(data stored in ACNUC11299 zone)

EMBL: FN392321

ID   FN392321; SV 1; linear; genomic DNA; STD; FUN; 2245428 BP.
XX
AC   FN392321;
XX
PR   Project:PRJEA37871;
XX
DT   25-MAY-2009 (Rel. 100, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   Pichia pastoris GS115 chromosome 3, complete sequence
XX
KW   .
XX
OS   Komagataella phaffii GS115
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Phaffomycetaceae; Komagataella.
XX
RN   [1]
RP   1-2245428
RA   Callewaert N.;
RT   ;
RL   Submitted (05-MAY-2009) to the INSDC.
RL   Callewaert N., Department for Molecular Biomedical Research, Flanders
RL   Institute for Biotechnology (VIB) / Gent University, Technologiepark 927,
RL   Ghent, 9052, BELGIUM.
XX
RN   [2]
RX   DOI; 10.1038/nbt.1544.
RX   PUBMED; 19465926.
RA   De Schutter K., Lin Y.C., Tiels P., Van Hecke A., Glinka S.,
RA   Weber-Lehmann J., Rouze P., Van de Peer Y., Callewaert N.;
RT   "Genome sequence of the recombinant protein production host Pichia
RT   pastoris";
RL   Nat. Biotechnol. 27(6):561-566(2009).
XX
DR   MD5; bc589b6a2b16d165c5a4a71c8ce7666e.
DR   BioSample; SAMEA2272385.
DR   EnsemblGenomes-Gn; EFKPAG00000000003.
DR   EnsemblGenomes-Gn; EFKPAG00000000008.
DR   EnsemblGenomes-Gn; EFKPAG00000000016.
DR   EnsemblGenomes-Gn; EFKPAG00000000017.
DR   EnsemblGenomes-Gn; EFKPAG00000000019.
DR   EnsemblGenomes-Gn; EFKPAG00000000021.
DR   EnsemblGenomes-Gn; EFKPAG00000000024.
DR   EnsemblGenomes-Gn; EFKPAG00000000025.
DR   EnsemblGenomes-Gn; EFKPAG00000000029.
DR   EnsemblGenomes-Gn; EFKPAG00000000030.
DR   EnsemblGenomes-Gn; EFKPAG00000000034.
DR   EnsemblGenomes-Gn; EFKPAG00000000043.
DR   EnsemblGenomes-Gn; EFKPAG00000000052.
DR   EnsemblGenomes-Gn; EFKPAG00000000057.
DR   EnsemblGenomes-Gn; EFKPAG00000000062.
DR   EnsemblGenomes-Gn; EFKPAG00000000070.
DR   EnsemblGenomes-Gn; EFKPAG00000000073.
DR   EnsemblGenomes-Gn; EFKPAG00000000078.
DR   EnsemblGenomes-Gn; EFKPAG00000000082.
DR   EnsemblGenomes-Gn; EFKPAG00000000084.
DR   EnsemblGenomes-Gn; EFKPAG00000000088.
DR   EnsemblGenomes-Gn; EFKPAG00000000095.
DR   EnsemblGenomes-Gn; EFKPAG00000000097.
DR   EnsemblGenomes-Gn; EFKPAG00000000099.
DR   EnsemblGenomes-Gn; EFKPAG00000000108.
DR   EnsemblGenomes-Gn; EFKPAG00000000110.
DR   EnsemblGenomes-Gn; EFKPAG00000000112.
DR   EnsemblGenomes-Gn; EFKPAG00000000116.
DR   EnsemblGenomes-Gn; EFKPAG00000000117.
DR   EnsemblGenomes-Gn; EFKPAG00000000118.
DR   EnsemblGenomes-Gn; EFKPAG00000000120.
DR   EnsemblGenomes-Gn; EFKPAG00000000121.
DR   EnsemblGenomes-Gn; EFKPAG00000000123.
DR   EnsemblGenomes-Gn; EFKPAG00000000137.
DR   EnsemblGenomes-Gn; EFKPAG00000000154.
DR   EnsemblGenomes-Gn; EFKPAG00000000157.
DR   EnsemblGenomes-Gn; EFKPAG00000000162.
DR   EnsemblGenomes-Gn; EFKPAG00000000166.
DR   EnsemblGenomes-Gn; EFKPAG00000000168.
DR   EnsemblGenomes-Gn; EFKPAG00000000173.
DR   EnsemblGenomes-Gn; EFKPAG00000000182.
DR   EnsemblGenomes-Gn; ENSRNA049508896.
DR   EnsemblGenomes-Gn; ENSRNA049508908.
DR   EnsemblGenomes-Gn; ENSRNA049508931.
DR   EnsemblGenomes-Gn; ENSRNA049508942.
DR   EnsemblGenomes-Gn; ENSRNA049508953.
DR   EnsemblGenomes-Gn; ENSRNA049508963.
DR   EnsemblGenomes-Gn; ENSRNA049508986.
DR   EnsemblGenomes-Gn; ENSRNA049508998.
DR   EnsemblGenomes-Gn; ENSRNA049509012.
DR   EnsemblGenomes-Gn; ENSRNA049565005.
DR   EnsemblGenomes-Gn; ENSRNA049565086.
DR   EnsemblGenomes-Gn; ENSRNA049565145.
DR   EnsemblGenomes-Gn; ENSRNA049565209.
DR   EnsemblGenomes-Gn; ENSRNA049565271.
DR   EnsemblGenomes-Gn; ENSRNA049565329.
DR   EnsemblGenomes-Gn; ENSRNA049565393.
DR   EnsemblGenomes-Gn; ENSRNA049565457.
DR   EnsemblGenomes-Gn; ENSRNA049565524.
DR   EnsemblGenomes-Gn; ENSRNA049565617.
DR   EnsemblGenomes-Gn; ENSRNA049565683.
DR   EnsemblGenomes-Gn; ENSRNA049565726.
DR   EnsemblGenomes-Gn; ENSRNA049565801.
DR   EnsemblGenomes-Gn; ENSRNA049565886.
DR   EnsemblGenomes-Gn; ENSRNA049565933.
DR   EnsemblGenomes-Gn; ENSRNA049566027.
DR   EnsemblGenomes-Gn; ENSRNA049566113.
DR   EnsemblGenomes-Gn; ENSRNA049566159.
DR   EnsemblGenomes-Gn; ENSRNA049566249.
DR   EnsemblGenomes-Gn; ENSRNA049566331.
DR   EnsemblGenomes-Gn; ENSRNA049566409.
DR   EnsemblGenomes-Gn; ENSRNA049566453.
DR   EnsemblGenomes-Gn; ENSRNA049566549.
DR   EnsemblGenomes-Gn; ENSRNA049566609.
DR   EnsemblGenomes-Gn; ENSRNA049566679.
DR   EnsemblGenomes-Gn; ENSRNA049566754.
DR   EnsemblGenomes-Gn; ENSRNA049566799.
DR   EnsemblGenomes-Gn; ENSRNA049566851.
DR   EnsemblGenomes-Gn; ENSRNA049566950.
DR   EnsemblGenomes-Gn; ENSRNA049567118.
DR   EnsemblGenomes-Tr; EFKPAT00000000003.
DR   EnsemblGenomes-Tr; EFKPAT00000000008.
DR   EnsemblGenomes-Tr; EFKPAT00000000016.
DR   EnsemblGenomes-Tr; EFKPAT00000000017.
DR   EnsemblGenomes-Tr; EFKPAT00000000019.
DR   EnsemblGenomes-Tr; EFKPAT00000000021.
DR   EnsemblGenomes-Tr; EFKPAT00000000024.
DR   EnsemblGenomes-Tr; EFKPAT00000000025.
DR   EnsemblGenomes-Tr; EFKPAT00000000029.
DR   EnsemblGenomes-Tr; EFKPAT00000000030.
DR   EnsemblGenomes-Tr; EFKPAT00000000034.
DR   EnsemblGenomes-Tr; EFKPAT00000000043.
DR   EnsemblGenomes-Tr; EFKPAT00000000052.
DR   EnsemblGenomes-Tr; EFKPAT00000000057.
DR   EnsemblGenomes-Tr; EFKPAT00000000062.
DR   EnsemblGenomes-Tr; EFKPAT00000000070.
DR   EnsemblGenomes-Tr; EFKPAT00000000073.
DR   EnsemblGenomes-Tr; EFKPAT00000000078.
DR   EnsemblGenomes-Tr; EFKPAT00000000082.
DR   EnsemblGenomes-Tr; EFKPAT00000000084.
DR   EnsemblGenomes-Tr; EFKPAT00000000088.
DR   EnsemblGenomes-Tr; EFKPAT00000000095.
DR   EnsemblGenomes-Tr; EFKPAT00000000097.
DR   EnsemblGenomes-Tr; EFKPAT00000000099.
DR   EnsemblGenomes-Tr; EFKPAT00000000108.
DR   EnsemblGenomes-Tr; EFKPAT00000000110.
DR   EnsemblGenomes-Tr; EFKPAT00000000112.
DR   EnsemblGenomes-Tr; EFKPAT00000000116.
DR   EnsemblGenomes-Tr; EFKPAT00000000117.
DR   EnsemblGenomes-Tr; EFKPAT00000000118.
DR   EnsemblGenomes-Tr; EFKPAT00000000120.
DR   EnsemblGenomes-Tr; EFKPAT00000000121.
DR   EnsemblGenomes-Tr; EFKPAT00000000123.
DR   EnsemblGenomes-Tr; EFKPAT00000000137.
DR   EnsemblGenomes-Tr; EFKPAT00000000154.
DR   EnsemblGenomes-Tr; EFKPAT00000000157.
DR   EnsemblGenomes-Tr; EFKPAT00000000162.
DR   EnsemblGenomes-Tr; EFKPAT00000000166.
DR   EnsemblGenomes-Tr; EFKPAT00000000168.
DR   EnsemblGenomes-Tr; EFKPAT00000000173.
DR   EnsemblGenomes-Tr; EFKPAT00000000182.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00049; SNORD36.
DR   RFAM; RF00509; snosnR64.
DR   RFAM; RF01203; snR47.
DR   RFAM; RF01216; snR87.
DR   RFAM; RF01223; snR13.
DR   RFAM; RF01239; snR49.
DR   RFAM; RF01242; snR36.
DR   RFAM; RF01256; snR43.
DR   StrainInfo; 594005; 0.
XX
CC   Contact: Nico Callewaert
CC   Unit for Molecular Glycobiology
CC   Laboratory for Protein Biochemistry and Biomolecular Engineering
CC   Department of Biochemistry, Physiology and Microbiology, UGent
CC   VIB Department for Molecular Biomedical Research, UGent
CC   Technologiepark 927, B-9052 Gent, Belgium
CC   Tel: (32)93313630
CC   Fax: (32)93313609
CC   Email: nico.callewaert@dmbr.vib-UGent.be
CC   ----------- sequencing/assembly
CC   Unit for Molecular Glycobiology
CC   Laboratory for Protein Biochemistry and Biomolecular Engineering
CC   Department of Biochemistry, Physiology and Microbiology, UGent
CC   VIB Department for Molecular Biomedical Research, UGent
CC   ----------- annotation
CC   Unit for Molecular Glycobiology
CC   Laboratory for Protein Biochemistry and Biomolecular Engineering
CC   Department of Biochemistry, Physiology and Microbiology, UGent
CC   VIB Department for Molecular Biomedical Research, UGent
CC
CC   Laboratory for Bioinformatics and Evolutionary Genomics
CC   VIB Department of Plant Systems Biology, UGent
CC   Web site: http://bioinformatics.psb.ugent.be/
CC   Bioinformatics Online Genome Annotation System (BOGAS):
CC   http://bioinformatics.psb.ugent.be/webtools/bogas/
CC   -----------
CC   * NOTE: finishing of chromosomes in process
CC   * Final curation of the annotation in progress
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2245428
FT                   /organism="Komagataella phaffii GS115"
FT                   /chromosome="3"
FT                   /strain="GS115"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:644223"
FT   CDS_pept        join(1805..1858,2282..2812)
FT                   /locus_tag="PAS_chr3_0001"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69934"
FT                   /db_xref="GOA:C4R399"
FT                   /db_xref="UniProtKB/TrEMBL:C4R399"
FT                   /protein_id="CAY69934.1"
FT                   /translation="MFLTSKNMVFLNAMEDFYEITYSSTLNPHSGCKGLVAAKSFTFLR
FT                   RNYDCGDVLTVGQVASSKSNSKENVILPKIARPRPDVRQKKDQALRTNALGDVIFVPFI
FT                   YVFKPSILRNELPASIIYFLLVGLMHTAILFALIAFRACKYYLKPAESSRFHFASQLVL
FT                   SVSPALQGFEQPCKSKVTLELKLKVFATLAK"
FT   CDS_pept        complement(4131..5918)
FT                   /locus_tag="PAS_chr3_0002"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69935"
FT                   /db_xref="InterPro:IPR025928"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3A0"
FT                   /protein_id="CAY69935.1"
FT                   /translation="MSLLLFLVLGAFLLSSVKAADIGAFRLRVYTPGRFTNGALNFNNW
FT                   GYQYLDASSSNGQLFAGYATVTSVTTFLAPDDEGFVWGSSLGGYPGFLGIGAGATAFHL
FT                   TGIPGDALSWYIEDNILKTSSPTYVCSRNDGDVVVGIEANTRWLAMHDTSQLPPNYYCF
FT                   QADYEIVALWYIPDTTSTWTGTETSTTTDDDGSVIELVPTPLPDTTSTWTGTFTTFTTD
FT                   DDGSVIELVPTPLPDSTSTWTGTYTTFTTDEDGSTIAVVPSSTIDSTSTWTGTYTTFTT
FT                   DEDGSTIAVVPSSTIDSTSTWTGTYTTFTTDEDGSTIAVVPSSTIDSTSTWTGTFTTFT
FT                   TDEDGSTIVVVPSSTSDHHDKPGASETILTNGGISTTVVTVTSCDIEKCTKTTALTGVT
FT                   ETTLTTGGTTTVVTTYCPLPTDIVTVKTTSISGSEVLQTIYTAKPSNDVPDVQTLTVTI
FT                   TREVCDASTCTQATIVTGEILKTTTLADTHSTTVVPVYVPLDTDQPLVELSTLETVLKS
FT                   SEFASGPAVTAGSAQQPSYQSGGVAESSLTVSEFEAHSTSDTVSQPSTISPQTGEANAL
FT                   RWSSFFGAALVPLVNVFFV"
FT   CDS_pept        11166..12779
FT                   /locus_tag="PAS_chr3_0005"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69936"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3A1"
FT                   /protein_id="CAY69936.1"
FT                   /translation="MQLFLATLGIPFTGTLPAIAGNEDHSSANNNNGNGFSYDWHGNDT
FT                   LFAELLETDFFDHPIDDAMLCSLLSPPRAAETEQQQDTEWEQQKHTNLFGCCQKHKVEM
FT                   AKQQELYLLPDKLTKNIFNSESPVFICTKIPQTSSVQSFVDVDASLLATDSSLSKDSFS
FT                   ADSTVDVLFEQSVQEPYFYRSNSAETAPPSTACSSATLDLVSTLEATTTLFEEAANSKK
FT                   QMIGLKQQSKIEDLSFSCKLNFSASMFLDHSCIPLVRGRSFGGNSRPPKTPLIPGTRYV
FT                   TARLRLENSTSEDMCFPHWSERELSDSRRIIRIERSYQSNEIVASFFIVGSAIDHPETK
FT                   PSSELDVKVLEVSCLRCFINDNESEEERFVSEYTSDEARAQHALTEPLTSGLNKEPNGH
FT                   NPKTAGNSIGCRYYITSVEVIKIIELLIGSYSTSDPVQRRKERGRMRSNLVQFWSKHLV
FT                   SSSKDTMKRRSVPTCNDDYLSELEHRINTYDVRKPRKFDKSVKILEWSKLGPALQRAIQ
FT                   SYYMVRLDNSSNKTAATNSS"
FT   CDS_pept        complement(14281..15345)
FT                   /locus_tag="PAS_chr3_0006"
FT                   /product="NADPH-dependent medium chain alcohol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69937"
FT                   /db_xref="GOA:C4R3A2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3A2"
FT                   /protein_id="CAY69937.1"
FT                   /translation="MTTVFAYAAPSASGELGPFSYEPRNLRNDDVEIKILYCGVCHTDL
FT                   HKCRNHWGGSQYPLVPGHEIVGKVARVGTSVTKYKLGDVAAVGCLVDSCGNCRSCKDGL
FT                   ENYCENAPTLTYDADDRKDGKRLYGGYSESITVRESFVLRVPSGLDVKSAAPLLCAGIT
FT                   MWSPLRNWKVNSKSKVAVAGLGGLGHMGIKLAKGLGAHVTLLSRSPGKATDGRRLGADD
FT                   VLITTDEAAVARASNRFDIILDTVPYDHDVNPYLSLLRRDGNLVLLGLIGNIQATPLNT
FT                   GPMLSARRSVSGSGIGGIQETQELLDFCAAKKILPDVEMIAIQEINDAYERLIKGDVKY
FT                   RFVIDIESLSKVRG"
FT   CDS_pept        complement(join(20160..20356,20397..21095,21127..21622))
FT                   /locus_tag="PAS_chr3_0008"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69938"
FT                   /db_xref="GOA:C4R3A3"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3A3"
FT                   /protein_id="CAY69938.1"
FT                   /translation="MSNSSFKSDEKGGLKGSVQAQGIPVLLENDGVQNILETRFLLEVF
FT                   KRPMFAAFLVGVTAFACPGMFSALNGLGAGGTAEPTISNISNAVTFGTIAVGGFLTGTI
FT                   TNQTGVKESLLIGAGFYSPYAAALYISTQGNSNYKWFMPVSGFILGVSAAFFWIASSGI
FT                   LLGKAMSMKKKISLQHVGGLVGGAISLGLNHTKPSSRSVTGGTLLALTFVMLIGIPAAL
FT                   LLPTPRQINRGDGFKVDVFKQPSIWHEFALLKQIILRKDVLLLIPLFTYNQWYLSYQWN
FT                   FNYSYFSFRGRALNIFLFYLFGTIGAWILGLFLDLQRVRTITRARSGFTVFSIIAGASW
FT                   ILGLVVEIQWKNTTRLYDWGDREFGLGCFLFCLWGFMDAMYNAFVYWVVGTLSKKLMNC
FT                   SALAFAVFTKKASGIAQCAINTGLFFFSLTFFSVVVWRIKEDISEKHPEEEFPQTGIVS
FT                   FEDRL"
FT   CDS_pept        join(21714..21760,21979..22421,22458..22675)
FT                   /locus_tag="PAS_chr3_0010"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69939"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3A4"
FT                   /protein_id="CAY69939.1"
FT                   /translation="MPQLKSFGNLSLENKTIAVIGGGVTGLILGLAALRDGYRVDVFER
FT                   SDSITDVGAGISFDINAAKVFESLGLGDVIDRISYRSKTSTYRTHDTNKLKLFLDYSNT
FT                   SGKVMCLRAEFVREVAGLLPKDQLHLGKKFESLQQHHKLVTIRFKDGSSYAADLVIGAD
FT                   ESTPVFSHQVMYRDVLNLSKVTDLDPELLNSTIIPAPGDKHVVLFPLKKGTLLAVAAII
FT                   RIDHDEGWEESWL"
FT   CDS_pept        join(22838..22864,22900..23202)
FT                   /locus_tag="PAS_chr3_1144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1144"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69940"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3A5"
FT                   /protein_id="CAY69940.1"
FT                   /translation="MPCYPIRDKALTIGAAYRVDPKIKENFPIWLEVYESARKIHAEQV
FT                   ALTSRRMGYVLDRLRLSEKALSIYKTSFKWIHDSDPKVEIEKSVFAFFDPDTAFNLDWP
FT                   ASAKA"
FT   CDS_pept        join(23319..23515,23572..23735,23765..24495)
FT                   /locus_tag="PAS_chr3_0012"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69941"
FT                   /db_xref="GOA:C4R3A6"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3A6"
FT                   /protein_id="CAY69941.1"
FT                   /translation="MKRTRAHSACEHCRLKKTKCDEARPSCSQCKTRNLQCTYKDSVPT
FT                   KLERTLSLLFQRIENENSKLEQVKRASHHLEETEPYMIGGYEFDEVEVDLNEIKGSTTP
FT                   DERNRIIYLEEQYSLKVEYNFNSALIKKLKDAYLRHIYPVFPLLCEQKLSELSQDVSQK
FT                   GLQADFETFILLLVLALGAISLAEENDSISKENFWNNPNYQVAHRQVDPQPGWSYFWLV
FT                   LGMKSRLVSSSTDNLSLVMIPLLCSLYFLKLGDIVSHCDYLQEACTKLNKQLFRLKQSP
FT                   SIGSYNQLYVDTLRRIFWVCLDLERNMANMASIPKSELSSLQQWLALPTGCKPKFPFDS
FT                   NESYAFCYMSSIICCQISVIRRP"
FT   CDS_pept        complement(join(25147..25504,25631..25878,26253..26417))
FT                   /locus_tag="PAS_chr3_0013"
FT                   /product="Lectin-like protein with similarity to Flo1p,
FT                   thought to be expressed and involved in flocculation"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69942"
FT                   /db_xref="GOA:C4R3A7"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3A7"
FT                   /protein_id="CAY69942.1"
FT                   /translation="MTRAEYSNNSKPLKIATLGAGLVGAVAGIALSKLSNVNVTIYELS
FT                   EKAREVDRGLFKGDIVQYKGAVAYRNVFPMELIMDIPNLPNDTSAWVKDGDIMFFSPLG
FT                   LTQYGVVALRRTQFLIPRVWQTNFVGMKILENGPSPSVCRRCSASKSGAFGAGAQFGFG
FT                   DVWALYRPLQETVSDAYVDTGLLADYDLHRALFLFNETRRHFLARVEKQLGYDADTYKS
FT                   YFSTARNDKEWRARFRQVESPLEWMRENNVEADF"
FT   CDS_pept        complement(27503..29677)
FT                   /locus_tag="PAS_chr3_1145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1145"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69943"
FT                   /db_xref="GOA:C4R3A8"
FT                   /db_xref="InterPro:IPR018871"
FT                   /db_xref="InterPro:IPR033504"
FT                   /db_xref="InterPro:IPR037524"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3A8"
FT                   /protein_id="CAY69943.1"
FT                   /translation="MKFPVPLLFLLQLFFIIATQGDESGNGDESDTAYGCDITSNAFDG
FT                   FDATIYEYNANDLKLIRDPVFMSTGYLGRNVLNKISGVTVPGFNIWNPRSRTATVYGVQ
FT                   NVNYYNMVLELKGYFKAAVSGDYKLTLSNIDDSSMLFFGKNTAFQCCDTGSIPVDQAPT
FT                   DYSLFTIKPSNQVNSEVISSTQYLEAGKYYPVRIVFVNALERALFNFKLTIPSGTVLDD
FT                   FQDYIYQFGALDENSCYETTVSKITEWTTYTTPWTGTFETTRTITPTGTEGTVVIETPE
FT                   SYVTTTQPWTGTYETTYTVPPTGTEPGTVIIETPEIIDCEAVCCGPFLTAFSFRKREEC
FT                   QCENICCPGDTNCETYVTTTQPWTGTYETTYTVPPTGTEPGTVIIETPESYVTTTQPWT
FT                   GTYETTYTVPPTGTEPGTVIIETPESYVTTTQPWTGTYETTYSVPPSGTEPGTVVIETP
FT                   ESYVTTTQPWTGTYETTYSVPPSGTEPGTVVIETPEASTARTKFTTVTSSWTGVFTTTK
FT                   TLPASGTEPATIVIQTPTGYFNTSSLVSTRTKTNVDTVTRVIPCPICTAPKTITVVPEE
FT                   PNESVSVIISQPQSSSTDTTLSKPDSVRVISQPETASQMDTSLSKTDSAVISTETAGNN
FT                   IIPLAGSHSYNTIVTTVTDSPQVAQSTTATSSSNVHLTISTQTTTPSLVYSSSLSTVHQ
FT                   VSPSNGGFRSSITVHPLLSVIGAIFGALFM"
FT   CDS_pept        complement(31546..32607)
FT                   /locus_tag="PAS_chr3_0014"
FT                   /product="Putative dihydrokaempferol 4-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69944"
FT                   /db_xref="GOA:C4R3A9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3A9"
FT                   /protein_id="CAY69944.1"
FT                   /translation="MLPKVLVTGATGFIGLHITGELLSRGYAVIGTVRTHKEGDQMLKD
FT                   FARAFPSTLDGQLLYVVIPDISASGSFDDVFRSNSDVTYAIHTACPTPPVGEGSLEETM
FT                   LLPTVEGTLNLLRAIKRYANDSVKNVIYTSSLSACWNLDKVEDKSLVIDESTWNSYEWE
FT                   DINDDNRYLAYSVAKKKAEKAAWDFLENEKPFFKLTTIVPPFVFGPQRFDWKAKENVLS
FT                   GSAEIILSLLSSGSTLQDLHDAPISLAVDVRDLAVYHVLPLTNPTLEQKRLLTIAGKFS
FT                   GQRVLNVINENFTELKGKVLLGDPDNVLQLEGLKAPEYNNKETLALGHLGLISVDRSIA
FT                   DTVAQILRVNTIQ"
FT   CDS_pept        complement(33327..35351)
FT                   /locus_tag="PAS_chr3_0015"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69945"
FT                   /db_xref="InterPro:IPR018871"
FT                   /db_xref="InterPro:IPR037524"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3B0"
FT                   /protein_id="CAY69945.1"
FT                   /translation="MQTDLLSSRFQLRQLIQLRIWTGTYTTWTTDADGSVIEQIPTPSA
FT                   DTTSVWTGTYTTWTTDADGSVIEQIPTPSADTTSVWTGTYTTWTTDADGSVIEQIPTPS
FT                   ADTTSVWTGTYTTWTTDADGSVIEQIPTPSADTTLAPSADTTSIWTGTYTTWTTDADGS
FT                   VIEQIPTPSADTTSVWTGTYTTWTTDAAGTVIEVIPSGTSISSDVIPTPLPTSGVDIDT
FT                   IPYDAFNVAVYHYPADNYELANNLGFLTSGYEGLGQVTTATSVGNINFDTSSGWPYYIE
FT                   SNALGNTGSYVNATIEYVGFFQAPANGNYELSFSNIDYNAILFLGSPATDSSLAKREVQ
FT                   FLKPETSSEYVLFFDHGKDAGQTVSTTQYLSAGLYYPLRIVLAAVSERAQLDFQITLPD
FT                   GRVLDQYQGYVYNFAHEGIESATSSAHETSWSRFTNSTIYSHSSTIGIITSSTDAPHSV
FT                   INPTAIETTSTDTSISTVAVTTSICDTKDCVKTTVITPNSPLPTQTVSLTTTTIDRSEV
FT                   VQTAHSAVPSQFAPDAHPSAVTITREQCDAYSCSQATIVSGKVLQTTTVSDSTTVVPLD
FT                   TPQLSVEASTLETRLKSTQSSRAPTVTVQTSQSSRHSEDVTESSVHVSEFDAQSTSATS
FT                   ASALQAPSSISLQTGGANTLRLSAFLGTALLPMLNVLFI"
FT   CDS_pept        complement(35451..36590)
FT                   /locus_tag="PAS_chr3_0016"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69946"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3B1"
FT                   /protein_id="CAY69946.1"
FT                   /translation="MNLFTILAWGFLYVPLVLGEGYYSLNFDARVPIALGILGSSYQKY
FT                   TIMADRSLLGGSNIDLDVTFSGIIELLTNRVHIVVSLPDADGRVSVYDMYSGTSLGYLS
FT                   FVCSLTTCEVHAVSSSSGATTWTLDGNQLIPTSPSTVYACYRSLVGLLAQYTLNDRTSI
FT                   TAQCEQTNLYVELAIPAFPETTAVWTGTYTTWTTDESGSVIEQMPTPSADTTTTWTGTY
FT                   TTWTTDADGSVIEQIPTPPADTTSVWTGTYTTRTTDADGSVIEQIPTPSADTTSIWTGT
FT                   YTTWTTDADGSVIEQIPTPSADTTSVWTGTYTTWTTDADGSVIEQIPTPSADTTSVWTG
FT                   TYTTWTTDADGSVIEQIPTPSAXPDQNFXMDWHLYHLDH"
FT   CDS_pept        complement(39926..40681)
FT                   /locus_tag="PAS_chr3_0017"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69947"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3B2"
FT                   /protein_id="CAY69947.1"
FT                   /translation="MKIGIIGTGDIGATLARKFASRRHRVKVANSRGPQSISELAHEIG
FT                   ADAVTKEEAVQDVEVIIISIPFAKNPDLAHLIRSVPSDVVVIDTSNYIPQRDGQIAEID
FT                   NGKAESVWLSEMLGHSIVKAWNAVGATTLSDYGRQAGALDRIAIPVAGDDENAKSVAME
FT                   LVEQTGFDAVDSGSLAESWRQQAGTPVFCTEAKAEGMKKLLELADRKRASRNLELILKE
FT                   LGERGGKRSHEESVRFTRSINIPDGQFEF"
FT   CDS_pept        complement(41112..42821)
FT                   /locus_tag="PAS_chr3_0018"
FT                   /product="High affinity methionine permease, integral
FT                   membrane protein with 13 putative membrane-spanning regi"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69948"
FT                   /db_xref="GOA:C4R3B3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3B3"
FT                   /protein_id="CAY69948.1"
FT                   /translation="MAFLTLPKNVFTSTKSEHSTEEFQENVEKSSSLEKETVGEQTIEL
FT                   DTGDRRIGLVTAAFLITNRILGAGIFATPSTILLMSGSVGTALMLWVLGMLIALSGLFV
FT                   YAEFGSYPSRLLQRNGGEKNYLEYAYSRPKYLVTCMYALYILLTGGSAGICVVFGEYIL
FT                   RAAQVEPTEWAARGLGIASVCFAFLVNTLNVKVGIFVLNVLGTFKIVIVLLIAVTGWVA
FT                   LGGGIKNEEFTPTHAFSNAFQGTSPTAYGVVISLYNVIWSFMGYSNVNYNLSEVKNPIK
FT                   ALKYSAPIAVVSLGIIYILVNIAYFAVVPFDVMTNSGRILAADFFRIAFGTRAERACSV
FT                   FIALSALGNVIAATFSQGRIVQQFGREGILPYSAFWASQKPFNSPFTGLLEHCIIIIIT
FT                   IVAPPAGDAYDFVLNLISYPMNIINFFVAGALLWLRYEARKGRREWIPNIKTPVPVIVF
FT                   FLLSSLYLIIAPYIPPAKGQSSVYNHMPYWIHCVAAWGIFALGVLYWIIWGRVIPKVGK
FT                   YRLISRDVHDTDGYWRNKFFKIPYSYQQSDEEFIAQELQKQADKETFSEKPI"
FT   CDS_pept        complement(43577..44929)
FT                   /locus_tag="PAS_chr3_0019"
FT                   /product="Flavin-containing monooxygenase, localized to the
FT                   cytoplasmic face of the ER membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69949"
FT                   /db_xref="GOA:C4R3B4"
FT                   /db_xref="InterPro:IPR000960"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3B4"
FT                   /protein_id="CAY69949.1"
FT                   /translation="MCAKSVAIIGGGPSGIAAAKALSEENAFDRIVIFEQQEQLGGVWN
FT                   HSSKKPGAAFVPSDSPARTREWNRNQSTYFSAMYEKLETNIVKDLMPYNNYPFPEVSDT
FT                   LPPRQDVLEYLLNYAKGLNPSVIVRLNTVVTHLEKVGTQWRISYRQSSQAEREDTYQYI
FT                   VIASGHYNFPYIPTVPGLEEWVKVDADSISHSMYYINNEKFRGKKVLVIGNAISGVDIS
FT                   LQLTEVTWPVYRSKRHEPLLKPVEIEDIIEVSEIAKYDVSTRSATTIDGKIIDGIDHIL
FT                   FCTGYLYDFPFLKTYMSGEDAIITDGRITRRLYRQIFYIPDPTLSFSGVVKNVVPFPLA
FT                   ESQAAVIARVFSGRLSLPNEAEMRESEIADVKARGSEYKFHVYEAPADVEYINTLQQWV
FT                   NQAEPTELGFKAEVWTEEKKQRRVDCINVKNAHHLKYYAHIKKLRDETRKD"
FT   CDS_pept        complement(47774..48733)
FT                   /locus_tag="PAS_chr3_0020"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69950"
FT                   /db_xref="GOA:C4R3B5"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3B5"
FT                   /protein_id="CAY69950.1"
FT                   /translation="MLSILANLLLWSILGCLGRIALIELTNYPHSYINTGINIGTCLWV
FT                   NFAACLIISAINRNRIPNKNDNSKGPLYIGLTVGFCGTLSTFSSLIMEASLKAFDISDG
FT                   THDMRYKNSAYGIMEWLSVILVQFGVSSLGFLIGQTINIQEYLGYVTKYRTPENDRYFR
FT                   YAVIIGSILLLLLILFLAIFLPDSNFFRHWATSICFAPVGCFLRYFLSQQLNGTLKRTG
FT                   IFLGTLICNLVAVLVESICFLLLRISLITRKTDITVLNSIIVGFCGTLSTTSTLMVELA
FT                   SLTPVHRYKYFTASVFLSFLFPVLIIGVYNWTRGLSPD"
FT   CDS_pept        50808..52613
FT                   /locus_tag="PAS_chr3_0022"
FT                   /product="Allantoin permease"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69951"
