT
FT                   IVAYLEEGPESYNFKRLQERFKDVIFHGPQGMTTMGTNGTQVWDTSFCLQYFFMAGLAD
FT                   LDEYEELIIRDKRIGCFPFSTKEQGYTVSDCTAEAIKAILMVKNHPKFAYLGDYIDEDL
FT                   LKKGIDGLLSLQNVGSYHFGSFSTYESTRANPALEKINPAEVFGNIMVEYPYVECTDSS
FT                   VLGLTYFREHWDYRRHDIDTAIERGVKFICDAQQEDGSWYGCWGVCFTYAGMFALEALA
FT                   SVNQYYETNEVVRKGCDFLVSKQMADGGWSESIKSCETHTYVRGKRGMVVQTSWVLIGL
FT                   ILAKYPHKEVIDRGVQLIMSRQKTRGDFDFEAVEGIFNHSCGIEYPNYKFLFPIKALGL
FT                   YSKEYEQ"
FT   CDS_pept        724261..724899
FT                   /locus_tag="PAS_chr2-1_0392"
FT                   /product="Protein with similarity to the p27 subunit of
FT                   mammalian proteasome modulator"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69013"
FT                   /db_xref="GOA:C4R0I9"
FT                   /db_xref="InterPro:IPR035269"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0I9"
FT                   /protein_id="CAY69013.1"
FT                   /translation="MTSSYDINSLTLGVPDYDITDISTFDLTRLGDLKKLIESSLTHLF
FT                   DTLKDQNVDMDTSLLTEDGFPRDDIDIVKVRLTRTSIVRLRNDHKKILEALNLRLQEHY
FT                   SNNTISDSTSKDQGDVVESAIPFARISEVVRDSPADKAGLQSDDLIVTFEKLTTTSANL
FT                   LQNISRIVLENENQPIKLTAKRHGELLELTLTPKKWEGGGLLGCRLNLL"
FT   CDS_pept        complement(join(724955..725222,725279..725304))
FT                   /locus_tag="PAS_chr2-1_0393"
FT                   /product="Ubiquitin-like protein with weak sequence
FT                   similarity to ubiquitin"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69014"
FT                   /db_xref="GOA:C4R0J0"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR015221"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0J0"
FT                   /protein_id="CAY69014.1"
FT                   /translation="MLTINVEFLGGLDAIFGHVREHTVQVEDGSNFRELTQHLVEHLLK
FT                   DRKDEDVFIEDGSIRPGILVLINDTDWELEGEDEYELQDKDLITFTSTLHGG"
FT   CDS_pept        725446..727152
FT                   /locus_tag="PAS_chr2-1_0394"
FT                   /product="TFIIIB B-related factor"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69015"
FT                   /db_xref="GOA:C4R0J1"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR011665"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR023486"
FT                   /db_xref="InterPro:IPR029529"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0J1"
FT                   /protein_id="CAY69015.1"
FT                   /translation="MATLNKPRCKNCGGTEFTRDINTPASDLACVECGTVSEENPIVSE
FT                   VSFGETASGAATVQGAFVGSDQARANFGNNRGSLDSREQTLNKGKRRIKTVAAVLGIAD
FT                   YISDAAYLWFRLALTNNFVQGRRSQNVVAACLYIACRKVKTHHMLIDFSSRLQISVYSV
FT                   GATFLKMVKTLHISNLPLADPSLFIQHFAEQLNFGNSKIKVIKDAVKLAHRMADDWIHE
FT                   GRRPAGIAGACLMLAARMNNFRRTHLEIAAVAKIGESTIQKRLNEFKNTNASKLSIDEF
FT                   RKATNIESTAPPSYTSNRIKEKAIQQMINHNNKYSEEKETVMNFILKDSEISSEEIRTY
FT                   ILKIQKQQREDLKRKVNQVVSPSPGEVGEIQRSIDEDEDDDDESEDESDKDGNTANSIY
FT                   NSFERQQQDQARLIELNRPKNLHKLPTTGDLLGKIKSDPENLEDVDDEELEGFLLTEDE
FT                   SRIKERVWVGLNHDFLIEQEKRRLKEESDKLAGHTTIKRRRKKNIDDDGLGIPKTELTE
FT                   FASGLDPAALGLQSSINSIGEGSSALSSAKSMLQKKSYSKKLNYAAVENLF"
FT   CDS_pept        727303..728688
FT                   /locus_tag="PAS_chr2-1_0395"
FT                   /product="DNA polymerase III (delta) subunit, essential for
FT                   cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69016"
FT                   /db_xref="GOA:C4R0J2"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="InterPro:IPR024826"
FT                   /db_xref="InterPro:IPR040663"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0J2"
FT                   /protein_id="CAY69016.1"
FT                   /translation="MTMDQEVRRREVVRSSDSNKALLYTLNKNNRNYDRQYASIYTARA
FT                   NKLKPRLIEKCSEKWKGEKINGIPVSHTEKVLNISSNKATWCVGTVFCDLKYKPNILKD
FT                   VSESMYGGPVVKKVDGTYADRESDQLMLEDESGRIALDGELIDKILLVTGCIVGVLGME
FT                   INPGVFTVVDIVYPEPGLQKPRLLSNHRIALVSGLGINGDNLDLSRLELLKEFLTGELL
FT                   ENQAQESSIAKLIIAGNSIKVGDLNKIHQDKKNKFKATYASNYNATAVSQLDNFIHDVI
FT                   QTIPVDILPGAEDPAEIALPQQPLHKAFFNSSRQFVGNRLNTKTNPQWWDLAGTEILGT
FT                   SGENIDDIFKYVVPNDYHVDEDGCENSRIKIIESTIRWQHILPTAPDTLWCYPYQDDDP
FT                   FVLESTPHVYFVGNQARFESKDIILDNGFKVKLLSLPRFDQTGEVVILDLNDLSTNLVS
FT                   FSV"
FT   CDS_pept        complement(728709..730352)
FT                   /locus_tag="PAS_chr2-1_0396"
FT                   /product="Mitochondrial methionyl-tRNA synthetase (MetRS)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69017"
FT                   /db_xref="GOA:C4R0J3"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0J3"
FT                   /protein_id="CAY69017.1"
FT                   /translation="MVGAYLSSASKYFITTPIFYVNAAPHLGHLYSMLLCDFQKRWLDL
FT                   KETPNYFTTGTDEHGLKVQIAAELNKTDPRLFCDNLSNKFKHLAQISDIQYDRFIRTTD
FT                   ADHLATVRQFWETVWKNGYIYKGKHSGWYSVSDETFYPESQVEQRDGKTVSTETGSEVV
FT                   YESEENYFFKLSAFQSQLIDLYKANPQFVIPANYYSDLLKELEREPLQDLSISRPSSRL
FT                   QWGISVPNDESQKIYVWFDALVNYLTSIGYPSSRYKEFWPGTHLIGKDISRFHCIYWPA
FT                   FLMAAKVSPPEKVVVHGHWLMGGSKMSKSKGNVADPLAIGDYYGVDSLRLFLGANSILS
FT                   NDCDFTERKLNDHRDLFIDKICNVVTRCISKSFDPARSVMSFSNEDMNLVWKRILERGW
FT                   EGDLEKAAELKKSYDEIVDDAQQLFSKIDVLMSTFTTHKSVGEIFDLMLKVNQFVNSTE
FT                   PWNLKSNERLQDLSIFVALDVTRVCLILLQPFIPGLSNKLLDMIKVESSKRTATYAAFQ
FT                   QDSSYGQGAKFLKGSTPPLIKVPLRAGAYE"
FT   CDS_pept        complement(730531..731373)
FT                   /locus_tag="PAS_chr2-1_0397"
FT                   /product="Integral membrane protein required for the
FT                   biogenesis of ER-derived COPII transport vesicles"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69018"
FT                   /db_xref="GOA:C4R0J4"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0J4"
FT                   /protein_id="CAY69018.1"
FT                   /translation="MSFYQQPQQFGQYNPASLPQQQSYSAEQPFQQKQTPYHVSQSHSP
FT                   APGFQIPAAQSQQQQQQQPPPFQSFPSGSMDFNNVSGSIGDQKLSQGFLAAFSTSGYPG
FT                   EPPLLEELGINFKHIKEKTAAVLNPRRGNISADIMTDSDLAGPILFCLAFATFLLLSGK
FT                   THFGYIYGVALFGTICQHILFKLMSQDASIDLIRTASVIGYCLLPLVLLSAVAVFVPLD
FT                   NLPGYVAAILAILWCTTSASGFIVSVLRLQNVRMLIAYPLAMFYSVFALMAIFVEKTQ"
FT   CDS_pept        731547..732296
FT                   /locus_tag="PAS_chr2-1_0398"
FT                   /product="DNA repair protein Nse1"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69019"
FT                   /db_xref="GOA:C4R0J5"
FT                   /db_xref="InterPro:IPR011513"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014857"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0J5"
FT                   /protein_id="CAY69019.1"
FT                   /translation="MEYTDTHRALVQVFMENKMLTIPDIKEVLQAVNESDREISVNDTI
FT                   KLINEKLHFLHLEIKSITLQDTTETVYCFVNTLPDKVMEFSTIFSVTEITILKKLIEMI
FT                   MLHRSNDSDEEYYISRKEAIILIREQSSLQVNQANDLLHKLVENKWFERRGDKYTLSPL
FT                   CLIELKDMLIEKYQTRKENGIVNICQLCEGIVTLGVRCTCYIRLHHDCFRKYNVINPQE
FT                   TCPNGHNLPQGMVGKIFYEVQENETNS"
FT   CDS_pept        complement(732291..733337)
FT                   /locus_tag="PAS_chr2-1_0399"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69020"
FT                   /db_xref="GOA:C4R0J6"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR037353"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0J6"
FT                   /protein_id="CAY69020.1"
FT                   /translation="MSSKIPRLKPVPYKESDLYQPLLAPQLGPGCGTTEDIPYNKRDFK
FT                   YKPCRPNPFLLSKMYSTTDLPPYKGRFSYFDRSQRMCINEDCDQCTSEDCWRSVKGSLP
FT                   IRQGRVYVEFKILNSEGDSHVRLGFGRREASLEAPVGYDAYGYGFRDLTGQKVHLSRPQ
FT                   DFMGSFGTGDTIGLLIQLADRIKIDDIDRDEIPIKYKNQLFFEQYDYVVTKPMDHLLNP
FT                   VTVFGEKAIPDKDRYKPPVIQGSFIKVFVNGEPKGTAFENLYEFLPPASELKKGARDDG
FT                   SLGYYPMASCFRGGKVQLNTANKPEFAPQGEKEYLMYNELYDDSKIEEYVWDLIDEVES
FT                   AWLDELGL"
FT   CDS_pept        733530..734981
FT                   /locus_tag="PAS_chr2-1_0400"
FT                   /product="Putative protein similar to bacterial
FT                   glutamyl-tRNA amidotransferases"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69021"
FT                   /db_xref="GOA:C4R0J7"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0J7"
FT                   /protein_id="CAY69021.1"
FT                   /translation="MSSFPRINIPKVLEAQAKYNMFTCVRPVAMHIENPHSLLNMKLCA
FT                   IKDNICGIPEPTTCGSKMLKNYRSPFKATVLEMLENYGTVIVGKTNMDELGMGSTNTNS
FT                   VFGPVYNPSFDKTQKKLSKYTLSESQDIEETYDFPKHIAGGSSGGSAAAVASNVVDFAL
FT                   GTDTGGSVRLPASYCGVVGFKPTYGRLSRWGVIQYAQSFDTVGILSRDVDTSKVVFDYL
FT                   NEFDEKDPTSLLPSHRERIDELVETRNKGLHKLRIGIPKQLNLDIDSNVRESWIKLISQ
FT                   LFDQDHDIYPVDIPSVEHSIPSYYTLVPSEAASNLARYDGIRYGYRSKLDSKGDVLFAP
FT                   TRDEGFGEEVKRRILIGNFNLSHEAYIIHYLKAQNLRHQIKLDFDKVFRFPNVLTSSQP
FT                   SSEGVDILIAPTSLSTAPTVEEANSMTPLEVFVNDALTVPSSLAGLPTCSIPMKTPEPI
FT                   GMQVIGQFGDDNLVLNASRLIQQFM"
FT   CDS_pept        complement(734985..738857)
FT                   /locus_tag="PAS_chr2-1_0401"
FT                   /product="Protein that localizes to chromatin and has a
FT                   role in regulation of histone gene expression"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69022"
FT                   /db_xref="GOA:C4R0J8"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0J8"
FT                   /protein_id="CAY69022.1"
FT                   /translation="MVRRRTPSQNNSVESSPRVRARHRRQTSDILTEEKHSNEEDEILP
FT                   PRRKKQKVNYNEDAIFDQAYQDQDDDDGGDKLTNENVNENGHNDPTENTTVQVDQTDNN
FT                   VKNEHSDKESEYNDSEDYNGDDQADSEFDGLTSEEERFAKRKADEEFIVKDDFDYDDSK
FT                   SKGRRRARRTRSSRSKGSNSQSRKSRRQILDSEEEEDDANASQSVEVSDHAASSIQQEL
FT                   EDLKDSPPNTPPSRKLNLRNRKNVDYTIPPPLANEITELVNPPTPKKRAYSSHANRLKR
FT                   LFPTVGPFGGSDVTSIFGQNVPGLTALNNDSSSSSEDEIAPINSKSNRKDPNAKFNTGP
FT                   ANMGKVIKSKKNSLADSDPLGVDMNIDFTSVGGLDNYINQLKEMVMLPLLYPEVYTRFH
FT                   ITPPRGVLFHGPPGTGKTLMARALAASCSTGNTKVTFFMRKGADCLSKWVGEAERQLRL
FT                   LFEEAKNQQPSIIFFDEIDGLAPVRSSKQEQIHASIVSTLLALMDGMDNRGQVIVIGAT
FT                   NRPDSVDPALRRPGRFDREFYFPLPDLRARKEILQIQTKNWSPPLEPTFVEKLAELTKG
FT                   YGGSDLRALCTEAALNSIQRKYPQVYQSQLKLQIDPSKIEVSSNDFMLALEKIIPSSAR
FT                   SIASPSNPLPKSLESLLKKNLDNIIAELHQSLPTEKRVTLLEDSQYVDYSSMGKNKFDR
FT                   QELIQSLKRSRVYKPRLLISGGSGMGQIYLGPAILHHMEGYHVQSLDLGTLYNDSSNSS
FT                   STLEAVIVQKFMEAKKHKPSIVIVPSLDIWFRSVPDTVISTISALLRSADANDQLLILG
FT                   LLDSSRLVAEEKQILLDVFEFKNVIELKYPDKDERRDYFEQIFAALNLKPIEFNEIDTR
FT                   PRRKLRDLPQVQQESTVEANDKSTVKQLEKLDMRLKNMLKIKLSALMELFKQRYKRFRK
FT                   PTIDDSYLVHLFHDYISNIHPEDQPYQRDGDMILEVATGKKFYNMDLDVIEERIWNGFY
FT                   SEPKQFLKDVEMIYRDAREFGERERLLKASEMFANAQVGIEEIGDANFIKECKMMHARE
FT                   TERQRKYLQQSKNQLALDQAFINVHTDSKPEEAGQEDSTRILYESQQAETAEPGINPTS
FT                   NSENLVPSLVEDTFMATSTQAPEGDQTVLVEDSELPGGSQNQLQAQIKPPNGIAVSDIF
FT                   ESTELLQPPLAESTKDIGATSASNEESVLEAKGETNSNASEPPNLDPDSGPDIQEFHAR
FT                   FNVNLEYDQEYANRLKELLVNKTVKFNIDQLQEHNSQLTKIIWDDRKQLNKKGTLTKIE
FT                   EYINRI"
FT   CDS_pept        739529..742498
FT                   /locus_tag="PAS_chr2-1_0402"
FT                   /product="Alpha subunit of heterooctameric
FT                   phosphofructokinase involved in glycolysis"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69023"
FT                   /db_xref="GOA:Q92448"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR009161"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="InterPro:IPR040712"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92448"
FT                   /protein_id="CAY69023.1"
FT                   /translation="MPEPSISALSFTSFVTNDDKLFEETFNFYTKLGFHATRSYVKDNR
FT                   SDFELTGISTDSIKEIWLESFPLSEVVETSAGRELRKPLQESVGYQSEALLGYSPYQSD
FT                   GVVIKLRLSNHDLQKNKDLPGEVTFFTASIDKLRAKLIEIGAEIIPSEIDLVEFSTKDP
FT                   MGDVISFSSYPSLSSKKITSPDFFLHPKKEVRSQESIVEQVKSEEGKKKIAIITSGGDA
FT                   PGMNAAVRAVTRAGIFYGCKVYACYEGYTGLVKGGDMLKELQWQDVRGLLSIGGTIIGT
FT                   ARSKEFRERWGRLQACYNMVSNGIDALVVCGGDGSLTGADLFRNEWPELIKELLGEGKI
FT                   TKEQYETHRNLTIVGLVGSIDNDMCGTDSTIGAYSSLERIIELVDYIDATAASHSRAFV
FT                   VEVMGRHCGWLGLMSGIATGADYIFIPERPPSETNWKDDLKKVCLRHREKGRRKTTVIV
FT                   AEGAIDDQLNPITSEEVKDVLVEIGLDTRITRLGHVQRGGAPCAFDRFLATVQGVDAVR
FT                   AVLESTPAIPSPVISILENKIVRQPLVESVAQTKTVSDAIEAKDFDKALKLRDQEFATS
FT                   YESFLSVSKYDDGSYLVPESSRLNIAIIHVGAPTSALNPATRVATLNSLAKGHRVFAIR
FT                   NGFAGLIRHGAVRELNWIDVEDWHNTGGSEIGTNRSLPSDDMGTVAYYFQQYKFDGLII
FT                   IGGFEAFTALYQLDAARAQYPIFNIPMCCLPATVSNNVPGTEYSLGSDTCLNTLSGYCD
FT                   AVKQSASASRRRTFVVEVQGGYSGYLASYAGLITGALAVYTPENPINLQTVQEDIELLT
FT                   RTYEEDDGKNRSGKIFIHNEKASKVYTTDLIAAIIGEAGKGRFESRTAVPGHVQQGKSP
FT                   SSIDRVNACRLAIKCCNFIEDANFQVKHNANLSADERHLRFFYDDGVKTSAVSGKSSVI
FT                   DDNTSVVIGIQGSEVTFTPVKQLWEKETHHKWRKGKNVHWEQLNIVSDLLSGRLSIRTT
FT                   "
FT   CDS_pept        742868..743212
FT                   /locus_tag="PAS_chr2-1_0403"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69024"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0K0"
FT                   /protein_id="CAY69024.1"
FT                   /translation="MASTIESADYCSFSTVCKMWHFSYCGERYRCPSIGCILKRQVESS
FT                   PWKILPVAGKISQPRRSSQRKELHLVLRDGVLVNSKPQCKRSYRSAMAACWSHETHRST
FT                   GEVLLSCAVQ"
FT   CDS_pept        744022..745716
FT                   /locus_tag="PAS_chr2-1_0404"
FT                   /product="Transcriptional repressor and activator"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69025"
FT                   /db_xref="GOA:C4R0K1"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR027725"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0K1"
FT                   /protein_id="CAY69025.1"
FT                   /translation="MPESRTSKGSIKSVPKKSAFVHKLYTMLSNEELNDLIWWTGPEES
FT                   GTFALLPGAEFSKVLSTYFKHANVSSFVRQLHMYGFHKVSEQPLVQGDTIPKVTWEFRH
FT                   SNGKFRKGNEDSLPLIKRRSTSSSSKSITTDYVKFRVHDQYSYFPQDLQYPQNPQQSNQ
FT                   EGETEHTQQPVLYHPQPTVYYHPNVGVPPAPPAPALAPPPFSHLGQPMQPMSHQQPQQQ
FT                   IQQQHHHQPQSQHGQPQQPQQQYRQYTSHPPPALLPFTPMYNMRPMTASPTNMEPMVLP
FT                   TYHSMRLIETELEVKQSHLQSKSDALIKQVHDYNKHIPSLVQLIPPHFEPKVDRNIQHS
FT                   RLSGIEASVRNRISKLSQPNPQPIHSAHSSFVSSKRNSSLVDPLQDLPLTAPVPNTGSG
FT                   FLSAHRGFYVPKTNSVSSSSSLPVTHDLPARRTPTPFKDRNPGDSSVESSHSQLRPSIF
FT                   RVHTKEEPVKAEKSSIFSNKDDSIFSNVHASSIFSQKTSIASQRSSLSMILNKPTVDSR
FT                   DSITGSPLRKVSVHTIDEESTSSSNKRSHDDSNGFEDKRGKLMKLDS"
FT   CDS_pept        complement(745815..746777)
FT                   /locus_tag="PAS_chr2-1_0405"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69026"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0K2"
FT                   /protein_id="CAY69026.1"
FT                   /translation="MTWRSALFSSTIILLFEGLLYKSDEANRNKLVDYFRESPLEDIEI
FT                   RLSISLNPEQLKLPDLAESSQIQTNYELNRINQGLICQYKVDYYSFSPDCYFQMDLIIS
FT                   DNDAISIYENEPIIDLYHQLQSIRENDLPFFVSQAALYHLLESELESLAANHYTRKFTG
FT                   KKYVTIPNEPIDLETVCVNDTSVIRRLSKVTVLNSTICENRSVDSFLSTVTPNNLKFQV
FT                   DKAIRLKFLQQMMSFYGMLLQINQGENKYKEKHNLFRNVLQRRKEAVELFNSNHWDEAL
FT                   TLLNQLSIDNLPATNYTDSGWWLRSGLYGLILMWQLIFQ"
FT   CDS_pept        746887..747582
FT                   /locus_tag="PAS_chr2-1_0406"
FT                   /product="tRNA methyltransferase, catalyzes esterification
FT                   of modified uridine nucleotides in tRNAs"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69027"
FT                   /db_xref="GOA:C4R0K3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032873"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0K3"
FT                   /protein_id="CAY69027.1"
FT                   /translation="MDQISIETEKDRFENVKDPALKEETYVHTVYNEIASHFSQTRYKP
FT                   WPIVEKFLNSRKNYSIGLDVGCGNGKYLGVNKNLMILGSDRSDGLIRCAYKNGHRGLLV
FT                   ADGLQLPHHNDRFDFAVSIAVIHHFSTEERRIQAIKHILSKLRPQGEALIYCWALEQEN
FT                   SRRGWKEGMDQDQLVPWVMKSQNEQQTKLRYYHLYKKGELIDNSVSAGGEIVEDGYEKD
FT                   NWWVIVRKV"
FT   CDS_pept        complement(747724..749379)
FT                   /locus_tag="PAS_chr2-1_0407"
FT                   /product="Serine/threonine protein phosphatase Z, isoform
FT                   of Ppz2p"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69028"
FT                   /db_xref="GOA:C4R0K4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR011159"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR031675"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0K4"
FT                   /protein_id="CAY69028.1"
FT                   /translation="MGNSTSKQPKGKEGALPRSDTMTSTRSVRSFRSRRSLSKDSSQHL
FT                   NDAGSFKPSQSFDNRSRKSSFRNDIKPTITPIMGASTDRLSGEFGSLSVGDDYNLQLPP
FT                   SMIQMEPRQPILKQQDITNGVSNTSPEQHSGFNNTGLSSYTSSPSSPINTPHLTVTQGS
FT                   STSLTALSHSNNNNSSGANTPKSSHSNINSPANSDSVSTMSTSVPKTTLMTSRGVVINI
FT                   EDIIQRLLDAGYSGKRTKNICLKTSEISVICSKARELFLSQPPLLELSPPVKIVGDIHG
FT                   QFGDLIRMFTKCGFPPASNYLFLGDYVDRGKQSLETILLLLCYKIKYPENFFLLRGNHE
FT                   CANVTKAYGFYDECKRRANLKTWKMFVDTFNTLPITAVIASKIFCVHGGLSPMLNSMDD
FT                   IKRIQRPTDVPEFGLLNDLLWSDPADTSNEWVDNERGVSYCFNKIAINKFLNKFQFDLV
FT                   VRAHMVVEDGYEFFNNRSLVTVFSAPNYCGEFDNWGAVMSVSDELLCSFELLDPLDSVA
FT                   LKQVMKKGKTERRNATLQSQGPNSSVSNGASSIT"
FT   CDS_pept        749794..751530
FT                   /locus_tag="PAS_chr2-1_0408"
FT                   /product="Putative transporter (DHA1 family) of multidrug
FT                   resistance transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69029"
FT                   /db_xref="GOA:C4R0K5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0K5"
FT                   /protein_id="CAY69029.1"
FT                   /translation="MEKYQDKYHPKFVPGTYSIRAVKNSKLWGGNGDSKVWKMRNGMIL
FT                   LPQPSNSINDPLNWGFLRKSVHFIQLVILAGFTAAISNNASAVQTDIHDEFNISYDSMN
FT                   TGAGVLFVAIALSCFLLGPICRVYGRKIVYLIGLVFAVLGCIWFTELRNQADAICSQIF
FT                   IGISQGSTSAQVQHSFSDMFFNHQLGASITIYVLSYCIGTYLGPLITRYITTSQGWHWV
FT                   GWYGAIIAGILLVVCILFLEDTSFDRSRYDALLDGETQKNFYETKLSRLNSRGQQKLQQ
FT                   IKELQNMLRNSLNATSTEEDNDSINLRPYNLYYPNGQGDEEEPKSYYQRMKLLRKTPKI
FT                   GDFSKLSSLLVHSLKVFSFPSVWLSGAFFGFQLSALSFYLTTEDTNYAEPPFSYSDSEI
FT                   ARMNIPPLIGSIIGCLYAGSTLDYFVLWLSRKNDDKREAEFRLWFALLNAIISPAGLLM
FT                   FGIGTARNLDWRVAYVGLGFIGFGFSVGSDLAFTYVMECYPEMILECMTGVATIANFLG
FT                   CIFTFACSPWLDASGVENTYIALAVINIVLMLASLPFIKWGKHFRARTREGYLSFVENI
FT                   EN"
FT   CDS_pept        complement(751705..752892)
FT                   /locus_tag="PAS_chr2-1_0409"
FT                   /product="Steryl ester hydrolase, catalyzes steryl ester
FT                   hydrolysis at the plasma membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69030"
FT                   /db_xref="GOA:C4R0K6"
FT                   /db_xref="InterPro:IPR006693"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0K6"
FT                   /protein_id="CAY69030.1"
FT                   /translation="MLPIKETLRTLVAWSFATLLLTILMVLASVHNLFQKKNRKLMAVK
FT                   AFPRPLPKRDDLQFYAHMLGLDLLEYHILTPDGFEIVIQRLVNPNKEVSSKPILLLHGL
FT                   LQSSASFLSSGRKSIAYYLLMNGYDVWLGNNRCGFHPTHMVFKDNDPKMWDWEIHEMAT
FT                   FDLKTMIEHVKNATNSQSINLCCHSQGGTQVFYLLANRNLEHIDKLVCLAPAVFGGEMI
FT                   NDRLLFRFMRWLSPTGYDWLFGIQAFMPIMMKVRSVLYRYKLFDFCAYAMFNYLFEWND
FT                   TLWDPEIRSIHFLFSPVYVSAKLMKWWLSDSVGYAHQKSVFDNGDWAKIEEELPRIFCV
FT                   LGSIDLLVDGKKLMNCFQSPVVTYLELKEYAHLDVLWSDDVIQDIAEPMLDFLKQ"
FT   CDS_pept        complement(753433..754305)
FT                   /locus_tag="PAS_chr2-1_0410"
FT                   /product="Essential protein involved in 60S ribosome
FT                   maturation"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69031"
FT                   /db_xref="GOA:C4R0K7"
FT                   /db_xref="InterPro:IPR002140"
FT                   /db_xref="InterPro:IPR018023"
FT                   /db_xref="InterPro:IPR018978"
FT                   /db_xref="InterPro:IPR019783"
FT                   /db_xref="InterPro:IPR036786"
FT                   /db_xref="InterPro:IPR037188"
FT                   /db_xref="InterPro:IPR039100"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0K7"
FT                   /protein_id="CAY69031.1"
FT                   /translation="MESGLNVWPADSPPCFILPRLSRDQVHTPFKKKNPVSSFCSSQTL
FT                   PKMPINQPMSQIKLTNVSLVRMRKNKKRFEIACYQNKIQDWRSGAEKDIDEVLQIPQVF
FT                   VNVSKGQVAPHDDLKKCFGTTDTDTIIKEILNKGEIQLSEKERQANSSKYTAEVLQLVS
FT                   AKCINPKTMKRYPTTMIHKALNELKFNLTSTKPAKSHALDAIRLLVSKQLIPIARAKMK
FT                   VKIVMNSKDAKASKDKLHSLITEIESENWSSEWEAFAYIDPSNYRELFNMAKVELLEMA
FT                   AINESSGTL"
FT   CDS_pept        754716..756200
FT                   /locus_tag="PAS_chr2-1_0411"
FT                   /product="Membrane protein involved in zinc metabolism,
FT                   member of the four-protein IZH family"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69032"
FT                   /db_xref="GOA:C4R0K8"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0K8"
FT                   /protein_id="CAY69032.1"
FT                   /translation="MTENSAELRKRSVKNDSGSFPYSDSVLMKRASSSSSELLGNLADE
FT                   STKEEYLLNKLDMFLSDLEFKLDNFEEYMSSSNHEHLEFISTLLSLKDKVVRKSKQFHM
FT                   DQILKIIEDNYGALLPSSLNVTEKLITAINFLDAKLSEFDKLLIEEQNQLMPIINQKLM
FT                   NVDEAIEKGADNKLIHFYDLPFHWRENKYIVFGYRFNGTHKEATKSICQCHNETFNIWS
FT                   HLLGAMLLVYLSFCHLPSMELFQSFNMTDKFVLYQFMFCAFHCLMSSTFWHSFSNIASF
FT                   PLRNSYACVDYTGITVLITSSVVTTEHVALQHVNAWYRICLITFSVLSGVAGVMFTWSP
FT                   YFDKPENRHLRISFFVSLAFLGVSTFVLLWFLKGVSPTFAFYFPLLRSFASYGIGVVFY
FT                   ATFIPEKWRTDVVVDNKEICDRTLLTLYKESRLEEELYNKTPELTSKGKKKHLTSLYWC
FT                   DYILSSHNIWHLFVLGGILGHYSAILEMFGNMKDFV"
FT   CDS_pept        756448..757545
FT                   /locus_tag="PAS_chr2-1_0412"
FT                   /product="Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69033"
FT                   /db_xref="GOA:C4R0K9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0K9"
FT                   /protein_id="CAY69033.1"
FT                   /translation="MSLEGTSIEYDKLTFKDNASPLTFKKVTHKLPVSKDEIAVKVTAA
FT                   GLNPVDLGIYYTFHPWVSCLFPSYRTLGRDYSGTVVQVGSDLQNQYYVGDKVFGYVPTL
FT                   STGTLAQYLFLKPKTKHDASIVRVDSSVTDEKLVDFAGIPLVFLTTVQSLSVAPLSDKS
FT                   RVVIIGGSTSLGWTAIQLLLNHYKVKPENLVSVNGSRSNSFVQELGVLQQNTINYDQVD
FT                   SLQNPVLEKAKDGKFDLILDAAGNSDLFDHIKEILKSKEENGHYVTLVGDHKPVYASSL
FT                   LARFPSSFASFKRFIYWNLIGGGPIHYQFRNVHASKKDIDLAYRLYKEGNYKVIVDSIY
FT                   RSEEVTEAYKRLESNQARGKVIVKF"
FT   CDS_pept        complement(757616..760132)
FT                   /locus_tag="PAS_chr2-1_0413"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69034"
FT                   /db_xref="GOA:C4R0L0"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0L0"
FT                   /protein_id="CAY69034.1"
FT                   /translation="MILANYVYSLLRAALAIAFIDQTPGVVADDFEHVPTTTVVDILSS
FT                   QVQFSKFLRVIQRNGLVPLLNQMDNFTLVAPINSAFLPSDLNAFDSEELKRYLIPYVIY
FT                   SDSFEGVRIFPNLVNNPTSFTSFDEYGEFKVSNISIVEPDLEAESQDAVVQGVEELLSP
FT                   VDDLYATLSEKGDFGEILRASTIDSDFLNNVTCFLPRKLPYNEVEFSYLTSQYANEDQK
FT                   TFLFHHLVPGIYGGDVNTSLVNLNGDIVDFSSVDHGLEISLNDTFLSTEANVLASNGII
FT                   HEFSTNLFKGFPHFTPLKVLYGLNESEFVDEIIFRKLSYLIDDPSLNQTIFIPRVTDND
FT                   DDTENFQPYGVNKNNILYQFAEGQLSGNSELLDSKYCPSKIGGCQKLKLNLIGHDLFIN
FT                   NLVVVDSSSYKIGNTSIFYIDEALTTPSSLGTAVGSYFHCSRSLQFLEDLDLLHFPKSK
FT                   GYTVLLPCFNSWNNLGLTLDYLRSNKTALALVLENLIIDGPIYSDFVGTVESTSIANEP
FT                   VILTIEPDDDQDGITKLKVNDTELDLRKYTDILFDVGVVHPVSEIILPESLDIKLQQLL
FT                   TVVDSTIFQDILSWSNLTEILEEDGYSILLPTKESLESSNITLFSNPSYLKSFIALHIL
FT                   PPGSLDKLIDCENRIPTLLNNTNLSCRRVSKDSVTLQIVEGKDKEVRVINKGCTKRTLH
FT                   HESVHPGRYNKSSCLLILDRPIDPNWLFDDPNKVPMIHLPMVAVSIGVLIGILFISAIL
FT                   SCCVLCIFRTDKNTDEEQPLIEETLEENEERRRLEAHHHNYHSTEHGNIEDNTNSSGAE
FT                   GQKTSPSTEFSEGNYSEHSKSKPIPV"
FT   CDS_pept        760366..760995
FT                   /locus_tag="PAS_chr2-1_0414"
FT                   /product="Cytoplasmic RNA-binding protein, contains an RNA
FT                   recognition motif (RRM)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69035"
FT                   /db_xref="GOA:C4R0L1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034911"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0L1"
FT                   /protein_id="CAY69035.1"
FT                   /translation="MSEETQDNKEQPQQSQLDSNQTESQASQQELDQWKAKMAEMEAEV
FT                   NKLRELQGQQEVGSRPENGVGTANSDSDPKFLSIEERQEIDSKSIYVGNVDFSATPGEL
FT                   AEHFKTCGTVNRVTILMDKVTGRPKGFAYVEFSDPSSVSESLVLNDSEFHGRNLKVVPK
FT                   RTNMPSFMVRGRGRGRGGRGSFGPRGRGDRGGRGGRARGRARFVPY"
FT   CDS_pept        complement(761083..762798)
FT                   /locus_tag="PAS_chr2-1_0415"
FT                   /product="Alpha-isopropylmalate synthase (2-isopropylmalate
FT                   synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69036"
FT                   /db_xref="GOA:C4R0L2"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0L2"
FT                   /protein_id="CAY69036.1"
FT                   /translation="MPMLKDPSKKYVAFKPLNLPDRQWPSKTLQAPPRWLSTDLRDGNQ
FT                   SLPDPMSVAEKKEYFNKLVQIGFKEIEVAFPSASQTDFDFTRYAVENAPADVAIQVLSP
FT                   CRPELIKRTVESLKGAKKAIVHIYLATSDCFRNIIFGLSQEESLEMAVNCTKLVRELTK
FT                   DAPEMQDTVWGFEFSPETFSDTDPDYALRVCEAVKAAWGPSEENPIIFNLPATVEMSTP
FT                   NVYADQIEYFSRNISERKTVAISLHPHNDRGCAVAAAELGQMAGADRIEGCLFGNGERT
FT                   GNVDLVTLALNLYTQGVYPHLDFSDITSVIDIVERCNKIPVHPRAPYGGQLVVCAFSGS
FT                   HQDAIKKGFKKQEERQAKDPNARWQLPYLPLDPQDIGRTYEAIIRVNSQSGKGGASWVI
FT                   LRNLELDLPRALQVSFSKIVQNESEVKGRELYNKEITNLFKNSYFVDDDDTQHDLYFQL
FT                   VDYSITNTSKSARLINVELQVGKDTVSLKGIGNGPISSFASAISSYLKKDVLVLNYHEH
FT                   SLGKDSNSKAATYLHCAIGDDCKVWGVGIHEDVSQASFLSFISLLNSARRDGKI"
FT   CDS_pept        complement(762961..764070)
FT                   /locus_tag="PAS_chr2-1_0834"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0834"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69037"
FT                   /db_xref="GOA:C4R0L3"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR039204"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0L3"
FT                   /protein_id="CAY69037.1"
FT                   /translation="MFIRHRIRLFSYSCGRLTQEYNKTLLSKSLGVKTDSGSITRCTVY
FT                   DATGNASSVSSRTLKNELLLKHELLPRDLRKIDKGYDDIVPAILIRPSSILINVLHIRA
FT                   LIRSDRVILFNQGPSNSHTNTMFLNDLAAKLKTPTKEAGIPYEIRALEAIFISVVSNLQ
FT                   SEMKVNTMVIKGILKELEDHIDRIKLRYLLVQSKKLKQFHQKAALIRNLLEELLEQDDE
FT                   LAALYLSEKRSFHDHQEVEMLLESYLAHCDEIVQRVETYLSNVRTTEEIINIILDSNRN
FT                   QLMLLGLRFSIGLLSFGGLIFVASLYGMNLENFVEESDYWFWIIVGGSTTLCILVFAKG
FT                   VKALSKLERVSMLGDDLKPLTQVRRSRNN"
FT   CDS_pept        764399..766474
FT                   /locus_tag="PAS_chr2-1_0416"
FT                   /product="Protein kinase that forms a complex with Mad1p
FT                   and Bub3p"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69038"
FT                   /db_xref="GOA:C4R0L4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012572"
FT                   /db_xref="InterPro:IPR013212"
FT                   /db_xref="InterPro:IPR015661"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0L4"
FT                   /protein_id="CAY69038.1"
FT                   /translation="MSQDGVTASLPGWFRDQISMIDELDDPLEPYINYLKECENSNVLI
FT                   QLLEDVTRKFKDDQLYSNDIRYLKLWLHYIKFSNSPRKIFLYLHKKQIGSKLTLFYESF
FT                   ARYLESEGEIIHADELYQMAISNNSKPINRLLKSYTLFKNRHQQLNERSHLFSEPTQTA
FT                   HIFVKNPNLEYPVRKLITNKNKKDELFDFNLDLIYRDNEEFCFEEILAISYNLYDYTEN
FT                   NPQKNKENQNPAFLQQKLQDNPELPLEPSEIRQVRHDILHNKTLIKPIAISSSPEQSPA
FT                   SSPFVENVDSSMEDQEPLTQPLIEKITLNPMSPDFHSELLKKLNPPLSHYSRISVYPKP
FT                   LNKLSVLTSIFRADKNRMVLGNKNTMFQFGEKMYCITKLLGEGGYATVFLAESDLGELV
FT                   AIKVQNPVSLWEFYVFKTIENRLASLNPNDKLVKSFVLCQSFQVYQDETYLIMDYLNQD
FT                   TLLEVINVYRSLGKSGVDEQLVLFLTIELLTCIEFLHDIGIIHGDLKPDNCMVRFEKIA
FT                   DSKWSEFYDATGNNGWCKKGITLIDFGRSIDMTLFPNKGENVNFLCNWKVDEQDCPEMR
FT                   NGEPWTYQADYFGLASIVHFLLFGKSITLRKDENGNYRINESFKRYWQVDLWNEFFFDL
FT                   LNSTKVGTRVLPNNDILSKNKIKLCHWLTHHSQGLKKSISDLELIYRERSKKVFKR"
FT   CDS_pept        complement(766515..768335)
FT                   /locus_tag="PAS_chr2-1_0417"
FT                   /product="Transmembrane protein subunit of the
FT                   glycosylphosphatidylinositol transamidase complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69039"
FT                   /db_xref="GOA:C4R0L5"
FT                   /db_xref="InterPro:IPR007245"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0L5"
FT                   /protein_id="CAY69039.1"
FT                   /translation="MLRNWGFWLIVSQFSLVFCNQKGSFKERLDFTPLPKNNLLASFNF
FT                   EIKSDTVNWYDTSSTYSHYTVFPKSLGPILEDTKTRELHLRFSQGWWDSELWGSLPQNG
FT                   SQSGGTGVEVWAVIEADNKTEAEGEWIHLVNSLSGLFCASLNFIDNVITTNPVYSLQPT
FT                   SNFINELPTEGDLFLFRSALPREPVCTENLTPFLDLLPSKGKNGLSSLLNGHKVYDSQW
FT                   NSMSIDVETNCDDELNCHYDLKQNIHMIVNTKRVLSKLRDPLPVPTPGNELRCDRTKKH
FT                   DAYYCFPLVDSTDIKIDMREIFGNIINGENTVTTEKSRVCAHTVPEVWKVLAKVNDYDS
FT                   VFAYSEVQEPCYEISGTDTLNIELKTDRSDITLPLKEPPLVVSRSLTGYSQDSGGLRID
FT                   FRNPSDSEEVNFVYYQSTPWYMKTYLHTLKMTLTNNTSGESFVIPITDRSIVSYLPEFY
FT                   YEPMIDRVRPSHLELKLVLPPNFSMRLAYKFDKLMLKYAEYPPDANHGFEIEPAIVTVV
FT                   DKFNKVIYEARTTPALLTLPTPDFSMPYNVIILTSTVMALAFGGIFNLIVKRVVTEEQA
FT                   EYYYQQNSPKLRLRRLIARISAKFQKKKAD"
FT   CDS_pept        768523..771636
FT                   /locus_tag="PAS_chr2-1_0418"
FT                   /product="U2-snRNP associated splicing factor"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69040"
FT                   /db_xref="GOA:C4R0L6"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR038737"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0L6"
FT                   /protein_id="CAY69040.1"
FT                   /translation="MSHHNDSGLIPFDPKGSNGVQAAPQYTIPKEYEEEMIDNAEDIDP
FT                   LEGSIVSSKPKESDYHKRKYDNLMNINLTQQERTYKDRMKERQLDRQEEDIQKLLKQKQ
FT                   EQADQKFNDAKPENQPTRKRKKRWDVKSSEGDSVTVNILPVINGIELNNSILDKILPNG
FT                   YTIVEPPLSYKPLNDLPPDYKQEDQGYLLPEESTLALENKAVETAQELAIENLGEKEKK
FT                   VHTLISNIIEGASNMRKPALRQLTENARTFGAQAIFDQLLPLFMKRNLDEHQRHLLVKI
FT                   VGRVLYQLDDLIRPYTYKILVVIMPLLIDEDYYTRIEGREIVANLSKAAGLAHMISTLR
FT                   PDIDHSDEYVRNTVSRTFAVMSCALGIPVVLPFLKAVCNSKKSWQARHTGMKIVQQIAI
FT                   LAGSGVLPHLNGLVAAISKGLSDEHVHVRTIAAQAASALAESSAPYGAESFQQILDELY
FT                   KGIRRHRGKGLAAFLKAIGYIIPLLDPDYADYYAKMVFKVLIREFESPDEEMKRTCLKV
FT                   LQQCCDTEGIEKQYLIIEVIGSFFKSFWNRRTALDRRTAKLCCETTFHLSKRVGAGLVL
FT                   DNILVHLKDESEPFRRMTAETCYKVVQSYGTAELSDKSVDQLLDGILIAFQEQVIQDNV
FT                   ILKSFSVIISSLGLRIGVHLPSIVSIILYRLKNREPEPRRQAASLITVVAPVIKKCGNE
FT                   DMLLKLGSVIYESLGEVYPDVLASILEAMKAVIAVVGVESMNPPMSQILPTLSPILRNR
FT                   NEMVQETAIGLIGMIAQRAPEYVNAREWMRICFSLVEMVKSQRKSIRKAANRTVGYIAV
FT                   AIGPQDVLVTLLNNLRVQDRQLRVCTAVAIGIVAESCAPFTVLPALMNEYQTVENNVQN
FT                   GVLKALAFMFESIGSMGKDYIYATLPLIEDALTDRDLVHRQTAANVVKHMALNNVGFGL
FT                   EDAFIHFLNLLWPNIFETSPHVIARILEGIEGCRNVIGCGIVMNYTLTGLFHPARKVRD
FT                   SYWKVYNPMYVQSCDSMVPYYPDFKDQILTKDTEQVTPTVIEELDIWV"
FT   CDS_pept        771924..773024
FT                   /locus_tag="PAS_chr2-1_0419"
FT                   /product="Mitochondrial NAD+ transporter, involved in the
FT                   transport of NAD+ into the mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69041"