FT                   /db_xref="GOA:C4R3B6"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012681"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3B6"
FT                   /protein_id="CAY69951.1"
FT                   /translation="MALRDKLTQRSKSPGAVTNTVSAPGSLNSSSPLGSLSAEQNTSGR
FT                   SPIGKLLDKLVVQEEKELSASQSFLFNFDLRPVERRRRLWSWFNYVFFWISDSFNINTW
FT                   QIAATGIQAGLSWWTCWLSVWLGYSLTGIFVTVSARVGIYYHISFPVSCRSSFGVFGSI
FT                   WPVFNRVVMACVWYGVQGYIGGTTMALMLRSIFGNDLNTRIPDGISSPNVTTFEFLSFF
FT                   LFWLFSLPFIWLAPHTVRHLFTVKSYVVPVAGIAFLIWSIKKADGIGPVVKQPSTISGS
FT                   EFGWAFIRSVMNSLANFATLIVNAPDFSRFSKTKASAKWAQLFSIPLCFSITSLIGILV
FT                   SSASTIIYGETYWSPIDVLGRFLDNYTSGNRAGVFFISFAFALAQLGTNISANSLSAGT
FT                   DATALLPRYITIRRGGYICAAVGLCICPWELLSSSNKFTTYLSAYSVFLSAIFGVLFAD
FT                   YYIVRRGWLVLNDLYNAEKTSAYTYWHGINYRAFVAYICGILPNIVGFVGATGAGSVPQ
FT                   GAMYVYDFNFFAGFGVSVFIYVLLCYIHPLPGVPYEIKKDLFKKGWYEEYAEVENFDVT
FT                   GGAASGEVWEVVEEPIEYYDEEKKV"
FT   CDS_pept        complement(53672..55294)
FT                   /locus_tag="PAS_chr3_0023"
FT                   /product="Putative transporter, member of the sugar porter
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69952"
FT                   /db_xref="GOA:C4R3B7"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3B7"
FT                   /protein_id="CAY69952.1"
FT                   /translation="MSLLGRARSLNYQGKLYDKFPTIYNIHVIAITATVSGLMFGFDIS
FT                   SVSSFVSQEHYRNYFNRPDSLTQGGITASMAGGSFVGSLVSSDFQDIFGRRVALHVCSA
FT                   LWITGAIIQSASQNQGMLIAGRFISGLGIGFGSASAPVYCSEVSPAKIRGLIGGLFQLS
FT                   VTVGIMVMFYIGYGCHFIDGVASFRLAWGLQMIPGFILLVGVFFIPESPRWLANHERWD
FT                   DAVEIIANVVADGDREDPDVHLQLDELQEQVLIDKDAANFGYADLFKKDCRKRTFIGVS
FT                   AQIWQQLCGMNVMMYYIVYIFEMAGYSGNVNLVSSSIQYVLNVVMTIPALFLMDRVGRR
FT                   PLLIGGGIFMFIWLFGVAGLLATYSEPIENFGGDDTVRILIPDEHKAAARGVIACSYLF
FT                   VCSFAPTWGICIWVYVSEIFNNRQRAKGAALATSANWIFNFALAMFVPSAFRNITWRTY
FT                   IIFGVFSVCLTVHVIVQFPETRGKTLEEIDKMFKDNIPAWRTSSYVPEMPIVHKEKIGS
FT                   TEHIENASNLSEKPIMVHEEESV"
FT   CDS_pept        complement(55790..57841)
FT                   /locus_tag="PAS_chr3_0024"
FT                   /product="Plasma membrane transporter for both urea and
FT                   polyamines, expression is highly sensitive to nitrogen"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69953"
FT                   /db_xref="GOA:C4R3B8"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3B8"
FT                   /protein_id="CAY69953.1"
FT                   /translation="MSDAETTVHLLGKSVGYGVLIGVGAAFALAVVIATRLIARYLNEN
FT                   NNSTETFMVSNRTVGIGLTTSAIFSSWFWATELLWTVTMTQFYGVSVGFYYYWGLIVPV
FT                   SIMGVLGIEAKRKVPKGHTCLEVVELRYGKAAHILYMCFCLANNLLSCAAMILGAAGAI
FT                   SIIADNLSIVASSLLIPFGVLCYTFSGGLRATFLGDWGHSVIAIIVLLYVNTAALVKIG
FT                   SIDKLYELIFTGPNEGTIEGNYDGSLMTFRSQGAVFFGIIHLLGDMGLTVLDSSFYQKA
FT                   FSANLKSGVPSYMIGGVCIMAITWPLGTIIGMATTFLENDPSFPTYPRKMTTFEIESGF
FT                   GLPYTLKALLGDGACGAILLVIYLACTSTVSAQMISVSSILSFDVYKTYINPQAKNKQM
FT                   IRASHITVVFFSFFAAGFAIMLHYVGANMTWVGYFYPILICNPVCPMILLFTWDRQTKF
FT                   AFIASPIIGIGASVGVWLGTAYHYYGEITMETTSRQLPCLWAGLTALFLPLVLTVTFSL
FT                   FQKEHFDWNVFKKAELIEMEGSEASSPSEVDVVYESGSVSSPTEDSEKRSVDKSENVQL
FT                   QETELGVSSGDEYDEEEQKLIKRYIKIAYAWCILVVLVTSVLFPMSLYRNWIISLSFFR
FT                   GYTGLSMFWLYGVFLVIAVYPLYDGRHSLGRIGQGLWKDFKRIFKSKR"
FT   CDS_pept        complement(58856..59245)
FT                   /locus_tag="PAS_chr3_0025"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69954"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3B9"
FT                   /protein_id="CAY69954.1"
FT                   /translation="MSASDRRSSHYIVNKWVIKILIQRMKLLFHIWRSKTLPKACHYPF
FT                   AGNFGIHIVGSYLLFGCLKSRKRRPPVTLKLMWRRRAVQKVTHLVPLKLSSYQMKPSEL
FT                   IFYAIQTDQKSLGCKSNQISGELTI"
FT   CDS_pept        complement(60021..60917)
FT                   /locus_tag="PAS_chr3_0026"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69955"
FT                   /db_xref="GOA:C4R3C0"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3C0"
FT                   /protein_id="CAY69955.1"
FT                   /translation="MAFEFEGEGIAASIFLALYVIYTLFTIGIIWHKGTLRTIYSGLLF
FT                   FGLIRMGAQLCGIAFASLGYEHWQWLVAYLVLGAEGYFVLILTSFYMVSHAHIAARKES
FT                   WLKSRLVDTSNWGFLKKLNINGMRIFYYLAIVANVLVIVGGTMLTGLDADEYDDNVSRI
FT                   NTSKGLRGTGQALFLIFTLVVAGLAAYTVIHDNIRSYLLTSVFMATPFLFVRGIYGLLS
FT                   CFIQQMNYFSMANYTATGMSVHFVATEYVLATTMEFIAACIFMSTYYVVYIPKKALNED
FT                   ETSLIEVGGKHEDKPNE"
FT   CDS_pept        61903..63876
FT                   /locus_tag="PAS_chr3_0027"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69956"
FT                   /db_xref="GOA:C4R3C1"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3C1"
FT                   /protein_id="CAY69956.1"
FT                   /translation="MKTEKKLKRTFLACDICRSKKLKCINNGSTKEPCHRCSRLSHECS
FT                   YTPTQSHLRKHVNKDNWAKQSDYKVSKPIVPSHEVVIPEKDVVLEVIELFFSHQYQGVF
FT                   LFLHRPSLLAFIKSSEFNPSTYINDYYNSESPAPYHLLHRPDPVVLLSIFALSARFHPS
FT                   MVSSYGAFDLSQDPDLFTPSSSNGSGVFRSPVHASEYFAYHARKLLQPLFDRPSIQRIQ
FT                   ALTMLSSHDWGERNVARAFIYVGLACRMAFVLGLNDSTSLCYNETNPLISEVKRRTLWA
FT                   VYLQDRCISSGRNRSSCIKIEDIHIEMPALEAEFVLGKLSSPRLTFEEFQSILFESHGS
FT                   SPTGVENRLTNVSTYCFTIFLFEVWASLARWVGESGPRSNNLPTTGSGSSSKFSETDKK
FT                   LDVLESTIPVHLYNNTVNFQNQASEGTLMSFVYMHALLYLSRIFLHREYFFINPETLPA
FT                   NQWYNATRKFLQSVERSTKLISAAESINMMVIAPFTGFELFTNAATSLYFLTSPLSLLK
FT                   KNYEVQNKTAYQSLKSEVKTYVKTNIELLKKWSSVWPITSSWFLWTLDLQTSLKSFSTD
FT                   EQGIMFRNLMIDYGTTIVAEEANDNPSTTSSLSEQDNQSAQHFQNLVSTEDNVLTPDIN
FT                   NIVLGWRELFDVGPDLQLQSEW"
FT   CDS_pept        complement(63929..65554)
FT                   /locus_tag="PAS_chr3_0028"
FT                   /product="Putative protein with similarity to the
FT                   allantoate permease (Dal5p) subfamily of the major
FT                   facilitat"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69957"
FT                   /db_xref="GOA:C4R3C2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3C2"
FT                   /protein_id="CAY69957.1"
FT                   /translation="MASKTEKIRYSVNNNSVDSASSIEEPNDNPFADPQIAAYWRKIYE
FT                   DVGYENLHRFDPDFTWNKEEEKKLVRRLDLKVFSWTFVMFCALDLVRRNINRAVSDNLV
FT                   SGDIPGLDTNGYNLGQTIYLISFLCAELPLNLLSKKFGPNVVVSAECLVWSIICISQSA
FT                   MRTRAQFLALRALLGFAQGGFIPDQILYLSYYYTNTELPLRLAIFWTAIPLFQILGSLL
FT                   ASGLLEMRGIHGKTGWQWLFIIEGLMSLGVAIPSFYVMRSGPTQTKNILFKSRPAWFNE
FT                   HEEKILVNRLLRDDPAKGDMNNRQALNIRQILRTVLSEYDFWPLYIQGLMAFIPFQPVT
FT                   AYMSLILRSMGYSVFLSNVLAIPGQFWFLINLPLVVYFSHKVKEKSICVGIANYFIFPF
FT                   VVALVAYPATGSDWVKYFLLTGIVALPYTHAILASWVSHISNNVASRSVATPLYNMMYQ
FT                   VGSIAASNIYRESDKPYYIRGNKIILGITVFNCVFPFFTKAYYIMRNKQKEKKWNSMTK
FT                   EEQIEYTTNTTDSGVKRLDFRFVH"
FT   CDS_pept        65883..67502
FT                   /locus_tag="PAS_chr3_0029"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69958"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR039535"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3C3"
FT                   /protein_id="CAY69958.1"
FT                   /translation="MKFLTLISVASTIATSYADWQYRTRPDLSPIELNITIPATDDKVS
FT                   PGFLFAAPFSGYDQDNTHGPRQPGAYIFTDKGELVWSGFSYFANWQANFQASRINGENV
FT                   LFAFEGTHNPGYGHGHGHITILNNRYETIKELRAGNHRISDKHEFHVKDEKTGLIQIYH
FT                   PVPKDLSDYGASADQQWIVDAKFQELDLRTRKVLFEWSSLDHVSPHDSVLPINPWQAGS
FT                   GYNSSDAWDYFHINSVDKDENGDYLISARNAAAIYKINGTDGSIIWKLGGLPGKTSSNF
FT                   KVKGKPLTFSFQHHARFLSTSDDGSKQVFSFYDNSAHGTEDHRGHEVHYSDQSSGKIVE
FT                   VNTETNEATLLAQYDPPRGHNLLSKSQGSTQVLSNGNVLVNWGSEGAVTEYTADGTPVF
FT                   HAYFGTGELGKHVENYRAFKFDWHGYPAEAIALHSDISPEGDTIAYVSWNGDTETSYWK
FT                   FYSIDKVSERQLLGKVPRQGFETKFKIEGETHSKLVVEAYNDQHRFLASSDVVVSEEQV
FT                   EEKRVDTKAKFQHYFAWLANKD"
FT   CDS_pept        complement(68405..70168)
FT                   /locus_tag="PAS_chr3_0030"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69959"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3C4"
FT                   /protein_id="CAY69959.1"
FT                   /translation="MKFAISTLLIILQAAAVFAAFPISDITVVSERTDASTAYLSDWFV
FT                   VSFVFSTAGSDETIAGDATIEVSIPNELEFVQYPDSVDPSVSEFFTTAGVQVLSTAFDY
FT                   DSHVLTFTFSDPGQVITDLEGVVFFTLKLSEQFTESASPGQHTFDFETSDQTYSPSVDL
FT                   VALDRSQPIKLSNAVTGGVEWFVDIPGAFGDITNIDISTVQTPGTFDCSEVKYAVGSSL
FT                   NEFGDFTPQDRTTFFSNSSSGEWIPITPASGLPVESFECGDGTISLSFAGELADDEVLR
FT                   VSFLSNLADDVLEVQNVVNVDLTTADSRKRALTSFVLDEPFYRASRTDTAAFEAFAAVP
FT                   ADGDITSTSTAITSVTATVTHTTVTSVCYVCAETPVTVTYTAPVITNPIYYTTKVHVCN
FT                   VCAETPITYTVTIPCETDEYAPAKPTGTEGEKIVTVITKEGGDKYTKTYEEVTYTKTYP
FT                   KGGHEDHIVTVKTKEGGEKVTKTYEEVTYTKGPEIVTVVTKEGGEKVTTTYHDVPEVVT
FT                   VITKEGGEKVTTTYPATYPATYTEGHSAGVPTSASTPPQATYTVSEAQVNLGSKSAVGL
FT                   LAIVPMLFLAI"
FT   CDS_pept        complement(73945..78369)
FT                   /locus_tag="PAS_chr3_0032"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69960"
FT                   /db_xref="InterPro:IPR006970"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3C5"
FT                   /protein_id="CAY69960.1"
FT                   /translation="MFSTKYIAVLLSAFAAVEAIALPSYEQALDHAARGLVPQAFADAL
FT                   NPALEKRADFMCHAACGLAIYGAWECGPEAGPFDEECLCAADSSFSTQIDACLDCGWCI
FT                   YMSYFGNLAGPLDACGLPVTPTGTTCIETASTLTPTLGPFTDYTPTHPNNVPTSTEEPT
FT                   EEPSEDVTSTEDATSTEDSTEEPSSEPTPDYSDLTLGEAITDIKVVSERTSTESGYYND
FT                   WFVVYITFDTTGRDIVLPPYAVVQVALPEEIIFIEHPQFSAFSDPSLINFYTTGGSGVM
FT                   SSKVDWNTNVLNFTFSNRAQVITEVKGTISVTMRLKDNFVSTLSPGEYDFKFYTGVSEI
FT                   VSTFDFLPLDRTAPQKLILGGADAVNWVVDIPGAPYPEITNINVGSVIIENGWRYKYIY
FT                   DCENLKYIIASDFDEWNNVTTPVGDYLPLSSADSSIADLECGLGGVSFSFTESLGENEV
FT                   LRIFVPSEAMVSGTLYMENIFTVDITTGSDSVEITKREEFSYTFDETYYGDTRAETNVF
FT                   EVFALDDPPASSEPTEEPTSEEPTSEEPTSEEPTEESTEEPTEEPTSEEPTEESTEEPT
FT                   EEPTEEPTSEEPTEEPTSEEPTEEPTSEEPTEEPTSEEPTEDATSTTDDDETSTETSTE
FT                   EPSVEPTGSYTDLTLGEAITKVEVTSERTNEASGYTSDWLIVSFTFSTTGRDIILPPNS
FT                   VVQVAIPDALQFIAHPQYAAFLEPSLKNFYTKNENLIMRSRFNYDTNVIDFTFDNRGQV
FT                   ITRLEGVVYFTMKLEQDFIATLSPGEYDFEFHTSVDTHTSTFNFLPLVRSEPIKLIAGA
FT                   ADEVEWFIDIPGAYNDLATIDISSDIDTNADWQNYFYDCSKLKYTIGKEFDQWGNFTAG
FT                   SDGNQYSNTTNGYVPITDSTGSPVAEVQCLLESISLSFTNPLAEDEVLRVVLHSSAFRS
FT                   GSLYMANTVNVDITTGALVKRELFSYALDETYYAETRSERLAFDVFELADPVEETSEEP
FT                   TSEPTSEPTEEPTSEPTEEPTEEPTSEEPTEEPTEEPTEEPTSEEPTEEPTEEPTSEEP
FT                   TEEPTSEEPTSEPTEEPTEEPTSEEPTSEPTEEPTEEPTSEEPTSEEPTSEPTSEPTEE
FT                   PTEEPTSDDLSINPTGVPTEEPTEEPTSETTEEPTSDDLSINPTGVPTEEPTEEPTSET
FT                   TEEPTSDDSTIDPTGQPTEEPTTDDPSIAPTAVPTSESSSGQSVVTQITTATQTTITSV
FT                   CNVCAETPVTITYTAPVVTDPVSYTTVTSVCHVCAETPITVTLTLPCETEEVKKTDGPK
FT                   TVTYTEVCNSCADKPITYTYTAPESTEGVECTTVTSVCNVCAETPVTVTYTAPKDTSAP
FT                   KTVTYTEVCNSCADKPITYTYTAPESTEGAKSTTVTSVCHDCAETPVTVTYTVPKASTV
FT                   PVENTTVPSKPTNPGQQDTTITTHVTQTTSLVTASSSSTAPPAISSAGPENLAVRFSAA
FT                   GLFAMLPMILLAL"
FT   CDS_pept        80882..82606
FT                   /locus_tag="PAS_chr3_0035"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69961"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3C6"
FT                   /protein_id="CAY69961.1"
FT                   /translation="MTQSEPEPKKRKTALPDHSKAAHVKWLPKRVHTSSVVPRHPLGVK
FT                   PSGNRLLASHDSNYPDKSQRRGFWTLMASNEQLMTRILHFIDSPLDLMKLGHTSRMMYA
FT                   YTWNEELWRQLYMHKAAKSVESHYPLGIKEWKGSWRRTLLGIERDQEALIQVKENQICS
FT                   DLLYRPYQCSQIDYSEICREIIEDERVYHDHPEAYAKHNSLKGHVVRIPEEKMTLENFE
FT                   TNFTDLPFIITNLNRSRWPSWSMESLLERFSNVQFRQESVRWPLSFYCEYSLDNCDESP
FT                   LYLFDCNSDAMKELVNELTVPDCFKKDLFTVFDENDILCRPDHTWLIMGPKNSGSTFHK
FT                   DPNFTSAWNTAISGRKLWIMLPPDIKPPGIGTDKTESEVTAPVGIAEWTLSGFMQDALN
FT                   LTKSDQCLVGITYPGECMHVPAGWWHSVINLDNSIAMTGNFIPEPKLPHVLDFVKNKNN
FT                   QISGFHSLDVKKSLINICKRMNQNTERYQRFQDYIREAKDDNEDCGEIAFVPMPIYDMF
FT                   LELLEQSEQFNSIDLNNVVDVLTTIEKKNRPAKVRESKTWNQLVSQNGFSFGFSEDD"
FT   CDS_pept        complement(join(82715..83527,83575..83601))
FT                   /locus_tag="PAS_chr3_0036"
FT                   /product="S-adenosylmethionine transporter of the
FT                   mitochondrial inner membrane, member of the mitochondrial
FT                   ca"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69962"
FT                   /db_xref="GOA:C4R3C7"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="InterPro:IPR040062"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3C7"
FT                   /protein_id="CAY69962.1"
FT                   /translation="MNEFLVSLISGGCAGTATDLAFFPIDTLKTRLQAKGGFFQNGGWK
FT                   GVYRGLGSALIASAPSASLFFVTYDGCKKFFKAELMPLLKNENLTLNVSHMAAASLGEI
FT                   AACLVRVPAEVIKQRTQTSKFSSSLESLKYILRNENGEGVIRGLYRGWTSTIVREIPFT
FT                   TIQYPLYEYMKLRWAAHQQIEKVSPLQGALCGSVAGGFAAAVTTPLDVLKTRIMLSSHK
FT                   ISLGQVASQLYKEEGFAVFWSGVGPRTMWISAGGAIFLGVYETVSSFLTAEEKTKLG"
FT   CDS_pept        84001..85398
FT                   /locus_tag="PAS_chr3_0037"
FT                   /product="Cysteine desulfurase involved in iron-sulfur
FT                   cluster (Fe/S) biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69963"
FT                   /db_xref="GOA:C4R3C8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3C8"
FT                   /protein_id="CAY69963.1"
FT                   /translation="MFGVRRSCNKASAFGKVVRNISGASSARTPMPTSVSNASLNDAVP
FT                   PKGSAVSLGNSKRDDSLYGTRPIYLDMQATTPTDPRVLDKMLEFYTGLYGNPHSSTHSY
FT                   GWETEKEIEKARKYIADVIGADPKEIVFTSGATESNNMSVKGVARFYKKTKKHIITTQT
FT                   EHKCLLESARRLQDDGFDITYLPVNEDGLVNLEQLEKSIRKDTCLVSVMAVNNEIGVIQ
FT                   PLEEIGRICRNHKVFFHTDAAQAFGKIPLDVNKLNIDLMSISSHKIYGPKGMGACYVRR
FT                   RPRVRLDPIISGGGQERGLRSGTLATPLVAGFGEAARLAVQEYEYDTKYISRLSQKLMN
FT                   GILSMEHTQLNGSKTSRYPGCLNISFAYVEGESLLMALKDIALSSGSACTSASLEPSYV
FT                   LHALGADDALAHSSIRFGIGRFTTEQEIDYVIDAINQRVQFLRELSPLWEMVQEGIDLN
FT                   SIEWSGH"
FT   CDS_pept        85601..86503
FT                   /locus_tag="PAS_chr3_0038"
FT                   /product="Nucleolar protein with similarity to large
FT                   ribosomal subunit L7 proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69964"
FT                   /db_xref="GOA:C4R3C9"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR023106"
FT                   /db_xref="InterPro:IPR035808"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="InterPro:IPR039699"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3C9"
FT                   /protein_id="CAY69964.1"
FT                   /translation="MLQLIAPDEIFFLNFLREKEKIIPPNQSMSSTQTETEVLLKKRKN
FT                   DEVARMEKAESLRQAEEERQIQKRKKQNTFVPPEYLALRHLASEREQHRIDRVLKVEKE
FT                   LKQKAISSDKTQQEQDQGKLVFVVRVQGPKRAHLPQQVDLILKLLRLTEMNTGVFVRET
FT                   SSVIPLLKVIRAHVVIGEPSLYTVRSLVQKRAKITIEGENGPRSVELNDNNVIEDKLGD
FT                   YGIVCMEDIIHEIFSLEENFKVVNKFLNPFQLSPPESGWGPESKLRKLVAEESKSKVSN
FT                   SGRAELEYVDIDKYIEEQN"
FT   CDS_pept        86733..87860
FT                   /locus_tag="PAS_chr3_0039"
FT                   /product="Beta-isopropylmalate dehydrogenase (IMDH),
FT                   catalyzes the third step in the leucine biosynthesis path"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69965"
FT                   /db_xref="GOA:C4R3D0"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3D0"
FT                   /protein_id="CAY69965.1"
FT                   /translation="MSEPITKKPKSVIPKKIVLLPGDHVGAEIIDEAVKVLKAISSVSP
FT                   NADFEFQTQLIGGAAIDATGSPLPDETLEAARGANAVLLGAVGGPKWGTGDVRPEQGLL
FT                   KIRKELNLYANLRPCNFASDSLLKLSPLKEDIVRGTNFTVVRELVGGIYFGERTEDDGS
FT                   GVAWDTEKYSVPEVQRITRMGAFLALQSDPPLPIWSLDKANVLASSRLWRKTVTETLEK
FT                   EFPQLTLNHQLIDSAAMILVKSPSKLNGIVLTNNMFGDIISDEASMIPGSLGLLPSASL
FT                   ASLPDSNEAFGLYEPCHGSAPDLDKGKVNPVATILSAAMMLRLSLNLTEEADALEKAVG
FT                   QVLDSGIMTGDLGGSNSTTEVGDAISKAVVDILKN"
FT   CDS_pept        complement(87922..88806)
FT                   /locus_tag="PAS_chr3_0040"
FT                   /product="Mitochondrial inner membrane transporter, exports
FT                   2-oxoadipate and 2-oxoglutarate from the mitochond"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69966"
FT                   /db_xref="GOA:C4R3D1"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR002113"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="InterPro:IPR040062"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3D1"
FT                   /protein_id="CAY69966.1"
FT                   /translation="MSDPKPLPFVYQFLSGAIAGVSEILVMYPLDVVKTRIQLQVGSGA
FT                   NAEYTGIVDCVTKIVKNEGFSRLYRGISAPILMEAPKRATKFAANDEWGKFYRNAFGVQ
FT                   SMTQSLAVLTGATAGATESFVVVPFELVKIRLQDKSSKYSGMGDVVKQIVKKEGVLSLY
FT                   NGLEATLWRHIWWNAGYFGVIFQVRSLLPKTESSTQKTANDLLSGAIGGTVGTILNTPF
FT                   DVVKSRIQNTVKVPGVVPKYNWTLPSLLLVTKEEGFSALYKGFLPKVLRLGPGGGILLV
FT                   VFTTCMDFFRTLQ"
FT   CDS_pept        complement(89146..90312)
FT                   /locus_tag="PAS_chr3_0041"
FT                   /product="Middle sporulation-specific mitogen-activated
FT                   protein kinase (MAPK) required for production of the o"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69967"
FT                   /db_xref="GOA:C4R3D2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3D2"
FT                   /protein_id="CAY69967.1"
FT                   /translation="MISSQKPIGNKKADIEVAVKKEYSVYSKANFYLNSRYQVQQVLGK
FT                   GSYGVVCSVLDLKSENPVPLAVKKVSNIFTREVLLRRAIRELKLMKFFRGHRNIINLVN
FT                   LDIVYIKPYDGLYCFQELVDYDLARVIHSNVQFSEFHIQSFLYQILCGVKYIHSADVIH
FT                   RDLKPGNILVTVLGNLKICDFGLARGINHQFMQGSSRPRDNAITNYVATRWYRAPELIF
FT                   SRKEYGKAVDMWAVGCIFGELYGRKPLFIGDSQMSQIAEIVKVLGSPSKEVIMAYGSHL
FT                   AWDYFQPPKPQYRPLKWAHVYPYASGSALDLLSSLVCWEAKRRLDVEAALSHEFLSAVR
FT                   NKSQEPKCKSIFDFRWEKENTSLEDLKILLHEEVTQFKNERENNSQPN"
FT   CDS_pept        complement(90461..94483)
FT                   /locus_tag="PAS_chr3_0042"
FT                   /product="Myristoylated serine/threonine protein kinase
FT                   involved in vacuolar protein sorting"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69968"
FT                   /db_xref="GOA:C4R3D3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3D3"
FT                   /protein_id="CAY69968.1"
FT                   /translation="MGAELSLLAPTAQPIALSAYVDFLSNIQYNKPLGTSRFLKTVKGL
FT                   NDQGSIVVKVLVKPNSGLDLSEWVEKLEFLRLKLLDVPNVIPYNLVIDSVRAGYLIRPF
FT                   QQRTLYERVSIQPYLEPIEKKWIAFQLIHAVMECHERGQYHGDIKSENVLLTSWDMVFL
FT                   TDFAPFKPIYLPGNNPSQFSFYFDTSRRNVCYVAPERFLGEGTPTQYQEVDKLTSSMDI
FT                   FSLGCTVAELFLEGSVLFTLPQLFKYKKGEYTPSLSGIVDNDLRNMIQEMIDLDPRKRI
FT                   SAHDCLRKHRGKVFPEYFYSFLYDYMLELSTPSDHSVGNWRFDECDRRIERIYNDMGMI
FT                   CDKLDVNLDLNIVHSFTEEPSQNVIPMTLRLPGVEPHIPQSSKTPYDSALIILNILLHS
FT                   MRNTTHSSYRIKSCDLILMISEMLSDEQKLDRCLPYLVHLLNDPSIDVQAAALKYMTQL
FT                   LLLVDYLTPVNVLIFPEYILPKLASFLSTTKGSYMRMIFATILPHLAKTALKFYEMAIL
FT                   LGSHVEKFELLKNFENLTIQLLIDPDSSAKISLLKNILPLASVFGKDKTNDIILSHMIT
FT                   YLNDPDENLRVAFIESILGLSIFVGITSLENYILPLLVQTLTDNSEIVVVNVLRSFAEL
FT                   NNLGLIKKRYKFDLIKVSSKLLLHPNSWIRLGTLRLLISVVKDLSLTDFYCLLYPLVRP
FT                   FFEYEVTNFDWATLYPCIIKPIPRSIYTLSITWALKAEKTLFWQQVKLAKPDPFGSRNS
FT                   TFLLNRNSKIGESGVVSNNQIPTSPEDIGWLGKLKASGFDEKDLWKIATLRDYIFRVAR
FT                   SRSNIPTQENNEVTMQQMGIYPRIVFFEKGSMYETEGFVTGSSMMANYRILVNSEYSPE
FT                   SLTKRKTVGGVNTNHTYSGANPYILKFLECIKFRHVLDDSEEFGPSIPSATVEEGHWKF
FT                   EGVLVSHLTEHTGSITSLALSPDQQYFLTGDSKGIIRLWDVLQLERNGYATSHVTVSMS
FT                   SSVKDIKFIENRNSFCAVTADGEIKIFRVEINSTSSSVRSNGSPHRHESISLLREHSLE
FT                   GEHISDMKFIGPNLAVTTLSCKLILFDLRDMQIAEEIQNPVSHGFITSFDLDSSQSWLL
FT                   IGTSKGILDFYDLRFELLVKSWKLKSTSYPIKHITVPPAGFTCNRKSERFALINGGTND
FT                   SVTIVFDVSKGQCSELYFTETVNLNTAIDNYEVLEVDNGEERTRTSVLATEVEDRSITS
FT                   LTMLGSNQFLTATFDKRVILWDTGNKANSSALISKLDDFTSSFSSVQVRPHLMAINEKI
FT                   VEKDPQNIGGPKRNMASANSSTFDLHSDIITGIAVIQKPLKMLILVDRAGVINIYK"
FT   CDS_pept        complement(94614..95999)
FT                   /locus_tag="PAS_chr3_0043"
FT                   /product="peroxisomal integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69969"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3D4"
FT                   /protein_id="CAY69969.1"
FT                   /translation="MPNRLIPLANPANRVLQLDAKLLDNEISDMLYRQLSGAFNSNRLP
FT                   SWLGRIHSNYASELKLLLELLIFKVTVWNKHSSYGLTLQNLVMYDGGVHNKKFRSKQQS
FT                   ELRVTKKILLLSSVLLGYFVKKIQSYVYSFEDYDLETDGEDLSTLERIRLKTIKLLKSQ
FT                   ISTLEKAHSVLSLVNFVTFLVSGSFPDLTTRILNIRFKPLVTTQVAFASNPETISYEFQ
FT                   NRQLVWNTLTEFIVFILPALSVPKFTKSLVSSITGTSPKSSQVTDEDLKVFSSLPERVC
FT                   AICFQNSQNSDSGAQNDISLNDTLVTNPYETTCGHIYCYVCILSKLQIFKEEGKNLPKS
FT                   DPNKYWHCLRCNEPASWCRVYTGDVEDALRQKAVEEVTEDEDASSEDEEKRDQDSEGAK
FT                   TVSQSFHHVNGSDYQTASFIEQAELNENEYTDGSEVEIYDAEDEYTDEEVDDDSPGFFV
FT                   GAL"
FT   CDS_pept        complement(97204..97995)
FT                   /locus_tag="PAS_chr3_1146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1146"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69970"
FT                   /db_xref="GOA:C4R3D5"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR028661"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3D5"
FT                   /protein_id="CAY69970.1"
FT                   /translation="MLLLAIGDFHIPDRASSIPAKFTKLLAPGDKIQQVLCLGNVCESP
FT                   STLEFLKGISPDFQMVKGEFDRDLSLPTSLVFNYDKLKIGLINGFNVIPNADPLSLLTQ
FT                   ARLMNVDVLVSGGTHKIEAYTLDGKFFINPGSATGAFTTKAPSKADLEALNVDKNLAED
FT                   KEEDNDGKEDKDNKEREHQKQANEKTSEKPSPQTFKGETSNQVTPDEDDLDNINTDSLE
FT                   QLDPIPSFCLLDIQGNVCTLYLYTCIDGDVKVDKVSYRKED"
FT   CDS_pept        complement(98764..100146)
FT                   /locus_tag="PAS_chr3_1147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1147"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69971"
FT                   /db_xref="GOA:C4R3D6"
FT                   /db_xref="InterPro:IPR010541"
FT                   /db_xref="InterPro:IPR013881"
FT                   /db_xref="InterPro:IPR027104"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3D6"
FT                   /protein_id="CAY69971.1"
FT                   /translation="MKRKTDDHSGNPRKSKLPPSLRDKVEAAKQKLNGTPTGKTVEKTA
FT                   LNVELHPLLKQNVTSSIIPKDYNPVLHTKVRPGFSASQLNPYLDQTTLSKPTRPYRPLK
FT                   FVEKGTYVKKAEEQRERLKKQQEEQQLRSEKESLGLEPDEALGEQYYKPILPPSIEPWD
FT                   KPLLKGNSYDNLDDVTFLDSEDEDNPITIYIQHPVPIPCPWEKNEPAPPSLYLTKEEQK
FT                   RLRRNERAIKHKEIQDRIKLGLDPAPPPKVKLKNLMNVLTNDAIKDPTALEAKVRAEVE
FT                   ERKLKHEMTNEERKLTPEQKAVKRELKKMKELDRGIYCAVFKIDRLVNPKHIYKVDINA
FT                   KQNSLVGSIVSVKDTFSLIVVEGGEKSIRKYKNLLLNRINWTENEHKKKPEGEEKTDQE
FT                   EPILEDLSSNQCFLLWEGPIADFRFRGWSNKQFEDELEALNFLGFHQAEMYWREAKVTF
FT                   SQ"
FT   CDS_pept        complement(100280..110206)
FT                   /locus_tag="PAS_chr3_0044"
FT                   /product="E3 ubiquitin ligase of the hect-domain class"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69972"
FT                   /db_xref="GOA:C4R3D7"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR010309"
FT                   /db_xref="InterPro:IPR010314"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR025527"
FT                   /db_xref="InterPro:IPR035983"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3D7"
FT                   /protein_id="CAY69972.1"
FT                   /translation="MEDSQLIDETIVRPEVKIPDHTKNYIKYLSECSLSELESELGKVT
FT                   CWNSSKTDLYYWVPLLNRMDSILKEKVTKYNLEEEFAKPVEIQPADESLLAAILTFSSL
FT                   LFANCYNNSIYASTKHVYNLINCCSVPVLLAALRLCVALGDATIQTGTMKYKESKVIDK
FT                   FVNMSIGFLPPTPPVLSNKPVSLNAGSPTDPGSEGQFNLADCCKLTSRKVPTKWKMLDF
FT                   EYYNSDEKRTNEIGPKRKKSKLTPTNTQSSSGNDASSSKQKSVNFSREGVQHLIISEEN
FT                   MRKFSLQQIFDKFYDKLPKECFFDFALAVQIAKAFNTDTFESLKLRQQLVSIKCMAISY
FT                   LSCMQSATDFLDSVLSSDSTLINDLCELIDPSLETPDIIYESAGKALECISYRKVFSLE
FT                   ILKALNGHVSYGSLFRYIKQYIKMMKDDSVVIPENRILLFNLLRNLLATKHVAQSLSNT
FT                   DILTLLIDLLSIRSSHRFHLSAGITVLCQYIEVIPRSLDKFILNNGFQLLLKAIDDEIH
FT                   YSLQNPGIPPADIIVSYNISFHQMLYLRELMIFVLSLIQTDSGDRMRNLFDSILLEHFN
FT                   LVLDNPKTFGSPIVICVVSSVSAILHTEPTAFSILNESGTIDRLLKSYPQLFDSSNDLI
FT                   QSLFDVFGALSLNKDGLNKVVESKSIDIFFEIFRNDNYSYELVEAAPQLANSLDQLTRH
FT                   FPELKPIVMDNIIRLIEDIPNIVSKTFPPTEFFQHPNGSFYKSKDDVVVEKEEGVEKLK
FT                   PLEATRGGLMYENVTYLITVLLEHNSRWKDITKKITFQKLLKFIIIDNAPYDFIVSDSL
FT                   YSFMGVLKYYDDEDRNYGFVPLLDCIDEYTWKLHEFTHYEKDDVSFFSQYEKMENGNII
FT                   GGKVIDNMKTLNALFFLLTDSYFSPGSLFSERMGQASSYFTSQKGAKLLKELVLYFRRL
FT                   ILEEVIIQRFTPDSVCEDTTFFAKVDFAPVQMTLGKQSDVKKKIDSAPNTKSKNIAQLR
FT                   LQINRAHTWLGFTFGSICRITMHKTQDRPASLGFKNAVHILSDFTIYITELYGNISTQD
FT                   ILIERAYHGIVTSLLYRLLVTRSRTLDLAIFAFAIVLLQSDTFQILKKLLISCSTQLTT
FT                   FDPEKLKEESKNFKTVSMNIESLTLHTIRYILSIFAIVGNKSNLTLIPAARVYYEGDIS
FT                   GFGTLHNELVPSFLTQFRLFSLGMLLEVLSPLDDGIDLLSFDKVVRSFPPVIVELFITI
FT                   SKNAYSHLGENSSTVPNGLLYPLVWQNVHPTNSRVDYLVSLGLDRSDALEFLKSTGNSL
FT                   APILKDEVPFYQGDLSQDRIEELAAEAKNRPYIVPKLEPLKPQYSNFSTHDELVFLRKA
FT                   NESAFVERWFIFAELFPDCVEKLSDLLIHVFLKNPGTTSNFERTILSTLLAIILSLDTS
FT                   SSEDEDKLAGTIGLFANLIKDSEVYDLGTESLEGFLSFCADSISAEFVNCSWFPKLLFA
FT                   FEHILVFTSFPEPEKLEVGIADIVEAQIPKFADSYRAPSAPLDEIFDTIIHCKNLKTME
FT                   VTIALSRVLSIFAKDDLKARKIFDSGILNELIRASSLFTDDSNFPKLQNYLLLLMRTCM
FT                   ETGPILETLMDHYLQKKLSDSRTLSTLLKANGVLAARNPQILAECIGSSVRLSKCVDPL
FT                   ESLSIVPLKKGNEIEDSIMTDATTGKSTDELSEEPDYRQNTGLVHTLILELMSVCKNDI
FT                   FSSPESSEPISPDNIRKSKQKLLKLFENKHFGYAVFLLHATAELVSSYKQSKLEFLTFS
FT                   RKKTIQSCQRPRPTALNFILHTLLGTENSGDFDESETQRRVIVSNLIKMIVFGFVSTPI
FT                   SKFDPNLPTKVDPDMTYVRQFTTDVLSKVLTDTHSSVESPSTRYRKLSVFTELLQKLIS
FT                   EKRDLCGHGLDILFTKYDAYQMTKVLVEKNFASLLTSLVSSFDLNFPNANGVMKPLLGC
FT                   ISSLGRIKHTYSDLLKDGQDGEDTHSTDSEEEEDNDEDMDNRDDTPNLLRNSTLGMYDV
FT                   ADVDNEDYSSEGGYEGGYEDLSEDNEHGPIEIIFSDDEDDDIEDDENDTYQGSSDMVIE
FT                   DLDSAEIIEDDSNSEGPTDEEYEIVNNGNFLINGREYENVEYDESDAQNDASFDEEVPF
FT                   DSENPSFDDDAGDDTDYDGWLNILGAEDGDEDEEDEDEDNEHEELNRHHIGSRRGRQIV
FT                   EIDRLGEEDPDLFASGNMESSRLRSMIEHLFEADDQIAGAFERDGVRVSVVDNNGLIGL
FT                   VDRPSKFMKPPSLEMKSSYERWSVANDIYGKVEYDALRLLPGLINMLFPPSYEIYKEKK
FT                   EREEQKRLEREREIKRQQEEREKELLERERSRQLETEQQQSQVDTADAESDEEDSEPII
FT                   INIGGEDVDIRGTGIDPSFLLALPDDMREEVFTQHIRERRAQSSGDNASMDDIPSEFLE
FT                   ALPDSIRREVQTEESNFRNFLLRGNDEDDSDQFDLSEETDSASQSTKKKFVLKKHKYYR
FT                   TPLVDKFGICALIRFLFLPQNKYDIDSLKQAFLQLSHNKQTRSEIMQMLLLVLHEATQD
FT                   QKAIERIFYQLTSRSNSAAQKILLKEEPISDGGIDSKELALQQFPISCTPLILSTQALE
FT                   IINYLLNADVEFRYYFLTLHDHQQLLKKFNKKQKLKEKDSYQKGPNYPINSLLSLLDRN
FT                   IFLGDSFVLKQLCYAVHIATKPLGKFKKLQEKKLKDGETVKPDVQFPFVSDENLKKLVS
FT                   ILVTDDCTSSVFRKVVGGLQNLSILEEKRSILAQEISENATNLGKQLVVDLEQLSSRIK
FT                   NADENVDELSSETLEKFTTASSKQAKLLRVLTALDYLFYTKKSADASESEIEALTNLYK
FT                   SLALGPLWGGLSECLVTLRDKKTLQYIATILSPLIESLMVVCKHSKVKELPIREVLKYE
FT                   QKKNDFVNEPIESLFFTFTDEHKKILNQMVRVNPKLMSGPFSMLVRNPRVLEFDCKKNY
FT                   FDQRLHEGNEKRPKLSISVSREQVFLDSYRALFFKKVDEIKNSKLEISFKGEAGVDAGG
FT                   VTREWYQVLSRQMFNPDYALFIPVASDKTTFHPNRTSYINPEHLSFFKFIGRIIGKAVY
FT                   DNCFLDCHFSRAVYKRILGRQVTLKDMETLDLDYYKSLVWILENDITDIIDETFSVESD
FT                   DYGVHTIVDLKPNGRNILVTEENKQEYVRLITEYRLQTSVKEQMNNFLIGFHEIIPKDL
FT                   VAIFGDQELELLISGLPDIDVDDWKANAVYENYSPSSIQIQWFWRAVRSFDVEERAKLL
FT                   QFATGTSKVPLGGFKELTGVDGVSKFSIHRDYGSTDRLPSSHTCFNQIDLPEYESYETL
FT                   RGSLLLAVTEGHEGFGLV"
FT   CDS_pept        110554..112191
FT                   /locus_tag="PAS_chr3_0045"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69973"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3D8"
FT                   /protein_id="CAY69973.1"
FT                   /translation="MSYLFTFFVIVHIYKTPTDYMGDTDSISTNYTMDTNQKDQEGSTA
FT                   ASSPSKIDLTGMKPQPLPIAPNMIDGLKPVRRTKIGDIKSLFEPKGDGSQIVHLLAEIK
FT                   DTLEEQNVAKTTPNAELSDIKELLISMVDRSKSNKALLNTLIQEESTPDNEMLVEIRDM
FT                   IFNMIDRSKTNKSSLDDLRGHFDEQISDRLSQVCKTVEQQSTDIHEKMKTLLDSKVNSS
FT                   LLSELDSKLGNIVDHETEELKSLKATVSSLTKKSDIQGIELKLTDFSERMERLQESNDL
FT                   KDSRLEEKFDKLVQELTTNNTKLESRQELKEKELEQKIVGKDEIIDVLKLEIHDLHRKL
FT                   QYSNEKHTNELEAKSNEILSLRQLLNDSNMQNTAIQEELSTLKAKGLESSQLQASIEEM
FT                   KREKSVLTRTLISSCARIKNQQEVFQLWSDRTEDIKSNLLTLQETLKSDRSFIIPLKRP
FT                   STEGVDQLQESKNSPKKHIEVHHEEVGNISNGSIMSPIFMEKLSPKKRIVSSPSKILSN
FT                   RCLNSNSATPSKSPIRLSSTKNFTEQEN"
FT   CDS_pept        112368..114548
FT                   /locus_tag="PAS_chr3_0046"
FT                   /product="Protein required for S phase progression and
FT                   telomere homeostasis, forms an alternative replication"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69974"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3D9"
FT                   /protein_id="CAY69974.1"
FT                   /translation="MDKQHSILSFYSSFNTDVVDLRLGASESRVSSTGVSSTSSNETTD
FT                   RGVNDRRKVVKINDLLTGNMIKHRKEVTEASETIEETMRNLDPVRDIRNHEIIDLDQEQ
FT                   QNPPPKKNRVSLLSLLDGKGVRDKPTKPIEDTKLLVTLKISSSALKDIQKKIDRQELHT
FT                   PGVAISNRDPLKPAFSFLNEIQLRAQRALENKHNESGSDCLSSKGMLPPPLKVGDFLTQ
FT                   NVTDEVYNCPRRTLSLPSRANTRNHAVIDFPQALGDLKTEKTNPDPLRATKYHYTTSDF
FT                   QYHDLTRLVQEQVPDVKRHYGLECLIGLFHDIDFQRKIAHNSSQWIDLFKPTEYKELLF
FT                   SSDVSTGINDWIQSAFEKLQNMDRTKRKPAHASKKPKRDDNLDDFIVYDDIETIEVELF
FT                   APLLIIEGPAGSGKSSSIFTIVERQMKGFVFEINTGESRARKDIGFHLEQIATTKLVKR
FT                   MTKGYADMLDISVEDFENISNQKGVILFDDCDVDLEDDKDLFITIKNLLEYSHRPIVLT
FT                   CTDSTKIPPDLIELSTVIQIDRPDEKLLSDYLFIIGCLMRFTIDRPILNELARLQDIRR
FT                   SLMQLQAICNCKPPEGKIIQVKQVTPNTFEKVVAESNIQQLERYYDSLQDDVMLPTIPN
FT                   FDSLREEYLEFYASKAIRAGSRKWRPLYKNSKTYLIKYPFSVFQRLSITNTALFTELAP
FT                   IIRLFARMDVIMDGIRRFLHNPTKILLGLHSR"
FT   CDS_pept        114723..117176
FT                   /locus_tag="PAS_chr3_0047"
FT                   /product="Nuclear actin-related protein involved in
FT                   chromatin remodeling, component of chromatin-remodeling en"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69975"
FT                   /db_xref="GOA:C4R3E0"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR027668"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3E0"
FT                   /protein_id="CAY69975.1"
FT                   /translation="MSELSDSEVKVEVEEQAVPKKTPKQESSESTNGSAPKKQKRGSAA
FT                   SGQKVSAEILQRRREGRIKALATLQSKLDKLGIKRVDQKNALPASTVPSISLINQKNYF
FT                   TGYLKRDEQNLSIKNVKEMNRLLAEKKKKDKLSKSSAGTSTNTPDVDGEDEDDNDGDVD
FT                   ERVGSNTIVMHPGTTNIRIGLATDIDPKIIKNVIAFPRRPGQESTKGYIFESRKGSEHE
FT                   AKEFETHLPSIVSSFRERMRYYKRRILPNSNETVANFNKRQEPQVVEDHNDIHKVDFLD
FT                   SKKLLNDPEVKYLVGDDALRLDDYSDWILRSPFYKGNFNEDKSIYRSNQEILGDIELVI
FT                   KEGLSKNLGIEPAKYADLNIILIIPNLYDKTYVAEMTNLLINMSFANIGVLQEGVSATF
FT                   GSGISNGCVIDIGSHYTKVCCVDEGMIIPNSQIELDYGGDDVTKTFAKMLKRNQFPYKE
FT                   LDLSRITDWNLISQLKEKYLTFEDADIAIQLYNFSVRNPHQLTKKYDFKVFDEVMISPM
FT                   GFFYPEVFGARGSPINRKGNFFDVHRDYFSGRYDSPLSRSQLDQVEGKFLANMEDLEEI
FT                   VNRLLSESCGLGSNYNMGNNSNTSSGNNNLGNTGAATAGSEDSSDYMEIEETKLKKQIK
FT                   NFLELKKEGKGLNLTPLELAVIESISYAGFQDMNKLKKLYENILIVGGSSKIDGLDLIL
FT                   VDRIHIARSPVLYSTSLDQAIKYITLKKEEFEKANKDSKTEGDVKEFKITEEHLEHLRG
FT                   LLEGTSAVPIEILSSSRDIDPAEMCWKGGSVYARLKIVNEMWINKEEWNIFNDRAFNYK
FT                   CLFTF"
FT   CDS_pept        complement(117173..117853)
FT                   /locus_tag="PAS_chr3_0048"
FT                   /product="Essential t-SNARE that forms a complex with Tlg2p
FT                   and Vti1p and mediates fusion of endosome-derived"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69976"
FT                   /db_xref="GOA:C4R3E1"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="InterPro:IPR015260"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3E1"
FT                   /protein_id="CAY69976.1"
FT                   /translation="MDPFNDVYKDAVSQVNQLDGIINNLTPKNINQSNIDDIENNKQEL
FT                   NETIQDLRDTVRIIRENNDNYNISEKELDERIAKVDKISATFQQLNLHWNDKLAKRPKE
FT                   VTTMANRISQDYGNENPFNNDTAFQEFQQQEVLREQDQHLDSVYNTMQNIHLQASTMGT
FT                   ELEDQGILLDDLDTDFDRVGGKLTSGVKRIEWFIEKNKERASDCCIILLIIALIFLLVL
FT                   LFIA"
FT   CDS_pept        117945..118097
FT                   /locus_tag="PAS_chr3_0049"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69977"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3E2"
FT                   /protein_id="CAY69977.1"
FT                   /translation="MPCHRRMMDIRKVIKFSDVGDITMAVCGIHFRCRLFSFNKGIRRQ
FT                   SYSTI"
FT   CDS_pept        118548..119780
FT                   /locus_tag="PAS_chr3_0050"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69978"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3E3"
FT                   /protein_id="CAY69978.1"
FT                   /translation="MSLNVTPSILLPHIPSTGVDRYKNVNFLLRLNEDLVSAIQETTLE
FT                   QDVPKLIVKNGKLSFRIKGKLLEATVLRDNLKTELYSSSEDERFINMGTLDYKINMAKS
FT                   NIARCPQQPHKSLLKTSALSHQRSHPFLLTSSSAPPSPSPSSSSFSSSLHSDVQHLIQQ
FT                   FLLKGNSLTKEEVGALISKSKVPKAALRRMISKVHDVNYVLRDFYLLQVNCHLLGAMQR
FT                   HTIRQYLSCKLDQIGYPENHPLKLKILHALPDFKFFKKKKIQSPKPVASPIASTSKAEN
FT                   NSPSPSSSASSDGLKKRKADNVSPITSSEDDVKKTKTTKTTTTPVPKTVDPELLQLAIN
FT                   FKAKYPEYEKLYKSLSKPNCDPNHDKSWEHKQLTKLVKMHNQLSAWKAKLWEEEDNMRA
FT                   KSSGKVYIKEK"
FT   CDS_pept        complement(119796..120821)
FT                   /locus_tag="PAS_chr3_0051"
FT                   /product="Subunit of the SAGA and SAGA-like transcriptional
FT                   regulatory complexes, interacts with Spt15p to act"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69979"
FT                   /db_xref="GOA:C4R3E4"
FT                   /db_xref="InterPro:IPR003195"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3E4"
FT                   /protein_id="CAY69979.1"
FT                   /translation="MTDAKDKDHKYRYRMEIQQMMFVSGETNDPPVETTSLIEDIVRSQ
FT                   VVEIVLHSSQTALSRGTKSIVPEDVIFLIRHDKAKVNRLRTYLSWKDVRKNAKDQQSGD
FT                   LADIGGDDLLDNSTSQVAASGAPGAPGSSSSTSMDSKMLSKYKKSKIRLPWELQFVFTE
FT                   QPLDTNEDDAEDEDERAATLASLKRLKTNDERTKNMTKEEYVHWSECRQASFTFRKAKR
FT                   FREWCGLSHLAESRPSDDVIDILGFLTFEMVCSITEEALIVKMLEEQNGDLASSTTTIQ
FT                   KLQESHRKRKHLFDGPDKDVRPITSGHVLEAWRRLQKRNVEKKAIRNFQGGKLRSRVQL
FT                   I"
FT   CDS_pept        121028..121990
FT                   /locus_tag="PAS_chr3_0052"
FT                   /product="Thiamine pyrophosphokinase, phosphorylates
FT                   thiamine to produce the coenzyme thiamine pyrophosphate ("
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69980"
FT                   /db_xref="GOA:C4R3E5"
FT                   /db_xref="InterPro:IPR006282"
FT                   /db_xref="InterPro:IPR007371"
FT                   /db_xref="InterPro:IPR007373"
FT                   /db_xref="InterPro:IPR016966"
FT                   /db_xref="InterPro:IPR036371"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3E5"
FT                   /protein_id="CAY69980.1"
FT                   /translation="MVFIKTTEPNFVAENADLVDIPVPTDPSINVIRPLHPIIRYQIDD
FT                   NKVPGKTCLVILNQKINLFPRVFEKLWDNTYLRVCADGGANQLLSFVRENGLDEQKYLP
FT                   KYIVGDMDSLTEETKNYYLSTGKVIVKTQSSQYATDFDKAITVCFLHFNYPNFFNDFDT
FT                   LNLDDNNGLTTLKNSLDTKEFTVPLDMIFLGAIGGRFDQTIHSIGELYKHASDNLLQMR
FT                   FFNTEYLEIIFLVPKGTNFIVLEKQHVDDPLCYLGLLPLNNPFIMHTKGLKYDVANYAS
FT                   SMTGNISSSNYNVGSNGFYVQNTDHLVVNIDLNHILGEV"
FT   CDS_pept        complement(122032..122976)
FT                   /locus_tag="PAS_chr3_0053"
FT                   /product="C-4 methyl sterol oxidase, catalyzes the first of
FT                   three steps required to remove two C-4 methyl grou"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69981"
FT                   /db_xref="GOA:C4R3E6"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3E6"
FT                   /protein_id="CAY69981.1"
FT                   /translation="MTEIFNSTYLDSIRGPTFSDITKNIFATQPHLTFLEKIWAAYYTY
FT                   MSNDTLATGLLFFMVHELMYFGRCLPWFIIDQIPYFRKWKIQPKQIPSNKEQWECLKSV
FT                   LKSHFLVEALPIWTFHPLCKTLGISVAVPFPSWKTLALQFSVFFVLEDLWHYWFHRLFH
FT                   YGAFYKYIHKQHHRYAAPFGLAAEYAHPVEVMALGFGTVGFPLLWAYFTRDLHLFTITC
FT                   WITLRLFQAVDAHSGYDFPWSLHNFVPFWAGAEHHDLHHHYFIGNYASSFRWWDYTLDT
FT                   EAGPEAKKEREERMKLKAERKAAALAQKNKKIA"
FT   CDS_pept        124224..124769
FT                   /locus_tag="PAS_chr3_0054"
FT                   /product="Protein component of the large (60S) ribosomal
FT                   subunit, nearly identical to Rpl20Bp and has similari"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69982"
FT                   /db_xref="GOA:C4R3E7"
FT                   /db_xref="InterPro:IPR021138"
FT                   /db_xref="InterPro:IPR023573"
FT                   /db_xref="InterPro:IPR028877"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3E7"
FT                   /protein_id="CAY69982.1"
FT                   /translation="MSSTNTVPPVSQYKEFEVIGRRLPTETVPEPKLYRMTIFAKNETI
FT                   AKSRYWYFLQKLHKVKRASGEIVAIKEVLEERPTEVKTFGIWIRYDSRSGTHNMYKEYR
FT                   DVTRVGAVQGMYQDLASRHRARFRSIHILKVVELTNDDDIKRQYVRQFLEKDLKFPLPH
FT                   RVPKTQALYASKRPSTFY"
FT   CDS_pept        complement(124898..126043)
FT                   /locus_tag="PAS_chr3_0055"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69983"
FT                   /db_xref="GOA:C4R3E8"
FT                   /db_xref="InterPro:IPR013964"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3E8"
FT                   /protein_id="CAY69983.1"
FT                   /translation="MSKEKSTRRSIFIPPSYSDQNETQQKTMELENLEQELTLTLQQID
FT                   SDLTKTNRIINDSIIPVMRRYGAASQGVWQGVKVWKSFFEASANVQLSGYDEAMESYDD
FT                   STLHNKNSVNTGKDSAKEFNDDGNTGAVSNHTTDDIQKRYRESHRIFEQKRGPDDDTMT
FT                   ESFPTRIKNSTPNKTGRSFQFDDNTASVSLDPPSPTYHHLKAPKELSSEKDTSPNKQTQ
FT                   NPDQPTTSSIFDSSKLQQAQEEQRNKLMFMHRALDNVWQVQMTPKKRENTPIVNSRTPK
FT                   RRSEHKVRKAPQYDSSPFNAPEPPQLQSDLRLSMPSSPLRQVDDDQDESFMVAPQISVE
FT                   TKKMSESTQKEQLFDEIELPESTEIEDTTLKKIPGKYADSK"
FT   CDS_pept        join(126206..126367,126420..126521)
FT                   /locus_tag="PAS_chr3_0056"
FT                   /product="Mitochondrial intermembrane space cysteine motif
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69984"
FT                   /db_xref="GOA:C4R3E9"
FT                   /db_xref="InterPro:IPR007918"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3E9"
FT                   /protein_id="CAY69984.1"
FT                   /translation="MGNAMSQSVAPECTELKNKYDSCFNSWYTDKFLQGKSLQNECEGL
FT                   WDDYRECLEAYLIKKGIKPMVDETAKDAPFEEKGELQSKEKK"
FT   CDS_pept        complement(126586..127149)
FT                   /locus_tag="PAS_chr3_0057"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69985"
FT                   /db_xref="GOA:C4R3F0"
FT                   /db_xref="InterPro:IPR007529"
FT                   /db_xref="InterPro:IPR039723"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3F0"
FT                   /protein_id="CAY69985.1"
FT                   /translation="MYRVSEIPRGSDPDSYFSSIYKPASGTSRTTAGPSSGTKRSSRVN
FT                   YNFQSLEAQAHGNTVPTTQAEEKASNKRFEELNRENYNEQAKIEIPKSGLEAFTKHRRL
FT                   KPGETASTKRILASRKTLVNYVEEVDPQLMKIFKATTVPSNRRHLKKLCSICGNNAPAT
FT                   CVKCGARFCSVSCGRTHEETRCTW"
FT   CDS_pept        join(127260..127304,127393..128649)
FT                   /locus_tag="PAS_chr3_0058"
FT                   /product="Oxidoreductase of the mitochondrial inner
FT                   membrane, involved in cytoplasmic and mitochondrial iron h"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69986"
FT                   /db_xref="GOA:C4R3F1"
FT                   /db_xref="InterPro:IPR021163"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3F1"
FT                   /protein_id="CAY69986.1"
FT                   /translation="MIRQFVRFYSQKVAILPVPYGLSRFGVAPDHPEVKECQTRFEEVA
FT                   HDKRFNFYGNVDIGKDVSIEMLKDNYNAVIFAYGCSEDNKLNIKGADHKGVISSRQFVG
FT                   WYNGVFDLQDLNPPLEKARRVVIIGNGNVALDLTRVLLGPVDPLWKSTDITAKAISKLK
FT                   ESKVEHVTIVGRRGLLQSAFTNKELKELIDMHSIGVGFKGVSEDHIAPFAPLAKNLGRV
FT                   QKRRLDLLTKYFQKVKNSTKTACTKEWELQYLLSPKEIIAKDDQLLSKVVFEHNVLVQP
FT                   DIDVPVSIEPTGEFTELPADLLIYSTGYKGSAIQGLIEAGIPFNEKKGYIPNKDGRVSP
FT                   GIYASGWIRRGATGAIASTMMDAFFVAETVLSDLDNSSTEKHGLGHYISKQNKPVVTWQ
FT                   DWEKIQQHESEAGTSLGKTREKLTTIDQVLELIK"
FT   CDS_pept        complement(join(128696..128938,128990..129052))
FT                   /locus_tag="PAS_chr3_0059"
FT                   /product="Subunit f of the F0 sector of mitochondrial F1F0
FT                   ATP synthase, which is a large, evolutionarily cons"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69987"
FT                   /db_xref="GOA:C4R3F2"
FT                   /db_xref="InterPro:IPR019727"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3F2"
FT                   /protein_id="CAY69987.1"
FT                   /translation="MSFVIRRKLSTLIPPKIASAKNLGSNPHAKKIQEVVKFYKALPQG
FT                   QASFPKASSPIGKYGEKYFNDGNASAKPLLHLALGVILFGYSLEYYYHLRHHKGEH"
FT   CDS_pept        complement(129258..129518)
FT                   /locus_tag="PAS_chr3_0060"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69988"
FT                   /db_xref="GOA:C4R3F3"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR016487"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3F3"
FT                   /protein_id="CAY69988.1"
FT                   /translation="MSTARVDPSEFLSRITGEKVVVKMRDGTECHGALQSIDGFMNVAL
FT                   ENTVGKYKGETTKTYGDVFIRGTNGKYSLLSSILLERLLTL"
FT   CDS_pept        129687..132002
FT                   /locus_tag="PAS_chr3_0061"
FT                   /product="Golgi-localized RING-finger ubiquitin ligase
FT                   (E3), involved in ubiquitinating and sorting membrane p"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69989"
FT                   /db_xref="GOA:C4R3F4"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR024766"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3F4"
FT                   /protein_id="CAY69989.1"
FT                   /translation="MNVDRAQIIFFLILFFLLLGPNGGNDLSNENRNKVISFKQFKEDI
FT                   QHSNEVLRNSTWEEGYGDLAGFSVSYQDALDGLNRSSPINDNFTEDQKYSILPNEISEL
FT                   AMDIWSAEEGTKKIRSGSFPLNVSGTLRGQFHNSNKSFTRIPMVLPPFYNYSHPLQVMV
FT                   QPTTEFDDPTPTPIEEKESDINGNITDFEGDLMIRIGSLDEYTSINEYCKDTTVMSLEV
FT                   EANDFDELHQHKLNLIGLYHQNSGNLVATTRTGKFDGVHALPHLTLYQELFNQSKNAMI
FT                   QRTNKTHLEDLEISTMDYFRETSDNCEHVMYLHFESTGLSKDELRQIDDELFTPIGRPH
FT                   KKIPPVKVTSGLLYSPDCGISINFDEIVGPRKEVQEQRLRNVILSGIVILFVQIFFSVQ
FT                   QMSATTTPSTISRISFSTLAILNLIDGSLSILYALCSVVYERLYLPITVSAFLSFTLAS
FT                   VFEMRYMISIYLSQMNERNVSMRTALQGTPVDNINETQPLVDNNETILPTTQAPTTTPQ
FT                   QQNLRPTILEDEQTVSGQIYTRFFFFLIAFTFLILNAILWPRKSRLIFEYITVFALSSF
FT                   WVPQVYRNVYRGTRKSFNWGFVIGTSILRVLPVGYVCLYKHNVFYHHYDPIFFIVIVSW
FT                   LGLQILVLQLQEFLGPRFFVPDKMLPAAYDYHPVLTESDLENGFGASEEEGHHVTHEDG
FT                   HCVVDCAICMSELKVPVVSRKGLGNEESTEHSNIPGILSRRVYMVTPCRHLFHSECLES
FT                   WMQYKLQCPVCRNPLPPL"
FT   CDS_pept        132173..132910
FT                   /locus_tag="PAS_chr3_1148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1148"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69990"
FT                   /db_xref="GOA:C4R3F5"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3F5"
FT                   /protein_id="CAY69990.1"
FT                   /translation="MASSRTIKACLFDMDGLLINSEDIYTISLTKVLETYGKPPLTWDL
FT                   KIKLQGRPGPSASKLVIEHYDLPLTPEELFAKTTAVQMDLWPTVKFLPGALELLQYLDT
FT                   KKIPFALATSSHKLNYDRKTGHLQHGFDLFRHHIVTGDDSRIPPGKGKPFPDIWFAALE
FT                   SLNKERKQHGQDTIDITECLVFEDGVPGVEAGKASGAYVIWVPDERALKVLAGKEKEII
FT                   GENNEHGIILKSLEAFDKTMLGS"
FT   CDS_pept        complement(132959..133921)
FT                   /locus_tag="PAS_chr3_0062"
FT                   /product="5-phospho-ribosyl-1(alpha)-pyrophosphate
FT                   synthetase, synthesizes PRPP, which is required for
FT                   nucleot"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69991"
FT                   /db_xref="GOA:C4R3F6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3F6"
FT                   /protein_id="CAY69991.1"
FT                   /translation="MATNSIKLLASDTHYALAELVSKRLGTPLTNVAIKRDSNKEVSFS
FT                   IGESIRDEDIFIIMQIGSGIVNDKVIELLIMINACKTASARRITAILPNFPYARQDRKD
FT                   KSRAPITAKLMADMLTTAGCDHVVTMDLHASQIQGFFDIPVDNLYAEPSVVKYIRETVN
FT                   IDEAIIISPDAGGAKRAAGLADRLDLNFALIHKERARANEVSRMVLVGDVTDKVCIIVD
FT                   DMADTCGTLAKAAEVLLDNGAKKVIAIVTHGILSGNAIKNINNSNLDRVVCTNTVPFEE
FT                   KLPQCPRLDTIDISGVLAESIRRLHNGESISYLFRNATL"
FT   CDS_pept        complement(134238..135944)
FT                   /locus_tag="PAS_chr3_0063"
FT                   /product="Putative protein of unknown function, contains a
FT                   zinc finger region and has homology to human BRAP2,"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69992"
FT                   /db_xref="GOA:C4R3F7"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR011422"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3F7"
FT                   /protein_id="CAY69992.1"
FT                   /translation="MYNIVIDLDSPKELLLKARDQSEITSLRNLKALLAGNQIFGEDGL
FT                   DLDYWSTTVLKHHNIFVKSNTKQAQPHLALNFKKRSNIVEEIRNTLSKVQNTRIGVPDY
FT                   RYTRIELIAFDKMHDTNYEKTDYLRASFLGYGVIRLFREEINEKTTEDAELGPEPTSRS