FT                   /db_xref="GOA:C4R0L7"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="InterPro:IPR040062"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0L7"
FT                   /protein_id="CAY69041.1"
FT                   /translation="MKLKGGDGAQNPSQPTAGPRYSFITKENVTPISGALAGLIAGIAV
FT                   CPLDVAKTRLQAQGAFLQSKNVDHKLHQVFENKRYQGLVQTIKTITREEGIRGLYRGLV
FT                   PISIGYLPTWMIYFTMYETCQKFLDRTSFISQGNNLSYFISAIGAGLASSTLTNPIWVV
FT                   KTRLMLQTGSGSTIYDRFDGKHGINDMIEDKLKHSYYKGTIDAFRKMFKEEGILSFYSG
FT                   LLPSYFGLIHVAIHFPLYENFKIIFNCTQKDINEARKNNVNGSLPKSIVFKLAFVSCAS
FT                   KMFASAITYPHEILRTRLQIDGHDLGRKKSGLIKTIKSIYLKEGIRGFYSGFVINLTRT
FT                   LPSSAVTLVSFEYIKNYLDKIASPAL"
FT   CDS_pept        complement(773392..773769)
FT                   /locus_tag="PAS_chr2-1_0420"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69042"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0L8"
FT                   /protein_id="CAY69042.1"
FT                   /translation="MITVGRKNSTKWIPWARVSLKVSGVKSSGSWMELILMTVGPFSTP
FT                   ITGALGWIGCFSKSYCQKTGHDRFCNFHGDCCQNETVCAMLSLSRVCNCRTVVIYGRQS
FT                   QSRTDRCLVSSFSCLVLVLCI"
FT   CDS_pept        773845..775749
FT                   /locus_tag="PAS_chr2-1_0421"
FT                   /product="ER protein with chaperone and co-chaperone
FT                   activity, involved in retention of resident ER proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69043"
FT                   /db_xref="GOA:C4R0L9"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0L9"
FT                   /protein_id="CAY69043.1"
FT                   /translation="MRQVDCAANGDFCGKQSINSYPTLRLYGPSEDNTSYKLITTYPSG
FT                   GKRTPQNFLKFLRSQYDDLKNDRFNLPVKGEVLTEEKMLKLMNGDIEEPVLVSFWPTTD
FT                   KETTLKYFEDVHSNPISFKNCYSCFNLAVLWSRITNRLPDLETAVFNCGGTNSRVCQAL
FT                   NLPFNVNRAQVSPEIYMFLPNSHGGIRVKYNHDLVISDIVDWSERLLANAQAEEVTLDS
FT                   LAEKMTLLNPAKGLDFFKGPDPNQKQVFVYYYEEGSDAPEDFEIWPHLLQPIMDLTTNT
FT                   YIYRSKDSQLEDLLDKKYKKLIDYINQPDFEPERPLNRETYLARTITSVPTFLVFKDNN
FT                   MIPTVYQNFSPNEIRDVKKVVNFIEQNQFPLVDRLTTDNYESYFPKFNPQIHDKDEKIV
FT                   ISFFSSDNKTQTTNDYNQLLFVQHSYDYIKHQNRFDLIEKARADKTDKSEQLKGEGMDP
FT                   KEIIKVLSKKIDHLNNVGNVLTVYVDLADDRKLLEKTGWISSRTKYKPGESIIVTRFGK
FT                   HYWDRDVFGHKLMTTAQSLRETLSYLLFPSTYIPPEKKTTVRPSPRVAGSPYPDAFAFV
FT                   DIIHQYGLFGYLLIITSVIGVYMLIKSHRRRSRKAKFLSHRSHKEGFQDAYIELSKHD"
FT   CDS_pept        775912..776439
FT                   /locus_tag="PAS_chr2-1_0422"
FT                   /product="Acireductone dioxygenease involved in the
FT                   methionine salvage pathway"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69044"
FT                   /db_xref="GOA:C4R0M0"
FT                   /db_xref="InterPro:IPR004313"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR027496"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0M0"
FT                   /protein_id="CAY69044.1"
FT                   /translation="MQLYYHDGLDTPDNFCEDHNSGEEVSVEELSKIGVIYYHLDEESQ
FT                   VEKIARERDYKNRDFVVLSDETFPGGPDALQEKLKVFYKEHLHEDEEIRFILDGEGYFD
FT                   VRSQNDRWIRSKLFKGDLLILPAGIYHRFTLSTKKYVKTMRLFKEEPKWQAYNRPADDK
FT                   GARLEYLKSIQV"
FT   CDS_pept        join(776747..776780,776835..777157)
FT                   /locus_tag="PAS_chr2-1_0833"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0833"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69045"
FT                   /db_xref="GOA:C4R0M1"
FT                   /db_xref="InterPro:IPR002777"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR027235"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0M1"
FT                   /protein_id="CAY69045.1"
FT                   /translation="MSEGKPNPNQELFQKQYDEFQETLEALNNKIGQLQGDIEEHNIVL
FT                   KTITTAPKDRKCFHMIGGVLIEKTAGEVEPTLKTNVTKMNDAVENLKNEIQNTHKQFED
FT                   WKKKTGVKIVSANE"
FT   CDS_pept        complement(777240..778535)
FT                   /locus_tag="PAS_chr2-1_0423"
FT                   /product="Beta subunit of the oligosaccharyl transferase
FT                   (OST) glycoprotein complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69046"
FT                   /db_xref="GOA:C4R0M2"
FT                   /db_xref="InterPro:IPR005013"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0M2"
FT                   /protein_id="CAY69046.1"
FT                   /translation="MNHFKGLIVLIWSFCTAVMALSPIASDTLVVYDSSVLEFGEFSSL
FT                   VDHLNGEFSRVDIVDLNDKASEVQLFYNQKRIYQNLFVFPISGQSNQGDLNALKLIEFV
FT                   NEGGDIISITNQVGSNSEIVAFNTELGIYPSPKNYKLIDHFNGVNEQHDEIRLSLEESV
FT                   VPNSIVAFNKAIVYSGAASLLSNNEYLIPLLKAPKTSFAYDINEGVVNEQSTWTSGDQG
FT                   FLAVAFQGLNNARSLWLGSTLFFDNEHFDQSAKDLVDWTFQSRNLLKSTFAKHYLTDAP
FT                   ESTEEYKVKDEVSYEIGLSEWNGKEWVPFKANDVQLELIMLDPYYRITLEQVKTEDESV
FT                   QVYTSGPFKLPDQHGMFTFSTKYFRPGYTFIEEEDIVPVRHLANDEYPRSWEITNSWVY
FT                   VASAGAVVIAWIIFVIFFLYSTEDATEIKKNI"
FT   CDS_pept        complement(778979..781939)
FT                   /locus_tag="PAS_chr2-1_0424"
FT                   /product="Phosphatidylinositol 4,5-bisphosphate
FT                   5-phosphatase, synaptojanin-like protein with an N-terminal
FT                   Sa"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69047"
FT                   /db_xref="GOA:C4R0M3"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR002013"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0M3"
FT                   /protein_id="CAY69047.1"
FT                   /translation="MKVLLRKNPRSVALVSGDYCLLFKTVRTQNHVNSKPKSIIEFVSL
FT                   KHLSSQHYYELNMECYGLLGLIHLKGNTFVCVITGKQEVGSIRPQERINVIKNVNFICL
FT                   ENDSFEYIETKYNTQALTAEKNIEIYEKEVPYSSLKRLLSSNSFYYSNDFDIITSLQHR
FT                   ESSYLRKEKKFRMILEYSKNFLWNNFMVGELINFKDHLTPQERFLFEERGEFLVCIMRG
FT                   YVQSVNCSIETNGDSLMTIISKQNCVKTGKGHLFGPWGLDDNGNTSNFVQSTVCLYTKN
FT                   TIFFYNQIRGNVPLFWSLENQLLSTKIDFPRSSESSQAAFDKYFDILCQNFGNVHILDG
FT                   LSERGYQRELTEKYKESFRNLDDVLRQQVTYNEINFPLDSLKNHTADSKLLKAIEDRII
FT                   DIGAYCYNLKDQTSIGKQSGIFLTNTFNSLEKANYIQQLISSTVFHACLSDLDLNFSNE
FT                   IAAKHNELWHENGQRLQKITLHAMSSKHTKNKQGGLVGVVAGVSKKYVSNVVQDNKIKE
FT                   HNVDKLLGRLNGQIEVQLIDPIHDFVTNELRKKKNEFTSQRTLKIFTGTFNINGELYEG
FT                   DIRSWIYPLDDSAKENYDVIAIGFQEIISLSAGKMINVDSKNRQFWEKKLLLTVNRDDP
FT                   NKYTMLWVSQLGGICLFLLVKTTAKTRITDIEGTLKKTGLAGIAANKGAVAISFTYSST
FT                   TKFAIVSSHLAAGFHNVVERHQDYKTIAKGMSFARKRTLKDHDIVIWMGDFNYRIELSN
FT                   EDCKRLIGEKNYRKLYEYDQLNNQMAEGHAFPYYDEMELNFAPTYKFDNGTSRYDTSEK
FT                   QRVPAWTDRILSISRGKSLNQISYGSVPSIKFSDHRPVYGVFKATVDVIDEEIKNRLTA
FT                   ELYEEMKHKIGDANDILFYGDIINEQDTANMAPSNPGASNYVDNEITLAHGLPPPSSEH
FT                   TKWWIDGRQSVRVHFPELDDGKMMVNPNLPRNPFEKTKEADFVTIEEGLKEYPSES"
FT   CDS_pept        782340..783869
FT                   /locus_tag="PAS_chr2-1_0425"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69048"
FT                   /db_xref="GOA:C4R0M4"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0M4"
FT                   /protein_id="CAY69048.1"
FT                   /translation="MTEKEHYEQLCYACRIADVEQVEMLVSSGIDVNRVDEWDYSPLIL
FT                   ASLCGHLNVVKLLLKVGAICDRDTFQGERCIYGALNDEIRNVLLSYDISKSVNESQPFS
FT                   AHIHKLISGKATVNTKDMLLNNCVPVHRWYISSQQVGISIDHSNVTLNYDTKIVEQLIK
FT                   FLYLSPQFQVNESDLKPLVQCSKDFGIACFQQLCNEYLELSAQNDIKRLSKLRHKIQFS
FT                   QSLHTRDLLKEFVETQVLGAKIELGSSTDISPVKEKLFNLESCPDIILRLGNAFYPAHR
FT                   SMMVRSGYFDLMLQSSFAEASSYNELTDVIYHRDQVDPKVDIQVISLTEEIADERLFEI
FT                   LLRYVYYDETSVPANLSLETLYMSDQLMVDKLKTMAAIAITNDWESTGYSLYEILEAAW
FT                   VTRVHRLETFVAHEFAKHFDHYVTQPEFKEVIMESANRIDARQAVDSIELIDDIRFYLT
FT                   RVYSIDFEKPYHPEVDYEKWEIQQMNSDNVIQYNRCLQEIENLLAECGFDA"
FT   CDS_pept        complement(783887..784558)
FT                   /locus_tag="PAS_chr2-1_0426"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69049"
FT                   /db_xref="GOA:C4R0M5"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4R0M5"
FT                   /protein_id="CAY69049.1"
FT                   /translation="MKFLRLSTLALVGLGFLTQTTLCDPDTDEEFVPTEQKPFNIRVTY
FT                   EIDEHPQSFESTKLIELVNGEEISVTYNIKNGEDESVSVVGVAGSFNDPVTGLTKRNLT
FT                   ASSVGPLKLLKDMTFEFTQKIGIDLEPENYLFVPSIYVLKDDQLMLLGSKNQLITVSDP
FT                   QISVFQPQMLFLELVLLASFGGLIYALYATFGASYFQKPATAPKNKKVGSSNVRKTKKN
FT                   K"
FT   CDS_pept        785091..786227
FT                   /locus_tag="PAS_chr2-1_0427"
FT                   /product="Putative high affinity iron transporter involved
FT                   in transport of intravacuolar stores of iron"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69050"
FT                   /db_xref="GOA:C4R0M6"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0M6"
FT                   /protein_id="CAY69050.1"
FT                   /translation="MGIDISDYFSPQIFFIILRETLEAAIIISVLLAFLDRSFHTSSGY
FT                   QELPTEPATSQESDNTAAEIVGGEKLYKRLRLQVWVGSFLGLLLCLFIGGIFIVVFNVA
FT                   GSDLWAYTEHYWEGAFSILAAVIISVMGLAMLRLNQMKSKWHLKLNNLILNQTLQKENQ
FT                   TEKYAMFFLPFITTLREGMEAVVFIGGVGLDQPLSTIPASLLLGLAIGVSVGIALYKTG
FT                   HTMSLRLFLIGSTGFLYLVAAGLFSKGVWQFELQKYIDRCGGQDMSEVGSGPGSYDIGN
FT                   SVWHVNCCNGEMDGGWMLFTALFGWTNSATYGSVTSYIVFWVILVASLRMLRFEEKNGY
FT                   LPFIPLSWQAKRCKKRILLLRSNHTLSQEPSNNQGSSE"
FT   CDS_pept        complement(786382..786780)
FT                   /locus_tag="PAS_chr2-1_0428"
FT                   /product="One of two nearly identical (see HTB1) histone
FT                   H2B subtypes"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69051"
FT                   /db_xref="GOA:C4R0M7"
FT                   /db_xref="InterPro:IPR000558"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0M7"
FT                   /protein_id="CAY69051.1"
FT                   /translation="MAPKAEKKPASKAPAEKKPTAGKKTSSSSEPKKRSKVRKESYASY
FT                   IYKVLKQTHPDTGISQKAMSIMNSFVNDIFERIASEASKLASYNKKSTISAREIQTAVR
FT                   LILPGELSKHAVSEGTRAVTKYTSSTQA"
FT   CDS_pept        787331..787723
FT                   /locus_tag="PAS_chr2-1_0429"
FT                   /product="One of two nearly identical (see also HTA1)
FT                   histone H2A subtypes"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69052"
FT                   /db_xref="GOA:C4R0M8"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR032454"
FT                   /db_xref="InterPro:IPR032458"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0M8"
FT                   /protein_id="CAY69052.1"
FT                   /translation="MSGGKGKASSAEKASTSRSSKAGLTFPVGRVHRLLRRGNYAQRIG
FT                   SGAPVYLTAVLEYLAAEILELAGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGHVTIA
FT                   QGGVLPNIQSELLPKKSAKAKASQEL"
FT   CDS_pept        complement(788398..789351)
FT                   /locus_tag="PAS_chr2-1_0430"
FT                   /product="Essential subunit of the COMPASS (Set1C) complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69053"
FT                   /db_xref="GOA:C4R0M9"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR024977"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037866"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0M9"
FT                   /protein_id="CAY69053.1"
FT                   /translation="MVQKVDYELVLDIQLGSGYTTCAKFNPEGSLIAVSFANGTIQILD
FT                   QEGHRVKELKGHTLGVSDLSWSEDGRYLASASDDTTVKIWSIESFKCVKTLVGHTYHVN
FT                   CVKFNHKGNLLISGSSDEAIRVWDINNSKCLKTLCAHSDPISAVDLSWDGTIIVSASYD
FT                   GLIRLFDTQSGQCLKTLIYDGGDVSYPVSYVRFSPNGKYILASTLDGAVRLWDYMDNKV
FT                   VKTFFAHKQGIGEVSKIEMGKYNCNTDFFIDEKDPSRIIVVSGSDFGSVFLWDVKSRKL
FT                   LSLLQASEGSPILHVQVNNGKLLTLSRVGECKVYQL"
FT   CDS_pept        join(789530..789532,789587..789965,790022..790083)
FT                   /locus_tag="PAS_chr2-1_0431"
FT                   /product="Short-lived chaperone required for correct
FT                   maturation of the 20S proteasome"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69054"
FT                   /db_xref="GOA:C4R0N0"
FT                   /db_xref="InterPro:IPR008012"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0N0"
FT                   /protein_id="CAY69054.1"
FT                   /translation="MAPLTVIPLNDKTSKVDSTSFATPSVAIPSLPDTLREQKGPLSIA
FT                   SEINGKHPLEARLRNWEENEHNNRLETYRRIFGAGEPIKRQMELGIVDATDFKPTILGG
FT                   PSNLHRNILLNKDTSIDWEDVYTGFDSVACPDMHTEMERKVGI"
FT   CDS_pept        790555..792825
FT                   /locus_tag="PAS_chr2-1_0432"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69055"
FT                   /db_xref="InterPro:IPR003169"
FT                   /db_xref="InterPro:IPR035445"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0N1"
FT                   /protein_id="CAY69055.1"
FT                   /translation="MPYSYDSSGTSQTNFQEASTTVNAQEVPPRPKNSYSVSEMFEIRQ
FT                   RMVDANQLLPVESQLPYRLSEINRTIHVDLKEARLQDSTKKSSPTVNGFSNTDHDSQFL
FT                   VDKMEKLSTNDQGSNWSSPLVSHPLLTRQTSSRISSNMTPPPGITPLGSVPPTLEPSQI
FT                   QWIYLDAQGQEQGPFDGLMMQGWFEANYLTPELRLRRKEESSFRTLAELVQSLGDFRYP
FT                   FLKRLPPITQSTDPIFFPNHAEVPQWGANSSNSKSSSPWISHQNLSMDYGGQRLNSPST
FT                   FLPQFDLTSQIRAATPLSAPIVSTPDFSAEILGASTAPLGESNQKELSATLTKEAEPEN
FT                   IDDFPIKSISFDDEPSQGSTPVSTAKDEPEPSKPATISSVFASSSVTVPTSAPAPAPVP
FT                   APTTVRTLPSLREIQQEELTKAKLRRQAEEARLQESLRLQRLKEQEKSKNEVSTSQKAS
FT                   DIAPWANTKVSGPPLSLRQIQELEAKQLQERKKKQLNNVQNQPIAQRLSEGAASTSLPA
FT                   SATWAKTPVAPVLATKSLTEIQKEQAEAQAQRLQSQALKNNAVSFANVASSSSTPVEPE
FT                   DGWTVISKKVVAKPKPSAAAVAGALAPKQPLAPSALRALSAQGTVGTTANTATRSSQSA
FT                   PPSRQFLDWCRSQLVQLNKSVNKEDLLSILLQLSGGSESQEIIADTIYSNSSIMDGRRF
FT                   ASEFLKRKQVVEAWIEKNGFEFDWYEAQTKTLNDVNDSSKDQDDEWDMAFTKVVSKKPK
FT                   KRV"
FT   CDS_pept        complement(792882..793460)
FT                   /locus_tag="PAS_chr2-1_0433"
FT                   /product="Non-essential subunit of Sec63 complex (Sec63p,
FT                   Sec62p, Sec66p and Sec72p)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69056"
FT                   /db_xref="GOA:C4R0N2"
FT                   /db_xref="InterPro:IPR018624"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0N2"
FT                   /protein_id="CAY69056.1"
FT                   /translation="MAEEEPIIEDMPLQKISVFTPIIYVSIVIGALILFSIFYRRKRIA
FT                   KLQVMKPFFPPDLPKEIYLQLKDQDPKPDEKVLKAALIRRGAEAIRRLLKLRENNQYIT
FT                   LLYQKGSIGDEFFDRFKLALKIQELEIQELVQEAETYKQGWAPTFMPVCQEVTLNEALR
FT                   RRVNAIEDRKEQLAKEWELYQEIEASITN"
FT   CDS_pept        complement(793591..794451)
FT                   /locus_tag="PAS_chr2-1_0835"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0835"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69057"
FT                   /db_xref="GOA:C4R0N3"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0N3"
FT                   /protein_id="CAY69057.1"
FT                   /translation="MEKYTTYRDKGTGISPFLPLNKPKVNIFLRLVGVVLGVLKLLVLL
FT                   IVGLLYPVVPLLSTKAVLFLLNVDVDVSVDNIKKANKPLIQLNLPQKGDFVISNYQSPL
FT                   DPLVLSLITNNRLKNIVWLIPDIEGNLYEYSLFGVVVHALSSPNLHAQKNGKKIQLSSI
FT                   SESKTVFLFPEGTTSNNKSILPFLVTTDTVSVPKLFKKFKVKALSIKNENPYTTTPIPQ
FT                   ALASYLLTNLFTRNSSHYRLKEFILDKDHTWPEIRDLLSNSGRLKLVGKDLSLEKKVEF
FT                   IEKFR"
FT   CDS_pept        794666..795667
FT                   /locus_tag="PAS_chr2-1_0434"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69058"
FT                   /db_xref="GOA:C4R0N4"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0N4"
FT                   /protein_id="CAY69058.1"
FT                   /translation="MSQSASTTSRQSSLPQLTSSQASSTITSSASSSSNSESQNSTGSS
FT                   SANSSASSSGRPRLSSSTTSSGMPQLTTTSQTSSTSSFSTPAISVPPSNNNPFIWRSSQ
FT                   PSGTVFISIGAVMGLGIICFIIYITWKSLKFKRQAKTGGFYDSDDSYSHKYDTKYYGND
FT                   LTTTPSRVPFMAPDLRSTTDNTYYSSSNSEPGVNAGAFDSISTFHHKSKQPLDTTRMYV
FT                   SPTGDAIKHSRNSVLLPSVNNGKFGSDTSILSPSIKQSYQYKSPTGHHRSNSSQQLFMS
FT                   PMLSTTSLADSKIQQQQQSPSEKKSKRNAKRKTVPSMYLDQLMDGEGTDDLV"
FT   CDS_pept        complement(join(795783..796459,796520..796550))
FT                   /locus_tag="PAS_chr2-1_0840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0840"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69059"
FT                   /db_xref="GOA:C4R0N5"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0N5"
FT                   /protein_id="CAY69059.1"
FT                   /translation="MVFCSGSHKPIQRKIVILGDGACGKTSLLNVFTRGYFPQVYEPTV
FT                   FENYIHDIFIDRKQLQLSLWDTAGQEEFDRLRSLSYTDTDTIMLCFSIDSYDSLENVEN
FT                   KWVGEILEHCQGVKLVLVALKCDLRNTEDGDTQTQSGFPQQQDQDDSQQNQQLSQQNNL
FT                   SSDNGGIQSSSKGRSLVTYEKGLAVAKRIGALRYLECSAMKGRGVNEVFTEAARCALSV
FT                   KHEEDNKTSCTIM"
FT   CDS_pept        complement(797118..799319)
FT                   /locus_tag="PAS_chr2-1_0845"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0845"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69060"
FT                   /db_xref="GOA:C4R0N6"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011947"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR039189"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0N6"
FT                   /protein_id="CAY69060.1"
FT                   /translation="MNNIIELRLPSSVPFPVHITGIAIKEGDELGKHNTVLKYKYSEFR
FT                   DVTEDRNEYDEDYSYKPPKKEKLELIGSYECPVDGIVKDVLVSIGDVVENKESVIATVI
FT                   EPCSHSVQYGGLCALCGSAVEGNDYTGFSYDKQAPVVMSHGSADLKISLTEAEKIEQTS
FT                   SKRLLKEKKLSLVVDLDQTVIHATVDPTVGEWMKDPNNANYPAVKDVRSFSLKEEVILP
FT                   ENYVGQKPPATVCWYYVKLRPHLREFLEHVSERYELHIYTMATRQYAKEIAKIIDPDEK
FT                   YFGDRILSRDESGSLTQKSLQRLFPVDTSMVVVIDDRGDVWNWSSNLIKVVPYDFFVGI
FT                   GDINSSFLPRQHALLGPSKRRKSLASLEDQINAEKDLRDQSFQIDPEEQDKELSEELVV
FT                   SDENISDSSKENGEERGDSKETASTVDALLTMNDANGKTLREQSTEHNLEIEQQQSERP
FT                   LAKLQENLEKIVQTESDHESANLLFDDDNELETLEQALIRIHNEFYFEYDDSKVGNPDV
FT                   KDILNSMKQLVFKEYTFLLSGILPLGTKLNSADIVIWARSFGATVVADYDKSVTHVITR
FT                   NTGTFKVKLAKTLDPNVKIVDPNWLFKCISFWDKVDEDEYLLEVPEDYLLPDHIVEKYV
FT                   NENNIEKGQDGNDASFDLNVDDMQWIDKELEDFLSGDEIDDDEDDNDDDEANGTKKRHA
FT                   EAGIADDEDTSKRLKLDEEETDSSEDELAKEIMLDMEKE"
FT   CDS_pept        complement(799520..801073)
FT                   /locus_tag="PAS_chr2-1_0838"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0838"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69061"
FT                   /db_xref="InterPro:IPR019473"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0N7"
FT                   /protein_id="CAY69061.1"
FT                   /translation="MADKSDDNQSLVSVSSASSGKENPNSVGQRSMNPTLSHEEQHDQE
FT                   VQERYNTGKDLNITSQPECVPAMEVALKASVLLILSSLGVQASSLSIDHLTYITTKYID
FT                   RLVSELHRSTEIQRRRTIAKRDVQLVVDRGILDLEDVTLEYERLKLTRKRVKPSIEKLS
FT                   KYASELKESASSVQVSENDKDAFFFFDIAEKISEFMPLRMKRKNYIPKWMPVLPPEHTY
FT                   VATPQFTEVISDPKELREQLTAESRLGEKALQHLIGTKIVEDKKEDVGNENDNDIDKEI
FT                   HHGEIDVESDHNLEKGPNGETNGVQSQPPKSMVSSKRFDIVAHAKHRLSVLEKRKRHQE
FT                   QLLENRRKEIDGLVGQYLGYYATKKIEPPVSDIIVNIMNTEYYHVSREISKSEHRKQKI
FT                   QESQQLKRRKLEDELQQELEHQTEDIDFEFNFDEDDVDMNKNLNENLNENENDDEQVLI
FT                   EEDTSFDITNGDIEKTNQETPFTNGSSKQWDSNNAILDSTNSEPEPEPPIADLFNVDSS
FT                   "
FT   CDS_pept        complement(join(801278..802400,802457..802485))
FT                   /locus_tag="PAS_chr2-1_0892"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0892"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69062"
FT                   /db_xref="GOA:C4R0N8"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0N8"
FT                   /protein_id="CAY69062.1"
FT                   /translation="MSQEIQVFIKASGNQEYELTVDPSITVEEFKGKIAEVSDIPADRQ
FT                   RLIYSGRALKDADTLNFYKVQSGHTIHLVKSAPKNDGGSASVANANNSTSTSTGAANNT
FT                   SSAPSNIAAGQGAFNPLAGLTGARYAGMDVPMPSASMFGPDGGMGPMPDENQIAEMMES
FT                   PMVQESMRNMLSDPQMVEFMIQQSPQLQQLGPYAREMLQSEQFRQMMTNPQLMRQMSSM
FT                   RHMFGGAEAGAASFPAPGANPTLERNTSENNAGSATDSEANAAPTNDNTNNNNSTTTNA
FT                   TGINPFSALLNSSNPYAAMLNQSGGNAPPLPNTGNMQLFNSLFSGGAAPPAETDTRPPE
FT                   ERYETQLRQLNDMGFTDFESNVAALRRAGGSVQGAVNNLLNGS"
FT   CDS_pept        complement(802606..804975)
FT                   /locus_tag="PAS_chr2-1_0435"
FT                   /product="Mitochondrial intermediate peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69063"
FT                   /db_xref="GOA:C4R0N9"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="InterPro:IPR033851"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0N9"
FT                   /protein_id="CAY69063.1"
FT                   /translation="MKASSIQRLAVITRSCHKRTFTTHSALLQKIQPLVHEQNPIPDYL
FT                   NFQQKHTHHNELIREIFDNPVKWKEFNKSFIPHTKVSLTGKTYIPQVEGSIGLFQNPYL
FT                   TSPEGLLEFCEKSLSAAKNLVSHVIIDDSEQGKLNYIRNLDRLSDTLCRVIDLAEFIRV
FT                   AHPDEYFVEAAQKCHEIMFEYMNVLNTTSDLFNKLESVLGDEKIIAKLSPEEISVGNLL
FT                   LTDFLKSGISMDDSTKDNFIQLSQLISMNGQQFNKNLHELEHDSIKVDKKELTSYDSST
FT                   ENSLIYSLSNKKKIPLNSRVSTDILRLTNNESLRKKIWLGLHQPAKGQITLLENFLKYR
FT                   GLLAHFMGKSSFAEYQLSEKMAKTPENVMTFLKKNLKDIEEDVISELRTLIKFKVENSD
FT                   KLSDEQVIEMVKPWDRDYLTTLYLSSKRSSNTEDISQYLSVGVVLQGLSDLFQSIYGIQ
FT                   FKAVPLKPGEAWHNGVRKFHVTSETEGFVGIIYLDLFHRESKTLNPAHFTVCCSRKIYP
FT                   EELDENDPFKVEIPGKEGQLVQVSTAPDGTTSQLPVISLVCSFNQEEGGVSLLSLSQVE
FT                   TLFHEMGHAMHSMLGKTKLHNVSGTRCATDFVELPSILMEHFANDTRVLMSFAKHYRTN
FT                   EPLPLKLLQNYSCFNSFLNNCETFGQIKMAILDQVLHSNVVFDKDFDSIDLYHKLETQL
FT                   KIFADTESKWPGKFGHLFSYGAVYYSYLFDRAIAKKIWEHLFAKDPLSRENGEKFRNKV
FT                   LKWGGSRDPWELVADVLDEPELKKGDIKAMEFIGRR"
FT   CDS_pept        complement(805214..807100)
FT                   /locus_tag="PAS_chr2-1_0436"
FT                   /product="Putative RNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69064"
FT                   /db_xref="GOA:C4R0P0"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR018835"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0P0"
FT                   /protein_id="CAY69064.1"
FT                   /translation="MKNFSYTSQPGTPLDYNYGRSMLPSHLLTPFLATPVLPSQPSTPY
FT                   IDQHMSNLDQKYLTEHYQLLHEVNHSRSLLFEKLPKELSLKEFLDAFKSSQFLENVKIK
FT                   EDSGEGTSVLVQFVNDESALVFLQNFDWRDFVSSTGFDNLKISWCFNNSSDDYLVDGTY
FT                   MDRILNLNATRSLAVRTLTQNKTGDQLYDLVISILKADLPEAIPLIVDYQYRYETIQIN
FT                   FSNISTSIEVFELLNDTHQKLLLLSSFCSDPCLFHHQMTTPQISSNAPPINSSYSNLQN
FT                   RTIYLGGLHPDTTVESVCNVVKGGILQNVKLIPEKRICFVTFIDAFAAEQFYMNSQLRG
FT                   LTIKQKRVRVGWGRPIGPVPNNIPLAVTAGASRNIYISESKTKKTQSLPSADILRHDFE
FT                   YFGELEQINFFNGDKCVFLNFCNIAAAIELIDCLNLFKNKNLDPENPAFSLLSKYEEFK
FT                   INFAKDRCGNLPKEIKRDRKPHHRSKDGKEPHEPKNHHNSQSDPPKASESASPEQIQDV
FT                   QEIFASMGISTNGRPATAPISAQQKTDEEKSQSPPSGLSSISPTSSSTSKPTTASGGAV
FT                   NFKDQQRPGRTYAMSGSQIMAQYLASVQHNNIYYANAVLNVESERNSEDDYN"
FT   CDS_pept        complement(807591..808592)
FT                   /locus_tag="PAS_chr2-1_0437"
FT                   /product="Glyceraldehyde-3-phosphate dehydrogenase, isozyme
FT                   3, involved in glycolysis and gluconeogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69065"
FT                   /db_xref="GOA:C4R0P1"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0P1"
FT                   /protein_id="CAY69065.1"
FT                   /translation="MAITVGINGFGRIGRLVLRVALSRADIKVVAINDPFIAPEYAAYM
FT                   FKYDSTHKAYKGEVSASGNKINIDGNEITVFQERDPVNIPWGKAGVDYVIESTGVFTTL
FT                   EGAQKHIDAGAKKVVITAPSKDAPMFVVGVNEEKYTSDLNIVSNASCTTNCLAPLAKVV
FT                   NDTFGIESGLMTTVHSMTATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVIPE
FT                   LNGKLTGLAFRVPTVDVSVVDLTVNLKKETTYEEIKSVIKAASEGKLKGVLGYTEDAVV
FT                   SSDFLGDERSSIFDASAGIQLTPSFVKLISWYDNEYGYSTRVVDLLQHVAKA"
FT   CDS_pept        810169..812562
FT                   /locus_tag="PAS_chr2-1_0439"
FT                   /product="DNA helicase involved in telomere formation and
FT                   elongation"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69066"
FT                   /db_xref="GOA:C4R0P2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010285"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0P2"
FT                   /protein_id="CAY69066.1"
FT                   /translation="MRRMSVLGRPVLSQADIEALEVSFTDDDKSEPSFDIDDDDLILLT
FT                   LKNVHRSPLRKEQALHPSILETQRSEKITITQTPSPDWHLFETTCIKKRKIHFPDPVSF
FT                   DIEAQISTFSSSPIKADKKNNKVIEKQLTEPASKESPVIDLTSNEDKPELTTSTQKPST
FT                   PPRSTSAPVVTTSIGVRNIHTVTASNAQPLNSRIHLLTQIPKRPDVFQFTQKDSQEIDD
FT                   AQPKLVKPLVLSLEQEKVIQLAKQGLGIFYTGSAGTGKSVLLRNLIKELKEIHPQGTVG
FT                   VAASTGLAACNIGGQTLHSFTGIGLGDADVTKLLTKIRRNKKVRSRWLDLEVLIIDEIS
FT                   MIDGNLLDKLNLIAQRLRKNKKPFGGIQLIVCGDFYQLPPVSKTQSAKFAFEADCWDEV
FT                   VPITLKLSKIFRQRGDLEFIDMLNEVRNGRISPRVEAEFQKLNRPLPVDQGITPTELYP
FT                   TREEVERSNKRRLDSIPNEPLIFKSYDTGSLKDEEQIQHMLSNFMAPKTLTLKKGAQVM
FT                   MIKNVDATLVNGSVGKVLDFIDPDTYLFYKKVSGENSELELDTIEQEIEAKILSNGKKL
FT                   DASLKPSEKLISNASNLAKLDLDDSVFSFMKCIKSKKKTVSEDLRRKLELINTLYKNSS
FT                   GRRLPLVRFLTTDGETRDVLVEPEQFSINDIDEKPLASRVQLPLILAWSLSIHKSQGQT
FT                   LNHARIDLRRVFEAGQAYVALSRATSRKGIQVLNFNKEKIRTNPQVEMFYQKIYTVDDA
FT                   VEKAKIQQKQKPLDDASAHNEAKENSNYERMAPNDIIKHLTRRR"
FT   CDS_pept        complement(812607..815135)
FT                   /locus_tag="PAS_chr2-1_0440"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69067"
FT                   /db_xref="GOA:C4R0P3"
FT                   /db_xref="InterPro:IPR013244"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0P3"
FT                   /protein_id="CAY69067.1"
FT                   /translation="MLDTSEHSPLFESSIPIAYYSLLRSVVPTMITNQVYLLIGLLASE
FT                   GKTLQLKSLVDLIADFVYFKTKEIEELSKQGYPHDRILDLTLYNVTSLLLVFLPDHLDP
FT                   HLLTFILDLLDGYKPEDVVVSDDTSGTKLELELEETLERFQASHPDYQTYLNLDPSTIS
FT                   NRATKLCKQVTKKSMALSYSSSLDPTKLTVSFIKARTIKVNEVIPDLTFNFPLFVDEVS
FT                   DWRINYVQVAHKLFPYLSPDMTLSKWNTLTIRTQLKLIYDCINQDSAEKVTHEILLPYI
FT                   TYINCWGEYIEFLQTVFEQTLQDSQLLASNLSKLKTNDFEVLKVFQQNDSNCYNRLVSL
FT                   IIGTGYLTSSVDLSLCLMFKEILSFILNVSDDNTVSTNSADETIELNDWKEKNLSEVIK
FT                   FSTMVPTKNNILKLRTLLECCEKLYASNLSVFQLLNLQFTSDSQIQLLELNKFLANEIQ
FT                   YCSSERDWTSLLNTLNWFLNDTQIFSQVSKEEVNILFFKLFFSQSHDYHVFFRLIIPQL
FT                   VGVHEFNKNPKYASIILEHAWSLYGAASNINHLKTLLSHFHDPSIVTNPDIIPKNTNNV
FT                   SQNSQLQSLISAFESISQRFHLSFSRNFQPKNLLLLNNGEDPIHVIVRILESEESSYKD
FT                   PGYLVDIYENLIIGFSDSSESSQLLKAQFADLQILVQLKCIEFSLVRNDFNYSYQHGLE
FT                   LLDSPSSIIQQNWIVFFQISKYIDEDSSENSKILIEKQLSILGKLLLHVPTEFNVPIVE
FT                   QWSLLNKDLERIKGDLKLRNKRVVRESNARANESLESRFTRALTSSATEVLKNQTAQNL
FT                   KVDLGQAQDKFSNMLVNGLGWAIGATPNNR"
FT   CDS_pept        815178..815870
FT                   /locus_tag="PAS_chr2-1_0441"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69068"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0P4"
FT                   /protein_id="CAY69068.1"
FT                   /translation="MSTEEAGIRTQAQLLDTELNKYMSTRTQVWDLANVVKLGNKLTED
FT                   QIQKIQSLKADINRSEAFLKLNLRSQQLEFRTIYEQNKDVEEIVNEKLQSKLSEIEAQN
FT                   AKLQSQVDTVSELIDKRNQITDLLNLFISGNQDLELSKDELEKTFQGYDMEPVYKMAKR
FT                   SGKIYRFRKLHLKESVQQLNAKIKDKEAQIQKLKANIREKKARWDRLSKIIASNLESLK
FT                   EDLVTELR"
FT   CDS_pept        complement(815920..816783)
FT                   /locus_tag="PAS_chr2-1_0442"
FT                   /product="Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69069"
FT                   /db_xref="GOA:C4R0P5"
FT                   /db_xref="InterPro:IPR010729"
FT                   /db_xref="InterPro:IPR038340"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0P5"
FT                   /protein_id="CAY69069.1"
FT                   /translation="MNRSTVARFSTTSMAAARNRLPTNIKLRRPIPPTIDNITVPENHP
FT                   LWQFFDNKNFLRKPQEIQTTGRPWTIQELRRKKFDDLHKLWYVCLKERNVLGREHRLLE
FT                   SVDSQSAIIYEEQSEQIRTTMWRIKHVLRERQLAETKSREKLLKSSELQDYLQDFKQEY
FT                   LDSQDVETQEWYDKLERLQYAIFGIPNYLSADTVVDEHFLEGVKFIGELKFAKFSESVP
FT                   ELQDLGKLSSIVENYALFEETSNKEGVTLAVKRIEEYRANDIQIPQEKELEVIQELVRD
FT                   RLEVAE"
FT   CDS_pept        817104..817610
FT                   /locus_tag="PAS_chr2-1_0443"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69070"
FT                   /db_xref="GOA:C4R0P6"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0P6"
FT                   /protein_id="CAY69070.1"
FT                   /translation="MLRLIRLSSSLPKVNIPKANKMPARPTIAEGDIKEKFIKGGSGKG
FT                   GQKINKTNSKVQLTHIATGIVVTSQATRSREQNRKIAREILALKLQDLEDPANSRQRIV
FT                   IERQKMVKARKNKRTKAKYETLEKNKQEKEDLLEGIDEIVFIDENSEPIQIDTKQSKQK
FT                   LLKQL"
FT   CDS_pept        complement(817636..819201)
FT                   /locus_tag="PAS_chr2-1_0444"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69071"
FT                   /db_xref="GOA:C4R0P7"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015280"
FT                   /db_xref="InterPro:IPR021661"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR039595"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0P7"
FT                   /protein_id="CAY69071.1"
FT                   /translation="MNNFEDIQVNQVTPPIAHNRKTEAIFVTPIGTPYKFFLVGKDDSG
FT                   KEVEAVYKERITQHGGTLIDSTDDPLTLFLAESQEILNRNLQTVPNNRQVYRLSFIDDC
FT                   ITEGIVLPLENYTLLVDTNAQVYKMTPVRSYFTKEEDNIIAETYRLLIPTHRPVEINTH
FT                   IHKKYLPHRTVYSIKSRYNEKIRKSLKYYYQSDPDSKELLRDVEGNYVRVYINDADAST
FT                   ADDKTSEEPLTSSTLPGRVRYSAKDDFQLCSQILKYNVRESNINDVNDEDLKVNSSIFQ
FT                   ELADSFPHHSKKSWSERYAKWVSAYGVGSYYRYYQARLENHEVPEPVSNLVLEKGKYAA
FT                   STALRQVRNIDSDDEVLHDVLVNAKKRKHSSSVIPISSTTSKSDLSRVFLQSLQRDSPP
FT                   IDPEKIEKIGKDAYTKLLKDVLAEVKIFDSHQEWKSTFKNALGVKDYYLTFLLDVTSGN
FT                   LKLIVQIISNYLEDNTQYLTNFPGVFLPRHDIILLANENKDEIDQLIKYHSLENVEKRR
FT                   KYLF"
FT   CDS_pept        820142..822631
FT                   /locus_tag="PAS_chr2-1_0445"
FT                   /product="Zinc-cluster protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69072"
FT                   /db_xref="GOA:C4R0P8"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0P8"
FT                   /protein_id="CAY69072.1"
FT                   /translation="MPKATKKSIKKELEVPDVVIKDKKGRSTSCYLCQRRKQKCDHRLP
FT                   ACTACLKAKVKCIQPAKYGGKCPEKDEYTVWLEKRLQFLESVVDANDSIKRTVIPTGPW
FT                   TQSSSLVPINGSNNAENGVSNGIAAGITAASVGNTTSEFQLPLPTTSAMSALSSKVDRN
FT                   HLKILNLDSFENQSEADFIKRYNLQEFLKHDPVFQIDEHISRQLFDIFFTLLQYKFPIL
FT                   DETEVFEFHNAYFSNNLKGYMNNISYFYFCLARMFLVCAISALLHKTTGRYHGTRPASF
FT                   FSAALKYAAKCQKSISKLHRVELLILLVFYLIRTDKDSTGLFDVIRDAMSVCMELKLHK
FT                   KESYVGIPINVKDRQLRCFWSAYLLEKVITLSLSKPYVLNESEMDSDIPMFDDSLSKGN
FT                   NFLNQFIKIRRLEARFVEQLDIINTKSSPKSTQLAKVEQYFQELQQWRRECQGFSKGIE
FT                   NETLQSYYYRSVRTLIQPFLELLDPEDRLFQECQAAAAQICQSFKTYHQKTVSGHSTIH
FT                   VHTTFIAGVTLIYCLWLARNTDDMRRKLLGDDSKHTRPTISAALFQHMDDLRACSISLY
FT                   VMAERTKFALSFRDTFEEIMAATIGNLKIRCGPDSSEIIYNKEPGMPPAVVRKPPKHYT
FT                   STTELDIKATDAEELEEKARKEKRGQLQRNAIPKGLSHLLVDPVPMKSQNSSGKSSNSL
FT                   LNNNIDNNHAGTNGSSTFLAGSSSNNGNTNVVVDNSINGSSFLSLPQTEFTPFVGRTNT
FT                   MISNISVWTGESGQFVPNSMNQSLTQQGLSNDFTKTSSFTHNTTNNNGTTNSNVDFLQS
FT                   WGNVRMDELFNVNEFVP"
FT   CDS_pept        complement(822641..823381)
FT                   /locus_tag="PAS_chr2-1_0446"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69073"
FT                   /db_xref="InterPro:IPR031818"
FT                   /db_xref="InterPro:IPR038744"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0P9"
FT                   /protein_id="CAY69073.1"
FT                   /translation="MDIFSARISIQWGNDEPIEKTSTWVIQTAGGRFVDLRPFLPGYVD
FT                   ETKFPMEFCNFGSTIELEGSKKQFTQELSLAKFVDGKYVENDGGLPDIGEFEELPNGDF
FT                   KEVGEMANPDRNNKIEPYIEIWRDLDPYKDGPQVEKLDPKSAPNVHFSYCFDLSSEGVK