FT                   KIAAILAVPTYMSISAILKLVGENFVKDVVHFRIFKTQQYKRYMCILKFQSEDQCAAFQ
FT                   RALNGKPFNSIERERCQVVQVNKIIINSPHDKANKSEELNFTYGIIELPTCPVCLERMD
FT                   TNMTGLLTIPCQHTFHCQCLAKWRDDTCPVCRYSQKERTSKDVTSEASQCSVCGDTANL
FT                   WICLICGNVGCDRYNSAHAVNHFKETSHCFAMQIETQRIWDYAGDQYVHRLIQNQTDGK
FT                   LVELSLNNEKAGSSSDSNGKNYSADKVDTMELEYSKLMIAQLEEYEKNMTKIMEEEKIR
FT                   FANLQTAMGRLGTDSKVSERTKELETKLDQMMQKYDEEKTLALVLTEKLEFFDKQTSQL
FT                   KKENEDLKEEINDLLMHFQTMEKYKDADESVKEGKLVLKPSRKSSRKGSRK"
FT   CDS_pept        complement(136103..137641)
FT                   /locus_tag="PAS_chr3_0064"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69993"
FT                   /db_xref="GOA:C4R3F8"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3F8"
FT                   /protein_id="CAY69993.1"
FT                   /translation="MFIEGLDRKINLMMKTNTFFRKLGRKFKSFLAIGVELNPFVVLIL
FT                   GLLAAATLGMSTIERKSFRTGPMRFQLSSSPTFEKILQCSEIESASVCFDKHRKNLLKE
FT                   SGPFLSPFGEPQLQTCLSIASKNPNDISLLLNLQTCYHQVDIIERATEFSYALPKTSWW
FT                   TTIGIFLSISMQLFVAIHSFVVFVMRKREFSIIHDSIHRLTQDNYLRLEKERELNSYLS
FT                   SVSINTNSELAKLKSKVSESENVPLEVRKLEENLASLKKQVYYSNTRMLEAMSKQEREF
FT                   VLQKKHGYNTTRYYDPSPLTQNSKLDKDKQNDKKKEKEEENSNKTIEKEKKREEHSFDL
FT                   TTESGREAWKSYIQKSLAFKPKGPLLDKENKSTQATPVRLTTNQSSDQLKSIKNISSWE
FT                   NSPQKTKNTITSGSALKLAAQSLKDDNILGASVKTLIANTNSDEQSEGKHLGVTSSPLE
FT                   VSVNDIQQIDKNGRPFRRIFVPGRGWLAAKTFRSEVDSGAIKLVTETETRITTN"
FT   CDS_pept        complement(137836..142920)
FT                   /locus_tag="PAS_chr3_0065"
FT                   /product="RNA binding protein with preference for single
FT                   stranded tracts of U's involved in synthesis of both"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69994"
FT                   /db_xref="GOA:C4R3F9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR008847"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3F9"
FT                   /protein_id="CAY69994.1"
FT                   /translation="MAVTQKRKWKDTEPKDDMSPVSAAARSSILNPSEVVFPRGGGSVL
FT                   TPLERKEISNRVTADVLFEKETAKESSFKSTDATKKRKTTATTVINPAPTVSGTIYDQK
FT                   DDSNTTTTSMTLKNLIPGSVVLGQVISIQKLGMQLGLPGNIRGYVPITSVSKQITQQLE
FT                   ALEQDSDDEDASSSPQLSEKVFPELSKIFQLGQWLRAVVLEESSVPSEHKHKIQLSVEP
FT                   EKVNAHLEDDDLVPGGVLQVAVNSVQDHGCIVDTGKKIPGFIFSKSFKNSGIDMETDLK
FT                   PGFVLLATISKSNNKNTITLTLPSMNNKDNGSTLSTATSVDAVLPGVMVNAHILDITEE
FT                   GIFCRVLGLLPGRIPLAHLKLFNVPEIRETYKIGSTIKSRVVGVLEYEGSKSLTLSTIP
FT                   SILELDSTYDESPLESFPFGFTFESVKIVGKDSNNVYLELNEDTYGQVHLSKLNKEVSI
FT                   DSFYKVGSTHHKARVIGYSPVDKVFVLTMDPRQLEAKFLNIQDIPIGEIVTGVVTKVHS
FT                   HGLNIKIFDQFEAQVPYGHMSDVMLTYPEMKFKIGTKVKGRVLKFYRGNLCVTLKKSLL
FT                   RSERDELIFTYEDVVPNKRTFATVEKFFPTGVLMSFFNNISGFLPKTEISEAYVNRPED
FT                   HLKLFQTISVRIDSIDPATNKFRVSCLLSKDLSEEQEKKISTFIPGSSILEVYIVEKMK
FT                   DAMIVEVKDSNVRGVIQEGQLSDGDQNQNKTLLRTAVVGSSLEALFLHRDPKSRTINFT
FT                   AKDSLIRASKSGQLPASFEELPAVGEIVYGYVHTITNAGLFIEFADGLSGFARTKDITD
FT                   EPSDKLPSLYFKNQSVRARILKLDDEFRKFRLTLKDIDHQIVAATNPVDKSITNLNEFV
FT                   PGKITKAKIKSVTPTQLTVELAENQLGRIDVSQVFDSLLEIKDTKKPLSSFKEGAELKV
FT                   KVIGYQNKDSSFTSVAFRDWGDILVELSIKKSELEEEGKVNVLSLTQITPGTKWLGFVT
FT                   RYARGFWWVSVSPKFRTKLSLMDLSKSGSVEELEKAYPLGSAIEVTAKQIIGNKAVEVF
FT                   SKENRIETINDVKVGDKLPCRIISLSHDYVTVELSDKVKAKSFITEALDDYSESLESTF
FT                   STNDICTATVLSVDDTTRQIFVSLRSENAKDKLIESFEDVKRGDIVRGFITRISNFGVY
FT                   VSLGRTVFALVRVTDISDLFLTDWKKHVKLNQFVTGKIVDAGEERRILMTLKESQVGQG
FT                   TGALHQFDDLKVGDVYEGTIKKIMDFGVFITLDGVHSVDGLCHRSQISDSKIENFESLF
FT                   NQGDRVKVKILDINRNKKQLSLGMKASYFANRDDEEEADQLRAETDDSVDSDSDDQMME
FT                   NIFETRQQDSDDEPDVDIDTESPKKIASGLSTNGFDWTASILDQAEDDESSSSDEEDFT
FT                   KKKDKKNRKTKASIAEDKSATLNTRTPQSVSDFERLLIGNPDSSILWMNYMSFQLQLSE
FT                   IEKAREIAERALKIINYREEQEKMNIWIALLNLENTFGTDDTLEEVFKRACQYMDSYVM
FT                   HQKLVGIFALSEKWEKCEEIYTVMTKKFGRNVTTWVSYGAFLLERGNPDEARQVLGRAL
FT                   KVLPKADHIEVVRKFAQLEFAHGDAEQGRSLFEGLLADVPKRIDLWNVYIDQEIKINEK
FT                   KKVEDLFERVITKKLTRKQARFFFGKWLEFEEKQKDVKAADYVKAQASDYVQKHQK"
FT   CDS_pept        144270..144836
FT                   /locus_tag="PAS_chr3_0066"
FT                   /product="Peptide methionine sulfoxide reductase, reverses
FT                   the oxidation of methionine residues"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69995"
FT                   /db_xref="GOA:C4R3G0"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3G0"
FT                   /protein_id="CAY69995.1"
FT                   /translation="MPVVSSLISSNIKKSPQDKVVTVAGGCFWGLEYIYKMHFKDRIVD
FT                   TQVGFANGNLANPTYKEVCQGLTYHAEVLQIAYNPEVISYKELIDFFFLVHDPTQDDGQ
FT                   GPDIGTQYRSAVFYLDEEEKEIAEQSLAETQKKWFPHHEIVTQVEKLTSYWDAEDYHQE
FT                   YLIKNADGYHCPTHVLRTEPKAISV"
FT   CDS_pept        145294..145653
FT                   /locus_tag="PAS_chr3_0067"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69996"
FT                   /db_xref="GOA:C4R3G1"
FT                   /db_xref="InterPro:IPR028209"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3G1"
FT                   /protein_id="CAY69996.1"
FT                   /translation="MGICLSCLRPNYDDNDLNNDYSENTPLLNDEDNAVNSHFYEARNN
FT                   ELEDIVNNTNENLIDVTNFHLDTNQEVQPSEKGANSLNSTLHSEKDLSELEAKIREDFA
FT                   IDESLKSLPLVLNLE"
FT   CDS_pept        complement(145705..147414)
FT                   /locus_tag="PAS_chr3_0068"
FT                   /product="Component of the RSC chromatin remodeling
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69997"
FT                   /db_xref="GOA:C4R3G2"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="InterPro:IPR037382"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3G2"
FT                   /protein_id="CAY69997.1"
FT                   /translation="MAPKRKLTSEIGSSNKQQKRKGSTTTKPSKLVDLDVKQESNLKGL
FT                   TLRQFFTHVLDQLETLTAIEEETGAEYRRIDPYVKLPSKKFFPDYFQLIQVPISLEEIE
FT                   KKVKANKYKDANQFLEDFELMKNNANFYNDAESTIAKDSVIIWEFVKDLVESYESGSTP
FT                   DEEDYSEKIGGVIDELLSMKKPKIGKLALPFIESVDRDEYPEYYEVIKEPITFQMIQEF
FT                   LKEGKYKGGKKGVEKFQNDLTLLFNNARTFNDSKSLIYRNAELLEKKAESEIPLIYKEP
FT                   EHSSIKLKIKPIKTETEESLSAKKRGRKPKKAKAVTFTEKESKKVVEKSDNEDLEEINE
FT                   DLDLDNEPSLYQDDFSDEEEQVDETKLIDKNSIVNPLEPSESYRFKYKSSDKNDTAEYP
FT                   YEEPSIKEVSFSTFRARLINSAFNVHSTDKQMYEYKFPIKELIPNEESPNKREAHFSLS
FT                   LPSITESFHFDTKLNPDLRTDAKFETKLTVNNEKMNPIPSVSYEDILSSKYEMKLAIGL
FT                   NLVEFHCTVYSKPGKNDVDSITRLPSRHASDSKGANNVVHEKILIWIHIAQQ"
FT   CDS_pept        complement(147604..149493)
FT                   /locus_tag="PAS_chr3_0069"
FT                   /product="Carnitine acetyl-CoA transferase present in both
FT                   mitochondria and peroxisomes, transfers activated a"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69998"
FT                   /db_xref="GOA:C4R3G3"
FT                   /db_xref="InterPro:IPR000542"
FT                   /db_xref="InterPro:IPR039551"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3G3"
FT                   /protein_id="CAY69998.1"
FT                   /translation="MSAPLLFKRSFSMSLRRQAGQLYKYQDSLPNLPVPELSQTVELYK
FT                   RSLIPLYPEGETDPNFLRYSKVIDDFFKTDGPKLQERLQTLAKSERNWLAKYWDNVAYL
FT                   DYRDPVSPFVSYFFNHKDHRNIPFRGDQLKKAAALTREVVLFAQAVHEESLAPEVIKPR
FT                   VGAANQTPTAFCMESFRWMFNNGRVPGAPSDTNIQYDPSKNSYVTVISHGNFYVLNHHD
FT                   SQGNPLSEADLYQQLTEIKKHSLVNKQGEIAPVGVLTSSNRDVWYNNYSELIQSPLNKN
FT                   NIELINASTFVLALDSDSPVTIEEKSRRSWHGNGANRWFDKPVQMFVAENGSSGFLGEH
FT                   SKMDGTPTLGLNDYVNKKLKSETYSFETASTSDKQWKFLNWDITPATQTAIKQELATFD
FT                   QTVNSLDIRVWQYPGLGKSLIKKFKLSPDAFIQMLIQLAYYKMTGISRPTYESASTRKF
FT                   FRGRTETCRSVSKESLEYVKKWQDANVSDAEKVAAFRNAVSSHLNYITKASNGQGCDRH
FT                   LFGLKQQYQSGETVHELFTDPICAYSQHWFLSTSQLSSEEFNGYGWSPVVPDGYGLAYM
FT                   VNNEWLHVNVTVAKDNGLGLRADVMHYYLTEAANEIKELLTNELNQNQLKAKL"
FT   CDS_pept        150574..152703
FT                   /locus_tag="PAS_chr3_0071"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAY69999"
FT                   /db_xref="GOA:C4R3G4"
FT                   /db_xref="InterPro:IPR003150"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039779"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3G4"
FT                   /protein_id="CAY69999.1"
FT                   /translation="MQNDNPYGDITGSQRDPQKQQQQQQQQQQQQQQQQQQLQQQQVPR
FT                   QSYVTVPPSHQQQYTAPQQIIYQQPQFFTPQHQRQTSGSSMAQLDTHNALFDFPSQPQA
FT                   PSQLQTQFGTTSPAAWPLGHRRNQPSISTALGSFHMEHADMGTYVNPQSQPQVDPGMYL
FT                   QPSPSIQPFGTSQSEQLAPMMKEDSKLQQALESLRMEISLKDLAKQYRITYEDMKSVSK
FT                   DVDSKEFHEKERLRQVFTIRCLLQFLYIPSEREIRQRQRESNQHSHSPNRSTSLIASVP
FT                   RVHVYATYHRLTESCHVEPFGSSSLGKLLRITFSGIQTKRLGTRGQSKYHYMGIDIKPE
FT                   YLKLSTVSDIDAKGKFSNRAIEASLREQSHAKNKKSQHHLFELKQNLDVTEHIESPFHS
FT                   YINNYTEIPSNQALQLIAVSPHMESPTSPSFHQNLMLGSSDTLLKIIETENSSLLDDLQ
FT                   VYFDVSVLLLSDARVVKQLVYSENLLLVANQFMGFLDAGTTSLDSERVRALHSFINILS
FT                   KFLKGLKLNEEFERVIADALIKDSLVDELSSVAAGSFGTWEEFNNLVFDSESKKCLQTF
FT                   GISESTNIANILIEFFNREIPDFLITLTNTNEVDIQLLTGLVPLIVNLFSKIREALGNQ
FT                   SLRLQSFLMMFDVFQTIVLKYVTFRVDDALAESRKSVTYNLWLLCSSINEWLTFISETF
FT                   GLYEMIQKEKESGTT"
FT   CDS_pept        complement(152825..153724)
FT                   /locus_tag="PAS_chr3_0072"
FT                   /product="Diacylglycerol kinase, localized to the
FT                   endoplasmic reticulum (ER)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70000"
FT                   /db_xref="GOA:C4R3G5"
FT                   /db_xref="InterPro:IPR037997"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3G5"
FT                   /protein_id="CAY70000.1"
FT                   /translation="MAATTARPQRIGRSRVSKLEERISTSSSYSSLSSLDASDDTVLST
FT                   ESTSPVLDKAKNTSTSYLLLQSHKRFNKLIHKHELPRKLFHMSIGFFTLYLYTKNVQKE
FT                   QIQLPLVVGFVVVFALDLIRFRWPQVNKLYCSTVGFLMREREVDEYYNGVNWYLLGLAV
FT                   VFLFFKKDIAVMAVLLLSLSDTAASTVGRAWGQYTPKITSHKSLAGSLAACVVGILSCY
FT                   LFYGYFVPNYPECNDIPNQFEWVSEKSGLNIHSLALLSGLVASVSEGIDLFNWDDNFTI
FT                   PVLSAVFLRLVIKLTNTD"
FT   CDS_pept        155104..156852
FT                   /locus_tag="PAS_chr3_1149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1149"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70001"
FT                   /db_xref="InterPro:IPR036910"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3G6"
FT                   /protein_id="CAY70001.1"
FT                   /translation="MSSLELIMDNDHAEEVAVSHVSYSKPSTPIPSLMASLNEENTPVP
FT                   LMSSPNKNFQTPLRYVSTPDLLASNYSLSDLSHNLPTPIVNNELITIRQQNESEILYTY
FT                   DLLRRPAANAGSSSLNEMSGNIPKSVSNGVVSVRDIFNISDNTDEDIHQYRLNNPLMSQ
FT                   FSFHNFSMNSGLMIDDRMTGSFSEPDTSDDDEQLFTPPLDNSEIAFFPCTATSSQIEQT
FT                   DRKNIFAVKRPFSEAHINLLGKSKKSKVSAGAKPHCSISSTSNEETKLESGLQTPNPTQ
FT                   SSSTFKFKVKPVCITPKSVNYPSAPKTHVKKISKWIGISKLTDERVQRIYTLATSRKLK
FT                   FKDIQKSLSVFTIDNIQAKVDIIGNLLINRRNGIRDHPHPILVKDKNAEQYEVNVRTSC
FT                   GDDKDDSLQILIDACSGNPSNSSLLHTPSSPETSSSTYCLTSSLSTLASSPLSSNLRTK
FT                   AGHIKRPLNSFMLYRGILLKLGIVLNVVKSIENSIDLNNPSVLRKLHDNDPSLVSQILK
FT                   LIPTVVKTNHQVLGQAISMLWVTESSQVKEQFGKFSQVEKRLHKLCYPNYKFNPHRSGS
FT                   SKGRKT"
FT   CDS_pept        157093..158841
FT                   /locus_tag="PAS_chr3_1150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1150"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70002"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3G7"
FT                   /protein_id="CAY70002.1"
FT                   /translation="MPVSSPVPTSTGHPAERLSDFVPEEFRIQLAKTPPRLTIEQPVYQ
FT                   DRLKEIRNNEKFAFIVQWLYLLRGVIKLYEVHFDVISFEEELIGINGELFLLKFKSNLI
FT                   YALNGFRIDNIANHPELFNEQIQSILPNWFLEHYDSDEALSAFDFNDASIEVKLDIFYE
FT                   LLRLLMVRKEATVRKTVELYDSPWDTMKLLPVFAEDDVKNSVLKEYLILMDDRMYYREW
FT                   SFPKIKVPAQRKEYLKLLDEYENPFGDLEPKITRWECLTVGIYEFDEYLNNLKLKTGKK
FT                   TSSKEGKLLKALEPFVEQIYGTDLKKRKEALHRKKELQLQSLLANRKRSSRLEAKERQR
FT                   EEERRKEHDERIRQINEGTALRSSRRLIMKQTQKEESAPPTNTALSRADRLQQRRALEA
FT                   GLSGTSSPVPVTPDENKYSSFKTESAAASDNESSGNTSFAQAPEQQAKSHPVEAVPEQP
FT                   KQEPNHQSASTIPTSINSSIQPVNTFIPPPQFKNLLVDETAVHSYGYSPTPVTVPVLTP
FT                   VESVSKPLQTVPINTYPASPLNQSSININQTGPGGISDLDTEKNTESEDKHTSQQIGNF
FT                   YSPLNK"
FT   CDS_pept        158991..161210
FT                   /locus_tag="PAS_chr3_0073"
FT                   /product="Glycerol 3-phosphate/dihydroxyacetone phosphate
FT                   dual substrate-specific sn-1 acyltransferase of the"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70003"
FT                   /db_xref="GOA:C4R3G8"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3G8"
FT                   /protein_id="CAY70003.1"
FT                   /translation="MAEAGSQPDSTQSDKPWPEVSSATADSESEEVYVEVSWIRKLIYD
FT                   IVLWSFCVVFDCFFREIRSRGSFNLPRSGPTIFVGAPHANQFVDPIILMGQVQQRAGRR
FT                   ISFLVAEKSHRRKFIGLISRSQMAIPVSRAQDNLKGGRGKIRRDSENPLRIVGEDTYFT
FT                   QDCANQRMLALPNSLGTSEIGEVVSDTELILKKEFRHPSTEAEEKANRILAEGTSYKLA
FT                   PKIDQSIVYKKVFQHLAHGNSIGIFPEGGSHDRTDLLPLKAGVAIMALGAMSSDKSCKV
FT                   KIVPCGMNYFHPHKFRSRAMVEFGRPIEISDELVSMYENKETTKDAIKEVLRIITKGLK
FT                   SVTVTCPDYETLVCIQTARRLYSNNFSSRLSLESILEMNRRLVKGYEHFQNEPRIQELK
FT                   EKILAYHEVLRLSGIPDHKVNDYRPEKRLQTFAELLGNLFQFALLGLLALPGALLFFPV
FT                   FVATRKISAKKAKEALAASTVKIKAIDVVATWKILVSLGFAPLLYIFYSTVGTYIIRSR
FT                   YYIEPGFGKTAFTFFGFYILSATITYSALIVGDIGMDSFKRLKPLWLFLTDSETLSNLK
FT                   KERQELSLEITEVVNEFGPQLFSDFNLLDYQKKVESKRKKKRSEKYRKKAFEVSSMGLD
FT                   SSDEEEELKTQDVRRRRAARKQAASTTEAPSNRFDNKSTGINISNVPIFSNDLYGGTSS
FT                   APTTDVSSISSELSSDYQSSDGENENDDSQLKDRIRDRIHDSRHD"
FT   CDS_pept        161385..162191
FT                   /locus_tag="PAS_chr3_1151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1151"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70004"
FT                   /db_xref="InterPro:IPR031355"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3G9"
FT                   /protein_id="CAY70004.1"
FT                   /translation="MSDEEQSQVPVVNKAKEDEEFGSFSDASFEEFEAAPELDEPTRSF
FT                   STLSIEDLEQSDSKSDEKVVKIVNGILGVQPEDLNNAIEENRPFLDERARALLNQLSSE
FT                   PNNLQQLNWKQSIIRRQLFLNLSIPFDLDELYPRERKLGISKSYGKDSFSDSTDKLATD
FT                   IPFVEVSPERAKQLTEESDSIVQNIERRLQSEQYYTDGHLSEQELEDILKEMKGFNSQL
FT                   IELLSGWNQERLELLKDREISEGYLTNILDNTQKFRRQSSIKQRHL"
FT   CDS_pept        complement(162196..163701)
FT                   /locus_tag="PAS_chr3_0074"
FT                   /product="Protein that acts together with Uba3p to activate
FT                   Rub1p before its conjugation to proteins (neddylat"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70005"
FT                   /db_xref="GOA:C4R3H0"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR030667"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3H0"
FT                   /protein_id="CAY70005.1"
FT                   /translation="MSEKYDRQLRLWAQRGQSLLRHSNVCLLGATTTGTEALKNLVLPG
FT                   CGKFTIVDSSKVTTSDLETNFFLTQQDLGSNKAAAVVRNLNELNPDVEGTALDISLTNN
FT                   LVEDSHFWSQFSLIIIASSWHLQKVLTLADTLWDMKIPLIHVSTIGFYGYMRIYIKEHT
FT                   ITESHPESFSDFRIDRPWKELKEMSDSVDLEADDKEHIPYLLILIKALDRWKSIHGKQP
FT                   STPKEKAQFKQSCSELQSDLSLQNFEEAVTFSWRASQVSTQVPENVKTIINDPILDNLS
FT                   RSTPLFWIYVKALKLFIEKNGQLPPLPGVLPDLHSSTEAYIKLQHIYKAKAEEDIIEFT
FT                   GLVSQILSSIGRDADHLDHDSIRIFCKNSRYLFLQRGSKTLIDPRLIRELGNTPLLSLF
FT                   IAFIATHKFMDTHSGIIPQESDYNELISIVQLILKSEKVPDFLSDIVKEILRSKGTQLH
FT                   NICSFMGGIVGQEAVKLITGQYIPLENSLVFDGINSCTEKWKI"
FT   CDS_pept        164330..165592
FT                   /locus_tag="PAS_chr3_1152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1152"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70006"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3H1"
FT                   /protein_id="CAY70006.1"
FT                   /translation="MKFAKLYDEMLKSEEIPEDWIGSRIQYKSLKKCINRVVKELESAC
FT                   LEKDLIEVLLEGDHRLADYVLEKDSKIITPKLIIRVPHDKQGLPKSETSSRLWEFVNNR
FT                   EYLKDDELFKVVEVKEEEEATCLVFHFHEDSSFFRELSLELEGLNNFKEAQKRYLVDQV
FT                   DMISKSVSESTSFVKRRSDLYTWRELFKLYIDSEIFFKSSTSTAGERSVQQAKANLAAF
FT                   WNHVNNKKFHKAFHQKGSRSAFKSFIGLNERLLKVSQFQYLNKMAMTKILKKFDKQTSL
FT                   HTRLIFPKLLAHNTFIEESFAQQLCYKISTNLLSIIPQLDDYTCPICCSVAFKPIKLDC
FT                   GHIFCVRCLVKLQRSGEDRCPLCRGEVVLNADNSNLDVEHMEYLQKYFPKEVKIKQNET
FT                   EREIAKERFEAVYGEKNCIIM"
FT   CDS_pept        166362..168377
FT                   /locus_tag="PAS_chr3_0075"
FT                   /product="Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70007"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3H2"
FT                   /protein_id="CAY70007.1"
FT                   /translation="MSIIQQLFRSNRKKQSKKKEQTRKSPQTQANQLHPSDVPTGQHSQ
FT                   NEAVTYKDKEQILRTSLNSSETTSKSASSDVNKRLSDKVSHRRSSSTSARAAYVLPTAT
FT                   LRHSVSPNLNSYFPNGSDLPSIDKLPREMLPIVTLIHAQQARIYVEGLVKVPDNPDLSI
FT                   SNDSLLDLPDSWRIVSSKLSGTELSFWGMNQDGSLATTNDPEDDEVGLFKPIYANIVDA
FT                   AFSLDVSRLIIKITLSLQRELQLRCANINDLKLFYSSLLLAQFEYQQMQKAFTGALLSA
FT                   KAVNFSDIKVLLAPENKFVKEEWTTIRFPWLNAKWLRCYISVIPGESVSFPSLKFKDKE
FT                   KVNKDKPGKIEIYISSRKGKKNLLATIFNGRSCFSIYPEVPEFIDSNSLIRIEGEVLVN
FT                   ETLLDKLLNQDLDGLLSRSSSQTKLNKRSSTGSLSSFKNPFRSNSLTSMGHSRLRSSSV
FT                   NSVESNGSSICLPANSKVCRTNFVYIIPETHHGVPDSETMIRLLIPIFNVFKLYGRPQK
FT                   FLSSRDNKQSLLFGLPQLPHTQYLDSESSYQLVDLNLENSIKEEWALFDWTQVFQEMCS
FT                   YRISQGIKGSGSLVDTFRDGLLYSKELADLKRFEYAEDLEFYDAEEEEQNFKQGITGNG
FT                   KTSKHQRVLSQDISNNSVKMTPVNGINSDSYVSVNT"
FT   CDS_pept        169095..170036
FT                   /locus_tag="PAS_chr3_0076"
FT                   /product="Protein of unknown function, has similarity to
FT                   Pry1p and Pry3p and to the plant PR-1 class of pathog"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70008"
FT                   /db_xref="GOA:C4R3H3"
FT                   /db_xref="InterPro:IPR001283"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR018244"
FT                   /db_xref="InterPro:IPR034120"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3H3"
FT                   /protein_id="CAY70008.1"
FT                   /translation="MKLSTNLILAIAAASAVVSAAPVAPAEEAANHLHKRAYYTDTTKT
FT                   HTFTEVVTVYRTLKPGESIPTDSPSHGGKSTKKGKGSTTHSGAPGATSGAPTDDTTSTS
FT                   GSVGLPTSATSVTSSTSSASTTSSGTSATSTGTGTSTSTSTGTGTGTTGTGTTSSSTSS
FT                   SATSTPTGSIDAISQTLLDTHNDKRALHGVPDLTWSTELADYAQGYADSYTCGSSLEHT
FT                   GGPYGENLASGYSPAGSVEAWYNEISDYDFSNPGYSAGTGHFTQVVWKSTTQLGCGYKE
FT                   CSTDRYYIICEYAPRGNIVSAGYFEDNVLPPV"
FT   CDS_pept        170254..171165
FT                   /locus_tag="PAS_chr3_0077"
FT                   /product="Alpha subunit of the translation initiation
FT                   factor eIF2, involved in the identification of the start"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70009"
FT                   /db_xref="GOA:C4R3H4"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR011488"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR024054"
FT                   /db_xref="InterPro:IPR024055"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3H4"
FT                   /protein_id="CAY70009.1"
FT                   /translation="MSTSTCRFYENKYPEVDDVVMVNVQQIAEMGAYVKLLEYDNIEGM
FT                   VLLSELSRRRIRSIQKLIRVGKNEVVVVLRVDKEKGYIDLSKRRVSSEDIAKCEERYTK
FT                   SKSVHSILRHCAEKFNMPLEELYRTIGWPLSKEFGHAYDAFKISITDSTVFDKVQPPSQ
FT                   EVLEELKVYISRRLTPQAIKCRADVEVSCFSYEGIEAIKSSLKAAEDISTEANQVKVKL
FT                   VAAPLYVITTQSLDKTQGIEILERAIKIIEDSITKQGGSCNVTMAPKAVTATEDAELQA
FT                   LMERKENEDKVSDEDSDLDEED"
FT   CDS_pept        171348..172292
FT                   /locus_tag="PAS_chr3_0078"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70010"
FT                   /db_xref="GOA:C4R3H5"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3H5"
FT                   /protein_id="CAY70010.1"
FT                   /translation="MVKVRPATHAGSWYSGNPNELNSQLSHYLSLAKSSGKTSVKGARV
FT                   LVGPHAGYSFAGKTLAQTYNSFDPTGIKRVFILGPSHHIYFKDEVRTTRYGAYATPLGN
FT                   VPVDTDTIKDLVSNARHIDYMSSSVDENEHSFELHMPLYYKACLDKGLSTPPPIIPILI
FT                   SGFPGQLADSLTSTLQPYFEDKENAFFVSTDFCHWGDRFGYTSYTPNGDLESMDDITVA
FT                   FNGKSNSLKIYESIEAVDKKGMELISKGDVSLWRQYLQATENTICGAYPLTVLLKLMGK
FT                   ADTFEWLGYTQSSHVLDPYDSSVSYASGYAIPS"
FT   CDS_pept        join(176913..176942,176995..179115)
FT                   /locus_tag="PAS_chr3_0079"
FT                   /product="Beta-adaptin, large subunit of the clathrin
FT                   associated protein complex (AP-2)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70011"
FT                   /db_xref="GOA:C4R3H6"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3H6"
FT                   /protein_id="CAY70011.1"
FT                   /translation="MVNDSKYFVKCRGSELLAEFREATNSKKEKNTLLKKKNVLKKFLA
FT                   NITVESTDIIDVFTEVIKLYKEAQQSSLDQELRVMIYHCLRSTNHYRSEDREQVIELLL
FT                   RDYYSKSIPAHIKGLALQTLTSIPNEHFIQASIPAVKKSLHDQDPHVRKTGCFCVARIY
FT                   EFDLQIGNDAHLIDHLNDKLDDGNPSVVSSALVALSDITEKVEEFEFSISEDHAFELLD
FT                   ILPTINEWAQASSLSSILYFAPDSQATACEIIDKVLPYLQQSNNEVVLNALKVIIYMSN
FT                   YIMHPEDLIPQLPKRIGSALVSVLNSGPEIQFLLLRNTILLLLSKFNLVSLNVTSFFCR
FT                   YNDPIYIKDTKLEIIYLLANEENLHIILEELEEYARDSDVQMSRKAIRAIGNLAIKLED
FT                   IATDAVLVLSDLIESKVPHILQEVVVVFKRIVRRYPYLHSKMLNNLMENIDMIEEPGSK
FT                   LAIVWLIGEYNTAMEKNAVSLLKKIGQNFREDNSEVQLAFLTALIKVYLNFSADKMCED
FT                   LVVETFRTATEDIGNIDVRERGFYYWRLLSNRRDFPNAIEEIVNAKLPVISSDPDNLDT
FT                   RVLEELEMNIGTLASIYLKPVSHVFRLNKVKELQHTSALKREHSSVFAAQKNHSSKTLR
FT                   LRSSSSLTYRNKSASSLTPIEAEFKFNRQQAGQRYSSSKADDTDSDTMVGSLDISGSRK
FT                   QKNSLGLTRRMSKLGRKLTISR"
FT   CDS_pept        complement(179154..182531)
FT                   /locus_tag="PAS_chr3_0080"
FT                   /product="Putative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70012"
FT                   /db_xref="GOA:C4R3H7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3H7"
FT                   /protein_id="CAY70012.1"
FT                   /translation="MEKRANETSSYTGELKKQKKALSIPVSDWPEYFQTLEKIHFRINT
FT                   YFTFLCSRKHLVTTWELIKTAPESALKRQVTLEEGAQIAALLPDNVNFEYIDENQIHTE
FT                   KKQFTYNRGWEQKETDIFQLKDSDSDLNMSKQILIFEFVDGKIRKERDGISRYSSANAL
FT                   TTPTFSQDSMKKLISKRNTNFEIKVSQFLHKCYDNSLDPQDELNHIAKAYIPTTATYQD
FT                   PIEEMVSNSTKTPSQPSNETRDPIPVIIDHLKQTPFYRDQISDKGLFHLQPKEPVYEEL
FT                   DFDLSPEIWTGITHTKKINKLYSHQAEALNSICVHKKHVIISTSTSSGKSLIYQIPLLK
FT                   ALQETNGLATALYVFPTKALAQDQKRSLSELVKSIPSLFNTVLDTYDGDTEKSARLSIR
FT                   EHASVIFTNPDMLHSSILPSHKQWVPFLRNLQYVVIDELHMYKGLFGAHVALIMRRLRR
FT                   LCSIYGNDSVQFISCSATLKYPMAHMHNIFGIDESDCQLIVKDGSPSGGKYVVTWNPPN