FT                   GRFVRIGNWFQGLLGHLNNPKRTDSPPLSAIRGYYDTNGDVKILLSVGENTDDFPIKNY
FT                   KPSQLTVNKSQPVNQLIWKCVELN"
FT   CDS_pept        complement(823510..826932)
FT                   /locus_tag="PAS_chr2-1_0447"
FT                   /product="RING finger protein involved in proteolytic
FT                   control of sumoylated substrates"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69074"
FT                   /db_xref="GOA:C4R0Q0"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0Q0"
FT                   /protein_id="CAY69074.1"
FT                   /translation="MTDSVNSDDSDLEIIEVTEPTPKVDLLAPNPAFNFTAPISNSNGT
FT                   TPIRRKLDDQSNSNSFARLESLRESSVKPQASTFNSSRFIPQADQFSNNQNNELDNNNG
FT                   FADWISKSQPEFPFPLNDGPKKSSNQPTNSNFEEIIDLTEDIEINTSVPASTSSSTPVP
FT                   SSTQNQSHHIANNNTAQDAHIFQGKRPLQSYSDDEDEDLQIVGSNIVQQPLGIMPGTFN
FT                   APANILHFDGSNQNEQARWLDLRIKDLLDNLHNLRVHAQSNIMEINRFISTLGHLNREV
FT                   SELNLRYQSIVNNPQATANNQGYLTQLLNRIQELTNEKAHIFREMDTSKIKQQEIHRRI
FT                   HALSSTIDKLKKDRELIFRNAQNAFHGDMKNEVLEGQSFMDAIHRANSLGYASNIYSRS
FT                   DEDAGSLQRLLENIQPDMEDKDDDELAKTPKEFNIQLLKHQRVGLDWLLRMEKSTNKGG
FT                   ILADAMGLGKTIQAISIIYANKWKTQEEAEEEAKLEEKVRSEKSTSETNGEVSKTSTAK
FT                   SEKKPIQGDEGYFKTTLIIAPVSLLHQWESEILLKTKPEYRLKVFIYHKQKMSSFEELQ
FT                   QYDIVLTSYGTLSSQMKKHFEEAIKEADLQPNSSSIPAEDSGGISFKSPFFAKETKFLR
FT                   VILDEAHKIKGKNTITSKAVALVKSKYRWCLTGTPLQNKIEELWPLLRFLRIKPYYDEK
FT                   RFRTGIVLPIKSSMSGKYDSTDKKIAMRKLHALLKAILLKRNKDSKIDGEPILKLPKKH
FT                   IIDTFIEMEAKELDFYKDLEGQTAKKAEKMLNAGKGQGNHYSGILILLLRLRQTCCHHF
FT                   LVKLSEMKQEAKLKQEVATKMPQLATQLSPAVVRRINIEAEAGFTCPICLDNIINENAC
FT                   ILYKCGHVVCQDCKDDFFTNYQENETDDGLRVSKCVTCRLPVNESNVISFPVYDKIVNQ
FT                   HISVMDIVKSESPVLSKIEMIQQLIRENKGVFESSAKIDKAVEMIQELLRDNPGEKIIV
FT                   FSQFTTLFDVIEVILKENNIKFIRYDGSMSLSNRDAAIQEFYESTEKNVMLLSLKAGNV
FT                   GLTLTCASRVIIMDPFWNPYVEDQAMDRAHRIGQLREVFVYRMLIKNTVEDRILTIQNT
FT                   KREIVENALDNQSLNTISKLGRNELAFLFGIGN"
FT   CDS_pept        complement(827202..827789)
FT                   /locus_tag="PAS_chr2-1_0448"
FT                   /product="Non-essential subunit of Sec63 complex (Sec63p,
FT                   Sec62p, Sec66p and Sec72p)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69075"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0Q1"
FT                   /protein_id="CAY69075.1"
FT                   /translation="MLPFSYDVSSKKLKVTGDYADLEYDIQQLNTLSGEILANKADVPS
FT                   PPSKESFDKKLSHMAQKLHESAVSNIKTGKYPEAIKLLTTGLEMVNRRPKYESFQMTLS
FT                   EMTIFIVTRADAYMMNGDFEGAFNDADLLVTLLPSIPDNYIRRGVALFKMGRYVDAKNN
FT                   FERGLSFDPDNAKLKKELDFVLKKIDEENGEL"
FT   CDS_pept        complement(join(827978..828562,828640..828696))
FT                   /locus_tag="PAS_chr2-1_0449"
FT                   /product="GTP binding protein (mammalian Ranp homolog)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69076"
FT                   /db_xref="GOA:C4R0Q2"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR002041"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0Q2"
FT                   /protein_id="CAY69076.1"
FT                   /translation="MSTEPTFKLVLVGDGGTGKTTFVKRHLTGEFRKKYIATLGVEVHP
FT                   LSFHTNCGPITFNVWDTAGQEKFGGLRDGYYINGDCGIIMFDVTSRITYKNVPNWHRDL
FT                   VRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYFDISAKSNYNFEKPFLWLARK
FT                   LSGEPQLEFVAAPDLQAPEVQIDADLIKKYEQENAEAAAMPLPDEDDADL"
FT   CDS_pept        complement(join(828847..829097,829163..829249,
FT                   829304..829334))
FT                   /locus_tag="PAS_chr2-1_0450"
FT                   /product="Component of the U1 snRNP complex required for
FT                   pre-mRNA splicing"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69077"
FT                   /db_xref="GOA:C4R0Q3"
FT                   /db_xref="InterPro:IPR000690"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR013085"
FT                   /db_xref="InterPro:IPR017340"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0Q3"
FT                   /protein_id="CAY69077.1"
FT                   /translation="MAKYYCEYCNSYLTHDSLSVRKSHLIGRNHLRKYCDYYEEKAKEL
FT                   GIWDSNDLPYEITESDLYANIPGRPLSLETPLETFPPPPSLPNLPNPPPAIYHYNTTEE
FT                   KELISSVMREYQHRNTVK"
FT   CDS_pept        join(829439..829541,829702..829964)
FT                   /locus_tag="PAS_chr2-1_0451"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69078"
FT                   /db_xref="GOA:C4R0Q4"
FT                   /db_xref="InterPro:IPR019711"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0Q4"
FT                   /protein_id="CAY69078.1"
FT                   /translation="MSKSRRNHLNQPLDTHTMFAVIRSSVSLAFTTQFDLISDLYVKEL
FT                   KGFKPTPLSAADAEGATKPWAKPASPKVPSLEGETAEALQQYETSDVETVQAASSESAS
FT                   EVTEDWFVFPEEETAHH"
FT   CDS_pept        830337..831479
FT                   /locus_tag="PAS_chr2-1_0452"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69079"
FT                   /db_xref="InterPro:IPR021622"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0Q5"
FT                   /protein_id="CAY69079.1"
FT                   /translation="MSGLSVYKELNQSLINRGYLSEGVIFEDENTVRNQKVAQVIERLL
FT                   DSIDNNRTIRDDLLLREKDHLQVIDSLKTDQSLLKKRISTLEAKSTSQERHINQLTAQI
FT                   DELTSSVQTNIKQHNKTKSQLQTVLQSSNAEFRRKDLQIDQLQEKLVAKQLGIKGKVFS
FT                   LYSLPIMPDDQPKKRQKIAESSTETQKLTPVERFPVAQKETMTLLSDLYDIIYSLIQDN
FT                   NSKTRYLTIYNNFIKNLVRFISKIANYDGKISYDLREEYAQLTSMEINSPPGSASTVHE
FT                   TKEELVKSLQLSKTESENILRQFSSQMNELYNSLGNAFELNELSADSEVASRNGLKQQL
FT                   HERETQIESLRKELESVTHNWKAAIETMEKWKKYRTKKGI"
FT   CDS_pept        complement(831497..832984)
FT                   /locus_tag="PAS_chr2-1_0453"
FT                   /product="Cytoplasmic aldehyde dehydrogenase, involved in
FT                   ethanol oxidation and beta-alanine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69080"
FT                   /db_xref="GOA:C4R0Q6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0Q6"
FT                   /protein_id="CAY69080.1"
FT                   /translation="MASPLSKSIAFPTGQKYDQPIGLYINGEWRESKDTIDVINPSNGE
FT                   VITSVYAAQESDVDNAVSSARKAFKTWKKLAGEERATLMNRLADLLEKNAETVAGIEAL
FT                   DAGKPQFSNALPDIEGSVSILRYCAGWADKIYGNVIPSGPDKLLTSKRIPYGVVSQIVP
FT                   WNYPLNMAMWKIAPALCAGNCIVIKSSESSPLSLLYFAELVNDAGFPPGVLNIISGLGS
FT                   VAGARMASHPDVDKIAFTGSTKTGKEIQKLASSNLKTVTLECGGKSPLIVFDDAKLDQA
FT                   IYWAAFGIMYNTGQICTANSRVLVQDTIYDEFIQKFKAHVQENWFIGSPFDKKSTMGPV
FT                   INKSQFEKVKGYIQKGKDEGAKLVIGDEPVTFESGYWIHPTIFVDCTQDMSIVKDEIFG
FT                   PVVAISKFHSQEEAIELANDTEYGLAAMVFSKDIVTANTVASQLEAGTVYINSSNDDNI
FT                   RVPFGGFKMSGTGSELGMEGVLAYTKIQAIHTNLTRD"
FT   CDS_pept        complement(833240..834484)
FT                   /locus_tag="PAS_chr2-1_0454"
FT                   /product="Major exo-1,3-beta-glucanase of the cell wall,
FT                   involved in cell wall beta-glucan assembly"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69081"
FT                   /db_xref="GOA:C4R0Q7"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0Q7"
FT                   /protein_id="CAY69081.1"
FT                   /translation="MNLYLITLLFASLCSAITLPKRDIIWDYSSEKIMGVNLGGWLVLE
FT                   PYITPSLFEAFGDDVPVDEYRYTERLGKSLALDRLQQHWSTFYDEKDFQDIAAYGLNFV
FT                   RIPIGYWAFQLLDDDPYVQGQEEYLDKALEWSRKHGLKVWIDLHGAPGSQNGFDNSGKR
FT                   DSWDFQNGNNVQVTLDVLKYISKKYGTTDYYDVVIGIQLLNEPLGPILDMDNLRQFYAD
FT                   GYDLVRDVGNNFVVIHDAFYQAPEYWGDDFTSAEGYWNVVLDHHHYQVFDADELQRSID
FT                   EHIEAACDWGRDANKEYHWNLCGEWSAALTDCTPWLNGVGKGTRYEGQLDNSPWIGSCE
FT                   NSQDPSKLSSERICEYRRYVEAQLDAFLHGKSAGFIFWCFKTEASLEWDFKRLVNAGIM
FT                   PQPLDDRQYPNQCGF"
FT   CDS_pept        836411..837700
FT                   /locus_tag="PAS_chr2-1_0455"
FT                   /product="Protein required for assembly of U2 snRNP into
FT                   the spliceosome, forms a complex with Hsh49p and Hsh1"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69082"
FT                   /db_xref="GOA:C4R0Q8"
FT                   /db_xref="InterPro:IPR006568"
FT                   /db_xref="InterPro:IPR007180"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0Q8"
FT                   /protein_id="CAY69082.1"
FT                   /translation="MAKRSKNQQRRLRAKLRKTKGVPDQENGFSVKKSDSSEPIPVSDD
FT                   NDEVTIAQPDTGGLEGPLAQEFQNIFAKFVPVEEKLNFEPTPLESRKEEIIYSSSSEDE
FT                   ADSDKERTQTQTHLSKKEKKRLYGISLTELKKYAARPDLVEWYDADAEDPTLNVYLKCL
FT                   LRAVKVPVHWQSKRDYLSSKRGFEKPPFRLPDFIRDTGIMEMRDVSQEDESTLKQRTRD
FT                   KVQPKMGKLDIDFQRLHDAFTKFQTKPPMLAFGDVYYEGRGSETFELENFVPGKVSSRL
FT                   RTALGIANHEKPPWVAQMAKLGPPPSYPNMDADGVFKEPLMKNLGPPIERDSWGSIHPD
FT                   SEEEEDNDEEEEEEEEEEEQFIPRYDKESTDYIPIKSVSNEIPTMRHDTTNETEDDSTN
FT                   APLYQVLSQKKESGGFMGEKINYELPSSKR"
FT   CDS_pept        838937..841117
FT                   /locus_tag="PAS_chr2-1_0456"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69083"
FT                   /db_xref="GOA:C4R0Q9"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR015405"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0Q9"
FT                   /protein_id="CAY69083.1"
FT                   /translation="MLSVKRSISRIPTARLFSTTRRQLKEVELTVDGVKVSIEAGSSII
FT                   QAAEKAGVTIPRYCYHEKLAVAGNCRMCLVEIERSPKLAASCAMPVQNGMSVLTNTPKI
FT                   KKAREGVTEMLLENHPLDCPVCDQGGECDLQEQSLRYGSDRGRFHEIVGKRAVENKAIG
FT                   PLIKTSMNRCIHCTRCVRFLNDVAGAPEFGTAGRGNDMQIGTYVERNVNSELSANVIDL
FT                   CPVGALTSKPYAFRARPWELKRTETIDVHDALGSNVRVDTRGIEVMRVLPRLNDEINEE
FT                   WISDKTRFACDGLKTQRLTKPLIRQGNTFVDATWEEALATIAEGFQKVQPKENEIKAIV
FT                   GSLTDLESIVALKDLVNKLGSENVSTDGDATTVPPAHGADFRSNYIFNSTIDNIEEADQ
FT                   ILLVGTNPRHEAAVLNARIRKVWLRSDLEVHHVGEEFDSTFELNHLGSDVNALAKALTG
FT                   EVGKKLSEASKPLIIIGSGVTETQDAEAVYATVAKFVTSNANIVTPEWNGFNLLHREAS
FT                   RVGALDVGFTTQSPEVANTKAKFIYLLGADEIVNKDIPKDAFVVYQGHHGDLGASFADV
FT                   ILPGSAYTEKTATYVNTEGRVQSTRAATNPPGVAREDWMIIRALSEYLGATLPYDNLYE
FT                   MRSRLADVAPHLLRHEVVEPVSEGIAKVGFQSLVKPGIQSKGVLLKNPIENFYFTDVIS
FT                   KSSPTMAKCVGSFGSKIEKIKDEKANSYLSFA"
FT   CDS_pept        841897..843246
FT                   /locus_tag="PAS_chr2-1_0457"
FT                   /product="Protein involved in ER-to-Golgi transport"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69084"
FT                   /db_xref="GOA:C4R0R0"
FT                   /db_xref="InterPro:IPR004853"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0R0"
FT                   /protein_id="CAY69084.1"
FT                   /translation="MIITQNLVSYSGSSLNHDGKGNSRILLSSTNFQHRTPSEPLNGTA
FT                   YNHESDFVVRKTRSNSSSHSNVSFHGYNLRSLLPYVNFKLCGMCFLWYSSSVVSNNSTK
FT                   QILRQFSYPVTLTEFQFLLNAFFCLVTIIAVNQHDSRVYKTSSKMSKRFPPGTFPKDID
FT                   SAFFTLKDSFLTIKRNILSTTIPMGMFQFLGHITGHKATSIIPVSLVHTIKALSPIVTV
FT                   FAYRLIFHKHYPIKTYLTLIPLVSGVMLSCLKNNLSINNDLFFQGCLFAFLSMLIFVSQ
FT                   NIFAKKALTFKENQLNGDVDSKLKGDDDTILPQYKNSENNKAEKFDKLTILFYCSIIGF
FT                   SLTLPLYVILESNVFVQQKTLSLLQLTPGLLFLLILNGFAHFCQSLVAFQILGMISPIN
FT                   YSIANIMKRITIIGFSIFWEATKLNNVQWCGLVLTIIGLYSYDKWGAVKN"
FT   CDS_pept        complement(843267..844238)
FT                   /locus_tag="PAS_chr2-1_0458"
FT                   /product="Peroxin 20"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69085"
FT                   /db_xref="InterPro:IPR024111"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0R1"
FT                   /protein_id="CAY69085.1"
FT                   /translation="MFTSNGSCGPATALDNLSKRVGQDRTLENDHVARFRDQNSSQNRA
FT                   FRAESSFNTTAGAEFGQFQNTSVQRNYFPSAELIRKNTRFGDNWSSEFRQQQENNKWVE
FT                   DFGAMNLENVRMEQEQSFQTMDQRTNMQAMSSTANAWTQEFNHMQHNKEMEYEMRIRET
FT                   QRLVNAPAREVFSMVNQHSQQHNQNFTHNQTQLGDQSHYMTNLAFERQFETVQNEIDGM
FT                   DMFSDSEQVEQQKELQKEDDNNDIETTKFAEIAQQVFNQMNNVDTTVSQNTEHKFKQSN
FT                   FLRLMDKVAQREVEINGSGDRFIDKTGNDIRDYLPDPLSDLR"
FT   CDS_pept        complement(844395..848588)
FT                   /locus_tag="PAS_chr2-1_0459"
FT                   /product="Subunit of TORC1, a rapamycin-sensitive complex
FT                   involved in growth control"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69086"
FT                   /db_xref="GOA:C4R0R2"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR004083"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR029347"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0R2"
FT                   /protein_id="CAY69086.1"
FT                   /translation="MRHGFQDEYTSQQYMDMLANTFYIYYDDKRHETAGNPTTEEEKEK
FT                   NYKKYQPIVDWKIMKDRQKTVSAAIVLCLNIGVDPPDILKTQPSAKTEAWVDPLSFTDN
FT                   KKAIESIGRALQTQYETLSLRTRYKQSLDPCVEDVKRFCNTLRKTAKDERILFHYNGHG
FT                   VPQPTQSGEIWVFNRGYTQYIPISLYDLQTWLGAPCIFVYDCSSAGNIVTNFKKFVQKR
FT                   IDDDNDGNHDISAPSPTAAYIDCIQLAACKSSEILPMNPDLPADLFTCCLTCPIEISVK
FT                   WFLLQSPLKFHGYYDLLLDQNGQIQIPGKLTDRRTPLGELNWIFTAITDTIAWSSLPRA
FT                   VFKKLFRQDLMVAALFRNFLLAKKIMTANGCNPISDPPLPDITDHTMWDSWDLAIDQVL
FT                   SQLVKNHEKLSRDPTASANTLLRTEPNSVAPTPVSTTTSLSDSQDGNQTPQKPPAPAPS
FT                   QSQGQIINNYQHSTFFEHHLTAFEIWLKYGSSSKDPPDQLPIVLQVLLSQVHRLRALIL
FT                   LSRFLDLGPWAVYLALSIGIFPYILKLLQSPAQELKPVLTFIWARIMSIDHKNTQQELC
FT                   KDKGYNYFIQILVAPKPTTAASGNHFLVNDVNYEEHKAMSAFILSLFVKEYKPGQRLCF
FT                   SSDLVGTCLYYLEKSGHPLLRQWCALFTGQLWANYPDGRWISYKDGHVERLTKLLNDPI
FT                   PEVRASIVISLTNFLTTLSDDEEPSTMMMGKEESNQQEVKVALSMLFLLADGSPIVRRE
FT                   VVVFFSKFVMKYIHFFIVSACGQLEEEITLIDDPSMIDEVRRRSINYGTIYSSVFKTLL
FT                   IMSSDPDDGVKDYAQSLVDFIMIKLNQSPLGEIVCDMEQYLLQRSSTNDTTQLKSDQAS
FT                   LHGLGMVSNGNQLKIHKTRDPSHSKTGSRSQSLKITSNKNSTTITPLFEGNQQNGHNQR
FT                   SVSNVSTSSLTDRMSNLALNWLRNFSGASNRNIQDHDSQLAPVDLSHLYLGYGIEPIPP
FT                   TPRFVPLKQLSPISEPTMPLHSKFFEYSMEYFQEPQIGVNDVDEPGSFEYTRRLWRRNR
FT                   NESIINETQPQKDLAISGDWNNNIATFNNTTQPKLLKFTQFDSYLVSADEKDNITCFNW
FT                   ETNEQLSRFSNNNPFGTKITDMKFINEDDNAMLLTGSSDGVVRIYKNFQSMEDIRLATA
FT                   WRALTDLLLTSRTTGLVSEWQQSTGSLLVSGDVKIIRIWDAPRELCVVDIPARSTSSIT
FT                   SLTSDQVAGNIFVGGFGDGTIRVYDRRLDSRDSMVKIWQNRESRGMIKNVHMQRGGHRE
FT                   LMSASNNMVNLWDIRLDKPIESFPHRSITASLIHEHAPVILTASKIVNVATTTGEHVST
FT                   IRDPSPYLSNKTAGYVSSMMLHPHRMMVATSHTQDSHIQLYKCTDKLVQEHDGY"
FT   CDS_pept        complement(join(848853..850930,850986..851091))
FT                   /locus_tag="PAS_chr2-1_0460"
FT                   /product="Protein serine/threonine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69087"
FT                   /db_xref="GOA:C4R0R3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0R3"
FT                   /protein_id="CAY69087.1"
FT                   /translation="MASNPSITPPNAKLPPGTPLTVGTHSVTVIKYISAGGFSHVYTVE
FT                   CSPPFEGSSIACLKRVSVPDKAQLNILRAEVDAMRRLKGHKFIVSYIDSHASRMDNGVG
FT                   YEVFVLMEYCANGTLIDFMNTRLHNKLKEDEVLKIMSDVSEGIAIMHSLQPPLVHRDIK
FT                   IENVLISSDWTYKLCDFGSASSPLRPPKNIEEFKILQDDILRHTTPQYRSPEMLDLYRG
FT                   HPINEKADMWALGIFLYKLCYYCTPFERFNPDHTPNYKAEEMAIVNGSFQFPDRPPFSP
FT                   RLKNVISKLLVSDPQKRPHIYHLLEEICKMRNVPVPIENFYKQRKRISQPDVNVSKVLN
FT                   LTTNVQNAPISTTSSRTSSEKRDKDPFAKLDKSRFISNSEASLKSHQHHHNKHKSIGSQ
FT                   ASKFSGPSSSSSSSSSSESVPSLPPRRTLRPVSLYASDDFSSPKILDQEKRPSLEAANK
FT                   IIDSVAKEQTIELSPGNKNHIDSNVDFLRGLSKSENLKSRRAQLTGEGLGHSKKSSIGG
FT                   LKNLLTGGRDRERQDKWSSVAPSRSRTPTHENHYASRSTSSESLDLQTEESSKSKVKRS
FT                   SSIQRRIKMLLNKPEDPAPHTAEGYGKYTEAERKNNNASRADNIIRNVSKSLEKAKTPP
FT                   RIVPQKYSVVDPVKTAVPYSSSKKSEADNGQHHHKKPPPKPKKPEHLTTSLNLSKSKKV
FT                   QNNSDVWDEFDEITDKELTDLQIDFHKRFPSSL"
FT   CDS_pept        join(851343..851363,851422..852165)
FT                   /locus_tag="PAS_chr2-1_0461"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69088"
FT                   /db_xref="GOA:C4R0R4"
FT                   /db_xref="InterPro:IPR019166"
FT                   /db_xref="InterPro:IPR033181"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0R4"
FT                   /protein_id="CAY69088.1"
FT                   /translation="MKSFRAALGVSGLSLGAFFWGTNSSVILNESKRQFYQDDASVVPI
FT                   PGTIVPAAGTEIEALGKNKIVNGISIRSPSPLEATFSSVRKTINDVYKQAEDKFYNVST
FT                   KYYETESKVASQVAQLHEKREDLLPNGIYVIVGTLAGSIFARRRNILLRAITPVAFGLV
FT                   TFKIFLPETFGNTVGFAWKLEQEKIPKVAETQRNVVSKAEELYKDVESTTESSRAAAQS
FT                   LLHKSRDYVSQVTGLNLDQKVINGDATTTKNR"
FT   CDS_pept        852462..853565
FT                   /locus_tag="PAS_chr2-1_0848"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0848"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69089"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0R5"
FT                   /protein_id="CAY69089.1"
FT                   /translation="MSIPGTVSGSRSSPATGTGTGMNQLLSLASSSQVNSLQDLCSASN
FT                   GSAYTVINNPVSLNNPSLGRLLEYLGGNAPSSSNSVKAKLSKVLKTKKKEIQSEAELIK
FT                   ELNSWINVLPNKESAKLIFEYARSLEVMVKLQEEMLQKYENISLQLGYVDKRERKANAL
FT                   KAQRKKELRSLRQKESRTTENQTIIFYRESIECLNTSIEVVQEQYVRTINNALKGSFID
FT                   FHIFLRNMSTEIKNSSIGFFKFLNDGSSRNYQRYITANDMKPALRMASTSSSIVQGEKT
FT                   VSPNPSPLHHNLEIKRNSNNNPTLLTLQNNSVENILKDPLVERPQARAVSSIYHNLVPD
FT                   LRKLSHNREKRKVPESKDSVSNDNHWL"
FT   CDS_pept        complement(853636..854826)
FT                   /locus_tag="PAS_chr2-1_0462"
FT                   /product="Mitochondrial protein of the mitochondrial
FT                   carrier family"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69090"
FT                   /db_xref="GOA:C4R0R6"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="InterPro:IPR040062"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0R6"
FT                   /protein_id="CAY69090.1"
FT                   /translation="MSMASEIAGTVEEYEVDLNTRFKAGKEGLVTNSVVASNDISLNQR
FT                   MLSACVGSVLTSLVVTPFDVVRIRQQQQYLITPPAVTNAGECCRKVFWLDTVKEEARSV
FT                   AINEFCVSHSCSQDVKFESTSEGLSKIIRNEGFASLYRGLSFTLLMGVPANIVYFSGYE
FT                   YLRDRSPFRTSSPTLNPLICGSVARVLAATCVAPLELLKTRLQSIPSSLKNNPTHINAN
FT                   RKLFWKVLKRSGEEMSSRGLRSLFTGLQLTLWRDVPFSGIYWASYEFFSKRANFWNLPS
FT                   LNDDDALRQHKGLDLGVFARSFLSGSISGVIAAVITNPFDVGKTRLQISEESVSSLNVR
FT                   KPEKSMFQFLYSIVKAEGVRALYVGLFPRCLKVAPSCAIMISTYEMSKTLFLNQKL"
FT   CDS_pept        complement(854992..856332)
FT                   /locus_tag="PAS_chr2-1_0463"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69091"
FT                   /db_xref="GOA:C4R0R7"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0R7"
FT                   /protein_id="CAY69091.1"
FT                   /translation="MVNTTGLAVGLAVGVPCLMAIVVCVALSIRASRKFKKEVKDEIDV
FT                   DHDDVSFYGAPTDSPENSQAKELGNPVDSKTRLDENQYRRPDFLPSSRTNSEFSGLEQD
FT                   HSRVRSGNNYLDYYDTVVPMLPPNVNPESVSVKSSEKTESGLSFLKHGRLHSHSNEKLT
FT                   GPNGVSPSTGIAANGNENGSTNSNSVSSVAVDYVRRLHRNDSSGFPSTAQRVASLTPEA
FT                   INQNNHRYTRGNFPQSPKVQTETEPKVEIGKPLDIEPDKSTVNHTNRQSKPLSDYSARN
FT                   KSDESLKRPVSPNKTELKTKAFYSKNNYTQSESSDIVSYKTALSEYQRDSVVSVIEPEH
FT                   DLSENITAFSSHSTLNQADDTSVVTNTTNKSSAQQQKNSIAFGEPSPFDTPPKKHQTFN
FT                   NTPSPRQSQFMGHFDDEEPLSPQEAIDDGYTNYEKNKNKFLERYRQS"
FT   CDS_pept        complement(856533..857486)
FT                   /locus_tag="PAS_chr2-1_0464"
FT                   /product="Metalloendopeptidase of the mitochondrial inner
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69092"
FT                   /db_xref="GOA:C4R0R8"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0R8"
FT                   /protein_id="CAY69092.1"
FT                   /translation="MFLRNIRRFATYHRFQNTTVPIWNNKRKLKYLGVAVAGTGIFVVS
FT                   HIEEAPITKRKRLLWINPKWETIIGEQSYSQLIAENRDKILPENHPTVIRVKKIMNKII
FT                   KAGSAVAHDSQLSEDTSSLKPMANRSTTDNMNWKVHVIHDSTQPPNAFVLPGGKVFVIS
FT                   SILPICANDDGLATVLAHEYAHQLARHTGENLSKMPFYALLNLVLFTITGSSSLNRILL
FT                   QTAVQMPASREMETEADYIGLMLMSQSCYDPQEAPRLWQRMAEHEKSGAARGMGSVPEF
FT                   LSTHPASRRRIQNMSNWLPEAERLRELHCLGQVSWW"
FT   CDS_pept        857749..858516
FT                   /locus_tag="PAS_chr2-1_0465"
FT                   /product="Basic zinc-finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69093"
FT                   /db_xref="GOA:C4R0R9"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR019447"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR037321"
FT                   /db_xref="InterPro:IPR038254"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0R9"
FT                   /protein_id="CAY69093.1"
FT                   /translation="MAKAEFGTPKYVANQMKARGLQKLRHYCQVCEKQCRDDNGFKCHV
FT                   QSESHTKKVQQLSLEGGDNKKRGKIAEFSSQFVKDFIHLLRSGHGDKFVGANRFYQEYI
FT                   QDKQHIHMNATRWSSLTVFVSYLGQEGLCRVKQDDAEGLMIAYIDRSAAAERRRKEAQK
FT                   QMRKHTDEELAMRQLEEKIRAKRPREEAPLVPLGAKNTGEDKRVSVSLKPATETTSVKL
FT                   NMKSSHKKIANVKPINVFKRKKTDQEVGNVQLG"
FT   CDS_pept        858759..860813
FT                   /locus_tag="PAS_chr2-1_0466"
FT                   /product="Triacylglycerol lipase involved in
FT                   triacylglycerol mobilization and degradation"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69094"
FT                   /db_xref="GOA:C4R0S0"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021771"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0S0"
FT                   /protein_id="CAY69094.1"
FT                   /translation="MNLFGAVTDTLFAQRELLKSRQEPSEVHSPSRLFQVVESVASVLR
FT                   KIPFLKHCIGPPVEGEELIRQLLAQQKVSTSYEEWYEVSQKLDILQNLEIWKYEKEFSL
FT                   YDYQLVERRLAELRETINNKDYPKLLYLVRTTWSRNLGNMGNDVLYAYSHVGTKKLIEE
FT                   YVAECVKGLNILASEDNGLDDTHVLGTLIQTRKAIGRTALVLSGGGCFGLIHIGVMATL
FT                   LEQNMFPKVIAGSSAGAILASILSVQTPEETLQLLSTIATRKFEIFEENNHREGILVCL
FT                   SRFLKYGTWFDNCYLQRTMQTFLGDLTFKESYNRTGRILNITVSPAAVHEQPTLLNYLT
FT                   APNVLLWSAVCVSCSLPGVFPSSTILEKDPRTGEISEWNKAATVKFVDGSVHNDLPIAR
FT                   LSEMFNVDHIIACQVNPHVVPFLKMAGDGVNTGNTFLRKSLQMVNNLASDEITHYLTIA
FT                   GELGIAPNVCTKLKSVLAQQYSGDITILPDLRLTELNLLLTNPTPEFLLDASIRGARAT
FT                   WPQISMIQNHCSVEFELDRVIGLLRSRLVGRPVLIERNRPRSRTIAGGRRSDTATSTAI
FT                   TTTTNTRTPFGSAHDSSFTPVYHSGYSYYLETPAPAPAPPAYTRRASAYERRTATQPPS
FT                   PLQSPLKSRNNSMENLVRRNSLREINALLYRDNSPKTSRKRIGGPKNHK"
FT   CDS_pept        complement(join(860910..861122,861187..861195))
FT                   /locus_tag="PAS_chr2-1_0467"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69095"
FT                   /db_xref="InterPro:IPR013726"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0S1"
FT                   /protein_id="CAY69095.1"
FT                   /translation="MGVIGKVVHFGADLALLSGFLAGVHRSTGLTPNIEKIGNKDAEGL
FT                   VKRYLDAGEWAFDSSVAYFGASDWFKRN"
FT   CDS_pept        862186..864123
FT                   /locus_tag="PAS_chr2-1_0468"
FT                   /product="Catalytic (alpha) subunit of C-terminal domain
FT                   kinase I (CTDK-I), which phosphorylates the C-termina"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69096"
FT                   /db_xref="GOA:C4R0S2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0S2"
FT                   /protein_id="CAY69096.1"
FT                   /translation="MSNRRERIASQDDHGEAFFDSREPRQGGFRGRGGFRNGGSKQEQQ
FT                   RENPRRDIENDERDLLPSFPKASNREKNGPRDFKPQNNKNKNRPRELPKHPSETFTSER
FT                   ERTNYARERGDGYGKPRGSRYQNTRGGRGQNYPRARDTYNQRGDNYSRESEYRERDDDY
FT                   SREGYRNRRTDPRNRERELDPRDREREREIDSRDRDRDSNYRGYPKGPEREASFSRYSR
FT                   YGGTQLPSGPKASLRDPRDRDNGVRRPNESTRPARGSTRGRGNFRGRLPTGPRSAGSRY
FT                   DNHSESDVDEDVFLHKKEPTQFMYNHETDQLIFERIQQVGEGTYGKVYKARNLLTKNFV
FT                   ALKKLRLEGEKEGFPITSVREIALIQSFDHVNIVSLTEMMVEKNFIYMILPYMNHDLSG
FT                   ILTHPTLQFTDGHRKNIFKQLLQGMEYLHSKRVIHRDIKASNILLDNDGVLKITDFGLA
FT                   RKMKDLNKDAQSPDYTNRVITLWYRPPELLLGSTSYGREVDIWGIGCLLLELFTRKAIF
FT                   QGNNEITQLQSIFNIMGTPTTASWPDMDNLPWYEMVKPRSRIVSQFADKYGTVLKDPDC
FT                   FHLAVQLLCMNPADRITAKEALAHPYFKSDPRTEPLTFLKELGSEWHEYESKKRRRKEK
FT                   EEKRKATVSK"
FT   CDS_pept        864751..865905
FT                   /locus_tag="PAS_chr2-1_0849"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0849"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69097"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0S3"
FT                   /protein_id="CAY69097.1"
FT                   /translation="MESSSEWDKRRYVPQKGDPALPPQLADYSSKTTEEVMKDINRLPL
FT                   FMTELDETDGEGGENEGLEALKALAYEGEPDEVASNFKNQGNDCYKSKQYQDAVQYYTK
FT                   ALEVKCDDAAINASLYLNRAACNLELKNYRRCINDCKLALLLTPDNVKAYYRSAKAYLA
FT                   LGKLDEASELVDFALKQQEEHEVKQDTKALEILGTQIKHQKEKLEEQERQRNERENAKK
FT                   AKEAALAVALTLRGYTIIHTKEPFGILQDKKITLEAETDVESQMIFPGMVLYPTLDEWD
FT                   FVEQISELNTPKEIIGMLMDRPPEYFAQPGHGNFQPKNLQAYMQTQGGGLVKVGKNLSF
FT                   KEILSSKQPIIPLMDNSLRIYVVPKQDGDFLSQWNKTKALSERM"
FT   CDS_pept        866221..868857
FT                   /locus_tag="PAS_chr2-1_0469"
FT                   /product="Protein with similarity to hect domain E3
FT                   ubiquitin-protein ligases"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69098"
FT                   /db_xref="GOA:C4R0S4"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR005735"
FT                   /db_xref="InterPro:IPR035983"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0S4"
FT                   /protein_id="CAY69098.1"
FT                   /translation="MTGSASSGQRNWFQKLLKKNRTSTSRPESVISSRDIMHYIQEHEA
FT                   IIDPDCILSIEPEHCPEISNDAVEDYEESPEPEVQGDVLSNCRCCGTILKYPTFVKRIK
FT                   CTICDTITIVENGDPKNADRNGLNSDSGQTQLLSLEYLEEFIQNNSSPKALGVMLYESF
FT                   SSFRVLNNSFRVPNYRLSHRTPGLDFPQIKRFYKRILKLPSINSYYKMLLGMSDLLKRS
FT                   PELEEPQNILWLLIILELPTFQHVLIHKANIPELRSVQYDILKRTIGLIANLNKTPLQY
FT                   LCNWLHRSPEFLIKVDLINLYITFHVTKCINYQLKPTNTTDTATHSEDENVNYKDTLFK
FT                   DMNATSPAQALDALPQNATMNRQDEFTSKIGLSQYGNNWHIRTGARALSIFFTANSHNG
FT                   KFKVPVSNFYNTLVDYVNIKEDFDAWQLNNRKMSNGASSTGDSVQSVIDYLQNNTISAY
FT                   YGILSNDPTQMRKLSFTFCQFPFLISLGSKISILEHEAKRKMERKAEEAFINSLNQKQP
FT                   FGIYFKVRVRRGLIANDSLKCIKNHTNDLQKSLKVEFVDEPGVDAGGLKKEWFVLLTRE
FT                   LFHPNKGLFSYDETSKLAWFTISNIDHEELYYLVGVVLGLAIYNSTILDLRLPFVLFKK
FT                   LLNKKPSLEDFCELYPENGGSLRKLLKLQDDEIWDNMEIYFDVTYSDLLGAIKTEELVP
FT                   GGSSIKVNNSNKNEYVSRYLDFYLNKVISNSFNSFYKGFYSVIGGNALSLFSPHEIQLI
FT                   VLGDDNDGKKVDTEILKSVTNYNGWDSREAAVTSKQVAWFWEFFDSISYKQQKKLLLFI
FT                   TGSDRIPATGIQNLPFKITRLKGNKERFPIAHTCFNELCIYEYPDKNTMWRKLEYGMNE
FT                   SEGFGIK"
FT   CDS_pept        join(869035..869080,869280..869878)
FT                   /locus_tag="PAS_chr2-1_0850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0850"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69099"
FT                   /db_xref="GOA:C4R0S5"
FT                   /db_xref="InterPro:IPR004192"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="InterPro:IPR037008"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0S5"
FT                   /protein_id="CAY69099.1"
FT                   /translation="MLRSLARNSVGLKSLGQARTLSSSVTALKSNYDSPDFSHYLKKDR
FT                   NADKTRDFTYFMVGSFGLLSAAGAKSTVESFLSTMSASADVLAMAKVEVKLANIPEGKN
FT                   VIVKWQGKPVFIRHRTQAEIEEANDIDISTLRDPQKDADRVKNPEWLIMLGICTHLGCV
FT                   PIGEAGDFGGWFCPCHGSHYDISGRIRRGPAPLNLEIPEYDFADPDTLVVG"
FT   CDS_pept        complement(join(870048..871290,871360..871679))
FT                   /locus_tag="PAS_chr2-1_0470"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69100"
FT                   /db_xref="InterPro:IPR018712"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0S6"
FT                   /protein_id="CAY69100.1"
FT                   /translation="MPKTIILCVDGTKNQFQTQPFTNVMKFYRMLYKEDPSTQLCYYQP
FT                   GIGSVEAEFMDLQGYVRKIPVTINAEIDSMVAHRMDQHIVAAYKFLVQYYSQGDKIFLF
FT                   GFSRGAFTVRILAGMIEKVGLLSVGSTHMALTAWSIYRNWETCGQPKAPKDLANSLAVE
FT                   FKRTFSRNTVNIEFMGLWDSVNSVGVIRDRMFPFSSKADHIKHIRHAISIDERRTKFKQ
FT                   NLFCPIPSDFAFTETADELPDSPQIDLQEIWFPGSHSDVGGGWLSDDQGHCLSNIPLRW
FT                   MIAQALKYGVLFSSGSVSEFDLTYPTMDSLFSYHHDPLQLIPKRYSHNLPSPHHSSSTA
FT                   TSLLYDILEKDFAAMASSLTRFQFQRKLRQIFPNTLLLDEVPPPPVYRFDNRGEDSIIR
FT                   CLKWWLLELLPIGVYQNDPETNRWVRSYRPNLGKRRVLPRYARFHWSLFWRLYHIEDYN
FT                   PSNLTDMASTLFEILKQNSTNETGTHVNQINEFGELVPNTQINWKQFPNDLQLQLSATS
FT                   IVI"
FT   CDS_pept        complement(871761..873980)
FT                   /locus_tag="PAS_chr2-1_0471"
FT                   /product="Chloride channel localized to late-or post-Golgi
FT                   vesicles, involved in iron metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69101"
FT                   /db_xref="GOA:C4R0S7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0S7"
FT                   /protein_id="CAY69101.1"
FT                   /translation="MYWKNSENSRYLRSIARFDQFDTIDWINETLKSNQHRFSSWIIDW
FT                   LCLASIGVFVGIIAGCLNIITEWLTSIKNGYCSTAWYLNREFCCMGLSHDDCPFWNPWP
FT                   ASYLLYIGWSVLFASIGAILVKTYSKTAAGSGISEIKIIVSGFDFKAFLNQATLFIKSL
FT                   TLPLVIASGLSVGKEGPSVHYAACVGSVVPSVLFSKYFNGLAFNRRHFITAATAAGVGV
FT                   AFGSPIGGVLFAIEEISNFPLLSTFWKCYFCALCATATLASIDPFRNGQLVLFQITYNQ
FT                   TWYSFEIPVFMLLGLFGGLYGIVVSKLNIKVVHFRNRFLIPHAIKEVVYLTLLTSLICY
FT                   NNVFLKDEMTKTMQLLFKECSPDSHSLLCTNDNSHKSWLVLSLLVATLIRSVLVIISYG
FT                   CKVPAGIFVPSMAVGATFGRSVGLIMEILYASRETSWLFASCPKDGSSCITGGSYALIG
FT                   AASALSGITHLTVTVVIVMFELTGAVNYIIPIMIAIAVTKTINDRYGAGGIADQMIKFN
FT                   GMPFIDSKEEHEFFQDNATHKAMTLETVYFPLRLSYHDLEVILADTDYKAYPVLDQEGF
FT                   CSGLVQREQLVAEIGRLKGQDRLQLETMCMFSEDSSTNPFIEDLQDSETCYLDHLIKRD
FT                   PVSVMTSTPLEISLDIFVKLGPRLILVKNSGGKLAGLLSRKDIIKYENYLHSTTHSIDE
FT                   NEQILLDEEQNYIEDRVWSFFCLIGSKFPKIGRKEYEPLETPNTR"
FT   CDS_pept        875193..876245
FT                   /locus_tag="PAS_chr2-1_0472"
FT                   /product="Mitochondrial alcohol dehydrogenase isozyme III"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69102"
FT                   /db_xref="GOA:C4R0S8"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:5YAT"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0S8"
FT                   /protein_id="CAY69102.1"
FT                   /translation="MSPTIPTTQKAVIFETNGGPLEYKDIPVPKPKSNELLINVKYSGV
FT                   CHTDLHAWKGDWPLDNKLPLVGGHEGAGVVVAYGENVTGWEIGDYAGIKWLNGSCLNCE
FT                   YCIQGAESSCAKADLSGFTHDGSFQQYATADATQAARIPKEADLAEVAPILCAGITVYK
FT                   ALKTADLRIGQWVAISGAGGGLGSLAVQYAKALGLRVLGIDGGADKGEFVKSLGAEVFV
FT                   DFTKTKDVVAEVQKLTNGGPHGVINVSVSPHAINQSVQYVRTLGKVVLVGLPSGAVVNS
FT                   DVFWHVLKSIEIKGSYVGNREDSAEAIDLFTRGLVKAPIKIIGLSELAKVYEQMEAGAI
FT                   IGRYVVDTSK"
FT   CDS_pept        complement(876267..877664)
FT                   /locus_tag="PAS_chr2-1_0473"
FT                   /product="3-deoxy-D-arabino-heptulosonate-7-phosphate
FT                   (DAHP) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69103"
FT                   /db_xref="GOA:C4R0S9"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0S9"
FT                   /protein_id="CAY69103.1"
FT                   /translation="MTVQEVDPKRSRTPPVWDYGLNKQSTNSRPPSSQGSGLLLSEKFG
FT                   HSVVPQPEVLQQVLYPTNEELKQKILTYRNYINSLIKTDSNDSAQPNILPDTEIVENKP
FT                   LLVITGPEYIKDGTQAKRCAQWIAALTGKRNYKVVGEMDGVLEKEITPLFNPLTSTDRK
FT                   DLLVTMRTNLSEYGNGDNDQAIMSYEIQYGIPICRVLLTELAQYCPLVGELSDTLTPQY
FT                   VSDLYCIGLLSHTYTESQLHRELASGVSYPVGFQVYGDTENAFNHKLQSSIDAIYSTSQ
FT                   EHHFLSVTKLGSVAVIGTTGNSDTFLILKLNGDQQDSYLEDIAPLVQLLQKHIVEKFVK
FT                   IGRPDIKIMLDIGSIDNEGTYKYKELLLSQILANSEVSRYILGVIIDSGDSYLPESLDL
FT                   EEESQSISGPPQRFDHRELRQSLFKNVGKTHEKLDKFFFANRLLQRLVELSQKGEVKIS