FT                   LMSRTLSQQDGNSTRESFIVQTAKVLVQLVLKNVRTICFCVVRRVCELLMKEVRSQLKS
FT                   MDKLDLVTKVMSYRGGYSTSDRRKIEREMFNGNLKCIISTNALELGIDIGTLDCVVMCG
FT                   FPLSIANFQQQSGRAGRRNKDSLTIVVGSDDPVNRHYMNNPQELISMEYQDLILDFSNT
FT                   AVLESHLQCAAFEKPIDDLDWEAKWFSDYNQDQIEEILANRLDFLETSPDYPEPAYHVS
FT                   SRYLPWPPSHVSIRAIEEENYAVVDITNNRNVVIEEVEASRTSFTLYDGGIFIHQGLPY
FT                   IVRDFNSDDKYAKVERVNVDWITSQRDFTDVDPVEVEKIRSLRNGSDVPIYFGKIYTTI
FT                   VVFGFFKKNKIGEIIDAVEVNNPPIVIKSKGIWIDIPSSALDFIRMKHLNIAGGIHAAQ
FT                   HAIMNILPLFILSGVDEIQTECKAPEKEFATRQTKRVRPARLIFYDAKGGQCGSGLSTK
FT                   AFEYIDDILEKALNTVLNCPSECEWGCPNCVAAPFCKENSLVLSKPAAIIILATILKKT
FT                   IDLNSIPSGPEPFMPDIQIETIGESTETVKLSKDIEIIDVRKASTPLEEVPKDEEIVFL
FT                   GKRAIHNTPSTIKTEENP"
FT   CDS_pept        183587..184897
FT                   /locus_tag="PAS_chr3_0082"
FT                   /product="Enolase I, a phosphopyruvate hydratase that
FT                   catalyzes the conversion of 2-phosphoglycerate to phosph"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70013"
FT                   /db_xref="GOA:C4R3H8"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR034390"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3H8"
FT                   /protein_id="CAY70013.1"
FT                   /translation="MAISKVFARYVYDSRGNPTVEVDLYTEKGLFRAIVPSGASTGVHE
FT                   ALELRDGDKSKWLGKGVLKAVANVNDIIAPAIVKANIDVKDQEAIDAFLNKLDGTPNKG
FT                   KLGANAVLGVSLAAAKAGAAEKNVPLYQHIADLSGTPKPYVLPVPFQNVLNGGSHAGGA
FT                   LAFQEFMIVPTDAPTFSEALRIGTEVYHNLKSLAKKTYGQSAGNVGDEGGVAPDISTPK
FT                   EALDLISAAIEKAGYTGKIGIALDVASSEFYKDGKYDLDFKNPNSDPSKWLSGQELAAL
FT                   YKELISQYPIVSIEDPFAEDDWAAWSHFFSTVDIQIVGDDLTVTNPIRIKRAIEEKSAN
FT                   ALLLKVNQIGTLTESIKAATDSYAAGWGVMVSHRSGETEDTTIADIAVGLRAGQIKTGA
FT                   PARSERLAKLNQILRIEEELGDKAIYAGKNFHKSVAI"
FT   CDS_pept        complement(join(184965..186953,187046..187573))
FT                   /locus_tag="PAS_chr3_0083"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70014"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3H9"
FT                   /protein_id="CAY70014.1"
FT                   /translation="MLNQKQWIVKQLKRSKSLSEEEKGEVWNQIQAVLVEAIRKKKEDV
FT                   NDWERQGLPFFDKCDLQLCCEKDNDEPVLQGNNVDPIIDTTQRVAVSTDSPGDLPMDDE
FT                   EDSEDNFEKEEVEQIDRNHEANENAEPQNDGTIVTLGNEEEMVDEQSKDELSDKSIEDL
FT                   NKTPIEESDIEPAKKSEVQYVDNIKKDVIESEQASSTEEQHKSAEEIFEVPESQTVLVD
FT                   QIEQTEKSQLEDLQESQHRILETKDTNSDNKIATTGDYDERSAEQEDKQSHATNQSATE
FT                   NKGALGATNDSIHDQDHEMVDRDPTSRIEVIKFRAFPRKGYLDRVTGSSGGVAISIQNQ
FT                   TEVSTFFNGQPNLNPDAQFLNPSETQSEPQVTNQLSEDPHDFPHKTSMKSSQHSPARSP
FT                   INSPSKPISSATNSPKKSPNRTRTESPIIVPPGKPDSKFSPANAATTHSNKSFVNSSLN
FT                   SSSNSLTELSSKSPARSPGSHNFQTSQAPSQSNLPTFTPAVVTSQSPVLSHSQSADYDD
FT                   VSTHGIDSKTKDGSPTSPKGSPTASLPSSGPNLNPDNSLFGRESAPNSQQLSNTVTNEV
FT                   DKLNLKKQVELLRRHFVNISSRSDDLAMQQEIESIFEKTAAIKDLEKRVVFKTVCSQVL
FT                   VKLFLKRSYFSTEVLPYLQFIAENRSTFDLYQEQDSYEYHLCLLTCYYIYHRMEPELDK
FT                   FAQCIVDRIEALDSKLDSQANQPLPMLLCKIGLSILYAFLDRNYHDLFKSCFELVTIID
FT                   TEDHAAGKQFRLQSIRFSLATFLDREREKAITVIQQKFTEIPLRVLIFELRFYSEDECL
FT                   GFLDSLNLLNKLKEPQNESDDLILRF"
FT   CDS_pept        187928..190717
FT                   /locus_tag="PAS_chr3_0084"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70015"
FT                   /db_xref="GOA:C4R3I0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3I0"
FT                   /protein_id="CAY70015.1"
FT                   /translation="MLSVTPESKSGKKIVAKRACLACREKKIKCDGEPMRAGKEADIIY
FT                   PCTNCALCHTKCIFIPSNRGGRRKKGVSKVANSDFKKTTRGLPQEGSVHNYDVDTEAFP
FT                   YNYSLHSPESLKMQRLYPESLGHNQDARRSSYDRISSTHSQLSPNTSHHPQDYPTIAHP
FT                   GQYPNFNLPLPQSGRPGNVYTAPPMRVSSSTGALPLKSVPLKYSAQQYVGFHPPFVGPH
FT                   PSREDPIDSTDSVTTMSYRDHTPHFQRTPSSLSSSRYYDQTSSWLRTQSHYGSNSPIDD
FT                   SFLKPRKSLSSHSAAVKPRNSTLVMTSDSELELYEFPSWEITSYFIDLYYKYIHPARSL
FT                   MPSKAEFLKSISFPMHASLLHSLILTCCTHADPKIVRSHTFRNPKHWYNLTEKYWPEMD
FT                   LKCSLMSLTMLSETLSGYKFFRESIDGFQRASNLVKLNNMLASYTSMPDSQWKELVQIS
FT                   STRQLMDRESFVRSIWLLYRLAIFHRLNEGDPFKPRPELTMEYPNDLEFPMSDESFFNS
FT                   FSNKDSDSEIKKPVTWEDVSSAIDYSITTDKDEVTLPNSFENYAPAVSFFSTKVLSDVM
FT                   DLIYRGICTLESKVTLFNSKLNALEKLSRNVYRIESVVVDRDVHSKVMLINCTTLTGLF
FT                   QIHLSRSILHTPICGELLLFKRCLHKAMLESQKQNLVSEDILNSFLEALRSADENQWRS
FT                   LVPVIMSASGLVKLLELGQGVVDHKGTDLQGQILPVVVGPTSLEPAIDIGVVDSDDEPV
FT                   LKSKPWWHYAVSGIGAKRSGSVSTEPDVANAWVQYPLFASIPLCYATYHSASLLVLSKF
FT                   VDIQLSTEDTANFNLKNNQVAIDFCVYGKRKVSLLSDDEKHDDKSGEILTRKITVPVLQ
FT                   THADIILKCWNSDILLEHMRLFAKFLQVQGKYYPIYNNAYQNCQALTNFLEDKFLPNL"
FT   CDS_pept        complement(190791..192482)
FT                   /locus_tag="PAS_chr3_0085"
FT                   /product="Phosphoribosylaminoimidazole carboxylase,
FT                   catalyzes a step in the 'de novo' purine nucleotide biosyn"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70016"
FT                   /db_xref="GOA:C4R3I1"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR016301"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3I1"
FT                   /protein_id="CAY70016.1"
FT                   /translation="MDSQVIGILGGGQLGRMIVEAASRLNIKTVILDDGFSPAKHINAA
FT                   QDHIDGSFKDEEAIAKLAAKCDVLTVEIEHVNTDALKRVQDRTGIKIYPLPETIELIKD
FT                   KYLQKEHLIKHNISVTKSQGIESNEKALLLFGEENGFPYLLKSRTMAYDGRGNFVVESK
FT                   EDISKALEFLKDRPLYAEKFAPFVKELAVMVVRSLEGEVFSYPTVETVHKDNICHIVYA
FT                   PARVNDTIQKKAQILAENTVKTFPGAGIFGVEMFLLSDGELLVNEIAPRPHNSGHYTID
FT                   ACVTSQFEAHVRAITGLPMPLDFTKLSTSNTNAIMLNVLGAEKSHGELEFCRRALETPG
FT                   ASVYLYGKTTRLARKMGHINIIGSSMLEAEQKLEYILEESTHLPSSTVSADTKPLVGVI
FT                   MGSDSDLPVISKGCDILKQFGVPFEVTIVSAHRTPQRMTRYAFEAASRGIKAIIAGAGG
FT                   AAHLPGMVAAMTPLPVIGVPVKGSTLDGVDSLHSIVQMPRGVPVATVAINNATNAALLA
FT                   IRILGTIDHKWQKEMSKYMNAMETEVLGKASNLESEGYESYLKNRL"
FT   CDS_pept        192905..193699
FT                   /locus_tag="PAS_chr3_0086"
FT                   /product="Peroxisomal 2,4-dienoyl-CoA reductase, auxiliary
FT                   enzyme of fatty acid beta-oxidation"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70017"
FT                   /db_xref="GOA:C4R3I2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3I2"
FT                   /protein_id="CAY70017.1"
FT                   /translation="MSADLFSLNGKVALITGGTSGLGQGIVRGLYEAGAELILIHRPST
FT                   DPTAFIEEVRMSNADGASIHTIELDLVDADLAKLEETVTSPAVEKSSTGKIDILINNAA
FT                   IAIKSEFTSFTEKDYAAIQKVNVDFPFRLTQLVTKHFIKNQIKGRIIFTASLYSFEVTY
FT                   PNQSVYATTKGAINSLMKALSVELAPKGITVNSLVPGFVKSNMTADSYGNEKKSNEIVS
FT                   RIPIGRWGEADDFKGPTVFLCSEAAAYLTGVSLPVDGGWLSK"
FT   CDS_pept        complement(193708..195093)
FT                   /locus_tag="PAS_chr3_0087"
FT                   /product="Protein involved in bud site selection during
FT                   bipolar budding"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70018"
FT                   /db_xref="GOA:C4R3I3"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR036305"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3I3"
FT                   /protein_id="CAY70018.1"
FT                   /translation="MNNYNPDGSPVHGDYVQSNFRNKHDLEKYSPPKSNDPHDRLPTLY
FT                   EVLNRKTQTPVDLWSFYVYMKDSQSAIDYLDFWLDVIQHLNLCKSYVKGLKTTLTANYR
FT                   QRNATNVASAIPRKTPPNNGSFVSPFGANDIGNNSRESVGSQKHKSISSSVLLDMIMTE
FT                   NLLEDEDNNRLSSFLKGEATLRTSDPNVNQRIEELKRHSQSIGLNMGASNSNLSVFETQ
FT                   PENREINRISTIKPEMLETFIKEEMDSAQLKNDSPRPENLFVTRADLRSSSRKILYTYF
FT                   MEAAEKRLFIPEYIIKNIRHNLETEGRDDPEVFEEAKEYVFKAMENEAFPGFLLSNAIS
FT                   NITVTSHLVRLIFGFFFLFVGFWVGYTLIFLNWNPKPVRAVVVIPFFIGTYLLITSIYN
FT                   IDPVLSIFGYGESKATHSGLIKLKEPFVRRLLLKRGLWVLLLTSVIAAVLSIIFALVPG
FT                   KRL"
FT   CDS_pept        196924..198018
FT                   /locus_tag="PAS_chr3_0089"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70019"
FT                   /db_xref="GOA:C4R3I4"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR039559"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3I4"
FT                   /protein_id="CAY70019.1"
FT                   /translation="MFGMLTETQAQQEERLLDEEEKIAPTAIYDLELLRECKSSRRRWK
FT                   FFCVLVFILTFTSVAQLYLSLSEFKNQLLITTLNRVKSAELTKDIDIIPIHSHNDEWRR
FT                   LPLYDALKVGAQSVEADIWYFDSDPETIFVGHNKVFLSSKWNLDDMYLNPLFSLIGQNN
FT                   IAKRFEDENVSTRRNGIFYNNLHQTLYFYLDIKSNGEKTMAALEDKLSHFINNEYLSYY
FT                   DSETDEFVEGPITVIITGNYPYDFIVSKTKRFFFIDAPLFKFKDDEELAKYNHSSISLA
FT                   SSASLYELTESRRALGGVSGLSESQVETISSYIDIAHNNDIKVRVWETPSWPIRTRNEV
FT                   WKQLITLGVDTLNVDDLYAATTFF"
FT   CDS_pept        complement(198143..198472)
FT                   /locus_tag="PAS_chr3_0090"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70020"
FT                   /db_xref="InterPro:IPR019434"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3I5"
FT                   /protein_id="CAY70020.1"
FT                   /translation="MAKSSRSKSKLQAKAVKRSLEFQKYEDERRKRLFEKSQAALVKQK
FT                   EEASEDKDSKPAKVSTVEVDIDIDSVPLKKPEKRTTKKNFKKRSRRQKWNHRLGFEQFT
FT                   PEKPW"
FT   CDS_pept        199002..199616
FT                   /locus_tag="PAS_chr3_0091"
FT                   /product="Protein component of the large (60S) ribosomal
FT                   subunit, nearly identical to Rpl19Ap and has similari"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70021"
FT                   /db_xref="GOA:C4R3I6"
FT                   /db_xref="InterPro:IPR000196"
FT                   /db_xref="InterPro:IPR015972"
FT                   /db_xref="InterPro:IPR033935"
FT                   /db_xref="InterPro:IPR035970"
FT                   /db_xref="InterPro:IPR039547"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3I6"
FT                   /protein_id="CAY70021.1"
FT                   /translation="MASPSSKIHHVTNKSRANLRTQKRLAASIIGAGKKKVWLDPNETE
FT                   QIAQANSREAIRKLYKDGLIVKKPPVGHSRARARAFAEAKRAGRHTGYGKRKGTANARM
FT                   STQTLWMRRLRVLRRLLVKYRDNGKIDKTLYHTLYRESKGNAFKHKRALIEHIIQAKAE
FT                   AAREKVLKDESEARRAKNRAQRERRQQRQAEKREAFLNEEA"
FT   CDS_pept        complement(199673..201526)
FT                   /locus_tag="PAS_chr3_0092"
FT                   /product="Transcription factor required for full Ty1
FT                   epxression, Ty1-mediated gene activation, and haploid inv"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70022"
FT                   /db_xref="GOA:C4R3I7"
FT                   /db_xref="InterPro:IPR000818"
FT                   /db_xref="InterPro:IPR038096"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3I7"
FT                   /protein_id="CAY70022.1"
FT                   /translation="MSGQQGSKLPMIVDVSIDEQGKQVYQVHSTKKRVRDDMPVSNFKS
FT                   SKVKTESSVPLAASESGSSSSSASNVKEEEQDLKIPGSVEDTDVNPIWPADVELAFREA
FT                   LTIIPKKGLNKIKISGKCSGRNELISDYIFSKTGQVRTRKQVSSHIQVVKNMNKDHELI
FT                   KLILEGPEDSNLVEPFDSVFTKIVLAKTTGGKENNSPENLSDSENDNINITPPATALRT
FT                   RASVPHLQLNDATMSGHQDTPVRATSARLPTPSSDNRDSVSLDRPLYVQAEIQNFQFCL
FT                   ENAVMGMRFYLSNLQEPGFMYPPLRLKENANIKSRFPYLDSFVSTLNTRGVPILHGMTK
FT                   IGNINYEQISSMDAFRSNSYITLQLDNLSVENASWSVVTAVYSFGKEKALFVDPVEVKS
FT                   DPSFGETRMYTLKVDFANRFWNAYTKGIWDLYLNPNIDNAVIARKEKYSIKGTTIKQVL
FT                   VSGNLSPRSITRFEDINSSLVRCILLWEFYKVEHPEPNTTTIRRLHLTNDDAMYVMNQP
FT                   PFELTPQSSSKISSEAGLELPFQNLQRAPSVPYLDDSAHQMPVQQIPLTSGVGVPLAGP
FT                   APFLDDMLMGNEESAHVNQFQGEAIDGDPKVIMSTSNIPLN"
FT   CDS_pept        202296..205295
FT                   /locus_tag="PAS_chr3_0094"
FT                   /product="Constituent of 66S pre-ribosomal particles,
FT                   required for large (60S) ribosomal subunit biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70023"
FT                   /db_xref="GOA:C4R3I8"
FT                   /db_xref="InterPro:IPR005612"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3I8"
FT                   /protein_id="CAY70023.1"
FT                   /translation="MSGIKLDLSSLGDKVSSKLMGFKPTKEKEVKNKKSGGNTKGRSQD
FT                   QGSMSGNPSTQNDTSDILNTGDIQKDLSSVMKNIGLTGKPLSTPTKQKKKASKKQESKN
FT                   NKEVAKEKSVEPIKNTKVPKEQERSKVTVKELSMKKSNMVTDFSNVITDKLSIPAQKDW
FT                   YNVPMDTAVTADKLSAESLAALMKRGQEFLDRENEIYMREFSKASSQKKFLNDILTSGT
FT                   LSDKISALTLLIQEAPLHNVKSVDALLLMCEKKSRTAALQSIEAVTDMLVNGILPDRKL
FT                   HYFHRQPLNMQLSDEQLAIYVFEDHLKKQYFQFIGVLEHLLSDPISHIRVTVLRHIFNL
FT                   LASKPEQEANLLRLGVNKLGDSDNKINSKTSYLLLKLEEQHPAMVKVILDAIIDVCFKS
FT                   KEYHTQYYSVLTLNQTVLSVREVEIANQLVKTYFSLFEKTLLSNDKTNNLQLKAKEVTP
FT                   GKQKKSIKRGKKGGISVKKVELTQDELMDERNSKLFSAILTGLNRALPYSKLPDDIFTK
FT                   HLDTLFRITHSTNFNTSVQALILIHRITVEQNVSKESADRYYRTLYESLLDPRLITSSK
FT                   QGIYLNLLFKSLKHDSNIERVMAFVKRIIQICHNWISIGTVSGMLYLLIQLEHSIPTLR
FT                   NLVFNSPIDYPVKVQEDDQKDSKKEPTTDSEKLPTSYDPRQRDPRFAGAEKSSLWELNT
FT                   FVDHFHPTVRLYARSLLDGSDEKVTKPDLGLYTLSHFLDKFVYKTAKKNSATPSGSIMQ
FT                   SLNTPSTGHVLVHSANVSSSIDPSNTEEWLSRKVSEINPEDIFFHQYFTIKKKRTGSLV
FT                   NKKKKKKHTDDSDEEAASDSDSDIDSAVEGEISEGDASDFDEDEVWSALVQSNPEVEAL
FT                   NNDLDNMSDFDPADFDYSDSDEEEKKKDDNVPVQIPSHLAAIAAQEPYPEDSDNDNDNK
FT                   FSSDEEAKIFGPDSEDELSSEDEKPKKKRARTDTSDDVSKKSKSLKGLPMFASIEDYAD
FT                   LLEDDGEDEE"
FT   CDS_pept        205824..207644
FT                   /locus_tag="PAS_chr3_0095"
FT                   /product="Phenylpyruvate decarboxylase, catalyzes
FT                   decarboxylation of phenylpyruvate to phenylacetaldehyde,
FT                   whi"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70024"
FT                   /db_xref="GOA:C4R3I9"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3I9"
FT                   /protein_id="CAY70024.1"
FT                   /translation="MAPVPDIAYHTLNDLDHSWSMAPSASTIPMGEYIFRRIQSLGVSS
FT                   VFGVPGDFNLNLLEHLYSVEGMSWVGCANELNSAYAADGYSRASNKMGCVITTFGVGEL
FT                   SAINGISGAFSEYVPILHIVGTTPLSAKIAENNHTHHLVPKLSVFEPSDHFTYEKMVAP
FT                   VSCHQETVVNASDAPGQIDTLIRQILKYKRPGYLFLPSDLADINVDGDFLIQRTTQQFY
FT                   QSVDTNQSLTREVATKVLDKIYNCSNPAVLGDILCDRFQVTEHVRAFVKNACIKSFSTF
FT                   MGKSVLDESDSRYIGTYNGVESNNEVIGYFQASDLILHIGNYYNEINSGHDTLYNNIDE
FT                   EQLILMHPEYIKIGTELFRNVNFVHVLDVMLQMMDVSQIPRGISPTLSKKEINHIEHIS
FT                   ASTPISQTHLLHKLQDFIKEDDFVVVETGSIMFGLPDLVLPKGARLFGQHFYLSIGYAL
FT                   PAALGVGVAMKDGNSKGRLILLEGDGSAQMTIQEFGNYVYQQITPIIFLLNNSGYTVER
FT                   IIKGPQREYNDILPNWNWTEIFKTFGDRYESKSETKKIQTVEELDQVMLYTNNNNSKLK
FT                   LFEVILDQMDVPWRFSYMTAASKNKAKIVG"
FT   CDS_pept        complement(207728..210391)
FT                   /locus_tag="PAS_chr3_0096"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70025"
FT                   /db_xref="InterPro:IPR012860"
FT                   /db_xref="InterPro:IPR037516"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3J0"
FT                   /protein_id="CAY70025.1"
FT                   /translation="MGELDSLAYILTAEFDKSKGIVITNQHPCEDDSWLLSSQLQDISN
FT                   VLMPSQLQHSMNRESITVFPIYSTYSDVEFENAILSYDPKPHSLPSVILSISYFKSDDS
FT                   YRNGTANCLSIVTSLSFWYAYKNLLIVLLHLYMKDNDFSQLSAVFQTLNEIPLRQLDLY
FT                   FQNIPTIQKDLLKTLIERQELNNESEEESFLAKILNPNILDEDETEIIRGMLMFKDYLE
FT                   FSPQSKCFKANVLIPSVGTHFPIQIPLLSLLSSRFTFFGLNLEQESIIRTFLLDSKSLK
FT                   IQFYQDNKAFITNKEKDSIDNTAFKSVLPYGVHNTPFIIALINALLQRKRIIVYSYSRS
FT                   CNELLEFIMAYFIIVENFMSTDSPCTTDHLYPYVDLSQLEILEKMPFYVAGTANIIFQS
FT                   KPIWDLFINLDDKSILLNFDSFTSNSQVLSRRSNSHKKFLNLKTNPNNFFRRQTSNISN
FT                   SSSSPFRTRHSSQTSGNSTPSPSVSSVKKRPDADSLYEIYANSSQQFEENYKFLLPTFK
FT                   NNDALFSSSIAETQFDFNKHTSVGSSSSFIAFGFQYEDTSLDEISLFDSSLSQIDSSLL
FT                   KSIEDLLKNNERDSVICDTIFKYLDHLINRCFKSHEMISNSKKVREFTDYIQLKLDDSG
FT                   ESSFNNKNLVISEINKYMQRNKIVQPFVLGVDYGNQFFSVTYPLDTNSFNKSNLLSYYS
FT                   SLNKGSSRNLFLYEDYLKANSMDGIIKTKLSNYLVGVKEQTYLFDIEYILQNCFFVANE
FT                   KFKDVHSLSFMKGQKQLYQIYKMLNGYINSVDSFDPLLYHCLKTDKILDLNKQKNDKYV
FT                   FDTLESTLMIVLFLVPEESNITGGQDEIQYPLQEEFENYLKILFDKRTFFTEWFINHSN
FT                   GFIKSGLRDYFHFHYE"
FT   CDS_pept        join(210605..210856,211437..211663,211720..211930)
FT                   /locus_tag="PAS_chr3_0097"
FT                   /product="Nuclear protein that binds to RNA and to Mex67p,
FT                   required for export of poly(A)+ mRNA from the nucle"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70026"
FT                   /db_xref="GOA:C4R3J1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3J1"
FT                   /protein_id="CAY70026.1"
FT                   /translation="MASLDKSLDEIISSNKKPVVRSKKAPAPKASKVAKVSKKQVARNN
FT                   IPKASVPKTPGSSDYIDPSYATKVIVYNLPHDIKQNAVKEFFQSQVGGVKSIALSYNEK
FT                   GLSKGIATVVFRDNTHATTAVKKYNGAPIDGGANKLRLEMIFDPTKKPLISRISANPVV
FT                   EKPRKLNVQPIQTINKKKGPKATSKPAAAKPAPSKAGPKGGKKVRKPKKTVEELDQEMA
FT                   DYFENKN"
FT   CDS_pept        complement(211981..212310)
FT                   /locus_tag="PAS_chr3_0098"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70027"
FT                   /db_xref="GOA:C4R3J2"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3J2"
FT                   /protein_id="CAY70027.1"
FT                   /translation="MSTFTGNGIPSFAKFWKQTLFLSTLAIGTALFVKSKIHLRKKNQH
FT                   LPDAVLGDREQDYDISKIRPGFPQSKDDMTAYGRKSEFQGTADSYLTRKSGDKFSFFPW
FT                   FGGSK"
FT   CDS_pept        212600..213760
FT                   /locus_tag="PAS_chr3_0099"
FT                   /product="Mitochondrial NAD+ transporter, involved in the
FT                   transport of NAD+ into the mitochondria (see also YE"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70028"
FT                   /db_xref="GOA:C4R3J3"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="InterPro:IPR040062"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3J3"
FT                   /protein_id="CAY70028.1"
FT                   /translation="MSKNAQVDDLAHGLAGAGGGILSMIITYPLLTLSTHAQSSKTQKP
FT                   LDGSVDEKELEPKKSSTYGTLKRILKKQGVRGLYNGLESAILGIAVNNFIYYYFYELTG
FT                   NTLEGLSRGRKRGSRVGGLSAFQSIVAGAIAGVISRIATNPIWVANTRMTVLSREQRDL
FT                   KRVNTLQAILYIFKTEGFKTLFSGLIPALFLVLNPIIHYTIFEQLKTLLVKTRKRALTP
FT                   LDALLLGAFGKLISTVITYPYVTLRTRMHLQNAENARNSSGESSVSNSAVLSATSDEDL
FT                   GKEGDNEKKIAQEQPTNTIWGLSTKMLKEEGISSFYSGMSVKLSQSILSAAFLFFFKEE
FT                   LVSASDVAIKAVKKVDYKSFLNNPAQVVPDLNPAPSPNADGSPVDI"
FT   CDS_pept        213926..214834
FT                   /locus_tag="PAS_chr3_0100"
FT                   /product="Ornithine transporter of the mitochondrial inner
FT                   membrane, exports ornithine from mitochondria as pa"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70029"
FT                   /db_xref="GOA:C4R3J4"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="InterPro:IPR040062"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3J4"
FT                   /protein_id="CAY70029.1"
FT                   /translation="MKNESDTSSYIKSNTQKKIDELVFGSVAGALGKVVEYPLDTIKVR
FT                   LQYSSGKTPEHPSTWKVITQTYKHEGFFNGFYKGLSSPLMGAAAECSSLFFSYELAQDW
FT                   VKSYKPEITLLDKIYCGAFSGVVTSFILTPIELVKCKMQVINLQMKSEKPPGIARLVSD
FT                   IYKSQGLKGLWKGQLSTMIRETGGTALWFGAYEYVLILFNGGISKDAKSNGTSLQYIIA
FT                   GGVAGAVYNASFYPVDTIKSMIQTEQSHHQQVKTADIILRLWRSRGFRGFYSGLGITLL
FT                   KSVPANGIVFFTHQTLKNNFS"
FT   CDS_pept        complement(215484..216257)
FT                   /locus_tag="PAS_chr3_0101"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70030"
FT                   /db_xref="GOA:C4R3J5"
FT                   /db_xref="InterPro:IPR025207"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3J5"
FT                   /protein_id="CAY70030.1"
FT                   /translation="MDKRQARPKSYLSVHDSIKNQVSIVKKPLIISKDLNEILKTQHQY
FT                   EPNQAKHLSPLALNRLIRSVNFLLKARYASIFNRQAIHLVSLQYIESEKRMEIERLDEF
FT                   LKLYYLLEPFNSQDHSANNVHGLLLVQKEHFMDKVHKLPPSSTVAHLLKQRSDITPLLA
FT                   SYDKVKENLISKENKVEALKQKLSHYNDILKLLTSSLSDPERLQQNLVISSNTELTAQI
FT                   NQLRILLSRLEYKLRDPKVKLQVSNTLKALPSKVN"
FT   CDS_pept        complement(216374..216871)
FT                   /locus_tag="PAS_chr3_0102"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70031"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3J6"
FT                   /protein_id="CAY70031.1"
FT                   /translation="MNYSYRQEELDCYFEFQCSTIVESVDAYPFRLEITRSIESVLDDP
FT                   QPELTLNNAVEKSSLLTMGDILFGRKKQCFNGPPVKGTQWTTNSLRKTADSKPNEKPLK
FT                   GLLAPSTDSISENVFTFNSSSHSLVEPAKVEDQLLAINSQNTNSSNPGSEVNLYSRSCS
FT                   IM"
FT   CDS_pept        complement(217129..217599)
FT                   /locus_tag="PAS_chr3_0103"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70032"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3J7"
FT                   /protein_id="CAY70032.1"
FT                   /translation="MDTIPRQNGVKRKMAAKLFNIKKNFEKLNGLAWLKQHRNLASAID
FT                   IVDFPNSNKDISSASIMGSGYIPLHDILYQKAHPSSFMEQLKAGAIESDARSWNSSTRS
FT                   SRIQVYQPEPSAIFAVHEVFVCSVQEVEFLEEYVTIVSQTSSSSNANEIISQ"
FT   CDS_pept        complement(217832..218380)
FT                   /locus_tag="PAS_chr3_0104"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70033"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3J8"
FT                   /protein_id="CAY70033.1"
FT                   /translation="MLTRRSVGLLQSTRISPVLTNFSSSRFYSAHHESDKKHDDHHEEH
FT                   HDEHHDDHHTPLGPAENIFNKWNVTPFVWLFATVGIFQWDKSHRESHDGKGILDFLGEI
FT                   KVKESLDTYFKEYQTKVASTADLYGLISFTPKRDIHHYVIRVDEVPGKHFPTNTTGNFG
FT                   NTVDFENLEPRRKPINPYL"
FT   CDS_pept        218614..218937
FT                   /locus_tag="PAS_chr3_0105"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70034"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3J9"
FT                   /protein_id="CAY70034.1"
FT                   /translation="MVEWLAIVYDKPGTDRTELRPLHLKDIPPAVESGIVTNAGAIYHG
FT                   LDFEGKPSEFAGSAFNLVADTKEEALEFLKKDVYAKSGIWDVDNILIFPYGCAYRKGKD
FT                   LPK"
FT   CDS_pept        complement(join(218966..219333,219448..219460))
FT                   /locus_tag="PAS_chr3_0106"
FT                   /product="Profilin, actin-and phosphatidylinositol
FT                   4,5-bisphosphate-binding protein, involved in cytoskeleton"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70035"
FT                   /db_xref="GOA:C4R3K0"
FT                   /db_xref="InterPro:IPR005455"
FT                   /db_xref="InterPro:IPR027310"
FT                   /db_xref="InterPro:IPR036140"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3K0"
FT                   /protein_id="CAY70035.1"
FT                   /translation="MSWNAYTDNLIATNKLDRAAIYSAAGDSQWATTNDLTLLPNEIQE
FT                   LVAGFKDPSGLQATGLHIKGQKYFLLKNDERSIYGRHETEGIIAVKTKQAILIAHYPPG
FT                   VEAGEATLIVEKLADYLISVGY"
FT   CDS_pept        complement(219653..220942)
FT                   /locus_tag="PAS_chr3_1154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1154"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70036"
FT                   /db_xref="GOA:C4R3K1"