FT                   NSLKLIT"
FT   CDS_pept        join(878057..878084,878143..878465)
FT                   /locus_tag="PAS_chr2-1_0474"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69104"
FT                   /db_xref="GOA:C4R0T0"
FT                   /db_xref="InterPro:IPR009332"
FT                   /db_xref="InterPro:IPR038427"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0T0"
FT                   /protein_id="CAY69104.1"
FT                   /translation="MQKKSQQLMDKLDSNVTLMVQKYQSILELVTSSDKSIGTQSVETL
FT                   QIESNASTIIRLSEELLSMTRTLKESWVLGQLPKINEDSDLSNEHLREKMNQLLELVSD
FT                   ETKQPKEEESDL"
FT   CDS_pept        878787..879890
FT                   /locus_tag="PAS_chr2-1_0475"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69105"
FT                   /db_xref="GOA:C4R0T1"
FT                   /db_xref="InterPro:IPR013218"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0T1"
FT                   /protein_id="CAY69105.1"
FT                   /translation="MPPKRKGSKKKPKADSGTKTNGRVNLTSNASSILKKAKQANSSLS
FT                   QLLQNSHPLLDNIDELNEHTRHSQRFEEDEGFVFKRLKKDSDDDVEYTEASRSMILPLN
FT                   ESPVKRNPKQKRRSSLSNRGKRVSSIGNGFTGTPHDDVEIKHFHKHLDESLPEPHRMRQ
FT                   LLIWTGKRLLKKKQTHKDNTIVNIAKVIKEELIRDLIDGKLNTSWWNRVDSDEEDEFDV
FT                   TTFLPNQQNETNKKNLALLQHSLEQLKEEEKVWEEKLRQLTGTLALSPDISSVDVSNNE
FT                   TCSKTQETVSRLEKKVEEIGESIDIPLEKKLDLFADYTHKLRSIERTSRIYIDNKSNEI
FT                   ASLLSKKQEMKELPQDLLKAISRIDRS"
FT   CDS_pept        complement(880081..880479)
FT                   /locus_tag="PAS_chr2-1_0476"
FT                   /product="One of 10 subunits of the transport protein
FT                   particle (TRAPP) complex of the cis-Golgi which mediates"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69106"
FT                   /db_xref="GOA:C4R0T2"
FT                   /db_xref="InterPro:IPR006722"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0T2"
FT                   /protein_id="CAY69106.1"
FT                   /translation="MSLYLALIGTRDNPLYEMEIKMDPIRDFCPFIVHSALDIIEDLQW
FT                   KTNQLYFKNIDNYDNYSISGYVTPGNIKFMILYQNLRSDEAIRQFFGELNDLYVKTLLS
FT                   PFYTINEAIRSKAFDQKVRMLSRKYFNL"
FT   CDS_pept        880717..882738
FT                   /locus_tag="PAS_chr2-1_0477"
FT                   /product="Protein of unknown function, required for normal
FT                   growth rate at 15 degrees C"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69107"
FT                   /db_xref="GOA:C4R0T3"
FT                   /db_xref="InterPro:IPR038769"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0T3"
FT                   /protein_id="CAY69107.1"
FT                   /translation="MLKKYSNYSQEVPDIPLKQNEDQASDLAPPSLDRTVELTSLFLGL
FT                   RKSLLLDSHIEPASTMPKKVPMTCVKEGGRNSLDMESNSAYSKEDLNQLAKSLNFGINR
FT                   ESYEYNQDTAGQINLRSFSPQILERAKRVKLMFSLFYWNLERSLEIHMPLEDNPNKSQL
FT                   PGIDGVFNPLQTIRNRSIRRKQHYKIQDLGFKALPLPSQAFSRKGKKHKSGNKSTRYFK
FT                   WEIPLKELIIDMNWKLENWHLLIDPSGELWFEHSELPDGRLHHRLHYKRPHLRNHKRYK
FT                   KLFEDYKEDLDDDLADPFNLSLDKVHTNGSVSMLTTGSYDDGDSIRTTRTNDELKKKTS
FT                   ELEKSASDTASSYMPSRLAKMPGRFFKKKQQPNVAVANATNPDTSPSFDSESTHQPEPY
FT                   YAELPKVVIEEASIGDEAPRSDFGSYSWNRTKFEPLKVGSEEDLQTSSSTSMIERHFTN
FT                   VDEKKDSTVSLEQHFSSDSLPRRTSLVDDQEEQILKTCYQRLRKMDILIVLGEVHMSHK
FT                   ASSLTQFIQTRADQLQEKTVNLNTSFSRLENVELKEYDDRFHPIYQKAIEYRNFVDNDY
FT                   FNKLDQMMALSDRMIGEINTSVTLDIRKLNDRIDKLNQSTSLMATKSRFDLRKIGYKLL
FT                   ENLIVLLFWLIWVIVSAYRIVKIVLIMGIRFISWVLSD"
FT   CDS_pept        882818..883285
FT                   /locus_tag="PAS_chr2-1_0478"
FT                   /product="dUTPase, catalyzes hydrolysis of dUTP to dUMP and
FT                   PPi"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69108"
FT                   /db_xref="GOA:C4R0T4"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0T4"
FT                   /protein_id="CAY69108.1"
FT                   /translation="MTDQESKRIKQSEQLKVFLRSDKAKTPTRGSPLSAGYDIYSAEQT
FT                   IIPAKGQAVVSTDLTVIVPIGTYGRVAPRSGLAVKHGIQTGAGVIDADYRGEVRVLLFN
FT                   HGDKDFQIEAGDRIAQLVLEKIVLADIVAITREELDVTERGEGGFGSTGKN"
FT   CDS_pept        complement(883356..885707)
FT                   /locus_tag="PAS_chr2-1_0479"
FT                   /product="Pleckstrin homology domain containing protein
FT                   proposed to function as a glycerol channel activator"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69109"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0T5"
FT                   /protein_id="CAY69109.1"
FT                   /translation="MSRAPSPTGSYFSHSSKPSGSSFAGSRPALHGKESNESVFSSNDS
FT                   LTTDPLRNGSQNLSLPPPSDPSSPYHIALPLNPHPVEQLVNRFTIWKKLIKELIFYFKE
FT                   LSSLKQHYYELNIHMLNNIKLLTKPSAKSVAPLDHNDDPTGELAAFTGTTEEKFMKTAF
FT                   LPPSGSSITSVRNTLHNYHRALAEKELVTYNQLTLKVIPRLENFKRSLNSKIKEILTLK
FT                   NDFKLQKIKSQVAMTGQLLSDYVNVIELFNRGSTTTPSGLDTSEKYNSKLTSSGKYDPY
FT                   VLKLRFDLQLRQQLLEENMVRESFLSIQKAGLLLEEVVYKEVQNAFGKFANLIDAEVNT
FT                   VKKNLVEDLKEGFLKNVPSSDWDYFILNDKANFLNISSKEILNPSPGRKLSNIVYPYQK
FT                   KLAARCIRSGHLEKKNKLLKSYAKGYYVLTLNFLHEFKTPDRKKEYMPQSSLPLDRVVL
FT                   KESDRESRKFVLHDTSTKTNHIFKCVDAVDAGKWYTDLKELTKYASSIERNTVMEFRYA
FT                   NSVAKQPVQGHSKNSSESSIYLPERTTSPLPAELKDTEELRKNSSSFALPTFKNLSTSK
FT                   LDEVLSAPLHESPNSDSSSTPSTIHQPVPSISITRHQSKKKPSKVPVRSDTPPINTQQL
FT                   RNNGSVKTGDIHSSFALSGNHIADQREVSSSSQSNLAETNLTTPDVKGYEYNLDTPGKT
FT                   PDLDYFSFKGQNAKSMANSSSGLNTPTESISDSANSSTSKFHGTLELPTANFSDVIRNN
FT                   ASIPATPGELPSSSIKDMIKQYGLDEHLQE"
FT   CDS_pept        886085..887611
FT                   /locus_tag="PAS_chr2-1_0480"
FT                   /product="Mitochondrial inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69110"
FT                   /db_xref="GOA:C4R0T6"
FT                   /db_xref="InterPro:IPR011685"
FT                   /db_xref="InterPro:IPR033122"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0T6"
FT                   /protein_id="CAY69110.1"
FT                   /translation="MVKILRGPVFRTTVLVGRGLLRSNIRPVHVLGLRFQTSLKPNPPV
FT                   STIKDVEAQKPKDPSLAGQSKDIKHVTETAIVETEKKLTLWEKVKHEANHYWDGTKLLG
FT                   YEIKISFKLLCKLAGGYELSRREHSQLTRTTTDLLRLIPFSVFVLIPFAELLLPVALKL
FT                   FPNLLPSTYESKAERNKKRKSLLDTRNKTSKFIRKTVQESGINLPKQVTEDEKKDFVSF
FT                   FKSIQEPGERPSTEQIIRIARRFKNDQVLDNLSRPQLMAMARYMNLRPFGTDEILRYQI
FT                   RYKLLQIIKDDRAIDYEGVESLSIQELQSACASRGIKTVGASPARLRDDLKIWLDLRLR
FT                   QKIPSTLLILSSTFTYGDHADDLDNYYDALLAVLSSIPDEVYNVAKLELADQDNKLKLN
FT                   VLKEQDELIKEERQQSKSQRRSTPIKDDIKLDEYEEVKEDEVKDDVTKDTVEEKREDTN
FT                   EHVKEEPKVDASEEVKDETPAQSEEEVKEPSKDGTVIESKDQPQTTDKKE"
FT   CDS_pept        complement(887744..888178)
FT                   /locus_tag="PAS_chr2-1_0481"
FT                   /product="Ribosomal protein 59 of small subunit, required
FT                   for ribosome assembly and 20S pre-rRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69111"
FT                   /db_xref="GOA:C4R0T7"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0T7"
FT                   /protein_id="CAY69111.1"
FT                   /translation="MASKTENVTLGPQVRDGSQVFGVARIFASFNDTFVHVTDLSGKET
FT                   IARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHVKLRATGGTSTKTPGPG
FT                   GQSALRALARSGLRIGRIEDVTPVPSDSTRRKGGRRGRRR"
FT   CDS_pept        complement(888546..888938)
FT                   /locus_tag="PAS_chr2-1_0482"
FT                   /product="Protein component of the small (40S) ribosomal
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69112"
FT                   /db_xref="GOA:C4R0T8"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0T8"
FT                   /protein_id="CAY69112.1"
FT                   /translation="MTRTSVLADALNAINNAEKTGKRQVLIRPASKVIVKFLTVMQNHG
FT                   YIGEFEFIDDHRSGKIVIQLNGRLNKCGVISPRFNVKIGDIERWTDNLLPARQFGFVIL
FT                   TTSAGIMDHEEARKKHVSGKILGFVY"
FT   CDS_pept        889198..889353
FT                   /locus_tag="PAS_chr2-1_0483"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69113"
FT                   /db_xref="GOA:C4R0T9"
FT                   /db_xref="InterPro:IPR000077"
FT                   /db_xref="InterPro:IPR023626"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0T9"
FT                   /protein_id="CAY69113.1"
FT                   /translation="MPSLKTFKTKQKLGKAQKQNRPLPQWVRLRTNNKNRYNAKRRHWK
FT                   RTKLGI"
FT   CDS_pept        complement(join(889514..890014,890072..890101))
FT                   /locus_tag="PAS_chr2-1_0484"
FT                   /product="Protein localized to COPII vesicles, proposed to
FT                   be involved in ER to Golgi transport"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69114"
FT                   /db_xref="GOA:C4R0U0"
FT                   /db_xref="InterPro:IPR004895"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0U0"
FT                   /protein_id="CAY69114.1"
FT                   /translation="MSMSQFANFQFSQLSENMSVDRVRQEAQNISNKFANMKPPQEFFD
FT                   FRRVSKPANFGEVQQRVAYNLGYFQANYIAIVALLSTYSLLTNLLLLFVIVFTIAGVYG
FT                   IAALQGQELELGFTRLNTSQLYTGLFIVAVPLGFLASPISTLLWLIGASSVTVLSHASL
FT                   MEKPIETVFEEAV"
FT   CDS_pept        complement(890338..891480)
FT                   /locus_tag="PAS_chr2-1_0485"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69115"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0U1"
FT                   /protein_id="CAY69115.1"
FT                   /translation="MSFLARRVGSSVRWYSRYLQTTYNPASKLLKRPEFEPRSLFVIAT
FT                   PQHIDNLLTELGSISSEYEQLQIIAASTDSIPSGGTHRDGVSQMWLDEYITVNDSVRLE
FT                   ERDDNLEDNTGEESNGVIPVRANRPWKKMQTRLQVNLHNSDNGISTITTSLANSAFYFR
FT                   DLCFMFYTRSHGADQLINANHNLAELTLTLPKQIRPTGFRSWNKLEQLSFDEDLAVTEH
FT                   NHNLIKRINGQSAAGYLENCKRIMNLGSKDTKIFIELSNSSVQSEPRLYEVVAGGGGWG
FT                   EKGKMLAISAGCEINTGDSVKFFMLHPEERYKGLAVPLDVQNASGLFVETTVEEKEYRD
FT                   AQHEEERVIQNQFGFGSELGYTINGLQYNAGGSLTWIELE"
FT   CDS_pept        complement(891636..892022)
FT                   /locus_tag="PAS_chr2-1_0486"
FT                   /product="Fusion protein, identical to Rpl40Bp"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69116"
FT                   /db_xref="GOA:C4R0U2"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038587"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0U2"
FT                   /protein_id="CAY69116.1"
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLKVLASKYNCDKSVCRKCYARLP
FT                   PRATNCRKRKCGHSNQLRPKKKLK"
FT   CDS_pept        complement(892376..894361)
FT                   /locus_tag="PAS_chr2-1_0487"
FT                   /product="Leucyl aminopeptidase (leukotriene A4 hydrolase)
FT                   with epoxide hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69117"
FT                   /db_xref="GOA:C4R0U3"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR012777"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR015211"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="InterPro:IPR034015"
FT                   /db_xref="InterPro:IPR038502"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0U3"
FT                   /protein_id="CAY69117.1"
FT                   /translation="MRSFFVLTYRLSRRTFISAPGNCNQRLFMSSLSHISPKLRDIIGS
FT                   RLPKVFPEVDASTNSNYRHFEVKATDLYLDVNFEKSTVTGEVKYQLHVKDDAESIILDT
FT                   SFLNVKQVTIDNKEVEFEIEPRKEPLGSPLVIKQAVKKAQQLLLTSKFETTDKCTALQW
FT                   CDPEQTDGGDHPYLYSQGEPIHIRSLFPCFDTPSIKSPFTFRVKSPLYTLLSGKTYKQE
FT                   GDVYYAKQPIPIPVYLVSIASGNLVGADVGPRSKVYAEPIAIDACQKELKDDIEDFIQT
FT                   AEGLVFKYEWAKYDLLVLIKSMPFGGMENCEISHINPTCITGDKQNIDVIAHELAHSWS
FT                   GNLVTNCSWDHFWLNEGWTVYLERRIVGVLHGEPSRHFSAIIGWSDLEYSIKSMGQTAQ
FT                   RYSTLIQDLKDGSDPDDAFSTVPYEKGFNLLFHLEQVLGGTSVFDPFIPYYFSKYKYKS
FT                   LDSYQFLDTLYEFFSDKHEILDKVDWETWLYKFGLPPKPKFDTSLVDECYDLAAKWVDV
FT                   TKKDSKDLLKKTFSSDDISNFTGNQTNVFLDTLVSYQGVEGFLWNSKEGEQALTFMRES
FT                   YSVYDDSKNAEVIFRWYRLQLTGRSKQYYQRLADWLGTIGRMKFVRPSYRMLNDVDPQL
FT                   AKDTFLKFEPIYHPICRSMIRKDLHL"
FT   CDS_pept        complement(895161..896915)
FT                   /locus_tag="PAS_chr2-1_0488"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69118"
FT                   /db_xref="InterPro:IPR025340"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0U4"
FT                   /protein_id="CAY69118.1"
FT                   /translation="MVLLKRLLSKTPFITQQPAPTMAFKTTIEHFPHPFFDGFSAEANV
FT                   CFPRVVDDLIVQKLSYTIRSKPDWTTKYKNEEIKKKWIAEMEGQLKLEPDILPLHPAET
FT                   IWKFVFEELAWYEKYAEETGFTAGPNENVLFSDSALDDDFRKSLKKLVYEKLEDVPEDS
FT                   KDWHPGSNNQVLDLVHPSLYPLQYGKTLVVTEKGYEVSKVIVPKTIPKYTHYYGKDFLS
FT                   ENYQWLPSIFHVSKKNGEYDVNIQSYINNLDPVKYGSLYPLISSVFAKAIPGLNLLLTH
FT                   LSNLERLRVEYPRFDYMQYSLVYDQDFNNKLQALEATSDYDWEEYERIFEQREDHVDKS
FT                   RFPLEFKTPVFEKKVDLADFGDLKVITKLANIHLTPEKPTYPGGSWHVEGTVNEDIVAT
FT                   VLYYYDSENIGESKLSFRNATIEPKYEQSDDVTVRKIFGLHDEDRLTRFLGSVDCIENR
FT                   LLIFPNVYQHHVEPFELVDKTKSGHRKILCFFLVDPNNRHTFATDKVPPQQENLLGDKI
FT                   TSFLGKETSSKLPTEILDLIANKVQYTLSLDEAKKVREKLMEERTPEEEDEYGGSNVYT
FT                   SLFSLCEH"
FT   CDS_pept        897626..899272
FT                   /locus_tag="PAS_chr2-1_0489"
FT                   /product="Myo-inositol transporter with strong similarity
FT                   to the major myo-inositol transporter Itr1p"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69119"
FT                   /db_xref="GOA:C4R0U5"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0U5"
FT                   /protein_id="CAY69119.1"
FT                   /translation="MSKESGKVLQVNYSDSETSNGEDQYVHKIKPVEDEDDTSMMMSFD
FT                   NHKPTITIIILTVMASFSGFMFGFDTGYISSALVSIGTDLDNKVLTYGEKELITSATSL
FT                   GALLSAISAGLLADIIGRKPVIMGSNLLFVVGSVIQCAANTVWTMIGGRFVMGFGVGIG
FT                   SLIAPLYIGEMAPSRFRGRLVIINVIAITGGQLVAYAIGAGLTHVHNGWRILVGLSIIP
FT                   PVIQLFVFFFLPETPRFLIMTNKLEKAAKVIGKTHNESDEELIQTKILEIQSANAIIPG
FT                   SNPFQKTWNAIKEIHRVPSNFRALVIGCGLQGIQQFTGFNSLMYFSATVFETIGFKNST
FT                   AVSLIVAGTNFIFTSIAFFVIDRVGRRRILLIGVTGMILSLVMCAVAFHFLDIHFSGHN
FT                   AIVETNGISGTGVAIIVGMILYVASYALGIGNVPWQQSELFPQSVRGVGSAYCTAVNWS
FT                   GSLVIASTFLTMLENITPTGTFSFFAGLSFVSLIFVFFCYPELSGLKLEETQEILTGGF
FT                   NIKASLKLAKQRRNKQLEDPDKIVHKVVDQV"
FT   CDS_pept        899500..901056
FT                   /locus_tag="PAS_chr2-1_0851"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0851"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69120"
FT                   /db_xref="GOA:C4R0U6"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0U6"
FT                   /protein_id="CAY69120.1"
FT                   /translation="MDEESTVPFLEDTTSSQLPEEVNVKKRSFEYLENFPSPLILLLTS
FT                   TASISGFMFGYDTGYVSAALVSIGKDLGGSLLTLRDKEVITSATSLGALLGALTGGLLA
FT                   DLWGRKRVILLSNLLFIVGGGTQVFSQVVDSMIWGRFIMGIGVGVGSLVAPLFISELAP
FT                   PQFRGRLVVINCLAITGGQLVAYLMGALLRNWRILIAIGCIPALIQTLFFIYLPDTPRF
FT                   YLMKGYHDKAFQVLRRINPGISDTAIEDKILQINQQNKQSTLGLSPWRSIWVNYIRIHR
FT                   KASNLRALIIACSLQAIQQLTGLNALMYFASTIFQMVGFKNSNLVSMVIAGTNFIFTVI
FT                   ALFVIDRVGRRRILLWTLPIMSLSLFLCSVCFHYISVAFDPDGQPIIAPGTENVWGHFL
FT                   ILAFISVVASYALGIGNIPWQQSELFSQDVRGTGISISTATNWTSCLIVSSSFLTAMKL
FT                   VTPSGTFLIFSIIGVLSVVLIAFIYPELSGLELEETQEILQDGFNVKKSVQLSLQRQRT
FT                   Q"
FT   CDS_pept        complement(901082..901777)
FT                   /locus_tag="PAS_chr2-1_0490"
FT                   /product="Nitrogen catabolite repression transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69121"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0U7"
FT                   /protein_id="CAY69121.1"
FT                   /translation="MVHILLDQHNPEETALEAPYLKLYTFGTPNGRKVSTLLELLHLDY
FT                   HVHSLDITKNESKQDWFLKINPNGRIPTLTEADSNGNQFSISESGAILLYLADKYDKDR
FT                   KFSYAYGTKEYYEELEWLMFQMAGVGPMTGQANHFVRFTKEDIPYAKKRYLDEVRRLCS
FT                   VLEERLERNPHKALFLVGDHLSLADIATYPWIYGLKFLDIDVNDYPKLAQWAEQISKIE
FT                   EVKKGMSVP"
FT   CDS_pept        complement(902023..903654)
FT                   /locus_tag="PAS_chr2-1_0491"
FT                   /product="Deletion suppressor of mpt5 mutation"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69122"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0U8"
FT                   /protein_id="CAY69122.1"
FT                   /translation="MNNGPNLTAIERSTLERIRQIQKDECLSRRESTVSTLSNLSLDTI
FT                   ATTGRLLDHLGLESLVGSDDNATDEEDNLSIVYDDENKIKLAKSQTNSSTSTLKDVSMP
FT                   KQRDDEHDRDTAKNNYVSAQNFRSLKQRFHTSESLTNKIDLSSWKDAQVLESASHPTHV
FT                   SNNNYWEHRVSYKPETRQNDSDQSSNNSQDEASDGYGEDSKTSFSHEKSQSQTIPDSWR
FT                   MTDHDTQSATEPEIESPRRKRFTVFGTDSSSYIPSPPRIRSPLFKRLSGQMSKEPGVSS
FT                   SPKKNPLNLHVHQNERETLARFLDSNDIDYATIPQLPAALTTQLNINPDDLPSPTQRNF
FT                   HKHSNSHSSISSQETANMDRVSLALKLRNSGKLRESSYQLEKASHEGNEQAMMLYALAL
FT                   RYGDGVRKDNVLSFQWLTKIFLSYFPSLSSFLREPDISPFALNAENIPSSPKEPIASAL
FT                   YELGKCYMTGLGVTKDEAVGLKFLERSASMGIVDAMCEVGMIWSNKSKHRKKDLYKASA
FT                   WLRLADKFHAPLVGVSWIYKEKYFPK"
FT   CDS_pept        complement(903884..905917)
FT                   /locus_tag="PAS_chr2-1_0492"
FT                   /product="Protein whose overexpression suppresses growth
FT                   defect of mutants lacking protein kinase A activity"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69123"
FT                   /db_xref="GOA:C4R0U9"
FT                   /db_xref="InterPro:IPR008862"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0U9"
FT                   /protein_id="CAY69123.1"
FT                   /translation="MSSHLENDNLASNPTNNNSSATATATATSTSSAAPGGPPHSDSTP
FT                   STSASAPSANTSTTSVSSASSTHSCATKKRTLNQLLNHTKKIKMVSNSSHSSHGHQPTK
FT                   QKTGNNTDDLNIHLSNQQTSSSSITNSFPIEKRFRSRSVPYIPYQTFSQCENNKASMSR
FT                   FSGVSVQDITSSILLTNPLPPVNLSSLREIDLQEILKNPQLRHDIIFDPQLQFRPNVEG
FT                   DRGKRKKLHIDKYWSSIERELTLYFESHLNFNLAISKLPTLFITLRDILLSLMPQQDKQ
FT                   KIIDVMDIELLIQNLKNGTLQLCPMFQWLGSVLKKNCAPTRDSIVDNMLSCFERDADVK
FT                   SIIKGLGYSFQILERMKLDVANHQIRIMKPLLISTAIDFEKDYFNQMIKRDKISIQDSL
FT                   GWYSKAYHKLAGTIKSENLHQYTIIHSIIDLLSCRNMVNEFPSTLSFDNSKLIVLRADI
FT                   RQLACLQLCILLYKQLVLRFDENLSYRAELLSFDNLNDLKKRVLAIVVDENGNSKWTKN
FT                   INDLALTIVQRCTVNPKTSDGGKAQTTLPSNDMVAFAFNWLIKQTQPNSRMYGILEDRI
FT                   FSSLKSLVLSSFQKDENLLTSEEFIRLTSESSSNTSLLQSSFSSSAPLSSAAYLSQPSE
FT                   KKANDRNTDVTFQELSTLGNALTILIKFHWNVLGSCYLQCIN"
FT   CDS_pept        complement(907015..907581)
FT                   /locus_tag="PAS_chr2-1_0493"
FT                   /product="Essential NTPase required for small ribosome
FT                   subunit synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69124"
FT                   /db_xref="GOA:C4R0V0"
FT                   /db_xref="InterPro:IPR020618"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0V0"
FT                   /protein_id="CAY69124.1"
FT                   /translation="MTSRLYPNIIITGTPGCGKTSHCESLVESLNDELRSHFQHLEISK
FT                   VARERGCIDGFDQERDSSIVDEDKLVDSLEPDLREGGKIIDWHCCDVFPERLIDLVVVV
FT                   TCDNSVLFDRLSQRGYPDSKITENIDCEIMQVILQEAKDSYAPEIVIELSSEDLETMDD
FT                   NVERIIQWINSWRENNPDGASNELD"
FT   CDS_pept        907752..908270
FT                   /locus_tag="PAS_chr2-1_0494"
FT                   /product="Component of the CCR4-NOT complex, which has
FT                   multiple roles in regulating mRNA levels"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69125"
FT                   /db_xref="GOA:C4R0V1"
FT                   /db_xref="InterPro:IPR007282"
FT                   /db_xref="InterPro:IPR038635"
FT                   /db_xref="InterPro:IPR040168"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0V1"
FT                   /protein_id="CAY69125.1"
FT                   /translation="MSAAESTQEYAKALSEALKMPNNDQTTLLIGTELNMLGLPDSTGL
FT                   ISRSFTSPWLETSRSQVDPNCKQIESFKLSNSELPDPAMKISTFTDETLFFIFYTCPKD
FT                   TLQELASRELVKRNWRYHKYLQVWLTKDSNHEPVPNGLNSERGVYIFFDPHNWERVKKE
FT                   FVLFYQSIM"
FT   CDS_pept        909283..911967
FT                   /locus_tag="PAS_chr2-1_0496"
FT                   /product="Alpha-adaptin, large subunit of the clathrin
FT                   associated protein complex (AP-2)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0496"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69126"
FT                   /db_xref="GOA:C4R0V2"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR003164"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017104"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0V2"
FT                   /protein_id="CAY69126.1"
FT                   /translation="MAPQMKGLMQFISDVRSSKNAAEENTQIHSELINIQNHFKDKNLS
FT                   SYQKQKYACKLIYICLNSQKKDNVVNLDFGLPHCCSMIESESLSERNIGYLALQLIYAS
FT                   QLENLSEFNLFSHLERNLDSHQEDKVALALHFLAGVYYDELFTTNELAKIIELLLQLIR
FT                   ASNSSVLVKKKSSLALLKILRDSSESVKVHERFIPRILSLLDTDNIGLMISLCSLVQQI
FT                   SKHRPKACIPAIPVLIQKLDQLIEQKDIESDYLYNGFPSPWLIVKIMRLLETLVSDNFE
FT                   QVDQLQIEHLNRLVKDSIALVIKLFDKNDKNANPQFKNSILAVLFQSISLGSCLDSSLQ
FT                   SISVAFDALGGLLRSSEVNTRYLVLDSMIKIIRNNPASNIYIEKETSKYIDQFFQFLYD
FT                   RDTSVRKKSTEAIFLSTNSSNIVMIVKKLFEYLPRCDYTLRPDLILKISILLEKYSTDA
FT                   TWYVQQNLKLVFLSGNYLKDEVWERVVQITINNEDIQLTTARLVLDYLKQKEFPETMLK
FT                   IAAVVFGDYHRYLIQVQSPLAHEKELLSLLYHKYFYCSVQTRAMLLTCFMKLFIAYEDL
FT                   RPRILDIIEKETCSIDSEIQQRSVEYLQLSKPHNHALLAILLQENPPFTLKSKLYSIPN
FT                   IEKPPVPPPSRKRMLTSNWEEGYYRLINYNQGIFFENSLIKILFKCEKDRHILSCQLIF
FT                   INQAPTDITGFTVSIDNEATKNFSVQNLSLPDSVIPLGKRSVHKFQVTVKKPFVTSPLI
FT                   HISFMCGTLTSLTFKLPTCLLKCLHPQTLSSLDEYSFRWNQIAGLQYGEYATDVKVKHR
FT                   LSRESLLRILERIGVSLIDSFDPNIVLGAGILNTEASNYGVLLRLELGPSDALAFKLII
FT                   RCTGDNISHILVTTLADLFSHGV"
FT   CDS_pept        912167..912976
FT                   /locus_tag="PAS_chr2-1_0497"
FT                   /product="Single-domain racemase, possibly non-specific due
FT                   to the lack of the second domain"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69127"
FT                   /db_xref="GOA:C4R0V3"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0V3"
FT                   /protein_id="CAY69127.1"
FT                   /translation="MIQSCEYFPMLKHSVKRLILLRTMSNYPKATEERSKELLENVNHI
FT                   LDQITSVKSPNGRPVNLVCVSKLKPSSDIMALYDAGFRHFGENYVQELVSKAQELPKDI
FT                   KWHFIGGLQTNKCKDLATRIDNLYAVETIDSIKKANKLNSSRDASKPKINVFIQVNTSG
FT                   EEQKSGISSYDDLLALAKVIKNDCPNLTLKGLMTIGSIQQSTAAGERNKDFDQLTAHNE
FT                   KLESDLGTTLELSMGMSSDFEQAIRQGSTSVRVGSSIFGARPPRNGH"
FT   CDS_pept        913187..914827
FT                   /locus_tag="PAS_chr2-1_0498"
FT                   /product="Dolichol kinase, catalyzes the terminal step in
FT                   dolichyl monophosphate (Dol-P) biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69128"
FT                   /db_xref="GOA:C4R0V4"
FT                   /db_xref="InterPro:IPR032974"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0V4"
FT                   /protein_id="CAY69128.1"
FT                   /translation="MAKKKAAAKRPKKTLPPASSKPLNSGENPDESQAEYSGLPPPQLS
FT                   FKSAIVAEMTSVISNGITINKVIQVLILAYIANLLYVKLDLNFDYDSKVEIGIGFLSIL
FT                   SSILIIYVSRKRRWNTGVELGSIDKDDPEKWVELPEFNLIYAIVLPIFVTYIVDKRYLG
FT                   VNLVNILLVIDIPIAFKILLALSMEQQVLDESGYLNQGFVTTRNNLLIPVAHVGFRELL
FT                   GYYGGSSFSNTESELFSTLFVNLVLFVDKSNIELFILAKLTLAFIGSLVICTALYRVLI
FT                   LFSPKYVISLILHPVFTALVYYGSVYQLAPVLGKHPWDYLVNDIMNEQRIHFLYSWLIL
FT                   LVVVVPPVFYFVDAIPLDFRRKIWHFTILIILSYPLSIDPSFCVIALGGVFGLFLVVEI
FT                   LRSTEMPPFGQILSRNLEKFQDERDKRGNITISYLYLVLGIVLPVMFDGSSCAGLVSLG
FT                   LGDSMASMVGKRYGLVKWPGSNKSVEGTFAFIVVTFLGLLAARTFFGYQFSWEISFIAA
FT                   ALAGVLEGISDFNDNIIIPLVVFTILHGQ"
FT   CDS_pept        914975..915523
FT                   /locus_tag="PAS_chr2-1_0499"
FT                   /product="RNA binding protein required for maturation of
FT                   tRNA and snRNA precursors"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69129"
FT                   /db_xref="GOA:C4R0V5"
FT                   /db_xref="InterPro:IPR031779"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0V5"
FT                   /protein_id="CAY69129.1"
FT                   /translation="MDDFAKLKFIDLSTLCVSRNKHLKLPEQNSGQLKFFEKNQHFFDV
FT                   RVYDDIAWNNYLLETIKSNTDGVVILFDCFLEWHKIQPMFLRGSQSNHLFVVSEFTAIE
FT                   ELSNKLSKFEDILLKLDVEARKLPLKGIVLTNMSVYYWQSKDNGKKTWFSVVDQLERLQ
FT                   AKYGCTIIRGMWDFTSKRE"
FT   CDS_pept        915728..916492
FT                   /locus_tag="PAS_chr2-1_0852"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0852"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69130"
FT                   /db_xref="GOA:C4R0V6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002344"
FT                   /db_xref="InterPro:IPR006630"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0V6"
FT                   /protein_id="CAY69130.1"
FT                   /translation="MSEEQSKKEILEQVEFYFSDSNLPKDRFLYTTAQANEGWVSISVL
FT                   ANFTRMRKFRPIELIVEALRESENLLEVSENGEMVRRKVPLPSREEQIKIAQRSVVVED
FT                   VPEDATLEQLQEFFKKYGKTNQVRMKRNRKTKEFFGKVIVEFSSVEEQKAFLEAEPKPT
FT                   FNEKELKITSKVAYDESRESKRTAGFNGRDKSKGKKRVNQDDDESNKRVKDDKEVEADK
FT                   ETADDAAKEAGEDTATEPEKTEVPEENKEESK"
FT   CDS_pept        916639..918561
FT                   /locus_tag="PAS_chr2-1_0500"
FT                   /product="B subunit of DNA polymerase alpha-primase
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69131"
FT                   /db_xref="GOA:C4R0V7"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="InterPro:IPR013627"
FT                   /db_xref="InterPro:IPR016722"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0V7"
FT                   /protein_id="CAY69131.1"
FT                   /translation="MTVGSEILSKFGRKADDPLIIQKCEDLIGIFNFSVEELFINWESY
FT                   VLTSASDVNLQLSPENLEKLKDYLQQKLVQAAAQKNNSATPMMKNKIVRPVARGNINGS
FT                   SPLMGLNTPSTPVSSHKKRKLVTPSSSSATPSKHPPSSSPIKKSVQVSGKIIESLNDHI
FT                   PSIGGLQNDTDHTPNISTSNVTLTANFDPKKYQFRTMRQKLLDTADVLDEQIDSMAKTL
FT                   QKHHKIAESDFGNPCIASQFSVYCCGRIVPDSPFAPVELRLNPDSLFLETSRLGGIGQR
FT                   ISIDVQSLAEYSFFPGQIVGFKGKNPSGERFIVEQVLDIPYLGAPVSNKTELLEYKTNL
FT                   DGSSMKTTVLSGPYTPSTKIDYSLLESFVQKLNTEIKPHSVIMFGPFLDITHPSIRDGS
FT                   IESVPELQGKKVATLDNFFRAVITPILKKIDSRIQVILIPSTRDSISSHAAYPQNSFER
FT                   KSLQLPKNFKCFPNPCSFQLNECLIGVSNLDSFKDIKDVNRGKIGDLNRFDRIADHILQ
FT                   QRRYYPCFPGSLKTRKGPDGTVEHICGADLDMPYMGLSELYDVLPDVLIIPSEMRYFVR
FT                   VVKNVVVINPGYFLTGNNAGTYVTLSVKPPNPEVDDDDLTCINDDDRLYIHNIWKRARV
FT                   DIINV"
FT   CDS_pept        complement(918607..921273)
FT                   /locus_tag="PAS_chr2-1_0501"
FT                   /product="Plasma membrane protein that may be involved in
FT                   osmotolerance"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69132"
FT                   /db_xref="GOA:C4R0V8"
FT                   /db_xref="InterPro:IPR007632"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0V8"
FT                   /protein_id="CAY69132.1"
FT                   /translation="MSAQEIPLEAFHPDFVLDVNYPFDAKTATPTKNAQDDLKKLLASL
FT                   LKKSFDFQIRENTLNSILVFVSVKEDSLVKYVNSSLALDYQYGITNDLKLLSSYKELEK
FT                   GTVVSYAEKARIIYEVLTKHPSEGGAGITVGSGDWSFVKSITAVGNLADHVNDLKEYGV
FT                   NLTKIADSYDSSSFDYLRSKFGLSVAFFFEFLSKYTNWLIVTSFVGILSHKFLGRYSLV
FT                   FTIFNLLSSIAFYLYWYVFQSKLALNLHVRNISLTEPTNVSYLNALEQKRPSVPVYKTV
FT                   LKELAFVPAALLSTGVLLLAQIGCFVIEIFLNEIYDGPFKKFLSFVPTALIVGVSPIIA
FT                   AIYNVIIDRSLNWEQHPNNSSLKNSKLIKLFAFNFTASYVPLLISAFVYLPFGFKVNSL
FT                   LPHIHSNIHYYVSDKIPVLDKNFEVNRFRLNGQFQYFILTNQIVALVLEFVVPAGLNIA
FT                   TRFLSQPASSDKTIEKRDNEVFPQEHDYLTLVRSYVALPEISYDTNYRTLIIQFGYLVL
FT                   FGPAWSLGPIVSLIFIVARTFIYKFQLLSLKIGRVPIPERRDSIYPWDLIIRWLIVLSA
FT                   VTSTALSLMYNRELVSSVSGSALGQIKWWKVVGITLFTEHIVSLLLNISEYVIRSFVAS
FT                   STDSERLTDRGDVVSVDPTIRKELINKTVPGFFETNENSNLEISNFSNIIADVLTRSVE
FT                   LQSDLSSAQKKRTKVNEEPKAVSTSIETNATVPSTQKLSSSVEESKSNLKQDPDFGVND
FT                   NFVIAKEEETGHKVVSTIDDNIHAADKVGSSVLNGATIPKDMNSRTSLPLPKAAASTSE
FT                   APITEAPTAKAPIAEDPPVTASKTETEQEITSTPPVIRQVSDAVEQTTNSSSSYSENSG
FT                   TPSKKHRTLKKLFKKGL"
FT   CDS_pept        complement(922058..922588)
FT                   /locus_tag="PAS_chr2-1_0502"
FT                   /product="Thiol-specific peroxiredoxin, reduces
FT                   hydroperoxides to protect against oxidative damage"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69133"
FT                   /db_xref="GOA:C4R0V9"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0V9"
FT                   /protein_id="CAY69133.1"
FT                   /translation="MLRRYFSSNSARMVQVGQSLPKTTLFVKDPSDQFESGSIEPNSVI
FT                   VTVPAAFSPTCSDTHVPGYLTRLKDLKSKNINHLYVVSVNDPFVTNAWKKTLLKSFSID
FT                   KTEVPVTFLADPKGDFIHGLDLDFDSAAVFGNNRSKRSALIIGSDGKVAKDFVEPDNTG
FT                   LKVSAVDSVLKAL"
FT   CDS_pept        922783..923376
FT                   /locus_tag="PAS_chr2-1_0503"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69134"
FT                   /db_xref="GOA:C4R0W0"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0W0"
FT                   /protein_id="CAY69134.1"
FT                   /translation="MSMFLSVFVRRLGNLAQYVNKRKLLDHGWIKADKLLEPPFNKFYK
FT                   VSFSRSSGPGGQKVNKTSSKVTLTVDQNQFYQGVKLLLPPDELVKPSSAVDEKQVRNQL
FT                   LSLLWANNRYLKSQGLVIQSDVYRSQSENLKECLDRFLGELQNGLKCLGLLDKETSEED
FT                   KQKWEKRHLLNRERRLAEKKKHSEKKKLRKQAFW"
FT   CDS_pept        complement(923474..924223)
FT                   /locus_tag="PAS_chr2-1_0504"
FT                   /product="Peroxisomal membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69135"
FT                   /db_xref="GOA:C4R0W1"
FT                   /db_xref="InterPro:IPR008733"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0W1"
FT                   /protein_id="CAY69135.1"
FT                   /translation="MVLDTVVYHPTLDKVIQYLDSSAGRDKLLRLLQYLTKFVSFYLIK
FT                   NGHSIVTAQTVRRIEAIATLNRKALRFLKPLNHLKSASATFDNKLTDKVTRYSQVLRDL
FT                   GYAVYLALDSVSWFKQLGISSTKRLPQVQKLASLFWFVAVVGGAVNDLRKIRLSQQKVA
FT                   SLKQELVVTSDKEGEQTVSKETINLIESESKLIGSTTITLIRDLLDGYIALNGFALQNK
FT                   DEKVGLAGVISSLIGIRDVWQGKYINE"
FT   CDS_pept        924621..925178
FT                   /locus_tag="PAS_chr2-1_0505"
FT                   /product="Subunit of the GINS complex (Sld5p, Psf1p, Psf2p,
FT                   Psf3p)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69136"
FT                   /db_xref="GOA:C4R0W2"
FT                   /db_xref="InterPro:IPR010492"
FT                   /db_xref="InterPro:IPR021151"
FT                   /db_xref="InterPro:IPR036224"
FT                   /db_xref="InterPro:IPR038437"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0W2"
FT                   /protein_id="CAY69136.1"
FT                   /translation="MGYYDLDEILADGQKIPCRFTISVPGLGYLENNPGKPVIQNTKLD
FT                   LPLWLAEILAICEIQSEQNDPKEDPDQPTYFIELIQPDFYSSKIINAIKTNALKIDLHQ
FT                   LLPYFYKLSVKWGSMFNDTELMAIVQEMFKQRACAINDYSSDNNHLQLLNSEFGLQLDE
FT                   TERMLFRQCIESHRDLKTWLSS"
FT   CDS_pept        926087..927451
FT                   /locus_tag="PAS_chr2-1_0506"
FT                   /product="Mitochondrial aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69137"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0W3"
FT                   /protein_id="CAY69137.1"
FT                   /translation="MSDRPFLESSPSKMFDPLLYSIGEDPSITDSKQRLKPGDRDRQGS
FT                   DSGGVAMTNGNAITGGSLQGLVPTVNTNVISTGSGWTPFIERANNDLYLTKFNSLNMSS
FT                   PSNHNHLSQTPNNIEKSFQFADFLMDTPLGANNSNNITNSFDSPGSFYRTLLGGSAKKE
FT                   NIDSSLKFWKTPLKTSSNQLLSQLSPGLIKGTSNVNNILSFNTPSRDNAGRTVIRERIS
FT                   NNNQITPNIHEASSPSTIVLKSSEVNTAKKKDHNSTNLPDASVMVSPTPAKIAKVLPTK
FT                   VGPEGTSMGPVMGIFADSKHRQPLMPKHLNQGQFNQKQKLNVKSQKQEQAGPKKRQWDN
FT                   IESGMNKFQIVFTDVKQIHNRSQKKRRNNNNQNGLTRANTVGAMSNPGLPRPNNTQIRS
FT                   ERAIFRSVSVPDQQFNYANPQEFLHHNTNGNTTTSRNGNDDLEEDFVNLLRSTRG"
FT   CDS_pept        928316..929893
FT                   /locus_tag="PAS_chr2-1_0853"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0853"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69138"
FT                   /db_xref="GOA:C4R0W4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0W4"
FT                   /protein_id="CAY69138.1"
FT                   /translation="MLRTSPATKKALKSQINAFNVAALRFYSSLPLQVPITLPNGKTYN
FT                   QPTGLFINNEFVPSKQGKTFAVLNPSTEEEITHVYESREDDVELAVAAAQKAFDSTWST
FT                   QDPAERGKVLNKLADLIEEHSETLAAIESLDNGKAISSARGDVGLVVAYLKSCAGWADK
FT                   VFGRVVETGSSHFNYVRREPLGVCGQIIPWNFPLLMWSWKVGPALATGNTVVLKTAEST
FT                   PLSALYVSQLVKEAGIPAGVHNIVSGFGKITGEAIATHPKIKKVAFTGSTATGRHIMKA
FT                   AAESNLKKVTLELGGKSPNIVFNDANIKQAVANIILGIYYNSGEVCCAGSRVYVQSGIY
FT                   DELLAEFKTAAENVKVGNPFDEDTFQGAQTSQQQLEKILGFVERGKKDGATLITGGGRL
FT                   GDKGYFVQPTIFGDVTPEMEIVKEEIFGPVVTISKFDTIDEVVDLANDSQYGLAAGIHS
FT                   DDINKVIDVAARIKSGTVWVNTYNDFHQMVPFGGFGQSGIGREMGVEALENYTQYKAIR
FT                   VKINHKNE"
FT   CDS_pept        complement(929938..932559)
FT                   /locus_tag="PAS_chr2-1_0507"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69139"
FT                   /db_xref="GOA:C4R0W5"
FT                   /db_xref="InterPro:IPR003163"
FT                   /db_xref="InterPro:IPR018004"
FT                   /db_xref="InterPro:IPR036887"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0W5"
FT                   /protein_id="CAY69139.1"
FT                   /translation="MDLLDTYLSDNHEYYGFKYSGVKGTYLRRKIGGWVNVTRYLSLVR
FT                   STRTNEFRAELEQDTNVLELRGKSINIAYTGCWVPLNRARELARKYAIYDQLRPLLGFD
FT                   RVAKVNHCGVQLLEMFVIINFDVFVRILRRCDNNMVNMEGLFLLDKLVSPDGEVKKNIR
FT                   RHFLKCYQGVRIESTEHTLLGGFWVPLNVARQFSNERGLGKHTDPILGFSTFPVMNAKE
FT                   YIPLNSVEERLANTWIVESFNNSVFYGLPESFRIPNFTKTSKPITLKDVCYTVQLNCNV
FT                   KRGLTKKLVVLKRKSDSWVNASILINVCCSLRKAMSPNDTNVDNELYYHQMVYSLPFER
FT                   VQFGRATTLNGRWIPLSHARELFKEMQVKFLGPYKKYATQLQKLLEPIEPTEEHLLDDK
FT                   NDEVTILLGRPNDTNAPEAVPVPPISLSSDEEMDEPPMKSEMVPENKTPKATETIILSD
FT                   SESSETTSTRIPQPAIQSSRAILFCEKIKDFGKKMDNVQHFSKEHRTQLDNILSDLGLL
FT                   SGSEIRFMRELGVLRILETVNKRMTADMHKPGPEGGSEEINRQFNQDNPSGGVNAPILI
FT                   VDPRHETSNDAERRPDAPATQAQQSFSSSSTKFLSTPSSSVTPPLDTHTRSQASWKQAW
FT                   GVFQSILSKAQPSRSTGDAIATTNSDSHSQKKTGSMLVKQDASPPQRDKTFVHGYEQDP
FT                   PSSGQLETPKAITKVGLTSDHSSLSRRTPIMECSNKSSPSANGNSTTQSTPESNYTSLI
FT                   RLSSIKDKPYFTEPRSFPGNHLRPAQSSVANDLNESTGETLRRTHSHPSAAAQNESFSL
FT                   DPSRQKRKENDDTSSHPKRRRTMTRGDIVKSVRALHNPLGHVERIMAAYNKNTTNNKIF
FT                   HS"
FT   CDS_pept        932716..935064
FT                   /locus_tag="PAS_chr2-1_0508"
FT                   /product="Transcription factor involved in regulation of
FT                   cell cycle progression from G1 to S phase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69140"
FT                   /db_xref="GOA:C4R0W6"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR003163"
FT                   /db_xref="InterPro:IPR018004"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR029793"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="InterPro:IPR036887"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0W6"
FT                   /protein_id="CAY69140.1"
FT                   /translation="MEDSSKAMVYSATYSGVPVYELVTPLTSVMRRKSDDWINATHILK
FT                   VADFPKAKRTRILERDIQVGTHEKVQGGYGKYQGTWVPLESAVKIAETFDVRDILEPLF
FT                   AYVQRKGSPSPPPAPKHQNASKGSAAKKKLELKKKLSAAAGTVPDEKVKRRGRPPKPKD
FT                   ESGNSTTILDSNIKKAPSQPRLVRRQQSSNPNYYRNQVHQQRNISNLSDLSRRSLNYEQ
FT                   TPLQLLPQVSREGSYLPSTQDTRINLANFDLESSPVPKDLHSDLPDFRSPQGEHNEVEE
FT                   DLSNSESELMSGDDLANALRSPVNKNSAKSQLEQSLISIGKGTEDKPLQTWYKPNSDQD
FT                   YVHMLLEYFLAPDGNYEPKIPYFLSSETIRQASDSSKFDPNLQIDHEGHTALHWACAMG
FT                   DLRMCTALLNYGANTRAWSNIHQVPIMRAVCFTNAYYKRSFAQLLDLLRETLLDCDKDN
FT                   RNLLHLIVSQKLGSSASRYYMELVIAKVSEIQPRERVINFINQQDSNGDTALHIAARNH
FT                   NKRCIRLLISSGAKVDIENDQGESGQTILERNGLLRYDQKSDINGHSQASIHQLSYVSD
FT                   TALKMVQDIKSQFSNKLDELAFSVGNEYVEKQREYEESYKTVKRLEEEYAQLENTISQT
FT                   QSRIMKLIAPDSNTDSPEYTEKQIEIKLESCLREVNERSSFLRQLLERREAKNLAQMIE
FT                   SKEKNIQSSNIEQDKLTDQENLDALIVLTGLQIRRKYLVDELALQYSDSSADPERMNQY
FT                   RKLISLCCEVDFGEVDGLIDEIEEILRTN"
FT   CDS_pept        935281..937140
FT                   /locus_tag="PAS_chr2-1_0509"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69141"
FT                   /db_xref="GOA:C4R0W7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0W7"
FT                   /protein_id="CAY69141.1"
FT                   /translation="MTEGKANEVSLWIPVIGSPEKRLAAIITIPNRESVDDAFLKGFSP
FT                   RTRRLAILMHGLGGHKNYTYHRILAEKLARDLGIFSLRFDFRGCGDSDDSDDANGRVLE
FT                   RDVHDIESVVRFIEQGGYDGINFTLDALVGHSRGALAMFKWTIQHWEKFQKGEKAYNVP
FT                   NLINCGGRFFGKGLWERCLHNHPDFQTTGGFYIDAMRYGVYQKVFISKEEIKSLSAQDM
FT                   SIQFKAHFEPLVNVMSIYGLEDSIIPMQDAAEYGNALGSCHTLKFITGADHNYYGTVKG
FT                   HIHPEYPLNSRGYVNYNYKVTQLILNYLSHTESLHRFYKSTQTLKITPRWKKVEGIHNF
FT                   RSLGGWRIDSNHYVREGLIFRSANTSGVTSKGIEQLRRLGIKAVFDFRSTEEIKNDGRF
FT                   DADQIDWIHVPAFKDVNLSPDALVLRYKSLLTSWATYKDIYSDTIYQGKASFKKVFEFI
FT                   RDNENTPILFHCTVGKDRTGLMAMLILLLVGVDETIIAREYELTTLGLEPLKPHIKEKY
FT                   RHQLKRIIDNLENDKQGREILINQITKGRANFDLENDGFENLVSSRYEAMLDTIEIVNK
FT                   EFGGIQNYMEEHLGFTPDDIKVIKRNLTSTSDSYDIANEISNL"
FT   CDS_pept        complement(937503..938045)
FT                   /locus_tag="PAS_chr2-1_0510"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69142"
FT                   /db_xref="GOA:C4R0W8"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0W8"
FT                   /protein_id="CAY69142.1"
FT                   /translation="MRTRLNLIDLLRVAGGVLLLNCIFSFVFTSSPTWNYSGKYVDPRY
FT                   YKHLITPNIVLTDAQLAVFNGNKQHLPVYVAVNGTIFDVTKNRHLYSKGSSYHRFAGRD
FT                   GSRALGTGCLTNPNEYTWDLRGLTERQLGDIASWHEYYRNHRDYWVAGSVVHNYSELPK
FT                   QAPEPCINGMKFPKNIH"
FT   CDS_pept        complement(938232..940616)
FT                   /locus_tag="PAS_chr2-1_0511"
FT                   /product="Homodimeric Zn2Cys6 zinc finger transcription
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69143"
FT                   /db_xref="GOA:C4R0W9"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0W9"
FT                   /protein_id="CAY69143.1"
FT                   /translation="MSNVEDTYHSSSETPEIKSPTLNGTTSDTKGNLSGSALKRRAVAC
FT                   KSCHSLKVKCVPVDVNDPGGPCIRCEKAKRECKIDVSQLRKKKTKKVDKPSTSTTDLEK
FT                   KVIFLENELRKQKAINSKLGYHPGNTGSIPQVYPINSPQQFGNASVHSDNSSAASQNYI
FT                   PQQQKVYLNPEGAYQDELNLLDDIYNAVDRQKISEVRSLADTRTSYLENRYSKEKYNVI
FT                   KLGILTIEEAEERLHVFNTKLHKKFPFVDIPFFASIDEFMNEQPILFITVMSITSMCVS
FT                   KSVDQKQMYLDQLAIQAITAEILIIGKKTLELLKSLLLLNIWYNTPELFDHRRYHIFNS
FT                   LCEVMVSDLGLTNLASYFFSGEEGIVKKSQRLSENDTIECRALLLMVFSTSVCTSLFLR
FT                   RPIRVVWSEYLEQSCALLESSNESKYRYISLYGRLNHILEKIYHAIHSHEDPISSECSS
FT                   SRIRYTINQVQLELNQIKLKINNDPYLGIYYYSVQAYLYEPELQKFATIHSLVQGSTQL
FT                   PHYVVNSIDLCAQSCFSAIRLFCSLAPEDVAVLPLFYSSRVIYTSGMLLRLRYLTFCIP
FT                   SLSNIGIVPKEYLYEIKRFTEVVVNSAREHPGNVFLGKQVLIIALFLKTSISQVTNWRQ
FT                   MKLSLQMASNVGHQKQEPDQQEPLHERYTPEVTTNQVEQHTEAPNRAYLTSPTTWAPRT
FT                   QSQGYHPGSPLEILSNAAEMHDLNKNYTEETDTNKPTDFQKLFNSNDINSFDQDPSGTQ
FT                   SDKSLEMSYWALSDEFWSDLLVPADLNMAGHVSSEPAPKRL"
FT   CDS_pept        complement(940883..942427)
FT                   /locus_tag="PAS_chr2-1_0512"
FT                   /product="Subunit of DNA primase, which is required for DNA
FT                   synthesis and double-strand break repair"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69144"
FT                   /db_xref="GOA:C4R0X0"
FT                   /db_xref="InterPro:IPR007238"
FT                   /db_xref="InterPro:IPR016558"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0X0"
FT                   /protein_id="CAY69144.1"
FT                   /translation="MFRQTKRRTLGRRNFEDSKGSHIYAGNAGLKSKELLETVYSNRLS
FT                   FYSVPPFEEITLDEFEKWALDRLKVLIEIESSHLRNKTMKELESSIKPILEKHLPLSTN
FT                   TKDVNQLVAERRKDHYSHYILRLAFCRSEDLRNRFVRAESTLFKLRYKMLSSQEQKQFI
FT                   NGLHLPWEAVNEEEKQTHFEQLLAACTVPIRGILSQETNVMVTNDSVRAFCAKEQFLKV
FT                   PFEFIPDLVSSHSIFMHKGFGYVPQFQQLSLIANQFVSQLAESLQITVRSIPKLDEDDR
FT                   LLPVLNHISKGYIANEYQSDFKDGDADVGDINAETVQSKSVSQHYPLCMSQLMKGLSQE
FT                   HHLKYLGRQQLSLFLKGIGLSVDEALKFWSFNFTKGPMNLEQFNKEYRYNFRHNYGLEG
FT                   GRINYKPWDCHQILSKASPSRDEYHGCPYRDLTSEKLTMELNKMGITDQFDVNTIVDNS
FT                   SRGDYTNACTKVFELTHKKEIEIATQKTKFDLSLITHPNLYFDRSRKLAKLAEETS"
FT   CDS_pept        943543..944928
FT                   /locus_tag="PAS_chr2-1_0513"
FT                   /product="Member of the Sir2 family of NAD(+)-dependent
FT                   protein deacetylases"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69145"
FT                   /db_xref="GOA:C4R0X1"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0X1"
FT                   /protein_id="CAY69145.1"
FT                   /translation="MRTLLLDPEDREDKLCLSMINQKVSKSKKMLCLTGAGISCNAGIP
FT                   DFRSNKGLYNLVKQENKGVKSLNKGQDLFDISLFRQEETIQIFNRFMHSLYEHSRQIQP
FT                   TDTHLFIKHLYERKKLIRCYTQNIDGLERKLGLVTDNTNELKWKDLQIVQLHGDLHKLS
FT                   CTNCSNKFSWNLEYETLLHNGESPECPKCLEFYFARLSQGKRLSSINIGILRPNIILYG
FT                   ENNEYSEYLVRGFNQDLNKRPNILLIFGTSLKVNGVQSLVKKIAKNLHEDDSKGIVIYI
FT                   NKTPLNSSWNSIVDFHIQADCDEWVQHLRANFPDLFLTQSQLDLRKNKKKRSIIKEENN
FT                   CTTGDISLTPPVTPTKVKSENARLTNLKPSDNIQEYISLLDDTDQGELTDEDGENSNLL
FT                   PSPMNSMNSMTEQNTNIKQETNPITVQSKRIKPTVGSTRRVLKARNIPRRKNKIPQAET
FT                   IAI"
FT   CDS_pept        complement(945602..947137)
FT                   /locus_tag="PAS_chr2-1_0514"
FT                   /product="Peroxisomal integral membrane peroxin"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69146"
FT                   /db_xref="GOA:C4R0X2"
FT                   /db_xref="InterPro:IPR010482"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0X2"
FT                   /protein_id="CAY69146.1"
FT                   /translation="MVNKSLISTTHPMKDSMNTSESIQDKKWTDYATMADSSTKTMFTE
FT                   LFGLTSDQPKDSSSSSITSNSALMDKFVERIISMALPTAYTDETYQEQLQERLQNQQSR
FT                   PPLSVNIMTKNFIQLNSRLSIPFILIDEVVCIINWKRPYYTLSVLLIASLLILKPTLLT
FT                   VFPMFYILSGIMVPAYLKRHPPEKNQLLESNPIPAYGEPVKDITLPKPVPDLSREFVVN
FT                   LTDLQNRMLLYVITFDFINSINLEFFYFKDDAVSNFVFLALFALATIVFTSVNIIPLEI
FT                   LSFTAKFTLLVGIWGLMVLLHPENLDQFLALLYSEEYRLKLQTMSNKVETRLKNEFSNR
FT                   VDSDQNEIREIEIFELQTLDEDTNEWKLLCYCNDPFAINSTRRDNEKSIKGCLSLQSIM
FT                   PPIGWKFDLQDAPSSSVNPDSSTTSDETDVSRQTNIHGWTLDLSPTGWVHQNYLQGVLS
FT                   IDDDGKWCYDKKDSLSTLKKLSNCYESTGKEYRRRRWIRTCKRDFVLDSTPST"
FT   CDS_pept        947619..948575
FT                   /locus_tag="PAS_chr2-1_0515"
FT                   /product="Kinetochore checkpoint WD40 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69147"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0X3"
FT                   /protein_id="CAY69147.1"
FT                   /translation="MSTQKPVGILTSTNINDAGTPSHVVASKINGDLLLYQIEDMDTPS
FT                   NQITLDTGVLSSCWHPTSNTKAYTGHLDGNILEIDIEKSIANLTNSSHMLGVRKLIFLD
FT                   ENQILSGSWDKSLALTDIRSPLNHKYRVGLPGKVLAMDSSFNGYETVVSMTDRIIHVYD
FT                   KRDFSKPVNVRESGLRYQVRDLKILPNRKGYATCSIEGKASIEYFSEHDLHLNYAFKCH
FT                   RTPQEEADLVSPVNCIQFDEKERLFTGGSDCRICEWDYHQKKRLKQFSKEPWSVLTMSI
FT                   REKYLVYGVSDDGYKNMVSERRQYSVEGSLVGLKILE"
FT   CDS_pept        948873..951542
FT                   /locus_tag="PAS_chr2-1_0516"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69148"
FT                   /db_xref="GOA:C4R0X4"
FT                   /db_xref="InterPro:IPR010308"
FT                   /db_xref="InterPro:IPR040241"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0X4"
FT                   /protein_id="CAY69148.1"
FT                   /translation="MVFFLLFLASTVSAALVQSFNCFGIDPATYKISPMLTSAFFDQDD
FT                   KSLEFQLDGVALEDIDDIDESTNMFTTLRVVVEFTGDTIVDEYVRLCDYVKVEPIVLNI
FT                   SADIGGPSSTVGTTEFTSVPTITATAPAVESSDYVASSSSSDSQWIGVGKRDSASATSV
FT                   PTSSYNFPEEMPYKFKFGVPFSDYAFNGSCPIKKGNPLRLSYKLDAGSSHNFGSYKATF
FT                   YVISPDRSQNLISCRQTYVTTVQPSSLIKGAALLSLLFAIFLAVCNGSILMFSPHQESN
FT                   NPFLLTASAICNSSLLLSISPNVFDFLRYIHFAFFMSGLNIQYPGFFQPIMGSMRMVAL
FT                   IEILTVNSNSELFKLDGVYNTFHRNGILGLFLSVRDRMSEYEWIFFFANFGALYGILIL
FT                   LLTVVTFIAAVYRPNLNPGAKWLKNVLIFFLSTLITLLLHAFVIPFLVLTFYLFSTFSS
FT                   DDTVEYLTSPRAYILALAILIFFAFICLVSFFIFRYALSKSRKQKLYSSFNTMMLWGLL
FT                   YFEYDPRLLFFYIFEVAEVLIFSLAVGVLQGNGTAQVVLILVLEVIYLAALFSIRPYFA
FT                   GSKAYALKLAIVCAKVINIALCIPYIRSLGVSEKRRSEVAYTQLILQLVVIAFLFLLPT
FT                   ILNVIRTLKDLRREHIFKVPDDNDDEYTPDGKVGLLNQKEENYKGSSKLETSAYYRKRR
FT                   ISLNSDVTTIPKLTNPLLTTKHLSTASLSTRSSSSVLELTDKRVLPGVTINPGARNPFN
FT                   KSAELAYRSNKHQKRKREHPIDYSKREADMLYQYLGESSVDPELQQLWDEREERINSSG
FT                   MSTEGKEAKTYRKYHGFWPVNWLGKDSKRKQQDTELQVGQGKFEVRRPRQLKVKNLPVV
FT                   NESSSNEKEKESDSTSLN"
FT   CDS_pept        complement(951648..952586)
FT                   /locus_tag="PAS_chr2-1_0854"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0854"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69149"
FT                   /db_xref="GOA:C4R0X5"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="InterPro:IPR040062"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0X5"
FT                   /protein_id="CAY69149.1"
FT                   /translation="MLLESNLNQDNSRNSTISNPLTHYVCPLLKNESFKQTFSAFNGGL
FT                   AQTLIGQPLDLCKVLIQTGQFKSPIAAARSVVKNEGVLGLYKGSLVPLLGVGVINAIMF
FT                   NFCFEARRLILKHSETGALTLSQIYLSGTIAGGLTSFINTPVEGIRILLQAQPHGIKLF
FT                   NGPSHCIAQIWKQAGLSGLFRGLGLTFARDTHAHGVWFLTYEYLIERSCGLRKCKREDI
FT                   PLWELLVYGAIAGDLLWLSVYPIDVVKTIRQNDQFGLQAKFHNTKEVVMYVYKTSGWKG
FT                   FWSGLTSSLLRAAPVNAGVFCTVELCLRNLG"
FT   CDS_pept        complement(952808..954424)
FT                   /locus_tag="PAS_chr2-1_0517"
FT                   /product="Nuclear protein that contains a SET-domain"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69150"
FT                   /db_xref="GOA:C4R0X6"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR011383"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0X6"
FT                   /protein_id="CAY69150.1"
FT                   /translation="MTDNFQTITEAYKKWLEANLELAGNVKIEDLRDQNEGRGVVATRD
FT                   INEDEVLFSISKDNVLNIQTSSLANVKDNNGVILKRLNHWEGLILCLAYERSLGELSRW
FT                   KGYLDTLPTSFNNLIFWNEQDLNSLKPSLILDRIGSAEAEAMYDKLFPKVVAELGVSEE
FT                   LKDVNLKEFHKIASTIMSYSFDVEGEGDDQDEEEGEEGEEEGEDAEQEEEEKENHDNYN
FT                   EAEDENTEKNQSENESESGDEAFEFDDHILKSMVPFADTLNADTNLCNANLTYQSENLV
FT                   MKAIKPIKKGEQVYNTYGNHPNSEILRRYGYVEWTGSKFDFGEIRLSLIENYFISTYSV
FT                   EKESLKLIVKIIADSEYLLHLTGEDGSIVVESYDFYKDGEILPEFLMLVTLLTSICLCK
FT                   AEDLKWFKKTIRISKRNPTGSELSRFINRTSKKCYQLLEQNIITESVKENIGRILDLRL
FT                   KEYPDEIKELVGQELVVPKKKNREAMAETVLVCEYKALWACKDEGLKSFKVIQDEKLIK
FT                   NIMKRKLEEEEGSKRNKRIKG"
FT   CDS_pept        954655..956373
FT                   /locus_tag="PAS_chr2-1_0518"
FT                   /product="Hsp90 cochaperone, interacts with the Ssa group
FT                   of the cytosolic Hsp70 chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69151"
FT                   /db_xref="GOA:C4R0X7"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0X7"
FT                   /protein_id="CAY69151.1"
FT                   /translation="MSSEEFKAQGNQAFQAKDYEKAVSFFTQAIEASPTPNHILFSNRS
FT                   AAYASLGQYQDALDDANKCVEINGSWAKGYNRVGAAHYGRGEWDEAHKAYSKALELDPA
FT                   NKMAKEGLNETEIARDAGNDVKNIFSDAGMVEKLKKNPKTAELMKDPELVAKVQKLQTD
FT                   PKSMSQELFSDPRLMTVMGAMLGVDLGVQPSQQSAPQEDTPVPDAYPEPSSKPETNTTS
FT                   AKNAAAPEPEKEATPEPVDNSKEEADNLKQQANQLYKKRQFDEAIELYNKAWETFQDIT
FT                   YLNNRAAAEFEKGDYDATIETCENAVEKGRELRADYKLVAKSFARLGSAYLKKDDLPNA
FT                   IKFFEKSLTEHRSPDVLSKLRAAEADLKKKEAEEYIDPEKAEEARLQGKDFFTKGDWPA
FT                   AVKAYTEMINRAPKDARGYSNRAAALAKLMSFPDAVKDCDKAIELDPSFVRAYIRKATA
FT                   LIAMKDFNKAMTTLEEARTVDADTNEGKAANEINGLYYKASSQRFAAIDGETPEQTFER
FT                   ASKDPEVSAILQDPVMNSILQQARENPAALQEHMKNPEVAKKINILIAAGVIRTR"
FT   CDS_pept        complement(956434..958623)
FT                   /locus_tag="PAS_chr2-1_0519"
FT                   /product="AMP-activated serine/threonine protein kinase
FT                   found in a complex containing Snf4p and members of the"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69152"
FT                   /db_xref="GOA:C4R0X8"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0X8"
FT                   /protein_id="CAY69152.1"
FT                   /translation="MSSLVPNQDNRAITIKVPQRLDLQKFKSTTDIPRPPTEHKVIDDV
FT                   SESLYKKVKLRLGSEQLLHSTVPTAYYEPLETQKEKSPSSQQSKHHRAAIRSVIKKTDH
FT                   KSSNSNEKFRTRVSFDTVNLQYSDANAIDARSDDEDEYNYISTARNAQLLGGWTDTLDS
FT                   SRRGRSLSKASTGGRTSSPLAMSPTHSPMRSPQRRIHSPAPLSRGGPGLFGGFRRDYPT
FT                   SPIIEHDSCTLTKIHKDWELLYAGKLPNKKPALPNRVILVYASGRRHTWVAIDWCLRSL
FT                   LQDGDEIVIAAAVNPDHHIPNKLHKRHNVSKTGPQYIKVVTGNLMKYIISVVNPRKIVK
FT                   ISVELAVGSTKEVLRDMLQLYQPNLAVISALPNKNSALRSWKSSRLTDRMVKNYPIPTI
FT                   IVPAANMDDFENILFENLNRIYDEKAKHNVKEVDLEDEFYDIQLPTSQQFELALKNIRQ
FT                   RDLRELKDVDTASVSGKLEDGVEKKESTESSEDTNEEDLDYDNEEPQEYDGPRTGRTRS
FT                   RNEPHATRMVRPKSENHSSDSDSIYSNSSLEETTNIEHMRAVVYQTEANLVEQLYEIRK
FT                   KPLNKDTFKELLATVSTAGYKIGKEMAETARMGGEGAELVRTVTGAPSVGSSAYHTKSM
FT                   LLDVSPKTSNSATVAKQNQCPSPPVFKIGSNSSSNHSQMPIITKNGPSSIYSSEDKTAE
FT                   GSSKGHWSNRSESGAEGSTDKKKSRRFSIRRLWGK"
FT   CDS_pept        complement(958970..960613)
FT                   /locus_tag="PAS_chr2-1_0855"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0855"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69153"
FT                   /db_xref="GOA:C4R0X9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013896"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR028375"
FT                   /db_xref="InterPro:IPR032270"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0X9"
FT                   /protein_id="CAY69153.1"
FT                   /translation="MAAEQSKEPAQRIGKYQIVKTLGEGSFGKVKLAYHISTGQRVALK
FT                   IINRKVLAKSDMQGRVEREISYLRLLRHPHIIKLYDVIKSKEEIIMVIEYAGKELFDYI
FT                   VQRGKMEENEARRFFQQIIAAVDYCHRHKIVHRDLKPENLLLDDQLNVKIADFGLSNIM
FT                   TDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCGRLPFDDDFIPELF
FT                   RKISNGVYTLPSFLNESAKNLLTKMLVVNPLNRITIREIMEDEWFKIEFPDYLNPENLL
FT                   PKPKDVPVDDDVIHALSVAMGYDKQEILDAIRTGRKPDETNEVFDAYELMKENKTLVDD
FT                   IKSQNVEKSDSMDKIVSQGSAVTYHALNPSPEHMPTNSTIAILPSSLPQIHRAYMINKA
FT                   DKNNQPLNKINPVSTKKSKTRWHFGIRSRSYPLDVMGEIYLALKNLGAEWIKPSEEELW
FT                   TIKVRWKYKPNADEQQNVKVTPDLMKMQIQLFQLEPNNYLVDFKFDGWENSDESTAEFK
FT                   DDDDISSFSAYPFLHLATRLIMELAVNSQG"
FT   CDS_pept        960837..962228
FT                   /locus_tag="PAS_chr2-1_0520"
FT                   /product="Mitochondrial 3-oxoacyl-[acyl-carrier-protein]
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69154"
FT                   /db_xref="InterPro:IPR015158"
FT                   /db_xref="InterPro:IPR037393"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0Y0"
FT                   /protein_id="CAY69154.1"
FT                   /translation="MVKQDNISWKLDILEVMFLRTKPRYLKTTLFLNARNQKKVSSVLD
FT                   VRKFNKNSAINQISKYKSELSERKIHSAKVKMQRNLKKVIKSETSKCQAKLKTSPDDAK
FT                   QQERLQILQDIDLDDIINRKLIRILINVFTPTEELQEFPPTYLPTWVIDSIKDKNSKYN
FT                   PNNTTKGDSQAKINIVSQLMNNKELREILSTIDLTLRLVEGPVERPDQIKEKREKREKK
FT                   KSDDKDTATTIKKSEKNSSYSDNEAEDQDQDEDSDHSDLDDINFSKYDGALAASSDEDS
FT                   DDEPATQKKDTSRSLVEDDFFDFSVAELKQREKADAKKKEQKLEKEYNLPQLTSGYFSG
FT                   GESDGDYDNDKVVQEATKPRKNRRGQRARQKIWEAKYGRNANHVLKEHDRIRSEREQKQ
FT                   AEYEERVRKRAAKAAELRERQASMPPPKIQKVASKGLHPSWEAKKNLEKKQKNIPFQGK
FT                   KVTFD"
FT   CDS_pept        962329..963066
FT                   /locus_tag="PAS_chr2-1_0856"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0856"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69155"
FT                   /db_xref="GOA:C4R0Y1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0Y1"
FT                   /protein_id="CAY69155.1"
FT                   /translation="MSLIGKKAIVTGGSRGLGLNIAKKLSKLGCNVALLARSEDVMRKE
FT                   ALPQLTTKFDGQKHNCYKVDLSDRNELSQLHQLSVFKEKIDILINCAGITHNKLLIQTD
FT                   PDEIDNIITTNLTSSIVLSKLVARKMLSQKSGHIISISSALAKKPISGTVVYTATKQAL
FT                   IGLTKSLAVELGGKGIQCNAVLPGFLKDTLIGQSVNESLFKELLTNGHKLQLDDISDAV
FT                   VFLLNDKTMTGQCLTLDKGFSLI"
FT   CDS_pept        complement(963096..964544)
FT                   /locus_tag="PAS_chr2-1_0521"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69156"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0Y2"
FT                   /protein_id="CAY69156.1"
FT                   /translation="MGHTQMWSETKCNRVSRPFTSTILHLRGIYLFSNIDESKSIDDIE
FT                   TLWYRNKSDPDDPDQDYDPQGNEFTDLDSSKVKFQSLLSLSPEMQLEFKSSFRKICLFF
FT                   DTVYYQEPSRLQHLTSIKMGKNMLVRHIQNNLKYQNSKKRNFDELECSSGSDTESECDE
FT                   GSDKSDKLKFGNLLYVNSAISALYNRWILLGFGLEFMADNINHLVPILWHVLDYFVERK
FT                   MLYAARWLFKAALKNIDSFVFWKLFNHFRDFLPSVHFCNESILYNSCVNKLNSLSDLYY
FT                   FMENRCWTVIESKPVYMEIIFQTVNVVLRDLKRIGFSQNILSNMLDDFFKMYGTVDAPT
FT                   FLNGVYVILIIHKYHKVANSNQYEALKAISKSLKLNSARDETHYGKIYIHNKTMFRWLS
FT                   LNIQLFNDIIPSLDSRSLLEIKKYLAMRPEEYAHMLTEIRFILDTRTAKQIKNVKSKIK
FT                   SPVRPNPNQTRFRDNICLLRSSEI"
FT   CDS_pept        964758..965261
FT                   /locus_tag="PAS_chr2-1_0522"
FT                   /product="Protein that associates with ribosomes"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69157"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR011323"
FT                   /db_xref="InterPro:IPR018103"
FT                   /db_xref="InterPro:IPR018105"
FT                   /db_xref="InterPro:IPR034737"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0Y3"
FT                   /protein_id="CAY69157.1"
FT                   /translation="MIIYKDIISGDELLSDAYDVKEVGGVVYEADCQMVTVGSGDVDIG
FT                   ANPSAEEGGEDLEDGAQTVNNVVYSFRLAETQFDKKSFMVYIKGYMKRIRAHLTENAPD
FT                   QVEAFEKGASAYAKKILSSFGDWDFYTGESMDPDGMIVLLNYREDGVTPYVSIWKHGVK
FT                   EEKI"
FT   CDS_pept        complement(965303..966538)
FT                   /locus_tag="PAS_chr2-1_0523"
FT                   /product="2'-O-methyltransferase responsible for
FT                   modification of tRNA at position 4"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69158"
FT                   /db_xref="GOA:C4R0Y4"
FT                   /db_xref="InterPro:IPR007871"
FT                   /db_xref="InterPro:IPR021721"
FT                   /db_xref="InterPro:IPR022776"
FT                   /db_xref="InterPro:IPR039044"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0Y4"
FT                   /protein_id="CAY69158.1"
FT                   /translation="MTEEDSGKKRKRKNEERPQCQFFLVNKKRNCAMTRKIDQKFCAEH
FT                   MSLEDANNQRIPCPLDNSHFVWKHKLAKHIKKCKVQKKEVNLDPWFVHDINGKVESQKE
FT                   RSFDEGELSQFLQEFLSSYDKMQFPELETKEYTDSSIMIQQRLDLLTNKKHIIQQSSLI
FT                   QHLEKNGLLGPKYRYMEFGCGRAELSRYIGQSVFDKDKSYPSFTLIDRTRPRLKMDSKI
FT                   QKDFQELTKNEHSNVDCQRIKIDIKDLALCRLDSVNDPFIVVSKHLCGVATDLTLQCLE
FT                   NYEKTVSDSKLAGCLIALCCRHCCHYDNLLSGSKKFLSSNFDISEKQFNFLTKICSWAT
FT                   NGKRPEVSDQDGKDHVSGYSLAERKIIGLKARRTIDEARRASITNYTTYLFHYVSEETS
FT                   LENTCLLLLKKS"
FT   CDS_pept        complement(968187..968456)
FT                   /locus_tag="PAS_chr2-1_0858"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0858"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69159"
FT                   /db_xref="GOA:C4R0Y5"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0Y5"
FT                   /protein_id="CAY69159.1"
FT                   /translation="MISLVSRAAVRSSNAIRCYSTEVAPRKTSSLKGGLFGFLLGTTIT
FT                   GVAGYYYLLNEYKNSSDLVLSDVLALQKSIRNLETQVRVLESKK"
FT   CDS_pept        complement(968612..970174)
FT                   /locus_tag="PAS_chr2-1_0526"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69160"
FT                   /db_xref="GOA:C4R0Y6"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0Y6"
FT                   /protein_id="CAY69160.1"
FT                   /translation="MFYFQVPRNKRLAQVSCAILWCLFSGGPIFGFAALKPVLVQQHIY
FT                   EDICPLTNSTTSLIDTIAQSSGSISVQQGKLGLAKCTEQDLKLNMMFTVGAVLTNLTAL
FT                   IIGRTLDSYGPRVCGLLGACFLFISCSIFIYSDSITLFDPYLFGYGFMALGGPFAYISS
FT                   FQLSNAFPKKSGSVLALLTGAFDASSAVFLFYQLSFLKDPAFTIQNFFKLYLVVPTFIT
FT                   LAQIFVMEGDSYLTPPAAIMSGRSAPPPTETTTLLPVRQSVANELEAVGSKFQRKDSLG
FT                   DAMKTAYAEEAEEEARKQTNSVFGILHGFPSQYQFRTYWFLLMCLFSTIQMLRLNYFVA
FT                   TVHSQYAYLFNSPELAEKLNSIFDIALPLGGVLSIPFVGLFLDHCPTIVVLTALLVVSL
FT                   IIGVLGLVGSFPLGVLNVLIFAAYRPFFYTTISDYCAKVFGFETFGTVYGAIMTISGMF
FT                   NFGQKFLDQATHTTFKMNPVPLNIILVLVTLVIGGITCLYVQVQGRIYNQKKHQHQDNA
FT                   TLT"
FT   CDS_pept        complement(970548..971453)
FT                   /locus_tag="PAS_chr2-1_0527"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69161"
FT                   /db_xref="GOA:C4R0Y7"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0Y7"
FT                   /protein_id="CAY69161.1"
FT                   /translation="MSSSWWQFFRRWFESYSQLDVIVMGLANSGKTSFVNAVIGKPFSR
FT                   NSIPTFSAITTTIYKHINNSNYKLKLIDLGGQKRLLRAEWLKYYRSADSIKPSFCCHNI
FT                   TPFNKDIQALVFVIDVSDKFSLPAARKLFREVLFDTEADQTPMVVIGNKIDEVTENSTF
FT                   LGVKLSDIQASQSSTKNRNFLGKFYSNRDQIPDYLADAQPESSGFSIRSSRSISSLRKQ
FT                   LYGRINIFAEFLGLELHPDMSISVKLDESTATTTNASESLQPLTRELDRDFAIFLTSIK
FT                   EGDDIPDIIDWILGEMDSRP"
FT   CDS_pept        971587..972120
FT                   /locus_tag="PAS_chr2-1_0528"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69162"
FT                   /db_xref="GOA:C4R0Y8"
FT                   /db_xref="InterPro:IPR002483"
FT                   /db_xref="InterPro:IPR036483"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0Y8"
FT                   /protein_id="CAY69162.1"
FT                   /translation="MSVVPISQEAANKKKQKKIDDVKFPKIFKKSVDLKMVDLEVINSW
FT                   VKGTIEKLLGTDDDIVINFINEMLVDELDIKEIYLQLKGFLEDQTLPFCTELWELLLEA
FT                   QESRDGIPEKLKKNHNRIVNANRPRSGRYTDRRVRSDSRYRRHYREDGETRARVGDTKR
FT                   NERSHRDYSPSRRS"
FT   CDS_pept        979847..980890
FT                   /locus_tag="PAS_chr2-1_0530"
FT                   /product="Ornithine transporter of the mitochondrial inner
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0530"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69163"
FT                   /db_xref="GOA:C4R0Y9"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="InterPro:IPR040062"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0Y9"
FT                   /protein_id="CAY69163.1"
FT                   /translation="MSALTGRPMAPITGEVNDQHKVLFHLPSAIASQKPMLMSYTASIL
FT                   STTVGFPLDSLKTRMQTHSFNSAFQCFLYTIKSEGYRGLFRGIAAPLVSTSFSKSLGVS
FT                   IYIFFKTPVTEIRDRYLAYTKLKVDEYPQRNSILNNIPTSLFAGFLSGSLVSLFACPFE
FT                   FTKLFSQIQILVTKSTASAHNSAQAAPKSTLRVARDIVATDGLKGLYSGYRYHLMRDST
FT                   STALFFTIYETFKMALGAISPDDGYVQGSSIPSAPIVIIISGALSGVFTWATVFPIDTV
FT                   KAMYQKDIVANILRKRNGEERLPLKKVKIQLFNRRMYRGLGPSVTRSIIGTVVFFSAFE
FT                   YLMANVA"
FT   CDS_pept        complement(981012..986672)
FT                   /locus_tag="PAS_chr2-1_0531"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0531"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69164"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0Z0"
FT                   /protein_id="CAY69164.1"
FT                   /translation="MDSKTNSEKKRKEKASTVNSLHKLPGHLPQLPSLSFSLNDSIISK
FT                   SSYLRKLTDLPTKKHTHLLTNGDKNEDELVSWMKSITVEAKNSLLETQTEEKQMIRQLQ
FT                   SERERLNQHVQVNDSEFEKLGQLLASAKRNKDTLSAQSESSFVEEEEQTPIVDQSQWQD
FT                   EEVPELEEDDEFKEPQNEESDLGSDLEIIEVDDGPSSEDNEDEQEFSDGPRSDQELEYE
FT                   SSENENDLKDNPVESSTSTHLEYDESEVTYALTSLLNESAEYAEPTEKIARIQSEEPEE
FT                   SENNDDSDARFPELADSTVGQTQIQPFNSQIHHDSQEEESPFVEYEALETQDSEEEEEQ
FT                   GQEEGEEEEKEEEIQELQGLQEQGNEQSEEEDEDQDTQSDLSEDKDDIPEANYRYSSSS
FT                   IYGFMQPRAETSQSIVNVSSPHENTHSENNTSDESSSPSHDTNYFTANNNTTEYLTHQK
FT                   EDEETTTQVDTDLNILDSTNIQGIAEFMINMNQELLNQSESRGKVEEDKIDSESDAGEE
FT                   NSQEYRSNSESANKPSATDKEPPSTIAQQRPTMFDSSSDSETEAGVAPPVFVPSVLEML
FT                   SSSLKAHNEQPALSHLSLEHESNKVESTSTQESKSNADIGDACRNLDGAVTVEAEIDQS
FT                   MGEMEDIEPAHFVEDLKATSSPIDQEGSNLNSLSSQPSAENSYSEANASFVLEGESSND
FT                   SNKSESPAQHLHISPADNPEDRNSTDRYEELLKSQAEIENKSPHEVCEVSKSTTIDHPV
FT                   SDEDENLTPIIDSNIDNLPTLPASSPNVEDMESLDEQVATNIHSSSSSEFHTANALADA
FT                   TADHSLTLQNENYQKDFEESVKHQELQNIEYQGYQELEEHEELEEPEIQPNINDNSFTV
FT                   RDQHYKNEHSKHEQVAPNLQNNLQSKGAEDAHIKVASEEKQDLQTTAQQLEDTNSHFPE
FT                   DFNGEPSISEMRDISSTQALTNVNLEGLQPNSVTDEKDELPLDTGVSKVKSVLQSLQFV
FT                   EQIIEEAVEYDLFPFDEDENVRLDENNETKTEPEKVETTCGANNEQDVVSTIASIARNS
FT                   DRSSTFCEEEDTAFESAIYQNESFAEAQNEESVTAANLNGLGPLYHQSSNIPGEFSENI
FT                   TIDRKSEEDGAVSDEPDKREEENDSNDSESLEITSVARNQGSLMAKQSSAEDKEQKDVL
FT                   AFSVASRAGSDHNDSQVDASVSDIDDPNKNSKFNETSADETVHSDSTFIRDTEAFKNEL
FT                   SLGNSIFSRLREVPEKLFTVLKSVDVSDAVLDNSEEPLMQISVDQTKSGIDEGEDALET
FT                   PVQSDEEDEVVSAAIALTSDVIPNSSPGSSNESSSNGVVGDKNSNEIPPDSMNELAASS
FT                   ESEPASESNIQTKPESQEEIDLQDLQHSSITDSVQPPNVEERVNYEESALFPTKGANSL
FT                   DQTIESASSPRKHKLEELSERPKLKVLKSLFTQLFKRDSPNQEPSEPVSVASNDTKESI
FT                   HNDYKTETLVVKREETEIFSPISEDDDQSLRSTNTTLENDPATSIAETDHMNDINQNTE
FT                   EASEDSGERRSRSRSRKPLYVSTSSSRPNQRIPSTSRVTRSSAKPPAERTRSKSPVLCS
FT                   PYSPDTRRVSGRLLQTNAASKQSPVESSNDGWSSPNNPNKLSTVHHPGPEKEKEEQSIS
FT                   AGEISTVSEGKPEPFDNFELLVAKKSKASSPHSLKKESKSKEQAENQVTPVTSPKVQLS
FT                   TPKIATPGLGSPDHSYMRTRSGKFIGANTVEELQEAHNEEVFQNNLISEIASGKIHISK
FT                   VLTDISKEMLYETADDEKKHLEADKALFGGDLNTLRPTQDLAQEPKSEKNQALIHGTDS
FT                   VGGSKIQKGRISKKATPKRQSETLKMRGRGDEMIRARGALVRGRPRGRGRGRGRGRGRG
FT                   RGQAKGDSQSNE"
FT   CDS_pept        986887..990498
FT                   /locus_tag="PAS_chr2-1_0532"
FT                   /product="One of 10 subunits of the transport protein
FT                   particle (TRAPP) complex of the cis-Golgi"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69165"
FT                   /db_xref="InterPro:IPR022233"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0Z1"
FT                   /protein_id="CAY69165.1"
FT                   /translation="MDCKIKIGVYDPLGCSEHWEEMLMSKQPLTNLHWKLGPQSVLKSL
FT                   PPLHLDIVKEVPISIKNINPSTIQEDNDQYFHSVLLETKNTASVPVKIMIVGSDSLDDY
FT                   RSRIRPLVKEWLKAEVHSKIIKPKWQIVFYIDASTKDRTSIFQKLKTDFGGDIEETVER
FT                   CIKLKEKYATKQEETESWTSFVSGLKDMILQHFTFKLQFLEGILQKINLKRNLANPIYP
FT                   LAFRQLIATTYKDMSLFNDSLASYEILRKNFENLLAKKEFVCENNVEWAQDIDGFFSKY
FT                   QELNLIDELLKKTVTKYTFHTSVFLQEFDLYLQLIKLPATLTSSKARLTTEMFKRFKSF
FT                   MTTILAISSESEELQNYEMVYRLIDIFLSHPEILSLTELAFKHINTDDVQDLSDFPQVI
FT                   ELCGELRLYQRTNFKKLGEAFNYHVADIPLRDVHPTNYKIRSAVLKQFFSSEESFQNHF