FT                   /db_xref="InterPro:IPR007149"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3K1"
FT                   /protein_id="CAY70036.1"
FT                   /translation="MSQELEQNRHSGEESPDPVLDANTSDVDDDGLDLFGDDDDEQPEA
FT                   KPGQLDDSSNDAEEDEQEKAGKPEAKVTSHTKSVYDNGETLDISLPIHPKSHIPQGKQD
FT                   RWVVKLPDFLDINAEPFDPRPFEMNVKTHEDKNQELLDKLIAVNTVRWRYAKSETGGIF
FT                   KETNSQIIQWEDGTYSLRVGSEIFDMFTTNTDDNYLVSEHNEEGILMTESTLSKSVKLV
FT                   PASFQSTTHQKLAKALSAKQKKESYARSVVTKEDPEERQRRLESQENERYRLERRRKQA
FT                   EEEEDYDSYAVSTSRSRPSRASQMYNAADEDDDDDDVAIGRTLASRRNNGYEDDGFIID
FT                   DEEEEEAVENDSADEESENEGDDDEEDDEEAAERLNRLKRAGASKYTNEGEQAQSEPVK
FT                   SEEADNASQRDDAPRKKRRVILDDDEEEEE"
FT   CDS_pept        221352..222836
FT                   /locus_tag="PAS_chr3_0107"
FT                   /product="Sporulation-specific chitinase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70037"
FT                   /db_xref="GOA:C4R3K2"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3K2"
FT                   /protein_id="CAY70037.1"
FT                   /translation="MKIAQLFLRNHLDFVLISGTGVVLFTLIALFGDISTLDSNNRQTQ
FT                   KVLKDSMKALDKEQKEQQQVIHGSPHAPLSYRTCAYFSYWSVYEPRNFTPSDLPISQLT
FT                   NVFYAFFDIDCETGKVVVIDKWSSLEMPLKFSPRSDDIKTLYADGTAEAKKLKQLHFSK
FT                   KTVGALKQLYQMKLIKPSLQTSMSIGGWGRTDGFKALMKDESKVEQFVSSCVSAMQEFG
FT                   FDGVDLDWEYPSNDEEGQFLLHLVSSLKRKLSQLEAHYELPPDTFLITLATPASLYTLQ
FT                   HYPLSRLDLFVSFWNVMTYDFAGSWSPQTEYHSNLYSPKGEMLSVKDAMAYYVRNAIPP
FT                   NKLIMGLPNYGRGFGNTDGYNKKFKGVGKGTSDEEGIYNYNMLPQNFKDNEKYDPEAVA
FT                   AYSYEPISRTFVSYDTPRVVREKAKFVKNNGYGGAMWWEACGDFYFDNPEQSLLLNFVD
FT                   ELGGTQTLLKVPSSQHQDNNTKSAFYKKSNTLKGLV"
FT   CDS_pept        complement(223044..223907)
FT                   /locus_tag="PAS_chr3_0108"
FT                   /product="Protein required for Golgi localization of
FT                   glycosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70038"
FT                   /db_xref="GOA:C4R3K3"
FT                   /db_xref="InterPro:IPR008628"
FT                   /db_xref="InterPro:IPR038261"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3K3"
FT                   /protein_id="CAY70038.1"
FT                   /translation="MSEGLQRRRGVKSSNDSSEALDVNNKENNRVAFDPQDLSSNSREV
FT                   QSPMLTLMEEVLLIGLKDREGYLSFWNDNISYALRGLILLELAFRGKIQMVNDPARRRF
FT                   ELPDRLIEVVDGSLTGEMLLDEALKLMKSDPTNSSVLNWIDLLSGETWNLMKINYQLKQ
FT                   VRERLAKGLVDKGVLRTERKNFFLFDMATHPISDPQAKRQVVKRMLNMLTNRNYIIEND
FT                   PKYFAKECGYQHLRSVALVCGCYAGNVLENVVFDLNYEQRDRAFNRADELLSQYSDYPF
FT                   ENKKIP"
FT   CDS_pept        complement(226274..228238)
FT                   /locus_tag="PAS_chr3_0110"
FT                   /product="Nucleolar protein involved in pre-rRNA
FT                   processing"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70039"
FT                   /db_xref="GOA:C4R3K4"
FT                   /db_xref="InterPro:IPR012580"
FT                   /db_xref="InterPro:IPR039754"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3K4"
FT                   /protein_id="CAY70039.1"
FT                   /translation="MAKKQGKPSKEKDVFTSDDRFKSLYNDPRFSMPKKDQFKIKLDDR
FT                   FTSDDIKDYRHSAKIDRYGRKLKGEAANNDFERYYTTKDKELKDNNSKAEAKDLKKDDE
FT                   HSSESDESDSEEEAKVSKNSTVDIKVHIDKADDQLIDRARGEGFYSSSDEDSSDDTSEE
FT                   VSEEELEIESGNVEEGEPSKRLAVVNLDWDQVRSQDLMATFAGFVPSGGKIIRVDILPS
FT                   EFGKERMQREDTEGPPKEVFKSSKKSKLSRANSSDDDSESSDTESEIEDLAAAAKKLYE
FT                   EDDEQDYDSKSLRRYQLQRLRYYYAVVTCDSIKTAKNIYINCDGTEYESTANVFDLRYI
FT                   PDEMEFDDRPRDSCSSVPKNYKPNNFTTDALQHSKVKLTWDETPVERVKMAQRAFSQKE
FT                   IDEMDFKAYLASDSDSNSDQESNKKNLYKNLAIESSMLGYKSIFDDVKENGSEDVDMEI
FT                   TFTPGLSEAEALKQKAESEGRELSTIEKVQQREKERKKQRKERIKELMKNNREAIKESR
FT                   RKPEETRELVIENNTDDEDDDAHFNMKDIVKAEKQKKRKGKSRTKNIDQEMLQDDFKPD
FT                   LKDERFKEIFEEHEFAIDPTQAQFKETATMKEILKERSKRSHESKITKSKKQKKEKKEP
FT                   VENGNDIRNLVKKIKNKSK"
FT   CDS_pept        228617..230350
FT                   /locus_tag="PAS_chr3_0111"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70040"
FT                   /db_xref="GOA:C4R3K5"
FT                   /db_xref="InterPro:IPR006571"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4R3K5"
FT                   /protein_id="CAY70040.1"
FT                   /translation="MGQSVSSEEETKQDYRTVKVSKGQLQRLFDKNCLSLLTPIEVYSL
FT                   KENLHVRDINNDKQLSIDETVQLLGLPKDCPCNEVVYDFVRVLGWFPFFNSVDPLKGIS
FT                   LPMLIRSVVLSRSKSFFKLFKGDSSYKFEDLVFLVLSILSEPKDLVEKNLDSSCDETGV
FT                   LELALQGDSNIHWAQCKVIKDFDNTNIKERKVSAYNLAIFLTFLLAISRPLMSDYSQHL
FT                   SQWSNFMSHGMNLVRSFDSSITERSLHSKTVGYAAFISTIETKMPNVLHPLDALLDSLL
FT                   FMKQSKGASDVTPEFSVSTKLINEYSLAQLSTVLPLELCYSRLRKLYVGSESGFSMRSF
FT                   ESKCFNWNAPTITFISGHRITSKKTKRYLLFEEQFPRSRAAEDETGSDFDHANDDSARL
FT                   TFAVFLNQHWKTSNKEPFGDSKTTIFQLSPRQAVFKSSTFRKDYCYFNTSGGGIGFGNE
FT                   EPYLKNNTTKFRPGNVSLTIDSGLEFCVFRHLGKGGSFNPMVLEDDSIPVYEDRFVISD
FT                   LEVWGCGSEKELLEQAKRWAWEEKEAMARQRINADTLGEERAFLEMAGLVGNHGASGGS
FT                   V"
FT   CDS_pept        complement(230400..231746)
FT                   /locus_tag="PAS_chr3_0112"
FT                   /product="Essential serine kinase involved in cell cycle
FT                   progression and processing of the 20S pre-rRNA into m"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70041"
FT                   /db_xref="GOA:C4R3K6"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017407"
FT                   /db_xref="InterPro:IPR018935"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3K6"
FT                   /protein_id="CAY70041.1"
FT                   /translation="MSDKESDREQETQNTKANILDKYANRIKTDEFVFKKSKTSKDKSD
FT                   RATVENVLDPRTIKFLEKLYRNGTITKLNGCISTGKEANVYHAVNETNGKQYAIKIYKT
FT                   SVLIFKDRERYVDGEFRFRNTKNQHNPRKMIKIWAEKEFRNLKRLHSSGLIPTPEPVAL
FT                   KSHVLCMEFLTENEESPSPKLKDYQFKDTEEVGRFYQQMLVYMRIMFQKCHLIHADLSE
FT                   YNSIVHKGQLYIFDVSQSVEPDHPMSLDFLRMDIKNVNDYFQRKIQVYPERLVFQFIVN
FT                   GWDAIKEKTDKNTVLEEENEQTLFQYLESLPLKGEDDSDAGFEDDIFRSMHLVRSLNNL
FT                   EDRDFQEFADGKITTLNELVQDINLESDSDLSSDSESESDSDLDAESDSASDSEKSWEE
FT                   RDTSLKGKRFEDKDEKKARKQQAKELKQDKRKTKMKKHLKKKLIRKTKK"
FT   CDS_pept        join(231895..231924,231981..232724)
FT                   /locus_tag="PAS_chr3_0113"
FT                   /product="Component of the inositol phosphorylceramide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70042"
FT                   /db_xref="GOA:C4R3K7"
FT                   /db_xref="InterPro:IPR013862"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3K7"
FT                   /protein_id="CAY70042.1"
FT                   /translation="MGFLNSALPKKFLGIFPLYIGVELILGYAIINKMSGPYGLLSLFT
FT                   GHPIDFFQAMFYISSVIVLPLYFHGFKELFSPRIGMFSLVTTIYVLDTFLGLLSNLYFA
FT                   LQWFTYGGEDTTINKPSFGESATTASESIASAATSTLSFSSFTASPTPDFNPLDSTVPQ
FT                   PYKREMDENVQSASQARELFVIIASSVLLNGVRIYFTLILLAFTKILIRMGKNEGIQSN
FT                   DFNDLNYMQGETKFGRVLYFLKVKCLRILQTVYNY"
FT   CDS_pept        232965..233732
FT                   /locus_tag="PAS_chr3_0114"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70043"
FT                   /db_xref="GOA:C4R3K8"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013857"
FT                   /db_xref="InterPro:IPR039131"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3K8"
FT                   /protein_id="CAY70043.1"
FT                   /translation="MSLRTVFGTVKQVFKETFAPRDITPTLTLLDFKNNHELEKVVTRC
FT                   DQELGGYSTVNLDIARNGDNKCAHFHGNLNLDTPANNPKVMYSGWAMFRTKHKNAYQHK
FT                   LFYLSDYFANFRWDFSPYQCMVLKCKIEPTECFTPSNSKDGTRLRSFFVNIQTDSASQT
FT                   DLFQHRLFFQKPGQWETIIINLDDFVLTNRGRVLSQISGEMERERIKSIGIGITDGIYG
FT                   PYSLYIDSIKVMFGVDLAQSLNEARNANNEKSK"
FT   CDS_pept        complement(join(233812..234383,234556..236212))
FT                   /locus_tag="PAS_chr3_0115"
FT                   /product="Transcriptional repressor and activator"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70044"
FT                   /db_xref="GOA:C4R3K9"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR027725"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3K9"
FT                   /protein_id="CAY70044.1"
FT                   /translation="MPDHVELQETSSYNDGRTDRPASRSGATTMSTKTSFIHKLYYMLE
FT                   DGSMKHLIWWLPSGSSFAVVPNEDFSKALSHYFKHTNIASFVRQLNMYGFHKVNENSST
FT                   NSSNNGSTLPLDSVTQTEQNRSRASSTSSNPNGLSVWEFRHSSGFFQQGNSEDLKLIKR
FT                   RSRQSREGAPKGKDGVDIGNESNTFTPAPAIGPQALSAPSGAAQVSTTLEHPPVTNGFS
FT                   GSNGSMAPSSQSLASTSNPMTGTNPDVQSYTPQHYTLNSPSNTETNDEGHPMCQNTDPN
FT                   SNSLTDNSGTKRFGNETTTNKSELGDNVLAKYNDLNNKFIEFRKDYDILQYKYDLALEE
FT                   MKKSNFDMINLINFMKESILSRTDFIRNQQSHPFDNEKNFEAELDSFKKSILEKCNERD
FT                   LELRDSITKMTPPMIQPVVQPQSYQSHPNQVQYHPYHVQMPQQPFQQPNLSNAYHQQQQ
FT                   QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAATTTTTTTTTTTTAAATAASAT
FT                   TTIATAAATTTTVPTVTCNYPTTPATTTSRNKILLLPPQIAGSHSGQIPPVLSVPENRP
FT                   QPYPQQNVENSHDGELKKYSSGSSLPRGSLSSVSSHSLGNNFSAGSVTTLMEESQTETK
FT                   RPSYSLINPPRSIPEYELPNNNNNINRQRLPSASSLTSIINITSNPAYKDKYRAPNARH
FT                   NSDYQYQRQQSIGSPSYPRLTDDNKRSLLTNEEENETRKRQRSMMDTK"
FT   CDS_pept        complement(236857..238212)
FT                   /locus_tag="PAS_chr3_0116"
FT                   /product="Protein of the mitochondrial inner membrane that
FT                   functions as an ATP-dependent chaperone, required f"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70046"
FT                   /db_xref="GOA:C4R3L0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR014851"
FT                   /db_xref="InterPro:IPR027243"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3L0"
FT                   /protein_id="CAY70046.1"
FT                   /translation="MNSLPATANSNTPVVSLEKLKETDGSFKGMASGLLEDVMKGNPYF
FT                   AAGGGLMLLGTGLALLKSGITRVSGLAYRQMLVDLEIPSKDKSYLWFLEWMSQYKHRSS
FT                   RHLSVETNYTQHNNGSISTSFSLVPGPGKHLIKYEGAWMLINRERSGKLLDMTNGTPFE
FT                   TITLTTLYRDRNKFPSLLEEAKRMALKTREGKTVIYTSWGQEWRPFGQPRMKRLIDSVV
FT                   LDKGIKESIIDDVQDFLTSGQWYHDRGIPYRRGYLLYGPPGSGKTSFIQSLAGYLDYNI
FT                   CILNLSETNLTDDRLNYLMNHIPERSILLLEDVDAAFNKRSQTDEKGYSSGVTFSGLLN
FT                   ALDGVASAEEMLTFMTSNHPERLDPALLRPGRVDYKVLIDNASIYQIERMFLRFYGETH
FT                   RELCDEFLEQFKTLGLPTVSAAQLQGLFVYNKRDPKKAIEMVEVLKQPNHVF"
FT   CDS_pept        238466..242308
FT                   /locus_tag="PAS_chr3_0117"
FT                   /product="Ubiquitin-specific protease that removes
FT                   ubiquitin from ubiquitinated proteins, cleaves at the C
FT                   ter"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70048"
FT                   /db_xref="GOA:C4R3L1"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR025305"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3L1"
FT                   /protein_id="CAY70048.1"
FT                   /translation="MPDQVPSASTNVNNPFAQLEAYDFSKSKIFKTSNRLIDDIKNSVL
FT                   FLEQFSILNLPAVDYATQLSLQYQNRQINESFKLVLLNNQLDFAPTVSTEQLPNGTRTV
FT                   FRGLIVQDTVHGIPISDIPIYHCRILFKSLENEILCSKHQFFHFSDDSLSPSDRSDLVT
FT                   DYAKISKGELTDCEDDLKPSIVQSCPKLLDSTNYICRKCYKVLRIEIFEKDLSNEEYKQ
FT                   FELNEIQFRYSKTVSADPSLNISNENDVNKIPSQSECLWTLFKVLRGPLSRDPEELEVK
FT                   TLDVNHKILNIHLDMDIFEKCLFFHKSADGSYLTPPLFSEYGVFENLVRESYIRKLLEV
FT                   VYLGTICPNNPGLKRLNQFAQAYWFNDTGSKIFHFLKEFDSTAAIEWFGGLRYDVLERY
FT                   NPALTTLVSANYFNNKLICGSYSLLCESDPQNTPKYFDALRDIGLLRQAPVVQEFVAKE
FT                   ASKNVFSFRDTMRNYQILGIDTSSADFPTLSDDEILKFYKYELILANSESSYDRLRNAL
FT                   SSIADYRKSEALQNYLRIEPIHNIDQAYKHFDTPQSIEDDVLITAFQFKKDDFPQAVAL
FT                   YDRALLTIAIQRKSLFLWSYITHNLDYLFKVIVASSSKTITGVEDAYKYLGCDPLATDF
FT                   QVVTIFQERLIKDPGIDVILFFYSLVVIEKSRSSKLIGKFLQNGVVDASFLPLESSPVG
FT                   LNNIGNTCYLNSLLQYYFVIKPLRTAIQNFKDILPSSEEEFNSIEDYSKRRIGGRTVGY
FT                   KETERSFQFVYQLRDLFDELIHSRRIAITPTKELAYLAFSPSTDEVQFHLPEVQKPRPS
FT                   ITESETGMSDAPVPELSPVAMDWSSSIAYPEPSSSHHEESAALNSPDESSELIHSPTKR
FT                   KLSPQPSTEDLNEIDTKVSVTNAEPPTTTLPKRATTAVALIGNDQLENALELGRQQDVT
FT                   ECIENVLFQLESASKPTSLDSDDQEQNDLVKELFYGRTKQILQPVDKETKENITDSSVR
FT                   TKVERFVSLLVNIGDHPKDLYDALDTYFTEDLIDLDDGQVKRSLTITELPKFLQIQVQR
FT                   VQFDRERGIPFKALDPLPFHEKLYMDRYLETDNEELILKRKEIFQWKNEISKLNRRKDE
FT                   ILVPSSHSMTPRNALIATKEFLEAQKELPGDIQATESTLITLQKEIDILNSELQTINSR
FT                   LSELEEKCQHQFDQFKNTGYSIFAIFIHRGEASYGHYWVYIRDPTRNIYRKYNDETITE
FT                   VPISEVFNFSESNTATPYFLVFVREDLEDEVEPLKRELDSSPTTEDFRISVEELD"
FT   CDS_pept        complement(242340..244223)
FT                   /locus_tag="PAS_chr3_0118"
FT                   /product="One of six subunits of RNA polymerase III
FT                   transcription initiation factor complex (TFIIIC)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70049"
FT                   /db_xref="GOA:C4R3L2"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3L2"
FT                   /protein_id="CAY70049.1"
FT                   /translation="MARRSQRISEKPIKSESLDKVSSDLDVSVRTSSRVENDTDSDYIN
FT                   TSTVSGASDEKGQQATKKNLSKPKKRSKNKTESDSIPAYFEWRSSNPDYEKLDDDPYLD
FT                   ELLHFENTLQKIDSSSRVTALALKDRIFYCYGFNFGIVKSVIDRREEWVTNVFHPSVST
FT                   VASGKYNIREIDLASFPETNYQPLVKMDDTLPKLDRTISLKLDDSQTMTHIHPSMLIEI
FT                   PNENDRVAKLLNTGGFVLETIWLPSYVAEKVPAYLLISLKDHDPQDGAFNPQFSVFKRQ
FT                   QYPSALQFYKINPNNLNSILLVTIYLKTGGLTNLKVLSAEDNVVQLIALSSEKTIHLYK
FT                   LILEDTKSEICLTVDKPSLELSVKDLLITSFDMISPDRIIFGTSSGTIGEFDLSNKDPF
FT                   SPVYLYQTPLQSIVLLKTNGSDLLYEDSLNSELVVITSMDYKSLILDLADIIKLVRTAI
FT                   KQRYFLNQIEYSPFAKVFIATDDTASLTLFASRDSTAIISGASHTNRINRIGISPLHPM
FT                   ALSGSVDGEVRISNSFSSIFFMARSKSRPVSLCLWKLEHSSSEDAFRLVSHLKVGKAEQ
FT                   KVTLDATIFPNSITFTSLSWNESISSCNLYAAGSACGLVILEALESGTTKK"
FT   CDS_pept        complement(244342..245499)
FT                   /locus_tag="PAS_chr3_0119"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70051"
FT                   /db_xref="GOA:C4R3L3"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3L3"
FT                   /protein_id="CAY70051.1"
FT                   /translation="MTRDNDIEKAGFNTKLVHGDDSSARVPDVVQPINVSTTFRYNDDP
FT                   ASLVAALDLEPGSGILDNLIYSRLSHPNSEKLEQVFEGILDGHVVMYSSGLAAFMAMLT
FT                   HYNPKVIAIGQGYHGCHGIADIFTRLNGLKQIGLDDDYSQLGPGDIVHLETPVNPEGVS
FT                   FDIKHYAEKAHARGAYLVVDSTLAPPPLQEPFKFGADMIMHSATKFFGGHSDLLAGCLV
FT                   TKDLDIKHKLIEDRVYLGTNVANLESFLLLRSLRTFKIRLLTQSQSAQQLVQYLQNHIK
FT                   EFSALSAVHHSSLQKDAYIKEQLPIGHSPVFSIDVDSPETARQLPYRLKYFHHATSLGG
FT                   VESLVEWRSMTDKSVSQTLVRVSVGIEDVEDLIQDFHQALSGLSK"
FT   CDS_pept        245785..246903
FT                   /locus_tag="PAS_chr3_0120"
FT                   /product="Integral membrane protein of the endoplasmic
FT                   reticulum, required for normal content of cell wall bet"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70053"
FT                   /db_xref="GOA:C4R3L4"
FT                   /db_xref="InterPro:IPR037654"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3L4"
FT                   /protein_id="CAY70053.1"
FT                   /translation="MKSSWKIGLFFIAFVVELVSCESSFPSFLFSHKLIPGIQDKLPHS
FT                   PQEPFTLQQTNYMINQVLEKCQANVFILVNQPGVIVQDFQDFYSFQNLRSYMVQASTIL
FT                   TFPHTVVTEEDPHKGLDLDKIQTYIMRQCRAKLLTLKDDDPGSIESFIDSKTRVIRMDF
FT                   TGIPSKAEEEYEGQREEILKKHDLTLLKVIRELPSPFITLLYTTDTAQEFAKIPDELVN
FT                   VNEIPNDPQMIPLSMKNEILQKENVIFPDITLFDLTRLSEYERNNLGHYMNFDQKDRDA
FT                   EPVLAVNDDKDKPIFNKPRSKKVDVRPEWLRFGEDDDSIPTLFNEEILRENALLVLSLS
FT                   VSILGILLFIICKILASLVRLAFRSIHKQKTE"
FT   CDS_pept        complement(247081..247374)
FT                   /locus_tag="PAS_chr3_0121"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70054"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3L5"
FT                   /protein_id="CAY70054.1"
FT                   /translation="MKLSSSVSGAVRTFTYFMASGSHYMLKDVEYISLYGDEPSAIEQA
FT                   YAIFINVLEMDENGNVTNMSHAEKRATDYIRSYCDPSFTVQPPYEDWEVALY"
FT   CDS_pept        247583..248071
FT                   /locus_tag="PAS_chr3_0122"
FT                   /product="Small subunit of the clathrin-associated adaptor
FT                   complex AP-3, which is involved in vacuolar protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70056"
FT                   /db_xref="GOA:C4R3L6"
FT                   /db_xref="InterPro:IPR000804"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR016635"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="InterPro:IPR027155"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3L6"
FT                   /protein_id="CAY70056.1"
FT                   /translation="MKFYTSVDIETQRLLLQQVHQLVITRTEDQCSFLTPPPLLEDYDD
FT                   IKVIYRHYATLYFVFIVDNQESELGILDLIQVFVEVLNNCFTNVCELDLVFGWQVLQAA
FT                   LEEIVQGGMVIDTNIKKIVAAIDKANLQIESSTAGSNLASKGLFAFKKQAPGLFNAWG"
FT   CDS_pept        complement(248123..248575)
FT                   /locus_tag="PAS_chr3_0123"
FT                   /product="Mitochondrial protein required for assembly of
FT                   ubiquinol cytochrome-c reductase complex (cytochrome"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70058"
FT                   /db_xref="GOA:C4R3L7"
FT                   /db_xref="InterPro:IPR012420"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3L7"
FT                   /protein_id="CAY70058.1"
FT                   /translation="MAAANSSYLLWKKSLIYGGGIIGTGVLLYKFTTPTEEQLIARLSP
FT                   ELRQEYEQNKSLRRKEQEELMKIVRETSKSNDPIWKTGPLTPSWESSATGPTDRLPKGK
FT                   ELLVAKQAFEKSQAEEKQKEELRLLKKQVEETSQLESSKGSKWKFW"
FT   CDS_pept        248830..250308
FT                   /locus_tag="PAS_chr3_0124"
FT                   /product="Squalene epoxidase, catalyzes the epoxidation of
FT                   squalene to 2,3-oxidosqualene"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70059"
FT                   /db_xref="GOA:C4R3L8"
FT                   /db_xref="InterPro:IPR013698"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3L8"
FT                   /protein_id="CAY70059.1"
FT                   /translation="MSPERDYNIIVIGAGVVGPCIATALARQGRKVLIVERDWSEPNRI
FT                   VGELMQPSGLKALRELGMIEAINDIDAFYTAGYLVKNYNEDVLIPYSYKQDLKLVEEPV
FT                   PGCVKDGNDKLKDDKDTEAGISVKDWESDERIRGVAFHHGRFVMNLRKIATQEPNITKL
FT                   QGNVTSLLKNDLDACIGVEVEDDSKNRKNYTAELVICTDGIYSKFRKELFLSKKPQVGS
FT                   YFVGLELQNAIVPKLHYGHVIMGDHAPILMYQISQTKTRVLCAYRSEKLPPKNDVLKYL
FT                   NEVVLPSFPAETQPSLIEALSKDDCYRAMPNQYLTAKTNTIPGLAFIGDALNMRHPLTG
FT                   GGMTVGINDAALLARVLYDVRDLLDDATVSEKLAEFHYERKKLSSVINVLSIALFSLFD
FT                   GDSKALLILRRGCFAYFKRGGKCVTDPVDLLSGLLPSPMILFHHFFSVAFYGLWLNYID
FT                   RGLIGFPLAIWENLCALYTAIIVFTPYLWDELVV"
FT   CDS_pept        250557..252119
FT                   /locus_tag="PAS_chr3_0125"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70061"
FT                   /db_xref="GOA:C4R3L9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3L9"
FT                   /protein_id="CAY70061.1"
FT                   /translation="MLKIPRPTKVDPRPECFSSTLKECFCIFTLTFAPAAASMATGAYQ
FT                   ISINKVADHFHVAGGALTWSISSVGLANGSLLLLMGSIADLFGRRYSVLTAFTLYSMFS
FT                   LIGGFMNNYIALCIFRALQGVVVAVGTPAAAGIIGANYPIGRRKNRAFACFAAGAPLGM
FT                   CFGLVVGGIAAEFSTWRAIHFFNTVWYALLATVAFITVPKDQDTELSKKGKLATLKELD
FT                   YMGAFLSLTGFTLFCFSLTQVDVTVHGWKTPYIIALLIVGSLLIVALFVWEKYVPRRPL
FT                   MPMEMWSNSRFARSITIMSLLWLCFAGTLTYFSILFFENVQARSPLLTTAYILPMGIVG
FT                   ILTNIFIAFTLHVIPGRILLLAASLSFCGSAVIWATVSKNRLYWAGPFQAISLSVIGAD
FT                   TAYNVCNMVTMTSVSKDLQSSAAGVFNTVIQLSGAVGLAISSAVVNARNPLYGTPQQND
FT                   DPVKLLDGFRNAWYCAIGYSVVAVVLSCFLKIGTYGNSQHEEAEPEIASETLPQGFDGK
FT                   TSP"
FT   CDS_pept        252521..253027
FT                   /locus_tag="PAS_chr3_0126"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70063"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3M0"
FT                   /protein_id="CAY70063.1"
FT                   /translation="MVEVFMVHPNLQLSSCNNDLTKDLNRYKSVYETLQERYNEQVRAF
FT                   EKSHGGSKEDDGSLQYKELGYIKYFVDLAQKEYEYMCSYYQINNIIRKYFSKQEISPEM
FT                   EEEGLDLIEKEMASYKEIEKELDQLKARRGDVEQPIAEYCKRHPDDEGCKNRKEPLIDT
FT                   INAHN"
FT   CDS_pept        complement(253092..255248)
FT                   /locus_tag="PAS_chr3_0127"
FT                   /product="Protein kinase with similarityto serine/threonine
FT                   protein kinase Ypk1p"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70065"
FT                   /db_xref="GOA:C4R3M1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3M1"
FT                   /protein_id="CAY70065.1"
FT                   /translation="MMSSWKQKLKDSTHHFSRAKKDSSPTRDDQTFYSGGSPSSGSVDV
FT                   LSVSKPKPVLTRDSLEQANQRRNSSTESSMSTQTAVELDRASRSGNTVNVEEELKNLSL
FT                   KDDEQAIFTKDLSTTDPVMVPSSDSNSQLNSTEKTSDSQGFKPGLLTCKIYTGNDMKLP
FT                   IPLKISKVLMDRLIESGVDVNLSKLQETCNELLSAASQITNSEKDKTGNKINSKKLELL
FT                   MTKSIPALISVPSMYDPTPVKKPLIYLVVEFDKNTETINSIGNTINSPKFNNVTTFDVS
FT                   SNMQTLTINAFARLPSVLIPEDSLNQLNEEAKNLHNDKEPFRPLPQHDILIGSTRVDLN
FT                   KSTDISNATSSSRLINHEWVNIINPYNKDCMGLINLSIDFHPYSSKKSMSIDDFQLLKV
FT                   IGKGSFGKVMQVRKKDTGKVYALKVIRKAHIVSKMEVTHTLAEKFVLSKVDNPFIVPLK
FT                   FAFQSPSKLYLVLSFINGGELFFHLLKSGKFSLARAKFYISELLSAIETLHDMNIIYRD
FT                   LKPENILLDYQGHIALCDFGLCKINMQLEQKTNTFCGTPEYLAPELLSGQGYTRVVDFW
FT                   TLGTLLYEMTVGLPPFYDENVKIMYKKILNDPLKFPAGFDPDAKSLITGLLQRDPTKRL
FT                   GFNGSHEIKNHQFFADIDWQRLLSKSYIPPFKPPVQDSFDTSNFDAEFTSERPLDSVVD
FT                   DYLSESVQKQFGGWTYIGSSSYYP"
FT   CDS_pept        261874..265197
FT                   /locus_tag="PAS_chr3_0129"
FT                   /product="SUMO/Smt3 ligase that promotes the attachment of
FT                   sumo (Smt3p"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70067"
FT                   /db_xref="GOA:C4R3M2"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR004181"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR023321"
FT                   /db_xref="InterPro:IPR027229"
FT                   /db_xref="InterPro:IPR036361"
FT                   /db_xref="InterPro:IPR038654"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3M2"
FT                   /protein_id="CAY70067.1"
FT                   /translation="MFVTGRQLFQSVSYSLWLGSTVHVFDRILTFQDTINRINTLRVSE
FT                   LKALCRATGRLVSGRKADLAERLKLFFQLGRDNNDNVLLLATRTLVLKAANFQEVPNFD
FT                   TIYNALKTNSHLFMLPSAGSNVVPAVQSSVTHNQLPMSTGNTNMFQGVNMFPTKPSEDS
FT                   KKVRPWVYFQESPFYRLKRLVHGTPVMAEKAPGRRGQCNIQFILNESETKTLFGKPNYK
FT                   LLLLSGSYDGRNVTNNAFVEFPQPLEIYCNKAPVKGNVKGIKNKPGTARPANLTPFVKE
FT                   PPTMNNLQVVYAFSNTDYLFYLYIVESFSAFDVLQKVLAQPHIIKEATLNSFNKTEDDD
FT                   DVVEMSQILSLKCPLSFSRMKYPCKSIYCEHVQCFDGLAFLQLQEQASTWSCPLCSKKI
FT                   DVKDLALSDYVEEILKNTSDLVETVEIDPNGNWTIGKEDEPDVSQPQEKSTEGLKSEPT
FT                   EEFLPPPDASVEVISLDSDSEDQDDGVAINPPEPEVLNSTVLPQDMLSTTVAVSNTTNN
FT                   EGPSSSSASLPNGEEMLDYSDLPTANIRRGLPRIDSEGEDTASISSSPLPPPSRPPIQS