FT                   IELTELTIQHFIDCNNRRRTADTLTTELAIMAYEKGDYEKTRTIIHDAIYYFKEQGWNF
FT                   VSGYALKVYIDCLHKTNEKDSLLFLGSYLQLFATNSLAPSQADQCVKEVKKRIDNVPET
FT                   EYDLTNFCSVSVGTNQIVNTVDTYSIEITLYNTVQSENERLVFDKMSLHLESNDGKKRL
FT                   AFEIDSVELKNDKILLTSRQIINDEFVVKKLICYMGKLKFVKSFSDWFSTSRILLYQQL
FT                   TTNDLQTKNTILSVDLPTTRELNMERILVNCYTGDQDIQNLVFDFTETEIDQTLEGMKL
FT                   VHNGEEVSFELLEIAGSLLKPIRLNGTIKRNSHLELFIPYSRVEYDTKVLFNVTCRYES
FT                   TEGFEFSNSYQRNLNISLSIAVSVQDLFKDRFLYSNFTIGTSTQDKYLIISDTKFYSPD
FT                   SKTETDATFRITTGYIPDSILASYEQRVSVFYILEPFENCSVQNLCLKVTYRSIELECR
FT                   KYSRARLTQILTEEKLLNYFFLVESICDDLEFDELTYYNKKIVKSKSVPQWQDQLMAEF
FT                   QNKDKNLFRAVNHFLDILAHGIYADDHSVVSMELFIDVPMPSIDILHVVDFEPIEQNVQ
FT                   DFRVEEPIQFALKLKTDTRWSDMDFGKQESCSELSNDDKETVDKTTGEEKKVELNRNIN
FT                   KKYCFSLEVQDSDTWLISGITTFTYEVDFSRGKNITTFDEMRFVLIPLKTGQLLLPKVE
FT                   IKHGDPGESLRYEVDYKNGSESILVVSASKNATTVSF"
FT   CDS_pept        complement(990518..991315)
FT                   /locus_tag="PAS_chr2-1_0533"
FT                   /product="Uroporphyrinogen III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69166"
FT                   /db_xref="GOA:C4R0Z2"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0Z2"
FT                   /protein_id="CAY69166.1"
FT                   /translation="MPKAILLKNKTTPKDPYLENFVSSGYSTDFVPLLDHIHMEKSEII
FT                   AFLKTDYFLHKTLAFIITSQRAVEMLNECMQILRRTDPEITQIIYSKPVYTVGPATYRI
FT                   LADAGFVDLRGGDKAGNGSILAQIILNDDIYTGIEDSDKHITFFTGETRRDIIPKCLLS
FT                   NNFQLYEKIVYKTLPRDDIVTRFKSAVDSIDQSQRSSSWVVFFSPQGTEDIVTYLQHTK
FT                   DQFNIASIGPTTEKYLLSKNLKPKVVAPKPEPISLLLSIQKVH"
FT   CDS_pept        991707..996299
FT                   /locus_tag="PAS_chr2-1_0534"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0534"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69167"
FT                   /db_xref="GOA:C4R0Z3"
FT                   /db_xref="InterPro:IPR000331"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018515"
FT                   /db_xref="InterPro:IPR024584"
FT                   /db_xref="InterPro:IPR027107"
FT                   /db_xref="InterPro:IPR035974"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0Z3"
FT                   /protein_id="CAY69167.1"
FT                   /translation="MHSLKHDPPEPSTGFGHVLKSFTKSFKSSTSTSGKKSVQINPLTI
FT                   GGDPTQRGLLEKVSQGSTQSRTEHLFKLYESIGSYSVSSIPEIWYLVKDLLGSNNPDDT
FT                   RVAALNMLILCIKLDESAISSTIMYYDDILRYCTFTPSGLDRHFNLFLKALTTLTINGT
FT                   DIHLLATYEKKPLGKFLSQAMAIVESSLRSASHKNESTENIDETLCQILVYITDCIKFN
FT                   SNSFESFEIIHFLSQVITFTKITTNTSILERCLFFIETLSLYGVFPMDQLTSVISTLAT
FT                   VYTSEEEEFQELRHKVIRILDTLIQNSQTTIPTIFAICELIHQTHFVSEVNENVIVGCL
FT                   EFLKLLIMQEIDGRALNKHRNDRLNMFLDTSMSHLLESWEKSSEIPSLVVKVALLNFFL
FT                   EILNTSSDYYKIFGSMFWFNSDSSLWRCFDNLVNFSYDEDDDDADDYYRLVSSLLSVLQ
FT                   RLSETGKVLGMKDNCMNFFNNSFRRLSDSHATTVIEYYEKNLLCYEFNVDWEKNSVDIL
FT                   QRYFINKNLSLTTRLKAFMVVKDACTYTIQLKTENTFVSTYLYILFLKFEDDVSASDEK
FT                   LKERIIDCCIDLCREIDYDSFKELISNLTQRFEDTRDVRRRSITSLYSYTSGSQMSRFA
FT                   NPRLSDTASNEKSVYRSSKSIAMLIGKLFMVSTIKYRDNDKVLLLYDSLVKMATFGIKM
FT                   KFYSTTLIILKVLIRVRSTTTYDLYFANPIETDGLADAMHRNVSTDPSISESKSLKWVY
FT                   PESDKLHYIPFDCLDKCVTCSKTSVSKDTSFVDVRKWFQIVLDILTNFYDWELYSYVLA
FT                   HFCAQLSNLYLFDDSTKFVQDFRKVITDQLELKLPSSLNPPENVAKTDIQIASIRVLSA
FT                   LVAYHSCFSKQDQDQLVAALIHGLSSWEKTAIPCLHSLVICCYELPRSLKRYLSSILTA
FT                   LQTRISSTFAIAHILEFLMALCQLPKMSSEFSLLEFKRVFGVAFKFIEYAKDKFSNSDY
FT                   SDESQPNQGGYAKYGQEIEFDKLPSTKSTAVTPQLLQYIMALSYNVITSWFLVIPLKER
FT                   KFLSPFLIRNLLSSSVKSEDSDVSDEALATIDFVSRYTYSNMDLTWTGDKQDQKSTSDS
FT                   DEEELFREASWISGISILTIKTNKVTGDSTITVRKPIGTSEFSVSVQGQLPANIYKDDE
FT                   ENENLPKPANYTPNFLLLQFMHPLGTRVCNKPLPLSNDDSVKRSVDLFDKVPVVTALKA
FT                   GIIYIGKGQSTEQQVLSNLLGSDGYHKFITEIGDVIKLKDSQPFYVGGLDTTNDIDGEF
FT                   AISWGNQITRLIFHTTTLMPNNEDDPQCSMKKRHIGNNFVNIFYNDSESPFDFNLIKSQ
FT                   FNFINIVIQPHSRNLHKYESNHSENFYKIKMYRRAGLPGVFSTSHFKLISVSELPAFVR
FT                   NTTIIASLFANVWNADGGYISNWAHRVSRITTIRDKSVVYHENLKEEQGENGSDWLENS
FT                   QSRSHSNTVVAQSFLDQLSQLDISMVPSVPNSAASAEDKDEKKKRFKFQYVHENDSELY
FT                   ERMEFNSFTT"
FT   CDS_pept        complement(996347..998626)
FT                   /locus_tag="PAS_chr2-1_0535"
FT                   /product="Protein of the mitochondrial outer surface"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0535"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69168"
FT                   /db_xref="GOA:C4R0Z4"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033133"
FT                   /db_xref="InterPro:IPR033712"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0Z4"
FT                   /protein_id="CAY69168.1"
FT                   /translation="MSVDENISLNPWDNKSAGAFSKKSVPSISPFDMAPSLNGNTLGSN
FT                   FFNSTSSIGANNIPKGSAVVSDTESDVFAESPLVGLNKGALSAISAPLGTYNNNNKSNG
FT                   FPNQLFGAASVSGGQFSSYANGTGASAAGSNFLEKFGSLTEKTREVEFNMKSLAIGTNT
FT                   AKKSGSRRTSFLVNEPSNPSGSRHQSFSEKIDSYLSSPHAHRLSISSDHTPSITEQEKT
FT                   HNTIWNPAGATSFHPSNTFQPRQYPPVFNPVPFPYSPYMFQPMSPFPPMNEVESEKTKD
FT                   GIQPSATVLKHPKPTSGEGSSVLTDEPEQNFNNDDRNCAPISPFVMPPFSPYGMMPSVS
FT                   FDATSPPIPMLPEGMSGQVPSPFPQHSAPPKFPAAANNSGSKPPAKNGRASKNRPRAQH
FT                   IYRSPLLEEFRSNKAGKDYRLRDIYGHGPEFARDQHGSRFIQQQLSKATKEEKDTIFEE
FT                   IEPTSYELMTDVFGNYVIQKYFEHGSEEQKARLLKIMTGKVQSLSLQMYGCRVVQRALE
FT                   FVQLEQQIEIASELQDNVLQLVEDQNGNHVIQKSIEKISFDQISFILESLRQHIYHLST
FT                   HPYGCRVIQRLLEYCSESEQKFILEVLSNHIFYLIQDQYGNYVIQHILEFGEEGYRSTI
FT                   TEIVTKNLVMFSKHKFASNAVEKCIIYGNKEHRHMLFNELLKDNKSLEVTTVDDNSALA
FT                   LMMKDPFANYVVQKMVDALDEDDKKLLIIKIKQYLKQISKSSYAKHLASIEKLILLSET
FT                   ALKGIA"
FT   CDS_pept        complement(999138..999566)
FT                   /locus_tag="PAS_chr2-1_0536"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69169"
FT                   /db_xref="GOA:C4R0Z5"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0Z5"
FT                   /protein_id="CAY69169.1"
FT                   /translation="MCCCDCLLVIIAVFFPPFPVWVKRGLCSADSVINILLCILGYLPG
FT                   LLHSWYIISRYPEAYYVDLDPELGQAGVIYVNPPVERAISPTTVDRPSSRQQCLHQGSN
FT                   GGFNPHYGATYIPTPAESPPSYDRALEERTEGSSSGKN"
FT   CDS_pept        999949..1002381
FT                   /locus_tag="PAS_chr2-1_0537"
FT                   /product="Gamma-adaptin, large subunit of the
FT                   clathrin-associated protein (AP-1) complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0537"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69170"
FT                   /db_xref="GOA:C4R0Z6"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR008153"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017107"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0Z6"
FT                   /protein_id="CAY69170.1"
FT                   /translation="MAGGLKKFIKSVRNSKTIAEERAVIRKESAKIRTSFRNVQLDDQT
FT                   RKKNIQKLLYLYIMGEPTHFGQVECLKLVATPQFSNKRLGYLATMLLLDENQEVITLIT
FT                   NSLDNDINSTNQYIVSSALTTLGNIASPDMARDLYTVVEAHLDGNNAYLRKKAAIVAAK
FT                   LIEKEPDLVEVFLPKVESLLDDKNHAVLLGGLQLARVIHETDSTSHSTLSEFVPKLLYH
FT                   LKMLVTTGYSPEYDVGGVPDPFLCVSLLQTLTMLFESDHNCPHVEAYHDLLTQIASKID
FT                   TGKNSGNVVLYEAVRSIFRINPDSSLKILGVNILAKFLKSKDNNTRYVALNTLLSVLEL
FT                   EPQAVQRHRATIVACLQDGDISIRRRALELTFAIINKQNIRLLAKELLTFLQNSDTDLK
FT                   PYVTTQFTLVAEQYAPNEKWFFENLITMLKYAGNYISPDVSSNIIGLTIQIKDRELIKF
FT                   ITAELFKASVEDQTQYGLNLITTWCVGEYGDLIEGSIPSAKIVQLLARFINFSSYDDES
FT                   KNTHLIGYCLTACLKLSVRLTDPGSIEQLRQLLKSKTNDMDLEIQTRAMEYLQIFSQPM
FT                   SIKKGILAKMPPPPMKEKQSISLMLTSDKKTQNKAKLVDSNDLLLDLLGEDVDTPTISN
FT                   GNTKSVSTPENSLDLLSDIFGDKPNNNTPNPVNSAATPQVNKGNDLLLDDLLFSPSASV
FT                   AAPKVNVVVAFEDANISVGFITVENGGGAASLEAHISNKGSNNISALSLLLAVPKSQKL
FT                   QLSPISTTTLQAGGSALQTFKITGAEGSKIKLRAKLGYSTVGQAVTKQFEFSSASTL"
FT   CDS_pept        1002589..1003113
FT                   /locus_tag="PAS_chr2-1_0538"
FT                   /product="Membrane protein that interacts with Yip1p to
FT                   mediate membrane traffic"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69171"
FT                   /db_xref="GOA:C4R0Z7"
FT                   /db_xref="InterPro:IPR004345"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0Z7"
FT                   /protein_id="CAY69171.1"
FT                   /translation="MSQVQQFLSNIDKQFSKIGILDEFESKAKLPRSYAVLGGASLYGF
FT                   LVFLNIGGIGQLLSNIAGFVVPGYYSLKALETTGTKDDTELLTYWVVFAFLNVIEFWSK
FT                   AILYWIPLYWFVKTIFLLWLVLPATKGSAVVYKSVIQPLAQKYVTNNNVSDDLLNKVNE
FT                   AAKATSTGFEK"
FT   CDS_pept        1003892..1004593
FT                   /locus_tag="PAS_chr2-1_0539"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0539"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69172"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0Z8"
FT                   /protein_id="CAY69172.1"
FT                   /translation="MSYLKISALLSVLSVALADQRISVTVVGDGINSGLRSGGSHFEAG
FT                   PNAAGTPLDLILYEPSGFLVDAADASKYVGWDVAAGTSLTFLPQDQGGKDWGIVAGNLR
FT                   FNVGGTTFYACETRTGVWEVKSYEASGCKAVVLSVASHPVPSSSSSSSSHAPTSSVPST
FT                   SSHVSPTTTQPPHTTSSHTNHTSTTLTTSGRNDSNHSNHTIPPVPTGAAMGVSSNYGLL
FT                   VAAGIAAAALL"
FT   CDS_pept        complement(1004662..1005705)
FT                   /locus_tag="PAS_chr2-1_0540"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0540"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69173"
FT                   /db_xref="UniProtKB/TrEMBL:C4R0Z9"
FT                   /protein_id="CAY69173.1"
FT                   /translation="MSFQLHELKYRFRRLKIELHHRVWNNNDNNRLISGRILNQPFTSL
FT                   RTDQYLDVNELKRVQIQPIDERLDEVENENEEEDTVDRDEHVDELSLMIVDGLDEVDML
FT                   DRLLLEEDQAPTQDSRQVKPYLHREVQKPDRILSLLDMDNLQNIRSSISRALTDHDPIV
FT                   NRIKSFSDYLFRRSQQPKGSWKLVLNEASLNAALCSTGNTPSPIEKTHILPDLTNLCYT
FT                   PKFRVCPALTAKSPIPQLFEGDGYSAGIFEEYIDHISMSTTSPNNNNNRTFLEFPDHQP
FT                   SSLSSTSSLIIPHDPKPAMTSNTFYDSFILQNIEYNTVKSLRTLFKGSTLRLKENGMFQ
FT                   GTKSGKC"
FT   CDS_pept        complement(join(1005828..1007641,1007693..1007723))
FT                   /locus_tag="PAS_chr2-1_0541"
FT                   /product="Essential subunit of the Pan2p-Pan3p
FT                   poly(A)-ribonuclease complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0541"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69174"
FT                   /db_xref="GOA:C4R100"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR030844"
FT                   /db_xref="UniProtKB/TrEMBL:C4R100"
FT                   /protein_id="CAY69174.1"
FT                   /translation="MSANSNSTNTENHDWAKDIDCKNVFIHGYCKFENKGCYFKHPSDD
FT                   SIEKNKETKETKSSAPLSSGTEEGSSIRKKFSFEAPSFTPSGSVASLTNKFSTMSPKLD
FT                   EIPTFVPTSQQTPKKPQQVSAESNDYFAPPNSMFTPSVPSDNSQPGLPLSAQFPQHGTT
FT                   APHNVVPEMFYAQATQYPLNYNLYAPPPPPHFNLHLNPNERTVSSFFIDDNLRESLQKR
FT                   NEACLQTFSNPSIPDIVGVYHSLVPLNNNFDNNSARYGAVSHMYKATSNKDARLYALRR
FT                   IENVNITDKQAFKTIKAWSSIENSNIVKVHEAFTTTVFGGNSLVVAYDFYGNAKTLIEI
FT                   HFQNQPELITEQHLWSYLIQLVNALNEVHDKGLAVRSIDLSKVIVTNKNRIKLSGCGIV
FT                   DILQHENTEDIAQLQKKDLELLAKLLYDLSITSIYGSVSFDDKTQDQIIDHLKFSDDYK
FT                   ATLKYLISADFNLKEIQTRIAPRLLDVIDGLQNSNDFIESQLSTELENARLVRLMSKLS
FT                   FLHGRPEHEGDPNWSESSANYPLTLFVDYVYHQVDERGYPVVDLAHVITCLNKLDAGIE
FT                   ERILLVSKDEKNCIIISYKELKTLIEEGFNELRMRKDI"
FT   CDS_pept        1008261..1009019
FT                   /locus_tag="PAS_chr2-1_0542"
FT                   /product="Putative benzil reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0542"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69175"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4R101"
FT                   /protein_id="CAY69175.1"
FT                   /translation="MTVIILTGASRGLGLAIAHKVLKDPATKLVAVARSKDKLDSLVNE
FT                   YSSRDILPIAADLAEPNSADIIVKKTIETYGSIDCLILNAGKLDPVGPIAKADVPGYKN
FT                   LFDVNFFSIVDLVSKSVEFLRKTKGNVIFVSSGASVTSYDGWAAYGASKAALNHFSQSL
FT                   DSEESDISSISIAPGVVDTQMQEDIRNVFGKNMKPEAYKRFTDLKEENKLHPPEVPAAV
FT                   YANLALKGIPTDLSGKYLRFTDPLLEQYQT"
FT   CDS_pept        1009114..1009950
FT                   /locus_tag="PAS_chr2-1_0543"
FT                   /product="Uridylate kinase, catalyzes the seventh enzymatic
FT                   step in the de novo biosynthesis of pyrimidines"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0543"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69176"
FT                   /db_xref="GOA:C4R102"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006266"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:C4R102"
FT                   /protein_id="CAY69176.1"
FT                   /translation="MFTRSVRNSFVRAGPIRLGPVVSKRLYSQAQNGGINHKRILIGLG
FT                   LLAIGTTLYGTTNPTKTPIAFVEPATERAFKDGDVSVIFVLGGPGAGKGTQCAKLVSNY
FT                   GFVHLSAGDLLRAEQKREGSKYGEMISQYIRDGLIVPQEVTIALLEQAMKENFEKGKTR
FT                   FLIDGFPRKMDQAKTFEEKVAKSKVTLFFDCPESVLLERLLKRGQTSGREDDNAESIKK
FT                   RFKTFVETSMPVVDYFGKQGRVLKVSCDHPVDQVYSQVVSVLKEKGIFADNETENK"
FT   CDS_pept        1010064..1011242
FT                   /locus_tag="PAS_chr2-1_0544"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69177"
FT                   /db_xref="UniProtKB/TrEMBL:C4R103"
FT                   /protein_id="CAY69177.1"
FT                   /translation="MGKKDSSRKKKKKEPPEELDLSEVVPTFGYEEFHVEQEENPVDQD
FT                   ELDANVDYLIAEATISKSNKFGNLLASLAVPKSKSKPKKHQNVQLKLNPSNIQEILNDI
FT                   DSIIFDDDNDNNRPYKALKKEGFKVEDPLFDKKKLNRKNRRFCSILESDFNVIVKSEKE
FT                   LQQKIKEFDLKNYEPKPVPKETVTTSVALQTNNLLYNKVIYKTDPEQHISYFDLTKMRL
FT                   NHEHIKEVVQSSTNLNKSIVEWLLINQSALAKDEDYRIVQTILDFSMRKLENHHAEPSE
FT                   EYLQISQDMNLTWPMSNCLSMILIWGIHEFLSKKCKYISPILIDKIKNKSKKTVIMKAF
FT                   GGGLHLWDLNTRKQQVSPDAWNILEKYRRNYKFEDQTFIIILRLLSFPNLKA"
FT   CDS_pept        complement(1011273..1012361)
FT                   /locus_tag="PAS_chr2-1_0545"
FT                   /product="Peroxisomal acyl-CoA thioesterase likely to be
FT                   involved in fatty acid oxidation"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69178"
FT                   /db_xref="GOA:C4R104"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C4R104"
FT                   /protein_id="CAY69178.1"
FT                   /translation="MFKHVWKRFRQVRLNSMQKPMPKPMPLSTLANLEQYLELEKVSEN
FT                   VYSNVSTLRVPFGGRGIFGGTLVAQSLYAALLNVDEKFRPISMHCNFLVAANTKSRIEY
FT                   HVETLRDGKNFCSRQVKAKQNNQLIFLGSISFRSERLEGSSGASDSPKLSHYRRAPIVG
FT                   KDIPSPEDCHEQTEVFMEWAKNSKDNVQLQKLAKNPQQLLDSYDAEPCKWRLPMDMFDL
FT                   SQVAPEEFDKFVSDRVLRYWVKSKSHFKSPRFNDVAIAYISDYFFLSSNMRLNMQEMFT
FT                   SSFSVSLDHTIHFYDKFNIDEWLSFSIRSKVCQDDRALVTGEIYSESGQLVATVLQEGL
FT                   QALPAHAQLEPQQRKSTIKAKL"
FT   CDS_pept        1012567..1013235
FT                   /locus_tag="PAS_chr2-1_0546"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0546"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69179"
FT                   /db_xref="GOA:C4R105"
FT                   /db_xref="InterPro:IPR007599"
FT                   /db_xref="UniProtKB/TrEMBL:C4R105"
FT                   /protein_id="CAY69179.1"
FT                   /translation="MEAVNLQIEWIRQVPPVTVALVASMSMTYFLQRIDVLSSNMFVFE
FT                   RHRVFNEMAYSRLILSFFFSAHSFVGFFWTLYTLFQNSQALELTYENSIDYLYSLVIIA
FT                   GLIVAWASYLGGPFMLGWVLADVLRTIWCKQNPNERMSILGLVSFKAGYFPFVILAISW
FT                   LEGSSRNLLLMLISQTVSQAYIFGHHMMPELHGIDLFLPIWKFQCFRRQRQPPIHQHQD
FT                   "
FT   CDS_pept        complement(1013247..1013981)
FT                   /locus_tag="PAS_chr2-1_0860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0860"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69180"
FT                   /db_xref="UniProtKB/TrEMBL:C4R106"
FT                   /protein_id="CAY69180.1"
FT                   /translation="MITRLKNKSKERTAALKGKKRAQEGIEAQERKDLPPSKITQRTKS
FT                   SNKVTKMGKQSWYNDLSKYNHIKPLTSKVRGMVSNMTNYNHLLMRSIENPHYRQKLLDI
FT                   EERKLRLNSYPLPKVQNDQSLKDALNHFRIDRQGRSIPILDRNPHVCSSFKENKHLYAK
FT                   ARTTHNDALMEDPVLRNFFEVHSRQMFGVGYIDVDHEKKRVDLLTLKKIVDDDQFVNEE
FT                   DVFRGLKLEDFTEVQTFGFEPI"
FT   CDS_pept        complement(1014001..1015059)
FT                   /locus_tag="PAS_chr2-1_0547"
FT                   /product="Bisphosphate-3'-nucleotidase, involved in salt
FT                   tolerance and methionine biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0547"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69181"
FT                   /db_xref="GOA:C4R107"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006239"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:C4R107"
FT                   /protein_id="CAY69181.1"
FT                   /translation="MFSREVKLAQLAVKRASLLTKRISDEIAARTVGGISKSDDSPVTV
FT                   GDFAAQSIIINSIKKAFPNDEVVGEEDSAMLKKDPKLAEKVLEEIKWVQEQDKANNGSL
FT                   SLLNSVDEVCDAIDGGSSEGGRQGRIWALDPIDGTKGFLRGDQFAVCLALIVDGVVKVG
FT                   VIGCPNLPFDLQNKSKGKGGLFTAAEGVGSYYQNLFEEILPLESSKRITMNNSLSFDTC
FT                   RVCEGVEKGHSSHGLQGLIKEKLQIKSKSANLDSQAKYCALSRGDAEIYLRLPKDVNYR
FT                   EKIWDHAAGNILIKESGGIVSDIYGNQLDFGNGRELNSQGIIAASKNLHSDIITAVKSI
FT                   IGDRGQDLEKYI"
FT   CDS_pept        1015301..1016938
FT                   /locus_tag="PAS_chr2-1_0548"
FT                   /product="Protein containing SH3-domains, involved in
FT                   establishing cell polarity and morphogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0548"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69182"
FT                   /db_xref="GOA:C4R108"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR030507"
FT                   /db_xref="InterPro:IPR035548"
FT                   /db_xref="InterPro:IPR035550"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="UniProtKB/TrEMBL:C4R108"
FT                   /protein_id="CAY69182.1"
FT                   /translation="MISFKRSSKDKHSKGPKITKAEPIQVDTSHSEVLDTPKKVIKSLY
FT                   DYKAQGPGELTFKKGDFFHVIGSEDDPEWLEAYNPVTKAHGMVPVPYFETFFRTGHADL
FT                   QPQDQAATNPNRQSLSILHAKVLYDFRKERDDELDIDAGDYIIVCAHYDYEWFIAKYIN
FT                   KLGGPGLVPASYVQLIDMKTGQPILRDMKSIVDQEKLPTIEEWKNNNARYRESSKIISS
FT                   EYNQEGVHQNQQGNHGDEYPPKLSRTGTDLSSQHWLAPTDPYVVSVNVESFYMTNDKFW
FT                   FLVKATLSNGMVRLLCRFYEDFFNFQQNLLTRFPREAGKQEGHQRIFPYIPGPLSYVNE
FT                   NITAKRRADLDDYFQHLFRLPDYITRSALVSALFEIRSGDKEFKSSDDLTLPNPRVSVL
FT                   QYNNQSSSQQQRRSSQYQQDRLSQYEKHRQSDSINHLVKRMSSLNTETKSSSSSSSGLI
FT                   TSKLKLKFYFKDDIFVLIVPTTVGIADLKRLVASRLDHSASALHLYPKYGANIDENEYS
FT                   EHDEIQSDDTLWGSKCFVDKGKVLVIAT"
FT   CDS_pept        1017135..1018778
FT                   /locus_tag="PAS_chr2-1_0549"
FT                   /product="Alpha 1,3 glucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0549"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69183"
FT                   /db_xref="GOA:C4R109"
FT                   /db_xref="InterPro:IPR004856"
FT                   /db_xref="InterPro:IPR039488"
FT                   /db_xref="UniProtKB/TrEMBL:C4R109"
FT                   /protein_id="CAY69183.1"
FT                   /translation="MPHKRTPSSSLLYARIPGISFENSPVFDFLSPFGPAPNQWVARYI
FT                   IIIFAILIRLAVGLGSYSGFNTPPMYGDFEAQRHWMEITQHLSIEKWYFYDLQYWGLDY
FT                   PPLTAFHSYFFGKLGSFINPAWFALDVSRGFESVDLKSYMRATAILSELLCFIPAVIWY
FT                   CRWMGLNYFNQNAIEQTIIASAILFNPSLIIIDHGHFQYNSVMLGFALLSILNLLYDNF
FT                   ALAAIFFVLSISFKQMALYYSPIMFFYMLSVSCWPLKNFNLLRLATISIAVLLTFATLL
FT                   LPFVLVDGMSQIGQILFRVFPFSRGLFEDKVANFWCTTNILVKYKQLFTDKTLTRISLV
FT                   ATLIAISPSCFIIFTHPKKVLLPWAFAACSWAFYLFSFQVHEKSVLVPLMPTTLLLVEK
FT                   DLDIISMVCWISNIAFFSMWPLLKRDGLALEYFVLGILSNWLIGNLNWISKWLVPSFLI
FT                   PGPTLSKKVPKRDTKTVVHTHWFWGSVTFVSYLGATVIQFVDWLYLPPAKYPDLWVILN
FT                   TTLSFACFGLFWLWINYNLYILRDFKLKDA"
FT   CDS_pept        complement(1018795..1020897)
FT                   /locus_tag="PAS_chr2-1_0550"
FT                   /product="glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0550"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69184"
FT                   /db_xref="GOA:C4R110"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C4R110"
FT                   /protein_id="CAY69184.1"
FT                   /translation="MSPHSPTKSNGQRVEKKTRFEDSSSPNESSPIQLDDEEEPSKYIN
FT                   HEIKLEEHLNYPQTNDSVKSWPILRSKSLPIGKWRSNTESRLSIPITRSKSEAREKRSE
FT                   HEDNLKTETVVFDNEFKWKYPKVKLNSSVVQPLTVSSFEDGSSEPVTGPVSSLANSNKA
FT                   KSLDIKAASAKAESNNNVNSANMDYETLAFLNHPNSRVPEVGVGPSKNFMTSPIAETGN
FT                   TNKDIPAKFDQPTDSSKETVGLKLLDTSTSDVMFGSSVHSAYQKTETKEYSNEVGNETA
FT                   SFAPSSIYSEKAGKYREHGSWKSPFYVGCILVLLGSLIASLAILVPLVTELIGGTTTTI
FT                   FNYMNRVSPTERQKLIDQLISHYNLSTTNTSFSVSPKIMIQIPPANNFTQDETQNSYAG
FT                   LNKKFHNNTELKSLMSDKRLQKSIYGVNYAPRGSLQPMCGVNYDQVVLDLGVLSMVTSR
FT                   LKLYGLQCQQAAYVLDVIQDMGLNMTVSIGVWLNSDRQSNENQISDLQKILLKVRRDQI
FT                   DTIFVGNEVLWRHELSTDALFQYIKQVKRIVQQLGWYDLPVGTNEHYSCVKEDWADQLD
FT                   ILGVNLHPFFNGTTAKIAPGWVNSTLYNICSTKSCMEKIVIGETGWPYQGGSFIDAIAK
FT                   KKNYDLYLKGFSALARHLKIPWYWFEAFDEPWKKIYENGENKWETEWGLFTVDRKLKEG
FT                   VKLPKY"
FT   CDS_pept        complement(1021643..1022404)
FT                   /locus_tag="PAS_chr2-1_0551"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0551"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69185"
FT                   /db_xref="GOA:C4R111"
FT                   /db_xref="InterPro:IPR002809"
FT                   /db_xref="InterPro:IPR008568"
FT                   /db_xref="UniProtKB/TrEMBL:C4R111"
FT                   /protein_id="CAY69185.1"
FT                   /translation="MSPDLVLDPSLKVWVLLPISAVMILVGILRSYVTNLLQPLPKVSK
FT                   WRDVREQQQLQKARLFRGNSHVLVSKKEFLNRQAYLYEALTSGKYLKNAVKQNKDQMPN
FT                   PLSDPNASDAMFNMLKSNAANFIPQTVIMWWINYFFAGFIIMRLPFPLTLRFKSMLQQG
FT                   IDTPDLDVRWVSSLSWYFVTLLGLQSVFSLILSSSNAVQVIQQQMPAQMGMPGQPDMAK
FT                   VFAAEGESLQVAQFKSSTDSIEDRILDSYKL"
FT   CDS_pept        complement(1022711..1023589)
FT                   /locus_tag="PAS_chr2-1_0552"
FT                   /product="Protein involved in 20S proteasome assembly"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0552"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69186"
FT                   /db_xref="GOA:C4R112"
FT                   /db_xref="InterPro:IPR016562"
FT                   /db_xref="InterPro:IPR019151"
FT                   /db_xref="InterPro:IPR038389"
FT                   /db_xref="UniProtKB/TrEMBL:C4R112"
FT                   /protein_id="CAY69186.1"
FT                   /translation="MAFHSRTNPIEVLNSFKGSTLVLPIVSIGNVPQFTADLLIHNLNL
FT                   KSVAWLDDSLVHPFVSPVDYVEGNPDTSIQDFSTSLEVYHNKDLKLAILQQRSPVLPGY
FT                   TTQFYQQVIVPFINTSGFSKVLVLQSKDSAFKEQSDGSLYELYSNDLAANLSRLTVEEQ
FT                   TTKLKDPKELSPIIEILVNSLKNPELGLEMKPTPSCVNLLKLLETEFPHTVTLPAVSSS
FT                   ANLQQEPIKIVVLSIYVYEGDNISDAQVFAQRVYELLQIPQPATWVEPVSWKGVYGSRD
FT                   IPVGMEGGIYS"
FT   CDS_pept        1023865..1024815
FT                   /locus_tag="PAS_chr2-1_0553"
FT                   /product="Deoxyhypusine hydroxylase, a HEAT-repeat
FT                   containing metalloenzyme that catalyses hypusine formation"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69187"
FT                   /db_xref="GOA:C4R113"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR027517"
FT                   /db_xref="UniProtKB/TrEMBL:C4R113"
FT                   /protein_id="CAY69187.1"
FT                   /translation="MSDVNEATSLERLRDVLINNTGDIKLAHRFRALFFLKSIGAEYNE
FT                   KPEDANKAIKYIGECFADSSELLKHEVAYVLGQTKNMTSAPILRDVLESKEQQVMVRHE
FT                   AAEALGALGDKDSLDLLVKYYEDPAEVEEIRQTCELAIERIKWENSSKAKEEKLETSLY
FT                   ESIDPAPPLAIDGSNTKISKLQKILNDQNTPLFERYRAMFRLRDIGTDEAALALATGFS
FT                   DPSALFKHEIAYVFGQLSNPVTVPSLVQVLKDTSQAAMVRHEAAEALGSIATDEVLPIL
FT                   QGFLKDEDEVVRDSAVVALDMYEYENSNEVEYAAV"
FT   CDS_pept        complement(1024879..1025250)
FT                   /locus_tag="PAS_chr2-1_0554"
FT                   /product="RNA polymerase I subunit A12.2"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0554"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69188"
FT                   /db_xref="GOA:C4R114"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="InterPro:IPR012164"
FT                   /db_xref="InterPro:IPR019761"
FT                   /db_xref="InterPro:IPR034004"
FT                   /db_xref="UniProtKB/TrEMBL:C4R114"
FT                   /protein_id="CAY69188.1"
FT                   /translation="MSVVGSMIFCVECGNLLDSVAGQKSIDCNVCERSYDTKRFKNLSV
FT                   VTKSSPDAFPSTLRAKASLVKTSLKSDELEDGATIKEKCPQCGNEEMQYHTLQLRSADE
FT                   GATVFYTCPKCAYKFRTNN"
FT   CDS_pept        1025457..1027139
FT                   /locus_tag="PAS_chr2-1_0555"
FT                   /product="Subunit of the cytosolic chaperonin Cct ring
FT                   complex, related to Tcp1p"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0555"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69189"
FT                   /db_xref="GOA:C4R115"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012718"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C4R115"
FT                   /protein_id="CAY69189.1"
FT                   /translation="MQAPPQMMEMPDLSNAIMAQDEMGRPLIIVKDQGRKQKASGVEAI
FT                   KSHILSARSVASILKTSLGPRGLDKILVSPDGEINITNDGATILSQMEFSDEIAKLLVE
FT                   LSKSQDDEIGDGTTGVVVLAGAMLDQALELIEKGIHPIKIGDGLHEACKVAVANLDKIA
FT                   DQVTVYDGDQVDRNAQPESELFKAAKTSLGSKIVSKFQDKFAKMAVECVLAVADLSRRD
FT                   VDFELIKIEGNVGGSLDESRLIRGVLVDKELSHPQMPKTIEDARIAILTCPFEPPKPKT
FT                   KHKLNIGTVEEFEALQKYEQDAFAEMIGHVQRAGANLVVCQWGFDDEANHLLLQNHLPA
FT                   IRWVGGPELEAIAIATRGKIVPRFEDLSADKLGHAGIVRELEMGTTRERMLVVEECANT
FT                   RAVTALLRGSSKMIVDESTRALHDSLCVVRNLVRDNRVVYGGGAAELSCSLAVSAAADS
FT                   QKGIDQYAFRAFADALDCIPMALAENSGLDPITTVSTLKARQSTEANSNLGVDCLGSNQ
FT                   NDMKELFVIDPLIGKKQQLLLATQLTRMILKINNVIISGKDEY"
FT   CDS_pept        1027373..1028659
FT                   /locus_tag="PAS_chr2-1_0556"
FT                   /product="Essential component of the Arp2/3 complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0556"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69190"
FT                   /db_xref="GOA:C4R116"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR015623"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniProtKB/TrEMBL:C4R116"
FT                   /protein_id="CAY69190.1"
FT                   /translation="MSSINTPAIVMDNGTGLTKLGFAGNDLPSWVFPTAIATRAENSNS
FT                   KYNKSTSSRGGQTSGGNLSIKRGMEDLDFYIGEEALEAAKGPSYSLNYPIRHGQVENWD
FT                   HMERFWENSIFKYLKCEPEDHYFLLTEPPLNPPENRENTAEIMFESFNCAGLYIAVQAV
FT                   LALAASWTSSKVQDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPLAGRDITIFIQ
FT                   TLLRDRGEPDTSLRTAEQIKQQFCYTSSDIVKEFNRFDSNPEKFAQYMVETVNKSRTLT
FT                   VDVGYERFLAPEIFFNPEIASSDFLTPLPTIVDQVIQASPIDVRKNLYKNIVLSGGSTM
FT                   FKDFGRRLQRDLKQIVNERVASSERTSGAKSSGVEVQVISHKRQKNAVWFGGSLLAQTS
FT                   EFKSYCHTKQDYDEYGPNIVRNFSLFSVP"
FT   CDS_pept        1028918..1036171
FT                   /locus_tag="PAS_chr2-1_0557"
FT                   /product="PIK-related protein kinase and rapamycin target"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0557"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69191"
FT                   /db_xref="GOA:C4R117"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR003151"
FT                   /db_xref="InterPro:IPR003152"
FT                   /db_xref="InterPro:IPR009076"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR014009"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR024585"
FT                   /db_xref="InterPro:IPR026683"
FT                   /db_xref="InterPro:IPR036738"
FT                   /db_xref="InterPro:IPR036940"
FT                   /db_xref="UniProtKB/TrEMBL:C4R117"
FT                   /protein_id="CAY69191.1"
FT                   /translation="MTQAELYTLDQVFNGLRSRNPQRRLLSARNLKEHLLSVSREFTPS
FT                   EQVKRYNSDVYKRISDLIESKNNWEKLGGVEAINALLDLNADGNDDLVASSNSNTEDRK
FT                   IKRTVLKTYLDKLIPSSDLEVMYSATRTLGKLAIPGSALAGPLVEFYMPRAIEWLNPDN
FT                   KQEYRHAAVLIITSLSYNLSTSIYNYVHKILENIWIALRDSKLIIREDAAIAMRYCLSI
FT                   VYERDSQMAQFWFSALYTEASQCFKATPTSSTTISSTAVEVIHGSLLCYRELVIKGTSL
FT                   LSDKIDELYDNLNKLKDHKNVIIRREFSSIIPKLAHFNRANFVEKHLHRVLLYYFTQLK
FT                   IPRDRDFIFVAIGDIATEVKNRIVDYLEGILTNIDEALAVRSVKARREIEPACFYCLEK
FT                   LALALGSCMTKYINNYHTLNRIFKCSINDNMIQTLQVLIEKLPALEPAINERLIKIVTL
FT                   CLSGYEYKHPGSQGYKRQMNTSLAQEYRQQMLQRDGGTLIYEKAYTGYSTESGYEQNLR
FT                   DLDEDPDVTVIIQALKVLSCFHFADYNLTDFTRFSVMTYVDHDNIEVRKRAALTTCALF
FT                   MKDSICYQTSESSLKAVNEVLGKLLVICITDPVAEIRLEVLKVLGENFDPQLSQADNAK
FT                   LLFVATNDGNFEIRKAAIKIIGRLSAINPAYIVPSLRKLLMQLLTTLEYDGSSKRREET
FT                   AAILSTLISHSKDVTKPYVKQILDVLIPKAKDQSSGASINAIQAIGELAVVSGEDMKPF
FT                   IHEMMPIFLDTFQDQSAGYKRDTALRALGQLASSSGYVIDPLLDYPQLLGMLVSILKSE
FT                   SSQMVRRETVRLLGVLGALDPYKHREVDWKIKSSLPMEQITEQNAPPIDVSLLMQGMSP
FT                   SNEEFYPTVVITTLMKILKDSSLVNHHTAVAQAVIYIYQTLNTKCIPFLNHVIPGFIHV
FT                   MMNYPDVRLEFYFNQLGKLINIVKQHVRPYLKDIFVLIKKYFATPNLTVTILGLIQIIS
FT                   SAMDGEFKLYLTEILPLMLEVLETDTSPEREASLAVLNTFVVLGSNIDLYVHLVIPQIV
FT                   SLFDFSPYRLRKASIETIGKLASTVHLNDLSSRIIHPLLRALETNSSDELKKTIMNTIS
FT                   IMLLQMRENFLVFIPLINKILVQHKWKFPVYEQLMEKLLNGQKLPQNLIIGPEHESLRT
FT                   EAMEIEPSSNKLTLNQQALRQSWDASQCRTKVDWVEWIMRLSLELLRESPSHALRACST
FT                   LASDYTPLAKDLFNVSFASCWNELSPQNKNDLIQAFGIALSAVQNPPEIHQQLLNVVEF
FT                   MERDDKPLPIRVPTLGQYAKRCHAYAKALHYKELEFIQEPSTPTIESLISINNQLQQSD
FT                   AAIGILKQAQQHHDLQLKETWYEKLQRWDDALNAYNEREKEDPDSMDITMGKMRSLHAL
FT                   GEWEQLSELAQDKWLNSSTEIRRAIAPLAAAASWGLGQWDRMDTYIGIMKHESPDKAFF
FT                   NAVLCLHRNNFEGASTQILRARDLLITEMTALVSESYNRAYSVVVRVQMLAELEEIIRY
FT                   KCYPQGSEKRAMMRQTWTKRLLGCQRNVDIWQRMLKVRALVVKPKQDMEMWIKFANLCR
FT                   KSGRLGLAEKSLNSLLDEGDSDNPRPSRAPPQVVYAQLKYMWASGQQRAALSHLIDFTS
FT                   KLSRDLGLNENEAITQPLPTEVPGAAKHVEEYTKLLARCYLKQGEWKVTLNPNWRNEEA
FT                   TGSILGSYLLATHFDSNWYKAWHNWALANFQVISAHQSTHDGIADVSSSARSSHTPDEV
FT                   KPDMLQHYVIPAIKGFFHSISLSELNPLQDTLRLLTLWFSFGGITEAAHAMLEGFSMVK
FT                   IDTWLQVIPQLISRIHQPNEVMSRSLLNLLTDLGKAHPQALVYPLAVAVKSNSELRKQA
FT                   ALTIIEKMRIHSPTLVEQSELVSEELIRVAVLWYELWYEGLEDASRLFFGEHNTEKMFL
FT                   VLEPLHKLLDKGPETLREISFQNAFGRELNDAFNWVLNYRNTKDIANLNQAWDIYYNVF
FT                   RRINRQLPQLKTLELQYVSPKLLAAHDLELAVPGTYSAGQPIICIQSFDSTFSVINSKQ
FT                   RPRKMNIRGSDGKGYQYVLKGHEDIRQDSLVMQLFGLVNTLLVNDAECFKRHLDIQQYP
FT                   AIPLSPSSGLLGWVPNSDTFHVLIRDYREPRKILLNIEHRIMLQMAPDYENLTLLQKVE
FT                   VFTYALDNTRGQDLYKVLWLKSRSSEAWLDRRTTYTRSLAVMSMVGYILGLGDRHPSNL
FT                   MMDRITGKVIHIDFGDCFEAAILREKFPEKVPFRLTRMISYAMEVSGIEGSFRITCENV
FT                   MRVLRENKESLMAILEAFAYDPLINWGFDFPIDELAESSGLKLNAISPSELLARGEVSE
FT                   KEASEIESEYNQQMRNARAAFVLKRITDKLTGNDFKRAHELDVTNQVDKLIQQATSVEN
FT                   LCQHYIGWCSFW"
FT   CDS_pept        complement(1036180..1036659)
FT                   /locus_tag="PAS_chr2-1_0558"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0558"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69192"
FT                   /db_xref="InterPro:IPR019191"
FT                   /db_xref="InterPro:IPR038881"
FT                   /db_xref="UniProtKB/TrEMBL:C4R118"
FT                   /protein_id="CAY69192.1"
FT                   /translation="MTTAEEDPKREKLQREGINDDDDDIWGDEELHEATTEDNYGLETP
FT                   VKEHVNTSALRRKHAKAGYLDGIGAAENHGLQDAFDEGYPIGASIGTRIGQIIGTLYSK