FT                   LSGENRLNAAMSVASGTQAQSNDTLHNSELGDVAEKDVGTEDGNRRQRSISPLPPPAAP
FT                   PPHLHSQSSNAQSANNTNSSITIEDSHAVKTASVTSQENPQGSLSVSFTPPDAHRSISD
FT                   PQSAQLRQMFNSTPYNSELTTNYSSNLANRPSSFSSSGFPRNTEVVPPSNGNRRSEFNR
FT                   TKSIQIFLQRQEQLLTHNPTLQQLEASLKLQDHIYNQIATQKKILEALNPSLRNEEGQY
FT                   DQVIRQATVRTAQKNRILKLLAKKRGQLNHTHNHHANVNSISEKVDGTMPNGHGSTDFV
FT                   QSLRSAPLQASQNFSPLASSAQQEQHSQSPNFNRSYLVPSASNSSGQVQNQDQYNFNFY
FT                   GQPLVQTPNEVGAQTLPQLYPGAPSIHSSLRNDKQTQSQNISRNGVQPQLLNPAQESSE
FT                   TPSLVLPSWSNNSLLQSTGNPSASSPTNGYNNAEMHNDQDQNQQTQTKGLLGISMHTSI
FT                   FDKTPLQDSNGSLKEPSTQKSTSSSSYARPAEGIAEVANKRSKTVVDLTLSDEENDGDH
FT                   "
FT   CDS_pept        complement(265199..265921)
FT                   /locus_tag="PAS_chr3_0130"
FT                   /product="Farnesyl cysteine-carboxyl methyltransferase,
FT                   mediates the carboxyl methylation step during C-termin"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70069"
FT                   /db_xref="GOA:C4R3M3"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="InterPro:IPR025770"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3M3"
FT                   /protein_id="CAY70069.1"
FT                   /translation="MNSSKNLEPGQLEDQEKARILDSNNLHQVSAISLSLGVLFGLSLS
FT                   FLFTSELFQLPLYILCLSLFHFLEYYITAKFNTDKVSLDSFLINNGAEYILAHSLAIFE
FT                   VVLEAHWFPTLKSHRYISFFGLIFIVIGQFLRSTAMITAGRSFSHMISTTKKKEHVLVT
FT                   NGMYKYTRHPSYAGFFWWALGTQLMLCNPICFIGFLFTLRRFFKHRIEFEEQYLVAFFN
FT                   RDYINYKSCTGTLIPFIE"
FT   CDS_pept        266154..266723
FT                   /locus_tag="PAS_chr3_0131"
FT                   /product="Essential nucleolar protein that is a component
FT                   of the SSU (small subunit) processome involved in th"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70071"
FT                   /db_xref="GOA:C4R3M4"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR006984"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR037503"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3M4"
FT                   /protein_id="CAY70071.1"
FT                   /translation="MGKAKKTRKFAQVKRTLKSTDQRLKNSVQKPRDPKDDPELVRSVP
FT                   QVSSALFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDTLYAKCVPLITDCVVA
FT                   ELEKLGPKYRIALKLAKDPRIKRLSCSHRGTYADDCLVHRVIQHKCFIVATNDADLKRR
FT                   VRKVPGIPIMSVGGHKYEIERLPEVF"
FT   CDS_pept        266992..268938
FT                   /locus_tag="PAS_chr3_0132"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70072"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3M5"
FT                   /protein_id="CAY70072.1"
FT                   /translation="MTDESIAQLKDMGFDEEVARQALVMTNNDVTGALSYLFGDGIPKQ
FT                   QQGENEDTQHPEEKPNQRSDKENDQELEIESDHVQNTDIKLAGSSSSSLSPPPLPSREI
FT                   HLDEEIRTKIAAYGSLRSDEPGVIEEDSDIEDDDDMSSVDSSDDYTVYDDPSATQRNSY
FT                   IPPILVPINYEYFESYLAPLIITLHEIPSFRNLIFKLESFNDYGYEKNWWKDKDIKIAG
FT                   SVGNRFVMELQRVVAFLDNAPSKRFFASIHNLVQHLSKDLLAGLNDMEGVEDFFPAFFK
FT                   SLSGAATGVDNEKLQRLFQSEIIEIYNGEEREKQVVECFTIEPDVLKCNIYQTFHKLLW
FT                   ENDFERLGMIHINRLSEVMVIPILGNLNESVYGSFSVSEIFYPQIYLKENEQLMRSKIE
FT                   LRQELINQRLSNSKKIMDISSYQGKRVNDFLSTTVEYLQNKAEDEEIHKALQNINQIKD
FT                   NIIKEKLSITDQQNAIVEKLNSNMDLFNIPGIVKEEKLDWEPYFLTSIVLDTSNIYYFT
FT                   KNFESKETDYCWYQVRYFHREHSKRVSNFNIRKIMDFSEIQNTIHEFTRSGISNTMTLT
FT                   YVKRSAFFDEDPLDVLPNNLVKFFNRDNEQLAENLRENSDEESEVIDLTRDSDSYEEFD
FT                   SSAESNGESARRI"
FT   CDS_pept        269861..270790
FT                   /locus_tag="PAS_chr3_0133"
FT                   /product="GTP-binding protein of the ras superfamily
FT                   required for bud site selection"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70074"
FT                   /db_xref="GOA:C4R3M6"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3M6"
FT                   /protein_id="CAY70074.1"
FT                   /translation="MDRRRELNILMLGNVGVGKSSITLQFVQNQMPEHHDDDIEDTYSR
FT                   VWEIEGKEYQINILDTADSSQSTMETDLQSDHRRQQILATQGIILAFRINSKDSFDNLS
FT                   NILRNLSRIRGNSLPPILLLGNMMDLEDEREVSRTEAEYLQYQYKLDDYIEASASMRLN
FT                   VDDVFTRMIELILDIPDSKPHSANDSQVGIRQNSSMQGESKHDRNIDDEDFKLMREESY
FT                   DERSRSLSQVSQDDHRLSPSLHQSSAISGREAKPVAEEPSKNQNGITENNQVTTGNENK
FT                   DSRELHSVNKTAVSAVKEKRATSCCILM"
FT   CDS_pept        complement(join(271593..272858,272912..273898))
FT                   /locus_tag="PAS_chr3_0134"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70076"
FT                   /db_xref="GOA:C4R3M7"
FT                   /db_xref="InterPro:IPR007342"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR022830"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3M7"
FT                   /protein_id="CAY70076.1"
FT                   /translation="MLRRFLNFRRPLHYSAPIVSEEVQHAVKNNIPVVSLESTIITHGL
FT                   PYPQNLELANEVEHVIRDQSAIPATIAFINGSPKVGLSTEDLRLLADPASSGLPKHKTS
FT                   RRDIPYVVARGLTGGTTIASTMMLSKMAGIKVFATGGLGGVHRNGEVTMDVSADLEELS
FT                   RTDVAVVCSGPKSILDVPRTMEYLETKGVPVCTFNDGNAPFGKHVPGFYTRSSNVASPF
FT                   EFSSPKEAASMIFASLNMGLDNGQLFCIPPPLESALDLNFINSIIEDALQEAKVLEISG
FT                   KNVTPFLLDKIYHKTNGKSVECNAQFVLNNAKIASQIATELASLTKNESSIPNKNKAKF
FT                   NPSLNTPRIPQKVEAVIVGSIAHDTMCSLQSGYIANDSNPGTHAQSIGGVGFNVALATH
FT                   LASRDHGSFVETRLCSAVGNDLLGRGLMETMKSCGMATDAVSISENFPTGTYVSIHDHS
FT                   GALVVASADMKVVENISIEHAMECLGKYQPRWVLLDCNLSNSLIDSIVKLEDFDVVIEP
FT                   ASAIKAAKLGKLNNLRIFPHNSVKLITPTVTELNAIFNEFHDNCLFDAYQNEWFPVVDS
FT                   LGLDYNVRHALDREFERNDYLRPLLEQGFLTKTFRLLPFFNNIIVKDGKNGIIVFQIIT
FT                   DCDKYDNLIKGSKIIGSVSTFSFLTKGKPVGVGRIGVLVQHFPVLDVVPSDEIINVTGA
FT                   GDSLLGYLFSKLSADSSWLTRLDSTRESYLINSMKSSAASLKSNQAINIDQIRQIP"
FT   CDS_pept        274722..275882
FT                   /locus_tag="PAS_chr3_0135"
FT                   /product="Basic leucine zipper (bZIP) transcription factor
FT                   of the ATF/CREB family, activates transcription of"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70078"
FT                   /db_xref="GOA:C4R3M8"
FT                   /db_xref="InterPro:IPR000837"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3M8"
FT                   /protein_id="CAY70078.1"
FT                   /translation="MAHNNPQLVQEQPFSPVSQIDVNPRQSQGQIQQQSNTLSSPINQG
FT                   AEKSKKSSGGTFPHLFNQPTFDVHTMPPTNPPIFEQYYQQPSPFSHPIKTPNVIGVHNS
FT                   HQYPSAVSHAGLGFLDDQQFLSMNPSYYNTVNDDSSLYANVVPDVLNFNSTFDNDGIVP
FT                   SNPQFPTLKRRISISNGQIGQLIQATHMYQQQQQKGANFDQQELVKTSEHQARKTPTHN
FT                   IKLEDNSEFVSSLDSEGSDTKSSTIVLDDDGLPKHQLLYNNEVIFNPNDTLIPGTSAWK
FT                   RQKLLERNRIAASKCRHKKKVIQEKLQKDVDLFSQENRFLSKRIQLLEKSLEQIQALVD
FT                   GHISNCSNEDDLSQIREAIRNLRVDEGALKKNFRDSIKLTQDEDSE"
FT   CDS_pept        complement(275891..277186)
FT                   /locus_tag="PAS_chr3_0136"
FT                   /product="Component of the ESCRT-I complex, which is
FT                   involved in ubiquitin-dependent sorting of proteins into"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70079"
FT                   /db_xref="GOA:C4R3M9"
FT                   /db_xref="InterPro:IPR008883"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017916"
FT                   /db_xref="InterPro:IPR037202"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3M9"
FT                   /protein_id="CAY70079.1"
FT                   /translation="MGLPESLLRWLFQVLKPQYHNPVLCYQDVSLILMKYSSLKPRTRV
FT                   FADNKGQDQLLLSLYGSIPCKHHNVTYEIPITIWIPLDYPNSHPTIYVTPSNETHVLNP
FT                   NNYVDANGKVYHPFISQWHSVYGADKYNDPKKVQENRLLKLVEVIGDAFGREFPLFKRH
FT                   APPPIPGYDNPRQSPRLPTNEVNPMNSPRSEVLASSQPPPLPTKPKEYQSPPPDSSRPL
FT                   NFNTSSHSTPSQQSLSSPQPGATVPYVYKDMLSSNFDQSHKGDEQHSLLTSLHKSLSVL
FT                   LEQDLKLLYNEDILPQLQRIEKELLALKDLASKDDQLVKYYQTQIKKNKQILESKISEA
FT                   SYMIKNLSNDKSVDKIDEILVAETVVFNQLYDLRTEEASINDTIDIITKSHDSGSIDTD
FT                   LFLKYTRQLSREKFMVIALTKKIITSIGIENK"
FT   CDS_pept        join(277352..277359,277565..277694)
FT                   /locus_tag="PAS_chr3_0137"
FT                   /product="Vacuolar H+ ATPase subunit e of the V-ATPase V0
FT                   subcomplex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70081"
FT                   /db_xref="GOA:C4R3N0"
FT                   /db_xref="InterPro:IPR008389"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3N0"
FT                   /protein_id="CAY70081.1"
FT                   /translation="MSGVWRSTVLLTLAMCWLMWAFTYLAQLHPLVAPRRSDLRPEYAE
FT                   "
FT   CDS_pept        278151..279248
FT                   /locus_tag="PAS_chr3_0138"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70083"
FT                   /db_xref="GOA:C4R3N1"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3N1"
FT                   /protein_id="CAY70083.1"
FT                   /translation="MALDLGSILWYLPLKVYGTAQVMVAILSFLIWQPIMSVIDVLFYG
FT                   LIRLPMSILLFKLLLIEDEKLQVHAGRVWEFSKIMYQFLSAAFIVGTCVGVWLGLSLIL
FT                   VSYLLLWEKPIFTPFKISNVLKSIAEYLGFADLWSKIVSSFGEPNAEGREHKTKRYVLS
FT                   LTSEQLKAMLVGDRKNVNPALSEGSTLVERTQSSRNKIARSVSNNFSKFNNSPRRFSPL
FT                   SPKSNIEVVNQNFQRPSSSGTTRTSTSTMDSAASTLTETSLPKGNSPVSHPVPPELTVN
FT                   PLAIPTQPFWRSPSTSDVQQLTETPRSSRSPRDSVTSIVDPQYDDDRYFTPIVSPQAPR
FT                   SSFSASNNPESSRSISDYVIPEEEE"
FT   CDS_pept        279350..280375
FT                   /locus_tag="PAS_chr3_0139"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70085"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3N2"
FT                   /protein_id="CAY70085.1"
FT                   /translation="MFNSLYHAGNGRMNNNAFVSDMELQFPIINEQINSPLIFHTSSGS
FT                   TESDTKVGGDQEYIFGPSPQPSASRSGISSGSEVMASTRLKSHPKSKVREKIEPNPEWS
FT                   EESKSNIPLIQRRLQLFLAMNYQEDPDTGDLICKYNEDVSDAPPDLGKSLQTIEKLKKA
FT                   STDKAGGNKRLPDDNSLELIRSSRIEILKFLINDILRGSGLIPRGENWYALTQYVSLAS
FT                   TTPSLSDFSPVTSSASSVSSTFSHAMSTPSPQRLSVDILLNLSDAENISDQTNVYQAKI
FT                   SLHFMSTACHPTTMMNFKDTFFPTITHNFRYLTPNSNPGGLKYVKLPTDMVLLTTEVVV
FT                   V"
FT   CDS_pept        280750..281607
FT                   /locus_tag="PAS_chr3_0140"
FT                   /product="ER localized, heme-binding peroxidase involved in
FT                   the degradation of heme"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70086"
FT                   /db_xref="GOA:C4R3N3"
FT                   /db_xref="InterPro:IPR002051"
FT                   /db_xref="InterPro:IPR016053"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3N3"
FT                   /protein_id="CAY70086.1"
FT                   /translation="MSTKIPQQEIIPLRTDLAALGNRINAETRNAHNKIDKMMTLKFAL
FT                   ALRDPKIYRQGIQMYYHIFSAIEESLDRELSKETPWTSILKQVYKPTIRRSERLYKDLL
FT                   FYYDNDPKKFAEPIMPEQIRFIRHIKESTAEKPYLLLAYMHVMYLALFAGGRIFRSKLA
FT                   KAVGLFPQVVGKTTEEISLEATNFFRFECEDEDAFRIVYKRDYELATRNNLTETEKQEI
FT                   IKESQLVFEENATCVKEIESHNLRRLQEKVLYKVATKGYYVVLAVLIMLAVFLLKTIAS
FT                   RLLL"
FT   CDS_pept        281879..282568
FT                   /locus_tag="PAS_chr3_1155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1155"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70088"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3N4"
FT                   /protein_id="CAY70088.1"
FT                   /translation="MSLSLISTVALLAPAFYFDPVLALDLGSLDQWQDTDSSRNSNASN
FT                   DESGNSDSNSDASSESSLENSNQESNQNSEEGSTQDSNQNSNQNSAQTQQQTAATTQAQ
FT                   RASESEQTQSLAATTAASLETNTQQTPETTPTTTVWWSQSVTQWWTPSVTKWWTPESEL
FT                   TASSTDNSNSLSSTLSTVVSSSSTLKNTTSKNSTNSGLRSHQPNSNWKSGMLVGGILMA
FT                   SVVLSGL"
FT   CDS_pept        complement(282658..284424)
FT                   /locus_tag="PAS_chr3_0141"
FT                   /product="High-affinity inorganic phosphate (Pi)
FT                   transporter and low-affinity manganese transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70089"
FT                   /db_xref="GOA:C4R3N5"
FT                   /db_xref="InterPro:IPR004738"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3N5"
FT                   /protein_id="CAY70089.1"
FT                   /translation="MSSEPVMQAKTKSKRLNVHNLLDEFDHIEDPFERRRLALEKIDNA
FT                   KFSLYHVRAIMVGGIGFLTDSYDIFAINLATSMLGYVYWGGAHGGTGRIPSSTESLMKV
FT                   STSVGTVLGQVVFGKLCDYVGRKIWGIELIIMITATILQVCAGESPAVNFVALLTFYRI
FT                   VMGIGIGADYSLSSTITSEYSTKNTRGMIMAAVFANQGWGQLLAGIVALICVVGWKSDL
FT                   IDATNASECVGPCVLALDKMWRVLVGFGAVPGCIALYFRLTTPESPRYKLHKELQAYEQ
FT                   QMARQNDKMQLIAAENANNETAAAPLTFADRAVLEEEEEEHKVQPATWADFWNHYRQWK
FT                   YGKFLIGTAGSWFLLDVAFYGLNLNSAVILQAIGFASDENVYEKLYNVCAGNLILICAG
FT                   ALPGYWVSVATIDTLGRKFIQLMGFIVVTALFCAIGFAYDKLSDKGLLGLYIIVQFFIN
FT                   FGPNCTTYIYPVEIHPTRFRSTAHGISSASGKIGAIIAQTVLGTLINHGCSADKPNCFL
FT                   PHVMEIFALFMLLGVGTTLLLPETKKKSLEAIGEIYHGELNPDAFAADEEDLSSSTGVD
FT                   QELVNYQEQKHV"
FT   CDS_pept        complement(286223..287224)
FT                   /locus_tag="PAS_chr3_0142"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70091"
FT                   /db_xref="InterPro:IPR021463"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3N6"
FT                   /protein_id="CAY70091.1"
FT                   /translation="MSDRVARYKAKREEERAAAAVHFEEEENIDDNEIVESKCIPCTSE
FT                   YQYEPERIIKVFQTCFQDMFEDQTELNQLVQSVKGDLYNRDYAAAFGEERKRDAYVIRW
FT                   SPARALAYSSLFSQLKEVRELIYDFSDEKKDLDVLAVGGGAGSELVALNSIYCFAKEAY
FT                   PNTEKKITVTLVDIADWSLVVDKITDFTKKYWLYKTATYKPEFVNHDILKPGVSFVNRD
FT                   LITLLFTTNELFAEDRTEATKFLQRLSSECKSGALLLIAESAGSFSHIQVGKKKFPLTF
FT                   LIDTILCGRPGSDNGAWTIIDGNDSVWYRTPKVQYDLKLENMRFFYRLYRKR"
FT   CDS_pept        complement(287971..288585)
FT                   /locus_tag="PAS_chr3_0143"
FT                   /product="Secretory vesicle-associated Rab GTPase essential
FT                   for exocytosis"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70093"
FT                   /db_xref="GOA:C4R3N7"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3N7"
FT                   /protein_id="CAY70093.1"
FT                   /translation="MASRGTSRQQYDLTMKLLLVGDSGVGKSCLLLRFVDDSFNPSFIT
FT                   TIGIDFKIRTVEINGKKVKLQIWDTAGQERFRTITTAYYRGAMGIILVYDVTDERSFNS
FT                   VHNWYQTLNQHANEDAQLFLVGNKCDDEESRQVTKEQGEQLASELGVPFLEASAKSNKN
FT                   VDAIFLELAKRFEEKMRNTQQGPGSAGIDVNSSNDTKSSCC"
FT   CDS_pept        289030..290799
FT                   /locus_tag="PAS_chr3_0144"
FT                   /product="Beta subunit of cytoplasmic phenylalanyl-tRNA
FT                   synthetase, forms a tetramer with Frs2p to generate ac"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70095"
FT                   /db_xref="GOA:C4R3N8"
FT                   /db_xref="InterPro:IPR004531"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3N8"
FT                   /protein_id="CAY70095.1"
FT                   /translation="MPTVAVDKEDLYQLLGRSYTTEEFDELCFEFGIELDEDTTNDCAK
FT                   GERPQLKIEIPANRYDMLCIEGIAQALNEYLGRSSAPAYSLQPAVPQVTMTIKESTSTI
FT                   RPYAAAAILRGIKFTQRSYDSFIALQDKLHTNLCRNRTLVAMGTHDLDTLEGPFTYEAL
FT                   PPSEITFIPLNQTKAMDGNQLMEFYEKDKNLGKYLHIIKDSPVFPVILDKNRNVASMPP
FT                   IINSDRSKITLETTNVFLDITGTDKTKVAIVVNQLVAMFSRYCSTPFSIEPVNVVSEHN
FT                   KETRVFPDIKPRLMQAEISYINSCLGLNLDVDTIIQLLKKMGLQPKQNESKNDLLDVYI
FT                   PITRPDVLHQCDIMEDASIAYGYNNLVKTQAQSQALVAQPLPINKIADIVRLATSQNGW
FT                   SETLPLTLCSHDENFKFLRQNDDSKAVKLANPKTIEYQVVRTTLLPGLLKTVKENRKHS
FT                   LPIKVFECGDIVLKDETLERRAKNQRNWAAVFVGKTAGFEFVQGLLGKIMQTLRTDWLE
FT                   KPSAGKRGYWIEQDDANATFFPGRGAKIFFRAADGAEANEIGSIGVLHPEVLGFFEIPF
FT                   AASSVEINTEKFL"
FT   CDS_pept        294649..295860
FT                   /locus_tag="PAS_chr3_0146"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70096"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3N9"
FT                   /protein_id="CAY70096.1"
FT                   /translation="MELRISKVPTSLSLNSRSRSLEDHVHCEAFKDEENFSSTYYDSGM
FT                   PQYRKHHIELAFLMKNDNLSLACRLQKISDILLMNARSRNFSLILKPRISKLLQKTVLP
FT                   STVQVMENIQLYLEEEPEIVNSLMQIIESIYILENAQECQPFEPTISVLTDFYIFLTML
FT                   QEAENTHTLDVWCLKVLDTVAVVTETSRNFEEIISWLVDFLNQMKGKQTSIWQNSFDLL
FT                   SKVLKHMSSLCEAPLSDALERSENGKILKLSLESQYKEYVTFDYSTAKYFPLNISETLN
FT                   DIKVWKYLETEKKFPSFVALFEATQNSSYLSKNTALHLRQPDSLSNNKNHSPNVEKENL
FT                   NTHKSILGILCRKLKHSLAKRVAYSKQILNSFLGGDILVPSIGKTDSSAFKKDVCNESV
FT                   LDVI"
FT   CDS_pept        complement(295960..298572)
FT                   /locus_tag="PAS_chr3_0147"
FT                   /product="Essential DNA-binding protein specific to
FT                   single-stranded yeast telomeric DNA repeats, required for"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70098"
FT                   /db_xref="GOA:C4R3P0"
FT                   /db_xref="InterPro:IPR019337"
FT                   /db_xref="InterPro:IPR038528"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3P0"
FT                   /protein_id="CAY70098.1"
FT                   /translation="MEKGARIHYQIPSAISFRVKDMSLERLRQQPTLQELNEVLDELLP
FT                   IISDSAVKESVKLDIRSTLITVTVRQIYPDLSNLAKRKLAEIFQGAVGIKLLISSIQHA
FT                   ESLEIKCSLCDLLIIFLHNESSLESIFESNIRQARSLLFGSTVFNVLNETYQDVRQYKH
FT                   TVTGKLQEITTLKGYTSVVLPTLVANLKKERNPQLLLAALQLCSPNESQLVFDHFFQSP
FT                   EPFSTLVSTYNTFTPVQKPAFIKALLGYCISRYSLRAPQNLDNLQKVYSILSQFPWDSW
FT                   SSFFITVLDYQNLPLLKVYVKLINKYQVSDLLKSLVQIWGAPTFINKTPLTLQKHYLHL
FT                   IVLLLSHNPATNTEISSDHTFLTTITNRIDSTSLSVRAQGMLLANLVLQNSDSQNKKVF
FT                   IMKEQDDYESTFFEDLGDELKDSEAFDLVTSLVSDVCFPPLQTVSRVEKVTEVTNMTPQ
FT                   NSNLHIVTDDELSDPEDSDDDDPSVSRKDYPTRPVYIKELLQYLLADEKDPKAFDKLEV
FT                   ALKVAPTLIRQKSHFGDEIKHFTNELLATLVGLSNRFEMENFDQQRTNSIISIIVSNSE
FT                   HAIKELLNLFLTGDYSLQQRLIILTSFSLAARELKGHQDENVTRSFNKVKTEFASSLLP
FT                   KHIHDQFIELEHKQNGLLTFDQHAVQQLEDDYLNSTVESAEKNLMPHGKVLRVSRGLEL
FT                   KKAQKSLQLSKSRQKKFFKLVGPKFFFPLATTWHALNSQSGFKIGRYSPILTSHFIRTL
FT                   SLILDTAYPSAPDLLDMIQEMVSILIPLKDSYFDQFSAPELVDKGMNDELLILDSLVLS
FT                   FLVILQNTNQEFLLQNYGQELSQISDWLQSILETVIDDGIRRKCAGVLVSINNLFGNA"
FT   CDS_pept        298739..303589
FT                   /locus_tag="PAS_chr3_0148"
FT                   /product="Glucose-repressible protein kinase involved in
FT                   signal transduction during cell proliferation in resp"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70100"
FT                   /db_xref="GOA:C4R3P1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3P1"
FT                   /protein_id="CAY70100.1"
FT                   /translation="MEAPEVKAQDVDFHDKSDSNSENSEVFLQEATARNPVLVLELTLD
FT                   SKIKYISKSWESIVGTSIEKLIGTPISEIIVGSEDDKAVLQKATDIMIVDDNSYRVKFT
FT                   TPTNTLKHEPSESEGEEEEQAPDIHSSPKSLERNSNICSDLSTDGGFIQLEGQGILIHN
FT                   NTTHTPTHSIWMLKPSKQIDDLSLELPQQLVEGLGFGINIFESYLYQLTEAGIVDEDNI
FT                   PPPTHELCRICETQVPSWWMERHSEFCVTQHKTETIVELKHDAVVDQKKLIKQMLLTLS
FT                   NSDGISLPSKFTNSDDYPSSASSSSSSSSIASYRGFPLPTVTHPKQKHASVARQLITKM
FT                   TPAVMNLNRFPFKNLFALQDMCDDAIRVNYGTVELHNGDYIVAYSPNSEAAIKSLSERK
FT                   LPESTDKAIKLLTEDTEAICKEKLDAIMRLSYVNQYVEKVTREMDDLILDAVKHTIEKI
FT                   RDQIERDDYNITSSSDDLDDRVIDPTPMKPNTFGQIYKFNESEQDRSLEFENVTEYEDA
FT                   VSTIHSPQPQTRNTSSHVDLFNQTYLTNDSIPSNALSKSPAITELGKETSRSLTPKELS
FT                   ETSTPVISISSNMSSNDGIEVIQTASSQNAPPKGQASQTLLQKAGSRSSRSLTKNNLNS
FT                   PRRQLSPAPNYFSGSPMSSIQKNTMSRIVRLSDSSRASTPQSSPKMNTIDIPPVSDVEK
FT                   DSTRSSINRIAPPLSPLLLSSNIPKQAMGPSIRDYEIIKPISRGAFGSVYLTKRKITGE
FT                   YFAIKVLKKSDMIAKNQVTNVKSERAIMMLQSESPHVVQLYSSFQSRDYLYLVMEYLNG
FT                   GDCATLLKNMGQLPDMWAKRYIAEVIVCVEDLHNKGIVHRDLKPDNFLIDHEGHLKLTD
FT                   FGLSRMGLVGRHSRARENSTGFLGPPEMEVFQSQPSINARRRSRAGSIPQLSLSPGVGP
FT                   FGTHDSDNVVTHSPSSYYALESVLKSDKQAARTSSTSSSLNSPLVKPLVNRSNSQTSFI
FT                   IHDEDMVPSRMNSPFPSMNLALFDPKTSTQTRKFVGTPDYLAPETIQGVTQDEASDWWS
FT                   IGCILFEFLFGYPPFHAKTPELVFDNILHGEIQWPEIPDQLFQELCSNTAKDLITNLLQ
FT                   KDPSKRLGINGAVEIKSHPYFKEIHWETLFTEEASFVPLVENVEDTDYFDSRGAEMMIF
FT                   PSDSESAHESNKETDNIPQTQASSPSLKTSAYITPSSGSGSPGSNSQLGVPLKGKERRG
FT                   SRLAEGSNGEFGLFSFRNISALEKANKDVIKRLKNEHLENRGSFSSEPGSPTIQKGRQF
FT                   SNSSGTIRRADSSPSNVLNSPIKRASSLNSGAILNPKFGAVSNTGYSSGEEVASSAITK
FT                   EDTNSPVGPNLLTTHARLHRSSGSRSTDHGSPIHKALKADSKTPVQSSPTDSNGHPGHG
FT                   RFDSFSSASKMLFNYNNNNSTRRSSDLSATSSDTDDTKNAALLRLKKRRNSRKFRTSSS
FT                   STRNKPWVFRYDILLLEPIPIHRYNMEVLLKKIGVNVVSIKDPAELIRRASAGVKFDFI
FT                   FTTFKLPNLDSADLVKLIKNTASVNSDTPIVCVTAYFKEASSSGVFDYVIEKPATIEAI
FT                   KHCINLFSEVKIMDAQEAISDSESLVSVPSFNMAHAH"
FT   CDS_pept        complement(303597..304907)
FT                   /locus_tag="PAS_chr3_0149"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70102"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3P2"
FT                   /protein_id="CAY70102.1"
FT                   /translation="MESILLLPNERILKIIPIESCYLAPFTTKECYGLVGTADNRGLSI
FT                   LLEFYHYNSTNYTNVTVYVTSSRLVVVPHNQFRVLNRQRLSKYAFSIPYFSLSSFNLSE
FT                   NRSCGRINFRAPASVTSISISLEFTDKNKNALTSLTSLVSSLIFAQGVSQCLEDKKTDK
FT                   IDVSWINRIDMGEGLFFIEGSTIPIQTFSNQPNKQEEEILPTYEHSEMATGRFLQAQKL
FT                   LNRVRISLKSRTDDAYPEEEDCITLKEFVSQDDHYDHREASISIKEIRDLTQVTGTWLA
FT                   KVLITNCVRFIQRNLPKISLLREIMNDIPPTYQSLAEEFFFRCQNELYDTADPADIEEE
FT                   PELVIPVRHNAMIVAETIASEQNTPKLRRSKSKRFMTGMKKLVNSHSCQPNIPNIPRGN
FT                   RHTLYTPSHSAASPNSSLDRSKSVTLGASRARLLQQF"
FT   CDS_pept        complement(305816..306415)
FT                   /locus_tag="PAS_chr3_0150"
FT                   /product="GTP-binding protein of the rho subfamily of
FT                   Ras-like proteins, involved in establishment of cell pol"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70103"
FT                   /db_xref="GOA:C4R3P3"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3P3"
FT                   /protein_id="CAY70103.1"
FT                   /translation="MAVNNPSEFRKKLVVVGDGACGKTCLLMVFAEGEFPPSYVPTVFE
FT                   NYATPVEVDNRIVQLTLWDTAGQEDYDRLRPLSYPDANVVLICFAIDIPDTLDNVQEKW
FT                   ISEVLHFCPGVPIILVGCKLDLRNDPEVIRELQAVGKQPVSTSEGQAVADKIGALKYLE
FT                   CSAKTGEGVRAVFENATRATLMAKERKQRKKKCNIV"
FT   CDS_pept        307950..308396
FT                   /locus_tag="PAS_chr3_0152"
FT                   /product="Subunit of the RNA polymerase II mediator
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70105"
FT                   /db_xref="GOA:C4R3P4"
FT                   /db_xref="InterPro:IPR019145"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3P4"
FT                   /protein_id="CAY70105.1"
FT                   /translation="MTSMSAPATTLDQVENELSQLIETLIHLGVQVHDYAGTAESQLGL
FT                   SNNINKVVEHLQKLHNTDLNIPIPVDVVNYIEDGRNPDIYTREFVEVVRKLNQFLRGKQ
FT                   LGFKYAQSTLGQKIVNEFPELKEQVENIKKRTFIETVPMGTNSS"
FT   CDS_pept        308573..308962
FT                   /locus_tag="PAS_chr3_1156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1156"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70107"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3P5"