FT                   SNTELLDKARAELQISKVLDSKYFDGNVNLVDDSLLTKWEGHSINLTDSKKNNKD"
FT   CDS_pept        1036964..1037920
FT                   /locus_tag="PAS_chr2-1_0559"
FT                   /product="Protein required, with binding partner Psr1p, for
FT                   full activation of the general stress response"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0559"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69193"
FT                   /db_xref="GOA:C4R119"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="UniProtKB/TrEMBL:C4R119"
FT                   /protein_id="CAY69193.1"
FT                   /translation="MNSVITQVEENRSDSHLSSEAQQFDDDYNTEIRLNIRGTSATITR
FT                   DELMALPESILLCLFPNGVFVDIEGNVITNLTEEDVVYVNFSPECFNYIVDTFNEAAAS
FT                   DINRVHDERLVIEDGADLLQSKPSVIVLREDLDYYCIPPVQGMSKEQMIQVKIEVGHSL
FT                   VNEAHIFKGLGHQQNKTLGPAEQHLADMLCSSGFVADGCWGHRSLEPDKTVVFSLALVR
FT                   LKPDSPEDTTNTKKSKFNTLQYRNSRKKAKENTTATKLLLFWRKPARKCWWASEMIKTD
FT                   LSRLNLKDSNGNPISTVEIKVHIRRVWTLELSVIGVQ"
FT   CDS_pept        complement(1038161..1039096)
FT                   /locus_tag="PAS_chr2-1_0560"
FT                   /product="Protein with similarity to human cystinosin,
FT                   which is a H(+)-driven transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0560"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69194"
FT                   /db_xref="GOA:C4R120"
FT                   /db_xref="InterPro:IPR005282"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:C4R120"
FT                   /protein_id="CAY69194.1"
FT                   /translation="MLNLISTISGWAYVVTWSLGFWPPLLVNIATKSVTGLSIDFIYFN
FT                   FVGYVVYVIYYASFLYNDTIRSQFSKRYTKPPSSDFESLPLVNTNDLIYALHGLIINTL
FT                   VLSQAYCWGYRKNRNQKLSTPAKLFFLGCLVYVCIMVLSIELHSGLCQWLDLLNSLGIM
FT                   KIGMSIGKNIPQILYIYKRKSTKGWPIQVIFFDSIGASLSLIQLTSDAISSKSFDIIVT
FT                   NTPKLVIAIEVLICNLIMFTQHYYFYRDELPIDQREPQESMDSIIELSLKSYGSIDHLG
FT                   QSDADKNEPFRVEVRDSFDVESLAWLSAPA"
FT   CDS_pept        1039801..1041354
FT                   /locus_tag="PAS_chr2-1_0861"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0861"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69195"
FT                   /db_xref="GOA:C4R121"
FT                   /db_xref="InterPro:IPR012173"
FT                   /db_xref="UniProtKB/TrEMBL:C4R121"
FT                   /protein_id="CAY69195.1"
FT                   /translation="MLEDLVENPSKVFSNVEVKDILKQAKQLIDPISKQNSVLDEVYID
FT                   GLASSQVWAQIKLVIDGVTEDVLFNKIPELKKTGQANEEVDGSLEEEGSSNAEEENEES
FT                   ESDIVEDEIEDEDEGEDEEEGSNENEALDVLNEELNEVEEEKPEDDVEEPKTAPRESNE
FT                   SSDDESEFIDTHTEEFAQAEDELNDEFFDLEQFQQQVIAMEKPNDDDDDEEIDYFGESD
FT                   NAAEESDNEEVMYYNQFFDPKGFKPKTEKKKKKVTFDLQEEENLNEEDHMDKLVASTME
FT                   DLFDDHLSEDEEISETGEKNLSTFEKQQREIQKQIAELEQEQIAQKKWTLTGEASVKTR
FT                   EADALLEEDLDFERTSKPVPVITQDVTESIEDLIRKRISNYQFDELQKRLPTNIAKFKS
FT                   SQKVEVSEQKSIKSLAELYEEDYVKPDSTANKELEKAHDEISQLYETLSHRLDSLCSAH
FT                   FIPKPAKRSLEVKVQTDTITMEDAQPLTLAGESTFAPQEVYKPQAKKQRKSKNRESMED
FT                   "
FT   CDS_pept        1041524..1042639
FT                   /locus_tag="PAS_chr2-1_0862"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0862"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69196"
FT                   /db_xref="GOA:C4R122"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C4R122"
FT                   /protein_id="CAY69196.1"
FT                   /translation="MNRNLAFLRPSPRFFSSALRTQSNKLPFVPLVAENGFVDAIGNTP
FT                   LIKLNKLSDQLERNIYAKAEWMNPGGSVKDRAALYIIQDAEAKGQIQAGGTVVEGTAGN
FT                   TGIGLAHVCRSRGYKCVIYMPNTQAASKIDLLKLLGAEVYPVPVKPFDDPMNYNHQAKR
FT                   HAESLDNAVWTNQFDNTANRNAHIQSTGPEIWAQLDGKVDGFTCSTGTGGTLAGVTRYL
FT                   KEISNGKVKSVLADPPGSVLYSYIKTNGKELDRSGSSFTEGIGQGRVTDNLKPDLEIID
FT                   DAIRIPDEESIVMLYRLLDEEGIYIGGTGALNVVAAAEVAKTLPKGSNVVTILADSAHK
FT                   YSDRIFSKKWLQQKNLYDVLPANLQKYAILD"
FT   CDS_pept        complement(1042653..1045721)
FT                   /locus_tag="PAS_chr2-1_0562"
FT                   /product="Protein phosphatase with specificity for serine,
FT                   threonine, and tyrosine residues"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0562"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69197"
FT                   /db_xref="GOA:C4R123"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR024950"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C4R123"
FT                   /protein_id="CAY69197.1"
FT                   /translation="MKVTFSMPEKPSKASRKQSDSSQLSKERFMGPESFFPVSSAGTGS
FT                   SRELALMEDITPKHLNRSPPSKSKATTSLSQTKLSEHRSGGKRANSTNLSGADREKLRS
FT                   RLSNTLLGSSKDVKDINPQFVDKNYLIEASLQGDNPYLSIFKDNQSMDNFDIKYITLDQ
FT                   YYLLMTFFTTKKLPPADKMFPWLHGIHRNNRAQIEFIRAAMHMRSLIPNFEVPRDIRDY
FT                   IFCRSAPCAGDIIANSGMLLNSLEPREILTAWEGSSKLELKIFLKGFLSKVKMDSSFLS
FT                   LIIDDCYKLKVLPLFLELDPVNTISLRNVGIQCSKISHISDIFCYCLNDDHLQPNSENC
FT                   SCESLARLIRLAQMYKKSTLQDLQDCRYRSYILPRLDINELDQQKLMALVPVESSDSFR
FT                   TPGHLLSSFDILNFNNWDADYLYKESLELSKMSAATEIKNGLWLGNLTDFHSLQTLKAQ
FT                   DQDFNYEQEHLKHGQLFQPHPKYFDERNTIVSLTSNEILSVDDEFHLIPFPRANWRVFI
FT                   HCKDGNKFPTLEQLEILFDGLDESEGEDIVIDFPNSGSVSIGDCSEQELVAVVNLCKYI
FT                   YLKTQLTGAPALLFCSDGYTESSLLVVSLLTYLDMVSVDQTIINLHKEYFRPCFLFESD
FT                   YIFLKKVEPLLTHFSPKGIPIDSISKTMVTVSSLASIFLKSSSLKLNDNLITKNVCFNL
FT                   KGSLPSRILPHLYLGSLNHANDLPLLNELGITRIVGVGEWAEWMTYMPYTQRKTHSGCS
FT                   ILSLSHGAQTPDGIPSMIKQMLAFDIKDDGVGTLTETINDALDFIQAAYEQNEKVLVHC
FT                   QVGVSRSASLCIAEVMKRLNVSLPRAYLYVRVRRLNVIIQPNLRLLYELYTWEETFVES
FT                   QNRDLNRVFKGERERWSRDRSESLESTTSSVVSRVSLATTDRTSIGMGSTSSRRSSFKP
FT                   QSFRSEMLLVEEQEEPDNISTSVESPLETNDHHGGVILEASISSEDGDVVQIKDYPMRI
FT                   KRNVPDYFLRETSWQILCREIHSLNSPYIQTIT"
FT   CDS_pept        complement(1046099..1047439)
FT                   /locus_tag="PAS_chr2-1_0563"
FT                   /product="Protein that activates Urm1p before its
FT                   conjugation to proteins (urmylation)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0563"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69198"
FT                   /db_xref="GOA:C4R124"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR028885"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C4R124"
FT                   /protein_id="CAY69198.1"
FT                   /translation="MYHLLILGSLKFILNSEMSVEELTRELERVKEENRSLRNKLADKK
FT                   AEAIEMEPSNGYPLSLDEYSRYGRQLIVPEFQGVQGQVNLKNSKVLVIGAGGLGCPALL
FT                   YLCAAGVGKIGIVDNDYVDKSNLHRQVLHTTNRVGMLKCESARVYLENLNPNTEIETFP
FT                   IRLDNDNVFEVMSGYEYVLDCTDTPQTRYLINDGAVLCGLTIVSGSGLKTEGQLSILNF
FT                   QNQGPCYRCFYPNPPPPNSVTSCKDGGVIGPAIGMVGIMMAYEAIKLITGYYTMENFSP
FT                   FLTIYSSYPKQSLRTFKMRGRSEKCAICNGTITRKAIESGEIDYQAFCGTIHYRVMDPE
FT                   NDRISVTKYDELVSTDHSLIDVRPKEQFQICSLPNSINIPIDQLMKKELKDLSQFQRGT
FT                   PNFFICRYGNDSQSAVEFFRTLGIPSKDIIGGLNCWSNEIDSSMPKY"
FT   CDS_pept        complement(1047595..1048296)
FT                   /locus_tag="PAS_chr2-1_0564"
FT                   /product="Possible U3 snoRNP protein involved in maturation
FT                   of pre-18S rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69199"
FT                   /db_xref="GOA:C4R125"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR015720"
FT                   /db_xref="UniProtKB/TrEMBL:C4R125"
FT                   /protein_id="CAY69199.1"
FT                   /translation="MVDACQTKNRLPFLPQLPHKMSKLLTLLFLLVGIANAFHFYVDTD
FT                   ETKCFYEELPKDTIAVGKYEVYELNLNTREYEKVNNLKVELTVEELFHNNHKVVNQKNE
FT                   PIGQLTFTSLDTGEHRFCLTPRHTDWSKRARHRVFFDLAIGDAKSYVDSKKSSEFNELT
FT                   ARINELSKKLQHIRVEQDLFREREMIFRDQSESTNSRAVKWTLFQVAVLVATGVWQLSY
FT                   LKGFFVKQKVV"
FT   CDS_pept        complement(1048384..1049958)
FT                   /locus_tag="PAS_chr2-1_0863"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0863"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69200"
FT                   /db_xref="GOA:C4R126"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C4R126"
FT                   /protein_id="CAY69200.1"
FT                   /translation="MIVDEQAMEIPPKDEEELELERLVFGDLEGFEKGLRDVDFFGRDE
FT                   TEADSGNEPEGDDVSEDDDFEKLQDDQLFFVDESKGDVGVDYHGESGSEDNTDYSEEES
FT                   DAWEDSDDQNLRISVVKDDKLEKLRKRENESVLSGKSYIFRLKSQFEKIHPRPDWADES
FT                   DSEDSDGTASQEENELVKSNMLLDILSKQYQVASKTTKLLPPTNIDIDRLRDANAQRVA
FT                   HSSIKTIAFHPTHPLLATGGMDRTIRIFQLDGKVNNFITSIHLKQSSILSLEFQDDKLF
FT                   AGGSRPYMYKWNLQNERVEKINKLYGNEKTQKSFGHFKLSCDGRYIGLAGNSGWVNVLS
FT                   TTNGLWLRGFKIEDEVVDIDFMKQSDDNILIAVNSAGEVWEWNVDTGKFLNKWSDDSGT
FT                   GITQIKACDRWLAVGNNVGIVNIYDRRKLTNSTTRPKPIGTVENLVTAITALDFTPDGQ
FT                   VLCVTSNAVSDGLRLVHLPSCTVFRNWPTRTTPLGTVTTVKFSPRGETLCVGNTAGKVR
FT                   MWRLNHY"
FT   CDS_pept        join(1050161..1050165,1050217..1050469)
FT                   /locus_tag="PAS_chr2-1_0565"
FT                   /product="Putative protein of unknown function, identified
FT                   based on comparison to related yeast species"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0565"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69201"
FT                   /db_xref="GOA:C4R127"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4R127"
FT                   /protein_id="CAY69201.1"
FT                   /translation="MAQPDKYYNKYTYQMSPAMLRARRPYFWKNMGAFGILGGISLSVY
FT                   LYTYNFLMQDDFENIPIPPIKDEDLAALRREYEEKKQLSK"
FT   CDS_pept        complement(1050600..1051772)
FT                   /locus_tag="PAS_chr2-1_0566"
FT                   /product="Vacuolar protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0566"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69202"
FT                   /db_xref="GOA:C4R128"
FT                   /db_xref="InterPro:IPR031606"
FT                   /db_xref="UniProtKB/TrEMBL:C4R128"
FT                   /protein_id="CAY69202.1"
FT                   /translation="MSYTSDNKEKRKSWAVKLDNTTFDIIESQLFVNFKISTLLAYLMM
FT                   WLFIILSIAFLVSDIVTAYRLINLNRWAMNIEPFISKEICRWIFVGCIFASLAILIAKW
FT                   IWAFFHRSQRICETYMNNILRNTYSIRHYSYFCVYDKIGAGGFVKRLTFFTFFSIRDCL
FT                   TLLIADSPRQVINGITLFKFLKLETGDFSTITKVISKVAEENRYAAVTLGFMTFSFILW
FT                   VFFMIMLVTALLSYIPLRVYWSGRGYKDGLKQYCSLEANRVIHDFVSKRLPTELNMIKL
FT                   ENENQNFLPKLPDIDDDDNYYDEDAYEVNSLLTTSELEVPKPIGTKNSRYMSYENPYLY
FT                   THRNFSEQESSINLNESNPYDSNSQSRSDSTTSFFGETVTKNSYRGSGYT"
FT   CDS_pept        complement(1052455..1054134)
FT                   /locus_tag="PAS_chr2-1_0567"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0567"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69203"
FT                   /db_xref="UniProtKB/TrEMBL:C4R129"
FT                   /protein_id="CAY69203.1"
FT                   /translation="MSFEIQELRNQLELSKANHQIEYSNLLSKLDLQNRDIQDLKGDKD
FT                   FLYQRNLKLVEQIDQLKKENKSLLSKNDKKLAEQQLLDAKDEYESKLDELEEQNIALIR
FT                   ELNSLKNTVNVKTNGLKLLETQLDESKRELSQAREENERLKENQTPSVANPENKESKLY
FT                   ENELSQLIQKVTKLEQENEHLLNLSKSSKLDHELLLYLKESNKQLEFKAHNYDKLLKDN
FT                   SELAKKLAQYQSKFQNFDSDEVVSTQKLLKKISLLEDLNKSKELALNVLREDLYRVHPA
FT                   QLETVDQLAKLQKQLQSLKLDVSDKELDISRLSIQVGLKDKHLLFMKDQMDNISLERDF
FT                   YRKKMNGNENIEKPDSTDKILLDKLNSLCQEFEIQVAHISSLTESRESKRQKIKEESTV
FT                   LPDKNEQIVQLSKEKQELSIKLSELEDELKSRNEQIQKLVATEEATKASAETANTLTTS
FT                   VSKELFDQLFEKNQQLESKVSEFQVSYLSIKEISERELKEYQDIVQRILGLKVVKLGDY
FT                   IVKLQKNDSEYVVITIKEGKLALVETKADLKEFKIPLTSLIE"
FT   CDS_pept        join(1054480..1054490,1054546..1054954)
FT                   /locus_tag="PAS_chr2-1_0568"
FT                   /product="Protein involved in error-free postreplication
FT                   DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0568"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69204"
FT                   /db_xref="GOA:C4R130"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniProtKB/TrEMBL:C4R130"
FT                   /protein_id="CAY69204.1"
FT                   /translation="MSTIPRNFKLLEELEKGEKGLGSESCSYGLQDLDDLTMTYWNGTV
FT                   LGPPNSVHSNRIYFLTIECNESYPENPPIVKFQSKINLPCVDQTTGLVDPKKFKTLGEW
FT                   KRSYSIEIVLLELRKEMALPGNKKLAQPKEGSTYF"
FT   CDS_pept        complement(1054999..1055406)
FT                   /locus_tag="PAS_chr2-1_0569"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0569"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69205"
FT                   /db_xref="GOA:C4R131"
FT                   /db_xref="InterPro:IPR024645"
FT                   /db_xref="UniProtKB/TrEMBL:C4R131"
FT                   /protein_id="CAY69205.1"
FT                   /translation="MAPPVPVYTRDEVKMQFPQYMMKFLPSNCELYSIIQNQCTFSADE
FT                   IICVPFKRVFAKCRRGNQEAKRNIIPENGGLNLTGKKLIPREYTVIEVTDSLTNKYDNS
FT                   SLMDRFFEAERDLMIRFQEYEERNSKEGEIK"
FT   CDS_pept        complement(1055526..1057262)
FT                   /locus_tag="PAS_chr2-1_0570"
FT                   /product="Subunit of the origin recognition complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0570"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69206"
FT                   /db_xref="GOA:C4R132"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR016527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032705"
FT                   /db_xref="UniProtKB/TrEMBL:C4R132"
FT                   /protein_id="CAY69206.1"
FT                   /translation="MKTNLVDVLEYEKDNSPSRNNDKVSTTPALTDNSQLTKDFAGEFN
FT                   SLRVDRMGDDRISDVFKEKAKVVGNKSGVTIVTNGANEKKKENDSPRISQLTAFNPEEP
FT                   VPTTTIKLLKTQVLSKLRRNSQLLYGLDDHYRQVYSLCKHCLNDLQSRSLLLMGPRNTG
FT                   KTSLVNQVLAQLEKEHPKGFITIKLNGIFQTDDKKAVREFAHQLDIKLSQLAGYDTILD
FT                   RIVSKDKFVTVEKKNITHTLESILRILDSKRLQQNSEDEIKGNNIPIIVILETFEVFVN
FT                   QRQSFLYNLLDITQNGSSPMSVIGITNRLNTRELLEKRVKSRFSQRILQFNKATSLEEF
FT                   TSICLVNLLASVPKEGQPDAATKSYFEAYNSRIQELLTTSSPLRQKLVEIYYTTRDIVQ
FT                   FKLHCVPIVSQLSELSPLPGDLDSAYNITSLLRPMCLEDIILKGLSELEIQLLISASRV
FT                   VKDQCLENVNFNLVYEEYSKLVKKFQQERISQMSNFQSSTGVVASFNVYEKFLMEKCWE
FT                   TLITKYLLLDINVSSRNTNKSQSFMFNNNISSRSVKFYYLNVTLEELSEILDRDWAKWI
FT                   QY"
FT   CDS_pept        1057622..1058152
FT                   /locus_tag="PAS_chr2-1_0571"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0571"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69207"
FT                   /db_xref="GOA:C4R133"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C4R133"
FT                   /protein_id="CAY69207.1"
FT                   /translation="MTPPQVLQLLKSAKYIHLGTSADDIPHVSLMNYTYVSPEEVLKEG
FT                   FPLSDASHSVIILTTDKDTVKYNNMRANPSVSILVHDWVTKSNSLEAGANHLLSFLKNL
FT                   NQNELVSTSATLAGKAHILSDEKQIEYYKKKHLENNPEGKVFIDGDNVAIVLVQVLSSK
FT                   VADTENNVSEYNS"
FT   CDS_pept        complement(1058219..1059499)
FT                   /locus_tag="PAS_chr2-1_0572"
FT                   /product="AAA-type ATPase that is regulated by Vta1p"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0572"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69208"
FT                   /db_xref="GOA:C4R134"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR007330"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036181"
FT                   /db_xref="UniProtKB/TrEMBL:C4R134"
FT                   /protein_id="CAY69208.1"
FT                   /translation="MSDFLNKGIDLVQKAIEADTATKYDEAYKLYYNGLDYLMLAIKYE
FT                   KNPKSKQLIRNKFTEYLSRAEELKEHLDKQEQTTQSGENSATNGSVKAKKAGGGPDGDD
FT                   DDNKKLRGALSSSILSEKPDVKWSDIAGLEAAKDALKEAVILPVKFPHLFTGKRKPTSG
FT                   ILLYGPPGTGKSYLAKAVATEANSTFFSVSSSDLVSKWMGESERLVKQLFNMARENKPS
FT                   IIFIDEVDALCGPRGENESDASRRIKTELLVQMNGVGNDSDGVLVLGATNIPWQLDAAI
FT                   RRRFEKRIYIALPEPEARVEMFKLNIGNTACELDNEDYRTLASITDGYSGHDVAVVVRD
FT                   ALMQPIRKIQSATHFKPTEDGKYTPCSPGDEGAVEMSWMDLETEQLQEPELTMKDFIKA
FT                   VKNNRPTVNKQDLARFEEFTNDFGSEG"
FT   CDS_pept        complement(1059717..1060562)
FT                   /locus_tag="PAS_chr2-1_0573"
FT                   /product="Putative xylose and arabinose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0573"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69209"
FT                   /db_xref="GOA:C4R135"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C4R135"
FT                   /protein_id="CAY69209.1"
FT                   /translation="MSRYLQLNNGNKIPHIGFGTWELGRSQAANVVYHALKAGFRLIDT
FT                   AYLYRNEKEVGEGIERWLDEDPENNKRSDVFYTTKLWDSQFGYENAKRSIQRAIDQVPG
FT                   LEYIDLLLMHSPNGGPKVRKETYQAMQEAVDQGIVKQLGVSSWGEAHIKELFSWDGLKY
FT                   KPVVNQVELSPWCMRERLVDFCHKNEILTEAYSPLARGGRFNEQVVKSIAKNKGVTPAQ
FT                   VLLRWSIQKGHIPIPKTQTIGRLPENIDVFGFELNDQEIGQLDHPNAHDPTDWDVVNVP
FT                   "
FT   CDS_pept        complement(1060725..1063400)
FT                   /locus_tag="PAS_chr2-1_0574"
FT                   /product="Component of CORVET tethering complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0574"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69210"
FT                   /db_xref="GOA:C4R136"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR007810"
FT                   /db_xref="InterPro:IPR027370"
FT                   /db_xref="UniProtKB/TrEMBL:C4R136"
FT                   /protein_id="CAY69210.1"
FT                   /translation="MDLSIEEVQLEFHIKGKTVDLQVNSNILDLVLENGTIYTIDLSRP
FT                   ENVSTIQLPISAGTQVVGSFSDYKGCHLIVKTKSLDYFYVNRKSKSAISLKKLKNLDLI
FT                   GIKFSDELVGHSTTGPFLVFDEQNVYETCINLNSNKIERYFKNVHHDKSIVDVFWTLKN
FT                   AVDLDIIIFTKTGISTYKDKLEKIHHNSSNFVSVFKKNIGFEELSIRKVYTDDKTYAIL
FT                   TDLGFQLENVKVSLPSNVKASDIKSFSLTKYHVLVMTKHNDIILINSLNSTISARQSAP
FT                   EAVRLSTDSYSSSYWQFNEDSIYEIIINNEAKDIWRILLAQKKFDEALDMVSNDKLNRD
FT                   LILIEKGKNHLELKKYSEGAKILAMTSYNFETITLQLLELKEYDSLLLYLTTKLESFPT
FT                   KKFQMQKVILSCSCIKLLIQMLSDKSLSEEESKNIHTKFQSFVNKFKDSLDKETVYQLL
FT                   IPHNLNEDLLYFANLIKDYDFVLGYYVGLSKWKDAIKIIAIQNDPVIVYKYATVLLLNE
FT                   PNETINTWMKMIENLDIHKLIPSLLTYNRSVSKRIDISNNQAIRFLSYFIRFTGSPDNV
FT                   VHNTFLTMIISYPNSDETLSLKYLEDNVHPDGKISIYFDADLILRLCNRFKRIESMVQL
FT                   YSMLDQYQNAIQLALDNDLLWKSTQIAEKQDIDDKLRKKLWLQISRKMIFNIISNRKFQ
FT                   TDLITYDTDEIGEKIKKTLSFLLGKCDMLTIKDLLPLFPDFVVIDNFKKEIVQSLEDYS
FT                   KEMKLLSQEMDESADISETIKKELAEFKNDSFQIIEPKESCSVCNRILITRKFMIFPCG
FT                   HSFHQDCLVASILESNDYKLKSQISSIEKRMSSKRESRAELREEIDKLLSGKCCLCSDL
FT                   KINSIEDPFISVSDKDDWQL"
FT   CDS_pept        1064764..1065897
FT                   /locus_tag="PAS_chr2-1_0576"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0576"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69211"
FT                   /db_xref="GOA:C4R137"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C4R137"
FT                   /protein_id="CAY69211.1"
FT                   /translation="MVERSVDSDLEQFEIENEEDFDKLIQKPQDTSIVSKITNSDFFGN
FT                   NLGLLLIVISKVFNSVMIVCCKLLEMDPTVDRPIHALEILSVRMFLTYICCYAYMHHFK
FT                   TPDYPFGPKEWRLYGVMRGVFGFSGVFGMYFSLQYLTVPDAVVITFLIPSVVGILARIF
FT                   LHERFTKIEAWGALVSFLGVLLIARPPFLFGERSSDESDHNVETSDPAKRILAVAASLM
FT                   GVVGASSVTIVIKHIGKNVHPLILVSYFSLITFIISTVSIIFTPGLGFHVPQTLHQWFL
FT                   FILIGISGFFMQFLLTEGIQRERKASRSALMFYTEIVFVICWDYLIWKHAPNTLSWIGI
FT                   SIIVTSALTVVLVKDKGSEVPVVQEEPIFLDDIDIRN"
FT   CDS_pept        complement(1065929..1066828)
FT                   /locus_tag="PAS_chr2-1_0577"
FT                   /product="Methyltransferase required for synthesis of
FT                   diphthamide"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0577"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69212"
FT                   /db_xref="GOA:C4R138"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004551"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C4R138"
FT                   /protein_id="CAY69212.1"
FT                   /translation="MLYLIGLGLSYETDITVRGLQTVKKCKRVYLEAYTSILMAADQDS
FT                   LSKFYGKDVILADRELVETGSDDILEGADKDDIAFLVVGDPFGATTHTDLVIRARELGI
FT                   KVEAIHNASVMNAVGACGLQLYQFGQTISMVFFTDSWKPDSFYEKIMGNRKLGLHTLIL
FT                   LDIKVKEQSFENMMKGKLIYEPPRYMNIATAAQQLIEVEETKKEQAYTENTPCVAVSRL
FT                   GAPTQKFKAGTLKELASYDSGEPLHSLVMLGRQLHDLELEYLYEYCDDKEKFREFVLQD
FT                   QEFFKPPPYVAPEEEWSD"
FT   CDS_pept        1067001..1067600
FT                   /locus_tag="PAS_chr2-1_0578"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0578"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69213"
FT                   /db_xref="GOA:C4R139"
FT                   /db_xref="UniProtKB/TrEMBL:C4R139"
FT                   /protein_id="CAY69213.1"
FT                   /translation="MPRVYKRPRRRIASTILKYLTIFATIASLSVFFIGVPSKIFASEK
FT                   LDHLFIFKTKDVSVAGIDLGSGTVNLTVSGTVVKNYTYSNPFLVKTSHLVKEVNVQTSE
FT                   IELFGDVERSVTKLGKAQVQPFELNVEYGKEQDIQWIVTVKPKVRKMISIIEKLVDDPD
FT                   ASLRLRGDTLVKLSLFNGYLPLFRFKIYLDETISID"
FT   CDS_pept        complement(1067702..1069210)
FT                   /locus_tag="PAS_chr2-1_0579"
FT                   /product="Regulatory subunit of acetolactate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0579"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69214"
FT                   /db_xref="InterPro:IPR028012"
FT                   /db_xref="UniProtKB/TrEMBL:C4R140"
FT                   /protein_id="CAY69214.1"
FT                   /translation="MQRSSMYARICTSTELTIEFGTPESLIIVNKVQNLDLQCLSPNHT
FT                   QVMYSFREDSSLSASLAINVDPNLVIRNNTSDLIVEMQNVYSSNKEFNFDMPGTEQDPL
FT                   NDNCLATSFQPDFETNIFMGSSTESEVTTHQRIISQDPQQAQRADSNESFDTSPKAGSH
FT                   IICFQLDNRSSFKEANPGLVNPFETTPPLREDLLLSLPPQNFISTYLLKNRGDDGVGVN
FT                   EHVSETKPVNMDEIGPTGNNIDDFSSSFTAENMRHTSVVLLNSSEFCTEISQQLDFLKE
FT                   QQEFEESNSVVSNQHSLASPEEECSLASLRIPNNISLHHLKKESKFHYATQNQGYLTTY
FT                   SPRVYRTPKNNKNGTQGMCPYCVFDCSDVEEQNLLFFGMKDSSYVHHLGKNHGIYADGS
FT                   VMPDPMFIIPNYAFTEAKRGKKKKSQGSSETKTVIANGAICPNPSCVEGTRHIIPIKVG
FT                   DQMQGSRSSNKFLAYLRHHYEQHKKDTRVTNKSIAYVKQKMRHQ"
FT   CDS_pept        complement(1069619..1070512)
FT                   /locus_tag="PAS_chr2-1_0864"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0864"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69215"
FT                   /db_xref="GOA:C4R141"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:C4R141"
FT                   /protein_id="CAY69215.1"
FT                   /translation="MSAGRLMMPKALMPFRVLSRYSSSSTSALAYKTLHRNKKRPPLPT
FT                   LETPTWSANAAVSSIIYETPEPSKDPSTEHVLNCLVQNEPGVLSLVSGTLAARGFNIDS
FT                   LVVCNTDVKDLSRMTIVLNGQDAVIEQARRQIEDLVPVYAVLDYTNAEIIKRELLLARV
FT                   SLLGPEYFQQLIAHHNGLEESAPDLAASESKFHPTNLLPSERLRQKYQHLDSITKLAQQ
FT                   FGGRIVDISDRNCIVELSAKPSRVTSFVQLIQPFGILEIARTGMMAVPRTPLEAAESET
FT                   VKDVSDVVDASQLPPG"
FT   CDS_pept        complement(1070680..1071978)
FT                   /locus_tag="PAS_chr2-1_0580"
FT                   /product="Cytosolic NADP-specific isocitrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0580"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69216"
FT                   /db_xref="GOA:C4R142"
FT                   /db_xref="InterPro:IPR004790"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:C4R142"
FT                   /protein_id="CAY69216.1"
FT                   /translation="MGKVTVFHLFFFFLGISYCKMAHAKISVKTPLVEMDGDEMTRIIW
FT                   KLIKDELILPFLDIDLKYYDLGIEYRDQTDDQVTIDAAEAIKKYGVGVKCATITPDEAR
FT                   VEEFGLKKMWLSPNGTIRNILGGTVFREPIVIDNIPRIIPQWEKPIIIGRHAYGDQYRA
FT                   TDLLIPKAGELKLVFTPKDGSDPVETKVFDYPSAGVALTMYNLDDSIRDFALSSFKLAL
FT                   EKKVNLFSTTKNTILKKYDGRFKDIFDETYETQFKESFEKAGIWYEHRLIDDMVAQMLK
FT                   SKGGYIIAMKNYDGDVQSDIVAQGFGSLGLMTSVLTTPDGTAFESEAAHGTVTRHYRQH
FT                   QQGKETSTNSIASIFAWTRGLIQRGLLDNTLPVVEFGQLLENATINTVKLDGIMTKDLA
FT                   LARGETDRSSYVNTEEFIKAVAKRLTSEFEAKF"
FT   CDS_pept        complement(1072491..1074350)
FT                   /locus_tag="PAS_chr2-1_0581"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0581"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69217"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C4R143"
FT                   /protein_id="CAY69217.1"
FT                   /translation="MTFNLIHIESISDASLLNVTGSVPFRMQNQFPLTPKNSTVDLPKA
FT                   FEISGVTIYSMQETYFSQGFFMFNRTISQNLKKNGISWVRRLSSQPKAKSRSFRGHKVG
FT                   FVVVGVTGGLYFANDSFRNGVNHLVLTGERVGVVTLATMKCFKYYSTVLTKNFDSKEEY
FT                   YKELDETHKRAALVTLDALRTNGGIYIKLGQHVSAMTYLLPKEWTETMIPLQDECPKSS
FT                   LTDIKAMFEKDTGEKFDEVFSSIDEEPIGVASLAQVHIGTLRNSEEKVAIKFQHPSLQE
FT                   FVPLDILLTKTVFDLMAKVFPDYSLTWLSDELQSSIYVELDFQNEAKNAIKTAEYFKKF
FT                   QKQTALRIPKVIEAHKRVLILEYVPGGRLDDLKFIDSHNISRSEVSSCLSHTFNNMIFT
FT                   PDVSLHCDPHGGNLAIRPLDHKKNGHNFEIVLYDHGLYRDIPLQMKRDYAHFWLAMLDN
FT                   DTTKMKVYAKRVAGITDKQFPLFAAAITGRDIDHALSGKVHTQREDSEIDRMHQALLSE
FT                   GLVYDLMGLLSHIPRIVLLILKTNDLTRFLDEALQNPLGLQRTFLILASYCAKTVYYEQ
FT                   KEDSQKLRGLSWLRSTISLNFAYYKRVSQLWIYDLLVLVRGHI"
FT   CDS_pept        complement(1074568..1078857)
FT                   /locus_tag="PAS_chr2-1_0582"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0582"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69218"
FT                   /db_xref="GOA:C4R144"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C4R144"
FT                   /protein_id="CAY69218.1"
FT                   /translation="MGSQDENLCPSERIKLKRKRNRVPVSCTICRRRKVKCDKKKPICT
FT                   NCKKNGVPHLCYYLEPSWAKPLVNSELLSMGGNPEQLTSAQPVPASIIVNTPSNTLDHN
FT                   QSDSIQKDEEVRQLRQRVQDLEKLLMEKGDTGAQIHRNADGSLPDDREVVNLIANSDIL
FT                   YTTRHEQKFMFPLIYKINIFSWLFITKTDAYLNDLWQKIFNLRRHYEYYYNNHTVADAS
FT                   LASLGSLSTPLKNSLSSGSNFQEPNTLAVDFTSGLSNSSKRPFEHMDQSNQSDFKETEI
FT                   KKEVLSSDRTISQTTTPSSNDSSSGAAPTSMCPVTGEMGQCPVSGNMEKDVVNMKEVNL
FT                   LSGNTGKCPVIPTSESVFPNLSSEEDKNEPRVCPLMIGDARSLFREKLSKLNDTNLAKR
FT                   ALVASAYNSPMLDSTNTAMNHNPGSVQMKKSSSDESKISPSNTPSPSVYQSPLTLTPMQ
FT                   LDTSQDDDKWNGGNTGCPVLGCDMNSKKPKSSKKKIKTFTITSVKHLNYSNTKQAINII
FT                   EKNIPPRKVCWLLVDRFFDLLYLQFPCIDEVSFRKKVASIIGPKDGSTNKIRLSSLGSN
FT                   YNEDFMTVCLLILLIRLSWLSLPINLARKYDRPLTNEEKIMSKPENLVPMVLVDLIKEI
FT                   FTNTKMFGKPSIVILQVGIFLKCYNIFSPEDGFDLDDSYNTSSASDATGDITSESLNLN
FT                   SINFLSSLVTLANTIGINRDPLFYRNFQSTCSNDSQANINLFRKRHLWRKLWFTLISLN
FT                   VVTNISLGDYSKMLAINLDMDPVMGTQNKSWDCKLPGEVESELLSEAFSDPALLERELK
FT                   VVSNYKLEYEVNYTIFQGMDLLINHSKVPSKENVDLVLGKLNDIVKRDERYTGIPTPWD
FT                   MKTEPFLVFYEDSSNSSKLDIVVRIFKFRLFLTAKILLFVINYIMFINYEKELQSCPEE
FT                   KIATYQGYFNRYFEDTLLLAIEDYKLFGDFFDNSAKYFPNHGGELMLYPFLMILNHRSN
FT                   QFLISIILRLQQDSEPTIQLLNHNGIARDDLLMRLFQYLKNFLEKLDQLTKNYYYAWRL
FT                   KKLIRFFYNVLVNSNRLFSINFDNLNSGIERKSIHDRKNSSQSPSATNLFKRLKGSNSN
FT                   SSNNVAEPVQCPVFRNIDTQFVPTLVSQPSSQPASVNGSFSHQSNNKGYRQSIETEGPQ
FT                   SSQAKQIMESFPLFSMENSENIQKNIEFLNDNFFMDLNDFDDAVDDLTPVSTSFPMAEN
FT                   SLFQNSNEIDFTYADISSFSRDRFPAQQEQQQQHQQQHQRQQQQQQQQQQHQQPQQHQQ
FT                   HQPHQQQQQQHHQHQKTQQQQPIAPVSQMLGSSSNLPNDSVQRSSPIFPGSPNRMSENE
FT                   QLTRPFTQNFTGQEELQDGHQNEQLQPRSLTPRSQEQHEQQQLQQRQQQSSQLGVNVVR
FT                   MRTGNTPEQPPQEQSQQPAAPIWNYPY"
FT   CDS_pept        complement(1079168..1080847)
FT                   /locus_tag="PAS_chr2-1_0583"
FT                   /product="Protein of unknown function that may interact
FT                   with ribosomes, based on co-purification experiments"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0583"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69219"
FT                   /db_xref="GOA:C4R145"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:C4R145"
FT                   /protein_id="CAY69219.1"
FT                   /translation="MSQDNPPQQLSEHNETSPTIEQNDSKLIPADAVPPQATQELGGAQ
FT                   ALLQLGNKTKDTDETEKKFTQDLASEAVEAAVMRFVGGNLDSKKRHFTEDMSNITELQQ
FT                   WTGFLDEDFNFQPQNKKKKTSSIHNGNGNSHLSGTEDDNGHRLRNSNTDSNGNKSHHTN
FT                   QKIDPELAQLDSEAATDHDQYVQNVLMDARTLAQLDQDYLRHHDIEISQQQLAAQASQA
FT                   AAQIMAAAVGDVGDDNNKKDSDRQQGNHLGHNAGEADLKPNGGHDEAAELVAAAAAKAS
FT                   NWISGGKTYGKLFGKEECEAIDAFIMEYCKIHNMTRDDICHRIWSNDRKKDDFWDSLHR
FT                   VLEHRSRSSLYKHVRRTYHIFQTRGKWTPEEEEELARLATEQEGQWKLIGMKMGRMPED
FT                   CRDRWRNYIKCGNRRMVNKWSEEEEEKLRQVVHELLNDESSNNVINWTVVSERINGTRS
FT                   RIQCRYKWNKLLKRDATERALTIDAADRIWLLSRIKELGYTSAEMVDWNALSAFHGRNL
FT                   WTAQDFKVCFERMRSTIRDVKKKSFEELIDLLLQEVSKELHI"
FT   CDS_pept        complement(join(1081236..1081658,1081726..1081770))
FT                   /locus_tag="PAS_chr2-1_0584"
FT                   /product="Protein component of the small (40S) ribosomal
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0584"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69220"
FT                   /db_xref="GOA:C4R146"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR028333"
FT                   /db_xref="InterPro:IPR032440"
FT                   /db_xref="UniProtKB/TrEMBL:C4R146"
FT                   /protein_id="CAY69220.1"
FT                   /translation="MATELIVQSEKAFQKQPHIFTNPKAKANKRTKRWHKDVGLGFKTP
FT                   KSAIEGSYIDKKCPFTGTVSIRGKILTGTVISTKMHRTIIIRRDYLHYVPKYNRYEKRH
FT                   KNVAAHVSPAFRVNEGDLVTVGQCRPLSKTVRFNVLKVTPAVGGNKKFSKF"
FT   CDS_pept        complement(1082083..1082790)
FT                   /locus_tag="PAS_chr2-1_0585"
FT                   /product="Cis-golgi localized monothiol glutaredoxin that
FT                   binds an iron-sulfur cluster"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0585"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69221"
FT                   /db_xref="GOA:C4R147"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4R147"
FT                   /protein_id="CAY69221.1"
FT                   /translation="MAKLDKRTRILGLAALVLTIFLLITISHSDVSNVQIVDQTTSGKV
FT                   KIQVETPEKIPPITPKVPADKSDIDHMVNQNDRVVNEKGEIDESKVKDAEESSSNPKQV
FT                   AKSDGLTKETEPFDPAKEFAEIISMSPMVIFSKRGCPFSKKLKAMLQNNYEITPAPTIV
FT                   ELDLHTHGPELQQYIGEITGRSTVPNLLVNGISRGGCSEMQELHDANKLLSSLTQWAGK
FT                   KLQISKVNAPSNH"
FT   CDS_pept        1083396..1087019
FT                   /locus_tag="PAS_chr2-1_0586"
FT                   /product="Guanine nucleotide exchange factor (GEF)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0586"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69222"
FT                   /db_xref="GOA:C4R148"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR001180"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR035899"
FT                   /db_xref="UniProtKB/TrEMBL:C4R148"
FT                   /protein_id="CAY69222.1"
FT                   /translation="MDYRYELDISWLKQSSPEQAKHNDYISDTPPALPEKPPRHFLEAI
FT                   RKESISNDLLLHDLESASYKNPLKGPRVLPQESYHIPTQPLKVPSQKKLPNPLSISPNA
FT                   MNPIQQPLQSLNSPQHLYSPPKLPTLPQLPLKMLKSDSPPHVSDMYTKPLPKTPMERDP
FT                   SSVRVLPPEPLSSERRKSLSPLRVETSDSFGVFGRKSSPLKSTPTESPSKRSWPSPTKI
FT                   YQKLTPERSFRNRDSYSSDEDESIPNDQFTFSDDIEIYPEETNLDDTLDEITYLLEENR
FT                   LNPSQTLPELPFTPNSLLPSDFDALEYSNLLSSIWDWCIRLFEKNLRKLPNYNDLLKCL
FT                   YLLLNYWFPTLSHYYLEEQAGLILQELIQQGAISLSEDNLQIVPNYDAYVNGVMLGLVC
FT                   CYGQHYDNGDYSQCYRPSCAYGKNTFNIQLSKPPLDKVDSSLPVQERIIQYTSGSWDDF
FT                   WGVSLEQVKGLPPKTYELQATIFELILSELRTARNAKVLTDVYSSKFLKEHPSIIKKGE
FT                   RIYEGLFQPLQVWNDVHRQYLVDSLLETIKSQGKFISKFASIYIQWATRAEAVSIAYVS
FT                   KSFLSLKILEAEKKRPGSKLIKWFEDISRSVQSSLIDDYSMIIRAPIFRPIKLQPTIER
FT                   ILKLTNDNDPEKAELAKALNMSRTLMKNVENAVNVLDSQHSIGILKRELDSKHSIDYLN
FT                   LDRKGRYVAESGDVKRKSIIDKSSYHLILLDNYLLITERIHDDPVKKFKIVESPIPVEY
FT                   LLFRAKDKETSSNSGQPNAALDEADQFSFKIKQLGSDTSHTFYTQTREDRNKWLFSIST
FT                   VKQRLSEKVKRYEPFSLSVVSDREFTYSQSDTVNKINPLPKDGALDVAIRSVEDFDDTS
FT                   TKIQSNVLSACSFRYNNQDYVFLGLSLAGYVSLKGQPNSAKRLLELSNIKQCAVLEEYD
FT                   LLIVLSDKKLLYFNLTDVMKVYFGTSHSVEGDRFSRQSVSFFAVARNYENTTMIFFMKP
FT                   KARVSNFKILVPIRDSVSKKFDFFLEHKKFCVDCDTYKMTLFKNSFVVHTSKGFELMSL
FT                   SVLKPHPIPALHYSDLFVDGHTSGNYSSVKKRLNSNNLKPVGIFRLYSSGKFLLVYSQF
FT                   AVFVNRESEIVGECIEFQFKCKSAALDHDYLIVTNDQVIEVWMIGNDDAKIVQFFTGEN
FT                   VVLLDDTPGEALVSMTHPKHPERQLVLSFCLKNQFKRVVQY"
FT   CDS_pept        complement(1087043..1089199)
FT                   /locus_tag="PAS_chr2-1_0587"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0587"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69223"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C4R149"
FT                   /protein_id="CAY69223.1"
FT                   /translation="MDFDTSVDQRLILVISYHLKLFYEHDAPIESLMFLLSLPQKIKQN
FT                   CLFFSPLGKELKDLTGRVRHHPLKPESSSNDVKYQFLLSKSQLNESFLNMVTDTTYSRL
FT                   ISMRSVKSFPDIDQSFLFLYDSRESIPSFIKHRTKIIYIGSNVSSILLTQCLEEHLPIC
FT                   IPFLEYYSYTPGRLFKPVSADHLQFLSLTVLRLYQFPDMKSFEIDCPNLKSLDISFGNI
FT                   ELIKGKFENLKSLKLAHCSTKTFDLIAPKMKNIIIHFSNVHNVHGIFPSMNVCDLYANS
FT                   HQRLSMQAPCLESLTLSKIRGLETFYGSFPCLQAVDLEGSKDLRRLVISEARIQNINAD
FT                   GCTNLVMSYFLVDGRRLPNEGPFRHVDVLKGNFTHLKSMSLNYVPVSSINIVAPQLEKL
FT                   SLQGTPLVDLVGDLRVLKELNLDNCSTFQSMISHAAPTRMKVTFTEDMDFNLNGYSHVL
FT                   KSLSINETPLACVEYTSKSLVQLSLKGCHNLISLKGQMENIKRLDLSSSSLEDFGIHAP
FT                   SLEMINLSKTSNLKVIAGYFPNLLKLDLSYSAVESIAVDAFQLRKLILFGEDLPIVKIG
FT                   SYPNLKTVYISPSSTLTEARWISSVGEQNHVFKATMIKIEGASKLFHKVTRQKFQLFTQ
FT                   SKEKYVYFESREICYVCQEDILELESVFILNCGHFMHYSCTMTYFREGFKVCSICNQKM
FT                   ISFPEFRRCYEPFNHNLLEMTENW"
FT   CDS_pept        1089503..1091332
FT                   /locus_tag="PAS_chr2-1_0588"
FT                   /product="Subunit (61/68 kDa) of TFIID and SAGA complexes"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0588"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69224"
FT                   /db_xref="GOA:C4R150"
FT                   /db_xref="InterPro:IPR003228"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR037794"
FT                   /db_xref="PDB:6HQA"
FT                   /db_xref="UniProtKB/TrEMBL:C4R150"
FT                   /protein_id="CAY69224.1"
FT                   /translation="MNQPPNQPQDNDSQVSSSGMQGGNSMNYSSSAPVNGAGQGPQPQQ
FT                   NSQGQNGKKPVGMQQAQIQLLARRYQLEMQKAHQLGPQTPQGAEHLQTATKIKHVLLSY
FT                   QQQRQRQQGQVQGQGLSQPQGQNQAQGRVQQQTQGLSPDPGSHQGSPQFQQPHQVMMGS
FT                   AQTAGTSIANPQAQSNISSQVSQMAAAKVNSASPPIPPKTVGTPTGTPVGTQPRGQVTI
FT                   QQFQQVKSILEEFEKKLRTIEAAKRDQNLPEETLQKLLRQEAILKQRYAQTKATAYQMS
FT                   QHLQRQQQALRAASAESAEVYVTGSASSPNMNVYNQQILTQQPQQQLQQQQLHQPQPQQ
FT                   PQPARQSPHLLIHQQQQQQQQQQQQQQQQQQHPVTHRPSNVSQTMPQPSQPLQSSTPSS
FT                   AVGRNQSPGATPVTSVNAAAKPSPGTSSTSTLINQHILKPAPPPTEIPARLQVKPPQPA
FT                   AMKIPNRPTLLGGSAISQPSLTTPVSIRPPPLEMEGDHVLQKRKLKELLRNVGADEGDG
FT                   ETVIDGDVEELLLDLADEFVTSVTSFACRLAKHRKVDNIDMRDVQLHLERNWNIRVPGY
FT                   ASDEIRSVRKFQPTAGYNQKVQGVAISKSVNKN"
FT   CDS_pept        1091444..1092418
FT                   /locus_tag="PAS_chr2-1_0865"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0865"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69225"
FT                   /db_xref="GOA:C4R151"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4R151"
FT                   /protein_id="CAY69225.1"
FT                   /translation="MLGVPEPLVSSSRSSIDLVIYWTQLTLIHPALTWVFWLLGLPACF
FT                   CLTVDIIWLIIWASGRKKVKRDKIKVLITGGSQGLGMEVVKKLVPVSDKVYILDVEKPK
FT                   FHHEKLEYHKCNIADTHELSISFDKIIRDAGQLDILINNAAIRGSGAFMNSSQEHFLHG
FT                   FNVNFLSHVGLMRKMIKMHSSNYMNPNIPRKNLHIITISSILGLVGPRNLSMYSATKSA
FT                   LLAFIESLSHEVRSQDVSFATFLPGQLDTAMFSDVSVTHNFLAPVVEAEKLATRIVDAC
FT                   LYTREGTFMWPMYTWAIPILRILPFTIVEWARQFSGMDNQIIQ"
FT   CDS_pept        complement(1092421..1092948)
FT                   /locus_tag="PAS_chr2-1_0589"
FT                   /product="Subunit of signal peptidase complex (Spc1p,
FT                   Spc2p, Spc3p, Sec11p)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0589"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69226"
FT                   /db_xref="GOA:C4R152"
FT                   /db_xref="InterPro:IPR009582"
FT                   /db_xref="UniProtKB/TrEMBL:C4R152"
FT                   /protein_id="CAY69226.1"
FT                   /translation="MSGITKPVNLYSVAELRNATDDALPLALSKLGYEQSFSLIDTKLA
FT                   IGYVATILAGSLYYLEKKYNNDFSNLTYYYSMVALVVGYFALNGLLWLHGKYREKDIKY
FT                   VGINKNNQKKISIEARVENNTTPIYKVTVIENNRLLGKQDIPFTGIFDEDGFIHIDQLV
FT                   EIFTRLLQEKEK"
FT   CDS_pept        1093425..1095194
FT                   /locus_tag="PAS_chr2-1_0590"
FT                   /product="Cytoplasmic protein of unknown function predicted
FT                   to encode a DNA-3-methyladenine glycosidase II"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0590"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69227"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR039739"
FT                   /db_xref="UniProtKB/TrEMBL:C4R153"
FT                   /protein_id="CAY69227.1"
FT                   /translation="MDACVSFLHLYSAYWINQGTVQTIRMSRKGRSKHSKVSADDLLLD
FT                   DHVGKFPSNRKNLVNISHLVEYTLPNDYSSNNRPLNKRLPRPRRRSDSVHLSNMEYINV
FT                   NFKFIVNSTGDFRAQVLDPNVPLKQRDILRVIISKNDAQCPICLNEEPIAPRMIKCGHV
FT                   LCFSCLLRFLELDSTKQCPLCASIIKENEVLPVLISQVDNRFDAPRANEFLSLHLMHRP
FT                   SNDILALPYQFELSEEGGVNGHRPENFPWYSEAHQQFYQYARILKADPLFSIQCYEKEI
FT                   EFIHTNYEEDKLLYNENDIYCQKAIDKIRSLINDERKSMESSPDDISNSYDSSFSKLIN
FT                   DTENLQLQDLMVKQYEKQDQSGYFFYQTSFNSKIKFFLSPLDISVIKAIYGDNFSLFPL
FT                   VLSLKLQDITYETVLPDFLKKHKYLSHLPIGSEIGFLDVEWFEEKGKTFRSILPTQVFQ
FT                   RFKKQLLERAKRTSQRNKREEKNRVKFEKELEQKTLEFYASENNRSLGDYGLASIATRE
FT                   TPTLDSSLIEKSDTNIDLENAVTTVWGTKIIQRSDNIEEPEEDWHMEPLLQQAREKELQ
FT                   KHLKKRSKKKRNQ"
FT   CDS_pept        complement(join(1095273..1097184,1097236..1097240))
FT                   /locus_tag="PAS_chr2-1_0591"
FT                   /product="Coronin, cortical actin cytoskeletal component"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0591"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69228"
FT                   /db_xref="GOA:C4R154"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015048"
FT                   /db_xref="InterPro:IPR015505"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C4R154"
FT                   /protein_id="CAY69228.1"
FT                   /translation="MSGRFVRASKYRHVFGQPAKKELCYENIKVTKNAWDSNLIKTNGK
FT                   YLSVNWDASGGGAFAVIPLNEVGKAPDQVPLFRGHTAAVLDTDWNPFNDLQLVSSSDDG
FT                   KISVWEVPEDYSFFNYVDENGDPKDITPIKKLSGHTRKVGHVQFHPIAEDILLSSSLDY
FT                   SVKIWNVKTGENLQTLQHKDLVTSFAVNWNGTLVATTSRDKKLRVWDIRSAKIISEGPG
FT                   HTGAKASRVVWLGNSDRIATTGFSKLSDRQIGVWNTEDIASGPIGGFYTIDLSAGILMP
FT                   FFDAENKILYLAGKGDGNIRYYEFSDDELFQLSEFHSVEPQRGFAVAPKRTCSIHDNEI
FT                   LRAFKSVNDNYIEPISFIVPRRSETFQDDIYSDCPGDKPALSADEWWSGKEAKGPILIS
FT                   LRDVYEGSELNYHESTQSPEDIKRERVEHQEETSEEVKKPTKVESKSVSVKQETSPAPA
FT                   FSKTQEKGVDELLAKKEVNTLLDKVNNLSDDEPEKQEEDGDWDEAPKRSAEASEQLKIE
FT                   PEVKKESKVVEEPKVEPKKEPKVKQEPKDIPKVKEEPKEEPKKEVKTQEKPDKVPQEEP
FT                   VKPLTEAQGSPKKTLTLKETVEKLGSLVVDLESQISRLVEANLAKDEKLDLLQKKLDSF
FT                   LDK"
FT   CDS_pept        1098167..1104607
FT                   /locus_tag="PAS_chr2-1_0592"
FT                   /product="Presumed helicase required for RNA polymerase II
FT                   transcription termination and processing of RNAs"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0592"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69229"
FT                   /db_xref="GOA:C4R155"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR024481"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4R155"
FT                   /protein_id="CAY69229.1"
FT                   /translation="MDEDSWSELVRSIDLSHKEVSNDQLQEKVLASTFQYLTAQSPERI
FT                   KHLFCDEKNYPIAIHSLILFSFDTTPVLEWYTPKIDYCLNTCQRCISMFHKGRAKLRQD
FT                   FIVTRGLDPQSVSRFMDIILNWELNRILIKFRNAITSSNGGRVQVTTELSLSVVECLYG
FT                   CAMLRLSPELRTLFSTIFSDLVETQESIVPSNSPAFPGVIFFLFEGTDFERNWALSVLK
FT                   SFDSRKLFIEWDLLQLEEYEVHFYRIQDPSFYNSLNCANFWCNILPLIEYTTVDNLELK
FT                   LLLPASYKPMLKEVRFQIVSLDKVLINHVMSYLDYPLPFVLRALNIFLQKFSFKFWSVV
FT                   APHTFFNFMDAILGSPHFLKLLKELETKNCFLSIDKLSSKTPSFNDLIEWIPAMFKSLQ
FT                   GPSQQQMIIKASVFIWGQRDINISYVIELTLPLVLDCLLIQTPIYDSTFNIDVLTQSET
FT                   RVFLDNNFHVVLDSTIATESPKLMDMCCELVRELILFDSKQYASSSYNLNLRKPVKLVN
FT                   FLPKFWSYLSIKIPPSNLQFTSTVLESLKFICGVFVVGIGKQTPPPPGKQDERDNLLSI
FT                   ISKHNKNTELFFTQASQLLSTLVTFDPSVLRTALNGKQASIGYWSCILSSNQELYQSAA
FT                   NVLYEAFDVEGRLEGTRALLELNLQICLQSVVENLNTLLLLKVYELCPRTLRVLMDLLH
FT                   SLCDPVTGVFIENNSYDSKTRESILSFWNVSWDFLCLIYDRTTYWASIYSVSVLIDFAR
FT                   DTLDTSHLLLDGFRSFMNVVSDKPEIKNFLFDKIMLTFHKVLTWLRLGDESLLTSCLSL
FT                   VMKTLNLATELELPFDNDIIELLAKYGARAKKFNNKLSETQQFEILERARDFNSDLVNS
FT                   IVAEAEEYRNSKFNLGSVESPISIPDEKPVKKLQSDLSKYIKYVKEQDVPAIMPGSRIK
FT                   EIARLSAKEKAERDIRIKRMGKPEKAPAAPRPPGFNSSKKKRAEDSSDDEDEEDQNDNA
FT                   LDTLFHPNVEELKSKTARNLREKGKMKAQLLSMDRPKVNAAEMERKKAEYRMRMRLNVD
FT                   MNPLYAKVLQWSFKRDSRTPDNADLTTYKAISDSYDSVEQYQNTFEPLLLLECWQGIQQ
FT                   AKETGQDQPFNLVVGSKTTTGNFFDVYASVKKSVLQDRKIGDNDLVVLAYVPDGLKNMQ
FT                   GLDESVPRTVVKTSEHSCLGKVREIKYSNSEFCDVTIRVHNRNNISPFLTSRSELTGLK
FT                   ILQMVTIEREYSSLKGLPFYDLSDKIVKAKSAEPFNIDDTTLQETMVKFRVNKSQAQAI
FT                   AGASTSSGFSLIQGPPGTGKTKTILGIVGKVLTTRNNLHSTPISIPGAVTSGPRKPETG
FT                   VRKVLVCAPSNAAVDELVIRLREGVPGISGQMFKPKVVRLGRSDAINSAVKDLTLEELV
FT                   DAELNETARAPKADQSIREKHNKVLAERNSIREALKEVSNLKPEEVKDLQKRYSEITKA
FT                   KNELGKKLDEQREEVSVSYRNREIQRRAVQFRILSQAQIICSTLSGSAHDFLATMDTSF
FT                   DTVVIDEACQCIELSAIIPLRYGCKRCIMVGDPNQLPPTVLSQAAAEYKYEQSLFVRMM
FT                   NVHPKSVYLLNVQYRMHPQISVFPSKEFYNGKLIDGEGTETKNTRSWHKKIPPYCFIDV
FT                   TGKESTNTSNKSLFNRAEAQAVVSLIDALLGLDRDFNFASKIGVISPYKQQVVLLRDMI
FT                   LRKFGRNIGIDVNTVDGFQGQEKDVILFSCVRADETKGVGFLADVRRLNVALTRAKSTL
FT                   LIVGHASNLSGHSLWRHLVQDSKDRNVFFTQRSLLDGGKGDVTVGVLPSGKGKRKIEGI
FT                   LPPEKRKNTTANRNTDFKGQLNNEQRSKFKGQKNGKKSSKDFSNVTPSNTGYVAPPTKG
FT                   SLSMDSSAPQVKSGTLPSKPTSSSQRGQKVTSDSRLNRVDSKVLPSNDFETPGFITGVL
FT                   PSSRGSSRDKTLPPTASPLSTPSPTSLIPRPGVLPPKPPISKLPSNPQTSATSLGPSMT
FT                   SFSRPSMIQSPVVYNHPTMSQPNLAYNSHVPVNSGVYPGSSSVNLPIMNPTLPAALPLQ
FT                   SVSPVSESSNDPHSVSSKSNQGYLPPQSQPSALQNRKSDRQPSSYGLNSNIDPRSGPKL
FT                   AEPTDHFVHAGEKEKKKKKKKKKDKSSDKEKYKEKA"
FT   CDS_pept        complement(1104732..1105814)
FT                   /locus_tag="PAS_chr2-1_0593"
FT                   /product="Dihydroorotase, catalyzes the third enzymatic
FT                   step in the de novo biosynthesis of pyrimidines"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0593"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69230"
FT                   /db_xref="GOA:C4R156"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C4R156"
FT                   /protein_id="CAY69230.1"
FT                   /translation="MKLSLGITADLHVHLRQNKMMELITPTVRQGGVSVVYVMPNLTPP
FT                   ITSIAQVVEYKAQLQKLSPKTTFLMSFYLNQDLTPQLVEQAAQEKLIRGIKCYPAGVTT
FT                   NSKLGVDPNDFSKFYPIFTVMEKHNLILNLHGEKPSVQSEQNEEDDIHVLNAESKFIPA
FT                   LFKLHKDFPNLKIVLEHCTTKDAIEAVQKINENTTGTPTVAATITAHHLSLTIDSWAGN
FT                   PINFCKPVAKLPRDKKALIDAATSGKPYFFFGSDSAPHPIHDKSKHIGVCAGVFTQPYV
FT                   LSYVAEVFEQRNALDKLKDFVGTFGLSFYGITDDELVSKDTVSLAKKDLFIPELIGEKD
FT                   LQVAPFKPGETLHWEAIWDN"
FT   CDS_pept        1106166..1107821
FT                   /locus_tag="PAS_chr2-1_0594"
FT                   /product="Protein required, along with Dph1p, Kti11p,
FT                   Jjj3p, and Dph5p, for synthesis of diphthamide"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0594"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69231"
FT                   /db_xref="GOA:C4R157"
FT                   /db_xref="InterPro:IPR010014"
FT                   /db_xref="InterPro:IPR016435"
FT                   /db_xref="UniProtKB/TrEMBL:C4R157"
FT                   /protein_id="CAY69231.1"
FT                   /translation="MSQAPALSTHQEADQFQYSQIEEKRIERYYLGEYSDLKQRIIQFY
FT                   DLDELKTKLQEKDNDGRLKYKNITLQFPDSLIADSSIVLSYLQESLVTNEDCSTKSYPD
FT                   VEEIGCKGCVDCDKRDKNSKSQDSDKQAIWILADTAYSSCCIDEVASGHVNGDVVVHFG
FT                   DACLNPIDKLNALYVFGKPHLNAEKIIERVEELCLEDDKVVLMSDTPYSYNLYSIYREL
FT                   KPKYPNLAYADVDFDLQRENMEVIGKWSQPQDEDSIAFANRRIFGLVDEISNYKLFHIT
FT                   LPADPRLLFLSTNFSSVEIFDCKENCTVLGPFPSLMKRYKHMHVGRTAGTIGILINTLS
FT                   LANTKIMLNTVIKAIRAAGKKHYIFVVGKPNVAKLANFDPIDIWCILGCGQSGIVIDNV
FT                   GDYYKPIITPYELQLALKPEVSWTGRWVTDFMEVIENGEFDLGNDEDTENDIVERHKDD
FT                   APEFDAVTGKFSTFSRPLRQLKHLDVEVIENQDETALVKKFSSNLAIQSTVSTSAKALQ
FT                   ERSWTGLGSDFKDLEEYGAALEEGRNGIARDYGL"
FT   CDS_pept        join(1107991..1108042,1108100..1108575)
FT                   /locus_tag="PAS_chr2-1_0595"
FT                   /product="Calcineurin B"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0595"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69232"
FT                   /db_xref="GOA:C4R158"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:C4R158"
FT                   /protein_id="CAY69232.1"
FT                   /translation="MGLASSKIMDSLAEGTNFDREEVDRLRKRFMKLDTDGSGTIDKKE
FT                   FLSIPGVNTNPLAERLLDLFDEDGGGDIDFQEFIIGLSTFSSRSSITDKLSFAFKIYDI
FT                   DRDGFISNGELFIILKTMVGGNLKDEELQQIVDRTLMENDLDGDGKLSFDEFKSAVDHT
FT                   SIVNKFTLNLGI"
FT   CDS_pept        1108732..1110570
FT                   /locus_tag="PAS_chr2-1_0596"
FT                   /product="ATG28, autophagy related protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0596"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69233"
FT                   /db_xref="GOA:C4R159"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4R159"
FT                   /protein_id="CAY69233.1"
FT                   /translation="MICLFGNCNCQTGIFGLYDYVSFLYHSPSSCRVRLVLSLPASPNH
FT                   MEEQSPKFESSFPRRTSEGPVDDVGKSPPASFYRELLANKAQQPQLSEDEEDHNPKDFL
FT                   FKEDSEDELLIPDSENHNSSSTSPRKFKVENIRWGSDTLNGSILPLNSQGSNLQSLLSN
FT                   VGELEHLLSKDVAKHSKYLKEQSSKVEKARANIVTNLTRLSLVLSSIFNTYQAKAQDKQ
FT                   AILDKIEEWEDEKKSLLDDMKEVLSTDDNADGETHKFLELASESINVENEIEALETRLK
FT                   QLKIKQRTLKNECFQSQGIIESRLSNFVQAVEKIEMRERKSIEQVVQQLSENQLGYWND
FT                   NLALEVMNGLTINPGDISLVEEYEPVDILKQVESLEKPTIAADYHLPKNTNKQASRFTR
FT                   QLLEFNYKCQPKLNVYPVVGLITKELKEDSAKEQEYKHRYDQVTHTLSALKDSFALIYH
FT                   TEQQLQSITQSTQDLKDFQSLMNQMVESLLKTHSEADQYNLYLAKDVLAQEISIIHQAL
FT                   NKLNQSTEYSSVESDNVKNHDGLLFQTFSKAQERTKLPSIKSATSIRYAPSLYNSLSPT
FT                   STSKTTAKGEVNYDAGINKYTKVKEVLRSGKGNKDE"
FT   CDS_pept        complement(1110600..1110989)
FT                   /locus_tag="PAS_chr2-1_0597"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0597"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69234"
FT                   /db_xref="GOA:C4R160"
FT                   /db_xref="InterPro:IPR006773"
FT                   /db_xref="InterPro:IPR038633"
FT                   /db_xref="UniProtKB/TrEMBL:C4R160"
FT                   /protein_id="CAY69234.1"
FT                   /translation="MAIIKFNAGKVKIDEETKLCTPLATRGEIIVQLSAEGEEFYDFKW
FT                   VPTENTAGEGNQSETFLVIPGDVTWKHVKSCKDGRVFKLTFLSSGAKSLFWMQDDNGNE
FT                   DDPSELTTKDKEISEKITKLFDEEE"
FT   CDS_pept        1111288..1111806
FT                   /locus_tag="PAS_chr2-1_0598"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0598"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69235"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:C4R161"
FT                   /protein_id="CAY69235.1"
FT                   /translation="MHFPPESVKPLVKEIAQHLIENNETVAVSEGVCGGLLSAYLVSIP
FT                   GASQFFLGGTLVYSLKSRLKLSGWDEKDISSYTGPSEEVVLRLARNLKMELGATYVLSE
FT                   TGFAGPSGQYGKGSDQDEEVGTVYLGISTPQGDLACVKRTGIKSRSDNMALFAEEGLKF
FT                   LLEHLKSTK"
FT   CDS_pept        1112231..1117801
FT                   /locus_tag="PAS_chr2-1_0599"
FT                   /product="Protein of unknown function with similarity to
FT                   human DOCK proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0599"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69236"
FT                   /db_xref="GOA:C4R162"
FT                   /db_xref="InterPro:IPR010703"
FT                   /db_xref="InterPro:IPR026791"
FT                   /db_xref="InterPro:IPR027357"
FT                   /db_xref="InterPro:IPR031057"
FT                   /db_xref="InterPro:IPR032376"
FT                   /db_xref="UniProtKB/TrEMBL:C4R162"
FT                   /protein_id="CAY69236.1"
FT                   /translation="MMSEWSPLPKMLHGRFLKAFVPFESLPKGKAKQFSSELQDIHPGD
FT                   ECFMFETNGDEWARGYVISQPLLSEFSAAAIDLNKIPERKVTLGVFPRSYVFTIGEIST
FT                   EASPKQTDDSLEDVDFPNSVPTLYDTELQIKSSSNPDELLVPKSTALTKPNLPLIQLND
FT                   VDLLDEIVATLISLSSHIFTMYSINELYLFQRLHEIYLQLDDIRIDLQNNLLTKAEKTM
FT                   AKKNATYLMGTIVKLLASRGDTNAGANPKSKLTRSDISGYQAIMSRSHVTGNLLDFQKD
FT                   KINPAELVSNQLLFALSPNYPVSTKINADLTPEEDTYLKAVPTSHILVDVKNVSGSLSF
FT                   FPKGYNGMTAYIFLRTSKTRLTEAFSIHIRPGDDLSLENLSAALFKNIPATATESGKIY
FT                   LVAILTEGIDVASRSGKPVSLNQIRKGIAAGVTDVSRIFSRLKGSLAAGEAHQFIIKLF
FT                   TSFITESDNSNSWNINNGWGELIERIITGSSRGVAVNPRAERLILSIKEFKNEGISDQS
FT                   TLNNSLAIAPIRPLFYDPLSANRERIYIQLVNVTTTLDLGKTPFITTHLKASNKNYSFQ
FT                   KSSNEVPKDHWEFLTVAPGEYVNEIILLNNIPSKPRSSTSDYIIFTIFGNEEYLGEAKL
FT                   LFYDGKSVFEDKKGCSIDIMSNDEVVGKVQVEVDYQGKVYNLDPNLESILNWKSIFANN
FT                   FKANEESICSTLTKFGRTNVLTVVKYFAALVMSEFEIYEAALENELPTLSKVAFESIVH
FT                   LLDVAIARQKSYIYLFDDFTRNYAKLLPKVAQPFLNQIVSIFENAEQEWSHVSRSLCRA
FT                   IRLLLTLFQNMADVLPRIQLHNNLTRLVNAIAKFFSFKKDNLVSDQVLILSQVLHIRET
FT                   LLLGFTPLNVCKDMITWFDIIGTRGLGTLEQGANVQNKPLSRERELVITKLILLNRMLH
FT                   KSYNDDSDISNLLSNYAIHVSLEVLLGQSDVSASRLSSTILISVFSATWQKGDDATEQE
FT                   LLTIAQLLPLMSKIFNKYYKSYKRNDLQAKRVFTQLFQTSYPFTEHTVDSVVNNESFSE
FT                   LLLEFSTLLTFIVQAGQRLSDETGIMKVLEMSSKLQGKEPDILSSEVLLSILKTLKFID
FT                   EGMFYPKDKWLSASALFTVTSYGAFELIAHTMCTYYIPSVDNSESFDRLLWANFLRTLL
FT                   KISTSMPVAIEHLTSIPAIGCLKITGDLRVKTAKLLENIWDKLAWEALPEDVHRFQLKR
FT                   FGGYQVEFINYDFSCFKDLILLSLQKHESSREVGVKMLGSIIIAEWLISENLFDVEREC
FT                   ILGCYEIYNSEGYRPSSEEQQLFIKRLKQILHVDPEDVAYKPVKKFVSTLAEFLEILND
FT                   LENVPLGDEFDDERTFHKLNISGYLMEVNSPEVLQSFINGMYEDNKLKENFVQAALSLE
FT                   LLANTYDWDIDTVLPRCYEPEFPAQTPFERKEALFKLIADNFAKGNRLEQAVDCYKELI
FT                   EAYDKVSFDLRGLASAHAKLAKVYKGLEVVDRVTPSYFKISFIGLGFPTAIRGRQFIYE
FT                   GLPFEHITSIHDRLSRLHPGVRIISEEEEAEKLIEEVPFGRFLHVKTVEPFKDLASNFT
FT                   HATISMKRYMDNKDLKVFVSTRRLPGATGVTDLWTEETTYETYLTFPVLMNRSEIKSVK
FT                   TVKISPLENAIRLLSIKNQDLATLELFIRHALKADEDTLGLFNDLSRQLAGTIDSPVNG
FT                   GVTQYRVFFTSEEEAEDSFSGEEVKLLKSEFNDLVLLLGRCLILHGKLVSKSLKKSHDS
FT                   LIDLFEQNFTDEIQELEIDLESIRNAKMIDTKYSDHLPNFRPSSIRTESIHSVGDNSRI
FT                   EVSSGSLLSESSSRLTNLTDGTSRSAATRKRTALNWRRNRS"
FT   CDS_pept        1118839..1119921
FT                   /locus_tag="PAS_chr2-1_0601"
FT                   /product="Conserved nuclear regulatory subunit of Glc7p
FT                   type 1 protein serine-threonine phosphatase (PP1)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0601"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69237"
FT                   /db_xref="GOA:C4R163"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C4R163"
FT                   /protein_id="CAY69237.1"
FT                   /translation="MSKEEEKAALNSSDNNSIYETDPEDVQAPGNPISTLDTATGFSLI
FT                   DDTNPQEIAADEDLADELASDLEYLDLVHLKVKSLENLNLDRFAQLTGICLRQNLVDSL
FT                   VPLKAISKKDQVTELDFYDNRINHISKHVNEFENLEVLDLSFNKIKNIKNVDRLSKLKK
FT                   LYLVQNKVHEIKNISNLKSLETLELGGNKLTEIGEELLNLSSITDLWLGKNYIQRLQNL
FT                   DSLKNLEILSIQSNRLTKIEGLEELVNLRELYLADNGISKIENLDKNTKLEVLDLTSNK
FT                   IEHLENMSHLTSLTDLWFSYNKISSFAEVEKELSKLPQLDTVYFEHNPIQTENPTSYRR
FT                   KLKLILGSSLQKIDATYIRS"
FT   CDS_pept        1120137..1121294
FT                   /locus_tag="PAS_chr2-1_0602"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0602"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69238"
FT                   /db_xref="GOA:C4R164"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C4R164"
FT                   /protein_id="CAY69238.1"
FT                   /translation="MAEDRKKRVGKACDSCRIKKTKCDGKNPCSRCISDNKVCIFSERK
FT                   RFKDRNYPPGYVQLLETRLNLVLNGLEKIVNLVRKDVDLSELKSDEFMLQPEEEKVNIN
FT                   RVLSWMITQQDLVTNSPVEWDCESDIAAKLTGDVSDFQASIHKVLEQKKTQGRKESSSP
FT                   LDKPSTHLSTVYNVDNSSVSSNEETADINPQVEDNPLPILDNEDNNLNPDSSNTFDFNN
FT                   VNFELNLGGFQSGAALATAAMDGGLSMIDFENSPSMGGYSSSDQKSDLLDFHDESYIPP
FT                   TTLQRKNYNSNSPLTSPPLNPQNMRRSSSFKTTRRNSNSHLGYISKPQSNSHIHTGLKN
FT                   SPVAGIFLSSEADGSSGNSGTFSSIHSPAGDSFPTSSPNNKTDEY"
FT   CDS_pept        1121508..1124423
FT                   /locus_tag="PAS_chr2-1_0866"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0866"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69239"
FT                   /db_xref="InterPro:IPR021386"
FT                   /db_xref="UniProtKB/TrEMBL:C4R165"
FT                   /protein_id="CAY69239.1"
FT                   /translation="MYEEEVFDLPQDILDGLVSNVVEANEETKSESPKEQQEEFELEIT
FT                   DDILNRLVNDTVGLLEQQGQKAENKPSPEDAQGEETISNDQSDKDQTQKQTEETNHADK
FT                   EKPQLPSEAVTEDRNNDSSEYGKLLEDTEAILQQYESSKSGPQADSRVSTRPAQETSDI
FT                   ASQQQDSTVKTNNSQQTGHEIESEVNFRDMLRLAEQHVQIDQLLSGTSEEISHEILEQL
FT                   ASATAESIQNQQKQLAKEFGVPKQQQLQREFLNRQKQQQKKVETSPDENLQEALANMVQ
FT                   SVVNNVVENSRNEKADVSKSDLDTATSSRTKASESHDLDQTQLNQILENAVAMAISNPN
FT                   NLPDNAPTNQETKQSKISNETAAITSQEALDAAKARLSKLPIKPMKRAEEKNKSSDSST
FT                   NSGAGGFNQSPLQSTGNSSLLEAIRNASQSAMKQIQEYRKTGSTVPPSKEVQIGSASSD
FT                   MLPNSQASVVNDSVTKKAASSKAQDASKKRGLSIAQTLAITRDQMVRKASTEPQNISNL
FT                   YSSLSRNSSLYLQRQQMLNSMKTKPHESNKSESMDSLAFLPATISEEVSRITGLSSDAI
FT                   RNIFNTVNSAVDLIAPSLNRKSLEKANMDLKEKIRMDNRERKKRWRELNVDKNRDNDLR
FT                   ARVLKRASVLFPSADEEEKKKKWVQEEFTKRKQKRLERERENKPVYSAFETKKEANSKD
FT                   NHKASSELTTTTDTVLKQFSDLGLPDDPKFATDFTELYKTFQNSTSSVYSSKNSLINTA
FT                   TAAIVAYASLNQEPALKQENLDVTSKFGSMINNIVSALLNSTPQEAAVKEITGLPAGAM
FT                   SSFKIRKDSPNQNSSTADTIKLPSKVPDAELTLLIKNKNSSATNSSNSQMIGALRNLNL
FT                   NFTTEKRKMDDVPIAVDDSTPGKKLRTEDRKNFSAPWTFNTLKLPQYKKPEVGKPVYTP
FT                   APPRLAQPNTIPDREASKPLSFGGINLRKPGAFRKPKTTTQ"
FT   CDS_pept        join(1124542..1126582,1126695..1128574)
FT                   /locus_tag="PAS_chr2-1_0603"
FT                   /product="Putative helicase with limited sequence
FT                   similarity to human Rb protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0603"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69240"
FT                   /db_xref="GOA:C4R166"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4R166"
FT                   /protein_id="CAY69240.1"
FT                   /translation="MAKKKSKKAESPQPEAAATTRSRESREEAEKKRKANRLLVTNSST
FT                   WTGKLPVNLLHEHIQKRKWNKPEYDMKRVKDGFIAVVTLSWENPKTRETLRIRFEPIKE
FT                   VVEPQETPLEARHFAATYCLHRLAFSKNIHMVLPNNHKDFWKDLESYRKDMEKNKPYKY
FT                   KYEYTEEPFQMLLEKRKDEAEAQKQKEKEANNPQKLKIDRSKKIPVNYSTRNEVTFPRK
FT                   VWEQSPLLDLGFAFRRKIEKLLSGSWQKLFEDKKASRPEYVDSLTFLGFRNAHIEECLL
FT                   YTNNFNNSLEWLLFNVPEDDLPPFFQRDERDSTVEIKLSIDSKKDNIIKRLKAGGFDEE
FT                   QVMECYRSDEVDAAIALTYELVKYEPPTTEASDDLNIWEEEIEAITSIIEDRIKKTGDN
FT                   IVEFELDLENCSQCFILRVFKSPGYPSTLPGIHILTPNEKVANYIKQSIIQQLVAYLQE
FT                   NSIIGDQMLYSMFSWLEENISKIIENPGPLIKDDIFVTDAQIASVTGKSKSKNKQRKKH
FT                   TDVSRIKADYEQRVGLIDLESRTKLPAWSHRNRMVEILEENEIVLVTGETGSGKSTQIV
FT                   QFLLDHMNAQNDFSSQIICTQPRRISAIGLAERVSEERSDKCGKETGYIIRGENNTGKL
FT                   TRITFVTTGVLLRMMQSLLKDDDSSFDLDQIRYILVDEVHERSIDIDVAHTHIEGRTYP
FT                   IKDFYLDEVINLIDYKIERNNELVTPNPNSDFFKYRPLDLDLIAKLVFKIDSQLNSSGS
FT                   ILVFLPGAMEINSCIRKLKSAFNEGSLWALPLHSALSSKDQKKVFQKPPKGARKVVLST
FT                   NIAETSITIPDAVVVIDSGRVKTNVYDTKFHSTKLIETLCSKAEATQRRGRAGRVTSGL
FT                   CYKLYSKETELENMRDHPVPEIMRTRLESIYLIVKSMGISDAREFLKTGIDSPDDNLLD
FT                   NAKQFLHDIGAVSEDKLTHLGEYLSMLPVDLHSGKLIIFGTLLGALETSLTLAAIATTG
FT                   NPFIENKENVRAVKRSFANGKGDLMAIVEAYVQYSNLHTSPYKWCEQNCLSPMVLKDIS
FT                   STRDHYLSILEDIGFIPLNYTRDHQVLNRNDSDFKIVSSIITASFYPNIAKVNYPELKY
FT                   LKSSAGTIAREADARETKLFMKNQNYTIGSEALPSNRCFIHPGSSLFATSDAVSSVAEL
FT                   QLFDKTDIDSSKIGSAKLPSQLHSDFAVYRSSQVSVRDQNTKIYLRDITPTSSLSVTLF
FT                   GGKITYNLNTILAGRKSPGIVIDSWIPIVTWSKNGVLLHRLRIALDEAIKVRLSKAAYN
FT                   HVQNGGDNVLGLVEELIKNFRY"
FT   CDS_pept        complement(1128580..1130700)
FT                   /locus_tag="PAS_chr2-1_0604"
FT                   /product="Subunit of the Anaphase-Promoting
FT                   Complex/Cyclosome (APC/C)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0604"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69241"
FT                   /db_xref="GOA:C4R167"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR014786"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="InterPro:IPR036317"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4R167"
FT                   /protein_id="CAY69241.1"
FT                   /translation="MSLRPLDRSAFLSVFQSENVLPDLQQDWELVKEWINQSLECQGST
FT                   KDPPLRIRTSLRSLNNQHSSGPHLRELFLRVFRRYPIVVDGSLYNRLRAVKAVNRKVVE
FT                   IVRCMNLDENDRSAVERATNAVLQRTIRECPTLEKDLESMILIVLNGQDSYEEERAFKA
FT                   MKLIHMGDYLGELTVQLIRAKLASYINITYGGKWDHYVLPELRSWLYEWLLPRIYRIID
FT                   PNSFRADSWIQVIYDELITIRINESFDIVENFDIAEPCLEEMKNCLIHTHVREHLVSYF
FT                   TKLCQERLLHAGINTSTIISFYLLVIKAFLKLDPRGVLLDKVCRPIKHYLRDRDDTVKR
FT                   IVKALLDENSNELGQLSKELSKPPLAETHFIHDLRDLHWVPDPSEALPDFKKNKISDII
FT                   ESLISIFDSKNVFVNEFVSIISSQLLDLTSYDFADISHKIDLLKVRFGENEFNSLNVMI
FT                   KDVNDSKIIDRKIHKNCATIPENLHSSIISHLFWPQLEKDRFLLPLEVSNSIENYVKEF
FT                   STVKPERSIEPIHSQGRVTLSIDVNDQTRSFTVTPDKAAVILKFSADDSSRISWEIEKL
FT                   SEELQMDIALLQKNLQFWRQKNILQQSGSVWSSVTSFEEQESGVSEDTNAHDHNDQEEL
FT                   AETMQKYWPFIVGMLTNLGPTALSQMHSFLKMLVPQETPYNATEKQLELYLHSCIEEEK
FT                   LEVNGDKYKLKK"
FT   CDS_pept        1131218..1131991
FT                   /locus_tag="PAS_chr2-1_0605"
FT                   /product="Putative Nedd8 ligase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0605"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69242"
FT                   /db_xref="GOA:C4R168"
FT                   /db_xref="InterPro:IPR005176"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014764"
FT                   /db_xref="UniProtKB/TrEMBL:C4R168"
FT                   /protein_id="CAY69242.1"
FT                   /translation="MAPRSVQKLVESFKEVTDLRDSEATAWLTKYKWNLEDAVEAYLTQ
FT                   TSMNSQGQNFLTQEQKGSLISLFNKYKQDGEDYIGIDGTIQYIEDLEFEVEDPVVLALA
FT                   EFLESTQMGVFERAKFVNNWEKAGISSIHEMRQKVLEFQRSLENDEQFLKKVYDFTFKF
FT                   LLDNNQRTLLKDTAVEYWKLLLSHYFGEEKMSQWCQFINDEWQFAITKDQWQMLFLFMS
FT                   EWNQKDNFIESYDENAAWPSMMDTFVEYLRAKTSS"
FT   CDS_pept        1132185..1135007
FT                   /locus_tag="PAS_chr2-1_0606"
FT                   /product="Nucleolar protein, specifically associated with
FT                   the U3 snoRNA"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0606"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69243"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007148"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR024977"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C4R169"
FT                   /protein_id="CAY69243.1"
FT                   /translation="MVKSYQRYELGKSFGVISSDSNIVYLPQKKSTGKVITGGLEDILV
FT                   WDIKTGELSQKLHDGIPIGAADASVSGAPSQVVRLEYHHNNNIVAAGYSDGSIKIWDLT
FT                   SGTVVMSLQGHRSAVTILVFDRSGTRLVSGSRDSTMIVWDLVGETGLFKLKGHKNEITG
FT                   LLLLDGTEAKDDEEMEDWLVSVSKDGLIKLWDLKAQQCIETHVAHSGECWSLGIDIERR
FT                   IIITTGTENKCKVWTLDLDAPNKVSERGLFEKKSKQRGLTTSFKTIRGNSFFFIQNADR
FT                   TVEIFRLRSDAEIQKAVTKRTRTLKEKGLDEDEVEENLKSGDINRLIQNFATVRSMAKI
FT                   RNCTWTEKADLLISLNNNSVEYYTVSLPENVKKHQSTDMIYKKAHSVEAFGHRTDIRFM
FT                   DISDDGKLLTTASNGLLKVWNVNSLNCIRTFECGYGLVVKFLPGGALLVLGTREGNLEL
FT                   YDLASSTVLDSIQAHEGALYQLDITPDGKSVITGGADKQVKKWDIKLEMVEVLGSKEKV
FT                   ASMSLVNSRNMEMNDEILAVKVSPDQQLLAVSTTDNCVRVFYLDTLKFFLNLYGHKLPV
FT                   LSIDISQDNKIIITSSADKNIKIWGLDFGDCHKSIFGHQDSIMSVRFISNTHHFITTSK
FT                   DGMVKYWDGDKFECIQKLAAHQSEVWCSAVSLDGSFFVTASHDHSIRIWEETNDEVFIQ
FT                   EEREKEMDEQYEETLLASLEEDEDSLAKRKEEIDEVTGVTKQTMESLKAGEKLMEALDL
FT                   GTKELDAQEEYEQTLAAFQLKKTLNQPIKPTPNTILVVKKMTPAEYVLSIVLAIKASQL
FT                   EDALLVLPFSYTIKLFRFIQIWTDSENGSKNIVNLSTISRLVFTLVRNNCKELISQKED
FT                   KINQLIISVRDQLRKQLSLSVDDIGYNVEGLKFLKAQWKLAHSTEFIDEEEQKRYEEKH
FT                   VQKRVYQTVE"
FT   CDS_pept        complement(1135426..1136013)
FT                   /locus_tag="PAS_chr2-1_0607"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0607"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69244"
FT                   /db_xref="UniProtKB/TrEMBL:C4R170"
FT                   /protein_id="CAY69244.1"
FT                   /translation="MPDVPPDPNTYPKDGITIDTADIEQTLRGVNVLERQRLMDQLPNY
FT                   NDRLFFTKFFKAYIALPETCGQLLMDCETSQSVNSNGNATQSRDQTDCGIEYDPESNDF
FT                   LKYEREMELEMILREKVEKILKSDVLRSGNKLCSSTSVQGSTCSIKPRRKDMVEYDYEG
FT                   NSFFQKLWRKLSKKIGEGGPCYYYSQKRRTAN"
FT   CDS_pept        1136831..1137805
FT                   /locus_tag="PAS_chr2-1_0608"
FT                   /product="Activating gamma subunit of the AMP-activated
FT                   Snf1p kinase complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0608"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69245"
FT                   /db_xref="GOA:C4R171"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:C4R171"
FT                   /protein_id="CAY69245.1"
FT                   /translation="MFEQPQVELSSEQINQEQKRALDAIRVFLQSKTSYDVLPVSYRLI
FT                   VFDTSLLVKKSLNILLQNSIVSAPLWNNKTSRFAGLLTSSDFINVIQYYFQFPDKFDLV
FT                   EKLTLDGLREVEKSIGVSTIETISIHPFKSLYEACEKMLVSKARRIPLIDEDENTHREI
FT                   VVSVLTQYRILKFVALNCKETRMLLKPLKELQVGTMAEMSTVTMETPVIDVIHLLSNKC
FT                   VSSVPIVDGEGKLVNVYEAVDVLGLIKGGMYTDLSLSVGEALMRRAEDFEGVYTCTLND
FT                   SLATIMETLRKSRIHRLFIVDTDTSLLGVITLSDILSYLLFSQ"
FT   CDS_pept        1138023..1140245
FT                   /locus_tag="PAS_chr2-1_0609"
FT                   /product="protein of OPT family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0609"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69246"
FT                   /db_xref="GOA:C4R172"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniProtKB/TrEMBL:C4R172"
FT                   /protein_id="CAY69246.1"
FT                   /translation="MPILARLCQDPKPWEEKPSLKQITPRSILAGLLIGTIVLTSNFQF
FT                   GLQTGWVSMMSLPSALLGFATFKALSKKLSYPFTDVENVFVQSVAVATGTGPLAYGFVG
FT                   IIPAMEKFMTEEESGLGATLKLSLTQLILWSLGVAFFGVFFAIPLRKEVIIREKLSFPS
FT                   GSATGTLISVLHNTELYEDGNKIGTDKGNLPSQDNDESCSHDSQSKQGPARKSNESAGS
FT                   AAAYSPLNDCTVIESQDLVTLQRVEAYNHNIRSLVSTFSVSSVYTILAFFIPLLRQVPI
FT                   FGTYLSKNYLWNFQPSPAYIGQGMIMGLPSVSYMLFG