FT                   /protein_id="CAY70107.1"
FT                   /translation="MMLVKFYYKSKPSKKKQSRLKKIVSFKYSKIPHDQRKLASFMSDI
FT                   QTKQLDDSDDVHPLNISYLLGKESMSSTSSDGESCHVESPDDMDFETKNLFWKNKNVEL
FT                   TAYLSGYKRLYRVLEQRKRVLKGLA"
FT   CDS_pept        complement(311262..312863)
FT                   /locus_tag="PAS_chr3_0154"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70109"
FT                   /db_xref="GOA:C4R3P6"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3P6"
FT                   /protein_id="CAY70109.1"
FT                   /translation="MGLKTADPIPTPAFFRTYIYILSISPTLLGKETRMFLILLSSALT
FT                   YVICWFGYTFLLHSYRDVDPLVLYHQSSVANTRKEGETAVYRSVDTPHGIDLVTGLRIS
FT                   WKYKLRDGNLKDIWKLGINHNSKITFGQEEYSMDSLTKTMQALSNYIESSQFSCIGVDL
FT                   SQYEWFIIILTGLCSLRDFTLHFHEDLIETYTSTEPKVIFTSFAYLDRVLKSDFDTIVL
FT                   VDSPPCPLVIDSRVATFSSLNLINENAEEYEYTFDLKDDTRNLLVQHSQGDAFTYNQRC
FT                   FVSSISALLQSLPTEHEWSTKDRLLTTFTNDITFNLNSLVKIFGALVTGINVRILPPQK
FT                   LISELDNSTILNIPDNLLYQLMPKRNSFLVSRSRWLFSKGVFNKIAELPSFRPLRLIYT
FT                   SILEPPSVSSPFSSSYNYVQAITGARIINERLYEHIVGPIVKTNLFDYRITGGFVDRKH
FT                   TFPRKLGVSANNGELILRDYQDYSADQKEGKLSVRGFNVGIKDIDEFRKDDYWTHTDIV
FT                   GKFGGDGVLYEDIATH"
FT   CDS_pept        315713..316444
FT                   /locus_tag="PAS_chr3_0156"
FT                   /product="Diaminohydroxyphoshoribosylaminopyrimidine
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70110"
FT                   /db_xref="GOA:C4R3P7"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3P7"
FT                   /protein_id="CAY70110.1"
FT                   /translation="MSFVPFLEPFIPHENTLLPELPFVTLTYAQSLDSRIAAKKGERTV
FT                   ISHQETKNMTQYLRSKHDAILVGVKTVLADDPGLNCKLGTPIRPIILDPTFQLLSKIAS
FT                   LKLIKLGLSGEGEPPVFITRKGVVSPDLQANLRSDYGISIVEIADRDVHRGKMSWFAIL
FT                   KILKDAEIHSVMVEGGATIINDLLICRQNSVPLVASLIITVGPVYLGKDGVEVTPARSV
FT                   KLGNVRWWHGIQDAVVAASLE"
FT   CDS_pept        complement(316473..317117)
FT                   /locus_tag="PAS_chr3_0157"
FT                   /product="RNA polymerase subunit ABC27, common to RNA
FT                   polymerases I, II, and III"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70112"
FT                   /db_xref="GOA:C4R3P8"
FT                   /db_xref="InterPro:IPR000783"
FT                   /db_xref="InterPro:IPR005571"
FT                   /db_xref="InterPro:IPR014381"
FT                   /db_xref="InterPro:IPR020608"
FT                   /db_xref="InterPro:IPR020609"
FT                   /db_xref="InterPro:IPR035913"
FT                   /db_xref="InterPro:IPR036710"
FT                   /db_xref="InterPro:IPR039531"
FT                   /db_xref="PDB:5X4Z"
FT                   /db_xref="PDB:5X50"
FT                   /db_xref="PDB:5X51"
FT                   /db_xref="PDB:5XOG"
FT                   /db_xref="PDB:5XON"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3P8"
FT                   /protein_id="CAY70112.1"
FT                   /translation="MEDNNRIISRLWRSFRTVKEMAADRGYFISQEEMDQSLEEFRSKI
FT                   CDSMGNPQRKLMSFLANPTPEALEKYSDLGTLWVEFCDEPSVGIKTMRNFCLRIQEKNF
FT                   STGIFIYQNNITPSANKMIPTVSPAIIETFQESDLVVNITHHELVPKHIRLSDGEKSQL
FT                   LQRYKLKESQLPRIQREDPVARYLGLKRGQVVKIIRRSETSGRYASYRICL"
FT   CDS_pept        complement(317242..320016)
FT                   /locus_tag="PAS_chr3_0158"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70114"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR021772"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3P9"
FT                   /protein_id="CAY70114.1"
FT                   /translation="MTSVSYTLDTSEVTGHKLGVNSLAFSGDRLFSAGRDGMVASWSIN
FT                   KSVSNDAQGDDKYDEFDTNYKTHPQIDNYIAKNVDNETELSKLERSIARGLNFRQSSFN
FT                   GFELDKYSMLHSDWINDISVLDDSTIASCSSDLSVKLWNHKTSQVDTLGHHSDYVKCLD
FT                   FNEENNFLVSGGLDRQLKLWDVDHRKESSHYTGKSDRSSIYSVATSNHMICAGGPENAI
FT                   QMYDHRIATPVLSLMGHRSTVRCLKISPSYILSGSSDTSVKLWCLRTNRILRTLDMHLA
FT                   PVWSLHAPDPDFGVFYSGDKSGLLFKTDLRSCNYDDYLDESNNDNFILQNKINENLGVA
FT                   TLIADLSKSSKSENSVLSIVSNGSNVFTSTTTIQNSTEKSLKNTCIQAWKIPITNKIII
FT                   HQAIRLRKNILLLNSFRPGNLEDGDESRDVYDLVSMLSHETSNYDLAQIDDALSISHIS
FT                   PEATPIEDVIGLKSTPFASFQGGSSGEFAYADINTGQLTINIDPIDPDQFELLPMNDKP
FT                   SFSCSGNPGLIRYQLLNNRRQVATMDDSLNTQLWDLLNFKKVDECMLYDTKDVELEGSD
FT                   EESYRFESYAEKFQTNETLPIWCKVQVRAGKLFITLEENTLTNTEIYMDDLFELYPELG
FT                   KYYSTHHNSESHDYTALRFNIGKLVLTSLFQNFVDLEIVKQKTGSVSTSSSGISKKTED
FT                   PSDSTSKKFRLFGRTKSSNNTGASSIISTEDLVESIFDPNQPFKFNNFEVPRISSTKNV
FT                   QLIVNQQFQDLRNVTIEVYETNLSILKTLDQGSIDQVLKDLETHLPKWIINALFYNKYM
FT                   EKPLNKVNFVLLDGTPKDSPHKLPPLENNSLKLSAYNMLRMRKVLCYIVEKFSEKPPEA
FT                   SIYPDPSSWLTVHCQGQKLDLNMTLATVKARIWKNSGDIELNYTRTVPPSGGD"
FT   CDS_pept        complement(320149..320928)
FT                   /locus_tag="PAS_chr3_0159"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70115"
FT                   /db_xref="InterPro:IPR009730"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3Q0"
FT                   /protein_id="CAY70115.1"
FT                   /translation="MKRYYTGKKVDDIDSDSSEEGTDSDLQEEPPLTVEGSLREVPKDN
FT                   ILSLHSDLDERTQERNTDKKTINSTEHKNDDVLKMESNHDYESVQKTEDQTPPSSNAEY
FT                   LTSTAKETTLKVNDFSEQVPNASLVESSEESLDESVEESSEDSSDSSSTGQVLKPVFVK
FT                   RSKNVKPDSELDPDKEKNIILNNLQHYADKARETRIIPTQKDYLIIDDTDDIDPEKEKL
FT                   DWKIRELHRLKRDRDILVAKDQEYEEMQARRSLQDLT"
FT   CDS_pept        321045..321926
FT                   /locus_tag="PAS_chr3_0160"
FT                   /product="Nucleolar protein, constituent of 66S
FT                   pre-ribosomal particles"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70117"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="InterPro:IPR026532"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3Q1"
FT                   /protein_id="CAY70117.1"
FT                   /translation="MSAIYKALNKRSESKHTAKRVNRQRVLLMTSRGVTYRHRHLVQDL
FT                   FSLLPHAKKEPKLDHKKRLYELNEIAELYNCNNVMYFEAKKHQDLYLWISKPPNGPSLK
FT                   FHVQNMHTLDELNFTGNCLKGSRPILSFDKAFDDGEAQFQLMKELFIHVFGVPPLARKS
FT                   KPFIDHVMSFSIVDGKVWIRNFQIAETEELKENEEAATIDDSILKDLTLVEIGPRVVLT
FT                   LITVLEGSFGGPKIYENKEYVSPNVVRAQQKQLEAEAAANRSKATLDRKIKIRDQVLEA
FT                   DPLDNEVLFKNG"
FT   CDS_pept        complement(join(322043..322198,322267..322314))
FT                   /locus_tag="PAS_chr3_0161"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70118"
FT                   /db_xref="GOA:C4R3Q2"
FT                   /db_xref="InterPro:IPR021278"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3Q2"
FT                   /protein_id="CAY70118.1"
FT                   /translation="MGAAYTILGKTFQPHQLALATIGLVTLLAIPKPGGAKKETTPQIN
FT                   ASSPEEEAFIKEYLAKHDQKHD"
FT   CDS_pept        322564..324486
FT                   /locus_tag="PAS_chr3_0162"
FT                   /product="Component of a membrane-bound complex containing
FT                   the Tor2p kinase and other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70120"
FT                   /db_xref="GOA:C4R3Q3"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR031313"
FT                   /db_xref="InterPro:IPR031567"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3Q3"
FT                   /protein_id="CAY70120.1"
FT                   /translation="MAFPLSHRDAVFYMRRSILAISSVQTSGYDSVLQPLLSDNGNGND
FT                   LSVSPPIEVNHSEFSPETSPHNEADSPSTITKEPNGSIGTLKSESTSQNNTSSDEIPDK
FT                   INTETDKGIETNNSDLEIDSSVDFFSSDDEDSFDEEYSDFPSSIDPELRSVPLTSETTA
FT                   GTKNLSFAKRRNSNDSFKSRYTHNRSRSKTLGSLIGASSFNTGLTTVSEQLKTSKSFNN
FT                   LLNANRSDSSIGLEESALTRKTREKYHKPILTSRLTLMMKESPLENYKFVGTGDHMVNL
FT                   EVYVPSSSRYCDSPLELRINPAFTVVDTIGYILLTLSKLQELKSQSDENPNYWRLHDPD
FT                   IPSFTLDRTRKVSSYELDEVTLAKVDEKGFQENERITPMAFVFDPVSTEGAPTTDAVPP
FT                   PKESSFFLGEDIDDLVLNKTKIRGGMGNISHGSQDSVELAPFSLPNHNLLHDQNVPKEI
FT                   TDLSAYEGKERKPPVTKKVASKAKKPALLHTSKQNPFSHFGSLSLHKSNIASSFRMGPK
FT                   PKRSTILPISGAGSPLWATENFQKWTVYRKKQPMFISRHERSLVIDGDFIYILPFSDDK
FT                   GGISDGKTTSFLISRIIKCKQSRKYPNNFKIIIQKNSKFKRYDLEALNSKQCREIVSKI
FT                   NFLIT"
FT   CDS_pept        337216..337944
FT                   /locus_tag="PAS_chr3_0164"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70121"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3Q4"
FT                   /protein_id="CAY70121.1"
FT                   /translation="MWATCPGRIQLERGEAEELDLEEMRKTATWGRETRQKLIRYSFQK
FT                   SSKLSILKPNIKMDLTYSAWKERVRTRNYILSKPDQEKPSTFTRLYRKVVRNWKKSTMD
FT                   ETQTPKGQSSPMNCTIFSSSLNQKYMSSDYEYSIPRRGSLRDSEESSLASIVSPGSGII
FT                   PLKKDHSFRRQKSQLSRYSYKPADFGAIFDNLPESTDNDSQTFIASPLSDSSPNQDLWN
FT                   HLPIRPFRAIDDGLEVEESD"
FT   CDS_pept        338088..339311
FT                   /locus_tag="PAS_chr3_0165"
FT                   /product="Cytoplasmic tryptophanyl-tRNA synthetase,
FT                   aminoacylates tryptophanyl-tRNA"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70123"
FT                   /db_xref="GOA:C4R3Q5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3Q5"
FT                   /protein_id="CAY70123.1"
FT                   /translation="MSQKELETATEQLHIKEESQVVTPWEVEGAIVDGKAQSIDYDKLI
FT                   KDFGTRHITQETLDRFTKLTGHKPHHFITKGVFFSERDFGKILDLYEKKQPFFLYTGRG
FT                   PSSDSMHLGHMVPFIFTKWLQDVFDVPLVIQLTDDEKFLFKPKLTIEDVKQFSKDNAKD
FT                   IIAVGFDPKKTFIFSNLEYISGGFYENVVRISRQITTSTAKSVFGFGDSDCVGKMHFAS
FT                   IQIAPSFPSSFPDVLDLPPTAPALIPCAIDQDPYFRVSRDVAEKLKFSKPALLHSKFFP
FT                   ALQGASSKMSASDTNTAIFMTDTPAQIKKKINKYAFSGGQTTVEEHRELGGDPDVDVSY
FT                   QYMKVFKDDDEFLRQTYDAYKSGDLLTGEMKQACIQVLQEFVKNFQDRRAAIDEDTLNA
FT                   FMKPHRIS"
FT   CDS_pept        complement(339375..341348)
FT                   /locus_tag="PAS_chr3_0166"
FT                   /product="Arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70124"
FT                   /db_xref="GOA:C4R3Q6"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3Q6"
FT                   /protein_id="CAY70124.1"
FT                   /translation="MLIAHKINLRTFFHFMLIKLPYCHLIKRAFATKVVTPRIAPEYRP
FT                   TMLGSVESLTNNLNTLSLKLPEVNIQGSFPESNPVDLLRNYITQELSKISGVDKELIFP
FT                   ALEWGTTLEKGDLLIPVPRLRIKGANPKDLAEQWAAAFPKGGYLKDVIAQGPFLQFFFN
FT                   TSVLYKLVISDALERGDDFGALPLGKGQKVIVEFSSPNIAKPFHAGHLRSTIIGGFISN
FT                   LYEKLGHEVMRMNYLGDWGKQFGVLAVGFERYGDEAKLKTDPINHLFEVYVKINQDIKA
FT                   QSESTEEIAEGQSLDDQARAFFKKMENGDESAVSLWKRFRELSIEKYIDTYARLNIKYD
FT                   LYSGESQVPQEIMDEATKIFEEKGLLSEDQGAKLIDLTKFNKKLGKAIVQKKDGTSLYL
FT                   TRDVGAAIDRYRKYKFDKMIYVIASQQDLHTAQFFEILKRMDFEWAKNLTHINFGMVLG
FT                   MSSRKGTVVFLDTILEETKEKMHDVMRKNDSKYQQIANPEEVADLVGISAVMIQDMQSK
FT                   RINNYEFKWERMTSFEGDTGPYLQYAHSRLASITRNADIDLAELPGADFGLLVEPQAEY
FT                   LVRLLAQYPDVLRTSLKNHEPSTLVTYLFKLTHQVSSCYDVLWVAGQEKPLATARLALY
FT                   ASARQVLYNGMLLLGLTPVERM"
FT   CDS_pept        complement(join(341523..343162,343255..343303))
FT                   /locus_tag="PAS_chr3_1157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1157"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70126"
FT                   /db_xref="GOA:C4R3Q7"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR033121"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3Q7"
FT                   /protein_id="CAY70126.1"
FT                   /translation="MIINHLVLTALSIALANDYESLDLRHIGVLYTAEIQIGSDETEIE
FT                   VIVDTGSADLWVIDSDAAVCELSYDEIEANSFSSASAKFMDKIAPPSQELLDGLSEFGF
FT                   ALDGEISQYLADKSGRVSKREENQQDFNINRDEPVCEQFGSFDSSSSDTFQSNNSAFGI
FT                   AYLDGTTANGTWVRDTVRIGDFAISQQSFALVNITDNYMGILGLGPATQQTTNSNPIAA
FT                   NRFTYDGVVDSLRSQGFINSASFSVYLSPDEDNEHDEFSDGEILFGAIDRAKIDGPFRL
FT                   FPYVNPYKPVYPDQYTSYVTVSTIAVSSSDETLIIERRPRLALIDTGATFSYLPTYPLI
FT                   RLAFSIHGGFEYVSQLGLFVIRTSSLSVARNKVIEFKFGEDVVIQSPVSDHLLDVSGLF
FT                   TDGQQYSALTVRESLDGLSILGDTFIKSAYLFFDNENSQLGIGQINVTDDEDIEVVGDF
FT                   TIERDPAYSSTWSSDLPHETPTRALSTASGGGLGTGINTATSRASSRSTSGSTSRTSST
FT                   SGSASGTSSGASSATQNDETSTDLGAPAASLSATPCLFAILLLML"
FT   CDS_pept        complement(join(344017..344594,344651..344693))
FT                   /locus_tag="PAS_chr3_0167"
FT                   /product="3,4-dihydroxy-2-butanone-4-phosphate synthase
FT                   (DHBP synthase), required for riboflavin biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70128"
FT                   /db_xref="GOA:C4R3Q8"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3Q8"
FT                   /protein_id="CAY70128.1"
FT                   /translation="MSVFTPIEDALKAYKNGEFLIVMDDEDRENEGDLIVAAELITTQK
FT                   MAFLVRYSSGYVCVPLSTKRAAELELPPMIKNRTDRQGTAYTHTVDARDGTTTGISASD
FT                   RALTCQVLANPRSKPEELMRPGHICPLIAREGLLKERRGHTEAAVQLCELTGLQPAGVI
FT                   GELVRDEDGSMMRLDDCVQFGLRHNVKIINLDQIIEYMDSKNS"
FT   CDS_pept        345343..345981
FT                   /locus_tag="PAS_chr3_0168"
FT                   /product="Cytoplasmic and vacuolar membrane protein
FT                   involved in late endosome to vacuole transport"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70130"
FT                   /db_xref="GOA:C4R3Q9"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3Q9"
FT                   /protein_id="CAY70130.1"
FT                   /translation="MNRLFGGRSNEPKPNLNDAINSIEERVSSIDVKLTKVNTELSTYQ
FT                   QKLSRMRDGPAKNAVKQKAMKLLKQRKQLEAQKDQLESQSWNMSQASMTTDNLKNTMIT
FT                   VSAMKSANKELKKTYGKIDIDKIESLQDEMLDLIDKSNELQDSLAQSYDVPDDISESEL
FT                   DAELDALGEEMDFDAELGESNGLPSYLQNNDELPTFVDDEQEKKEEVAA"
FT   CDS_pept        complement(346003..346947)
FT                   /locus_tag="PAS_chr3_0169"
FT                   /product="O-methyltransferase, catalyzes two different
FT                   O-methylation steps in ubiquinone (Coenzyme Q) biosynth"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70131"
FT                   /db_xref="GOA:C4R3R0"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3R0"
FT                   /protein_id="CAY70131.1"
FT                   /translation="MHHLRRQFSHVGRLLQQSKLTATSEIEMSHFNQLASTWWDVNGPQ
FT                   RILHKMNLLRMDFINDTIKSHLKLNKGVTDPEEQIYIPPFNVDNVLPKEIADRINGEQE
FT                   IRRQQLWQQLKLDALDIGCGGGILSESLARLPVVNRVKGIDLSTEVLEVARQHKKLDPM
FT                   VREKLTYELKAVEDLDPNTEQYDVVTMFEMLEHVNYPAEVLKAALRHVKPGGWIFISTI
FT                   NRDLISWFTTIFMGEHILKIVPLGTHTYDKYINEKELEKWVEDGHENSDLGDLRKQFEV
FT                   AGSKGCVYLPCYGWKFTDNVEVGNYFMALKRRD"
FT   CDS_pept        complement(347027..349222)
FT                   /locus_tag="PAS_chr3_1158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1158"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70133"
FT                   /db_xref="GOA:C4R3R1"
FT                   /db_xref="InterPro:IPR008895"
FT                   /db_xref="InterPro:IPR013272"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3R1"
FT                   /protein_id="CAY70133.1"
FT                   /translation="MSSSSESEEELGIIATRERRANAGSRLKQLLQQEELDIGSQDFEQ
FT                   DDDDENVNLLFQEDENDDEFVEENEEEEEGEEDEEEDDEEDKENTPSNKAVSEEPNDEM
FT                   FSSESEISASDSDESEGEREFRREEKLKRKKRAEKAKFIPPVINKSTPKKTKPKTKVTA
FT                   HSFLNASSRASTRKSAVENKLAIVERLKEEEERRSKLKPVIRKEVVALTQKERLAEAKT
FT                   TERTNVLSLNKFHEQEQERKEKQKQMMLNRRKKLENVLRFYSASALVYPIDELKDLEKV
FT                   KKIEAEFMKSHKKRVYKKRKKKTEANKDESTETPKGEVKVEASENTKDGKKDDHAPIKT
FT                   NELDTKETDNQGENLPIRDDNKQDETTLSTVDNSPDINKAPTEIDIVEDRDVVMKDATD
FT                   SAEVVESTSSPLLSSKEKIDNENVQSKESSEPTVDIKTEAESSIEPSQKTKKVSFNEES
FT                   SQLEFSTESPVASLINNNVKETEIKKDVNQTFVKPESETEIETETEPRTQSNDKQEEEE
FT                   EEEEEEEKTDSKEEEVQYEGPPQFVARNTIELLEFSKKLTKLEYTKYILGDQAVLPAQR
FT                   RTSHLKPLIRIKQLPTMIETLFIPYSSTHEKEFHEILTLPKFGEENKTVHKQLLVKESD
FT                   TKKIEIITPAPIGIYLPNGSKKICPISGKPASYFDPKNGVPYASVEAYKVLKDVQDEQF
FT                   AWIQPDKGGEYSRYKGGIGAYLQRWDVRHAKNVPDWF"
FT   CDS_pept        complement(join(349336..349759,349813..349838))
FT                   /locus_tag="PAS_chr3_0170"
FT                   /product="Co-chaperone that binds to Hsp82p and activates
FT                   its ATPase activity"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70135"
FT                   /db_xref="GOA:C4R3R2"
FT                   /db_xref="InterPro:IPR015310"
FT                   /db_xref="InterPro:IPR036338"
FT                   /db_xref="InterPro:IPR039981"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3R2"
FT                   /protein_id="CAY70135.1"
FT                   /translation="MVVHNPNNWHWVDKNCLPWAKSYFQEVLPNTTQKNDAYEIVVTSV
FT                   DLVDGDCDVTQRKGVTKCIFDLKIQVSATVKVNTNSEVEEISYTVTLPELVHDQDEDEY
FT                   EYVIEGNLDHKSQIRKLLTPLLTEKLSKFQQALIDAHTQDVQHST"
FT   CDS_pept        350370..350960
FT                   /locus_tag="PAS_chr3_0171"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70136"
FT                   /db_xref="GOA:C4R3R3"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3R3"
FT                   /protein_id="CAY70136.1"
FT                   /translation="MEKQDHQLPITKGSYTNYPKSKNTSIYYAIFLEILILYGIVTNYQ
FT                   QLYEHSEYLAGVCLGSFSTLFSQSISQLYRQSFSFDKHFKFFLWGCINSLISNFWIGIL
FT                   LHSLDNNIHRFLLDQTVGVLTGQLIFVFFNAFWESSLNYASLKSTYLTCLRYSYMIWPL
FT                   VSFLSFFHLHEDYIFPLNCFVTLIWNIILAMIS"
FT   CDS_pept        351277..352755
FT                   /locus_tag="PAS_chr3_0172"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70138"
FT                   /db_xref="GOA:C4R3R4"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR024002"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3R4"
FT                   /protein_id="CAY70138.1"
FT                   /translation="MADDNYFSTPHEAALALVATAMKKARLRPEMLVISSIIAGMLFTV
FT                   GGMLHLLTQAHLQGFMSEYMGIINLLQGSVYPIGLFYVVVLGTELFNSNVLFFTVALIR
FT                   GSVSIVDLIVNWVVSFVFNFASTLFVCEVICHLSGITSTETMRLGSIQIIEEKASCGFV
FT                   KTLLRGIPGNFFVCLAIYLQLMVKPLHVKFLMIFLPIFTFVTMGFTHVVADFYLCLTGI
FT                   INGSSVSIGEYIWKIMIPATIGNIIGGVFFAIAIPWYLHLYVVEQDRERLDLPDYVEKD
FT                   EQPYLSMDSRVVRVPETRDSIGSTGLTRFKTTNSVRSTPKGVFPVVDMDCEGDDDIDQV
FT                   LDADQFKPSYNLKRMMTKRKNSNTDVESKAGSFKLDKFASRGTVSERELGLFRRFAPSR
FT                   KNSHKSASSEFEILQQKVSQAGITPAAAGASDEIAGTDSNAIKMMARSHRMNSNYSQQS
FT                   RMSSSYHIDQLKEDEEPMSSNETDSTESNIRTRI"
FT   CDS_pept        353048..356629
FT                   /locus_tag="PAS_chr3_0173"
FT                   /product="Protein required for establishment and
FT                   maintenance of sister chromatid condensation and cohesion"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70140"
FT                   /db_xref="GOA:C4R3R5"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR039776"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3R5"
FT                   /protein_id="CAY70140.1"
FT                   /translation="MAKKVVFELESPIISSISEPITTKELVDRLRNVCDQLSALDQDLV
FT                   DLDSLAEIKKDLVNQKLIKHNNQGVQAYVSCCLAEILRLYAPDAPYTATQLTNIFRLFI
FT                   SQFKKLLDEESPYYLNLYNLLKRVVEVKSIALMTDLPAAEKLTDELFKGIYDICKHSAF
FT                   PEKVDTLISDLLSEVISESDSISLPVLKLILNKFMANKTVSDSQHKNIRVPGFSITLNI
FT                   CKTNTDRLSRQVTQYFSEVIYEVTANENGTNQVSLDPDTLDQLRKLHGLCIEIWKYVPD
FT                   LLLSVMGVLDNELDADSEQIRELATLTIGKIASVQPSDVNFVKVHQDSWNNWRKKILDI
FT                   SSRVRASWVSATFNIIENRTDINDDIVTGITKALLDTDLHVRLNTVKVFNKLQPETFVS
FT                   KLLSRSIMDVLIHLLREKNYEIRKESISFVSNLYNRTFIDLYAADKKLDDTIGTIPSAI
FT                   LNLVYINSTEINQHLDLALFEKILPFDNIDENRARRCLTVLKHLDTKARSAFVAILKRQ
FT                   RQLSDVLTQFVGLCEAYNGGNPADKENKETLIKKIDKVSNWISLSIPPDIRPISCLNRF
FT                   VAENSKRYYKLIKIAISTESNYDTVRNALKELFNHLSSPSKEKTSMDSAQVTPEQMVST
FT                   FKLLLYRTAVIISNQSNMHSLFEIANQNGELANTAQELIETISETSPAVFKSQIHQFTN
FT                   ILRSICSAKSYHKATEERSLVKTLKTIYHYAKQYPQEMNMDESLTIALQFICEKGTPTE
FT                   SRFAVKILGLQGEKSILKRILATIYPLDDTSEHLASHLCVISEMFLLDDSLLESVESDL
FT                   TSTLIKDYLLKNKIKQKEDHSEFVSDDELETKEFTSCAIKIYSLKVIVNRLRASHDAEN
FT                   SKELAEPVLKLLFFIIGNSGEIVNEKDSSYPSPQHFKTRLRLMAGLSFLKLAKYPTYSK
FT                   MMKPSLVYRLIFLVQDENETIREAFLNELQKYLAENHISDKFLPLVFFTAYEPLDGLKA
FT                   KTLTWMRSTYKRFSSDKSKPLIFEKSLVRLIHMIAHFPEFVDSLKILPKEPEKASLVPT
FT                   LISASEYIIEFLEVVATEKNISLLYYLATQVKKYQDGLFSAADYDLDENPVIYNLYRVS
FT                   ELAQVCIKLLSLSKSWNVQTWPGKVQLPGDIFSSMKSIKEAQDIVSISFLPDQVVVEVE
FT                   NAVRARIARTNSRKDGLRRNKRIKTAA"
FT   CDS_pept        complement(join(356732..358395,358607..358691))
FT                   /locus_tag="PAS_chr3_0174"
FT                   /product="Essential subunit of the histone deacetylase
FT                   Rpd3S complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70142"
FT                   /db_xref="GOA:C4R3R6"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3R6"
FT                   /protein_id="CAY70142.1"
FT                   /translation="MSDTIRRKRLRNQKPANGSTAATTEMSHGRPAGPGSLKLFATTQQ
FT                   EESQQLATEADYKLKLVTNESESLTKPSLERTRNLRPTPKSGAPNYQIKLKLTGPRSPK
FT                   STNRTIQPPRTPSKKSAASPRDGRHVQKIKKSPRKQRAKAFPPAQFGAILPSASASPSS
FT                   SSSLSALNSTNPLSGNTDSEPNLNSISVAAPNGSSTSPEPDNDDFCSGCGGPGTFICCE
FT                   GCPRSFHFICCDPPLHEEDLSDDAWFCTECKAQRHPPPKHRGGFFAALLDQAVVRNPRS
FT                   FLLPKKIRETFVDVATTRLGSYSDGSSKVDQFSRASDKGNNASSQASQDVKFCYRCKES
FT                   DLRKPIIACEYCPLVWHLDCLDPPLAAPKLLGVRWKCPNHTDDLYNHRRRLKNQPQIEV
FT                   AMVRGFKNNGDVEIINDQNENDQDFVQLPTPPYFDNISTTEGIASLQKPAFKIVQIDNI
FT                   TYRIPENGVILDFIETAKIKKLNEIEQLKKENESILTRVDKSKREVLGGLIALKQSPIE
FT                   QKLSNSANLSNEVDFRQLVEIAEAQLGCDQHITVPPLETETRDLVYIKQLIQLKGRDAM
FT                   IKFLES"
FT   CDS_pept        complement(358902..360005)
FT                   /locus_tag="PAS_chr3_0175"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70144"
FT                   /db_xref="GOA:C4R3R7"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3R7"
FT                   /protein_id="CAY70144.1"
FT                   /translation="MSKTKVDYSFNNPDVVTQYSTAGSIAAQVLKEVKAKCVEGAKTFD
FT                   ICVFGDNRLKEELEKVYEEEKQGKKTTSKGIAFPTSITPNNLVAYLSPTAPEDEANLEL
FT                   KKGDLIKVSLGAEIGGFPSIISETLVIGEDEVTGRKADVIAAAYYALQSAIRTIRPGKR
FT                   NMEVTKVVDDVAKAFDCVPVESMLSHNQERNILTGEKEIIINPTPEHRKQIGTFEFNEG
FT                   EVYGLDILISSSKTGKVKKSSYLTSIFKYTGTSYRLKLKTSQSSLNQVKKLSPYFPVSL
FT                   RSFADSKRGRMGLHECVSHQVVVPYDVVQEKEDELVAQFYATIGVGKDATVQLTPFSFD
FT                   ISTIKSEHSVSDESLLNLLAQPLVEQE"
FT   CDS_pept        360326..361612
FT                   /locus_tag="PAS_chr3_0176"
FT                   /product="Mitochondrial ornithine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70146"
FT                   /db_xref="GOA:C4R3R8"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4R3R8"
FT                   /protein_id="CAY70146.1"
FT                   /translation="MNNLKLARFFATISKESKYVPNSGSYPLGYKVGAIHCGVKKNSTL
FT                   DLAVLVSETPASAAAVFTTNKFKAAPVQVSRQILNDKNGKGISSIVVNSGNANAVTGKG
FT                   GIEDALKMVDTVDSTLKNAPSSTLVMSTGVIGQRLPIDNILKGIPVALKDVGSSHEDWL
FT                   RCAQGIMTTDTFPKLVSKSFEIDGRKYSLAGLAKGAGMICPNMATLLGFFVTDAPVTPG
FT                   ALSKILTYATDRSFNCISVDGDMSTNDTICAMANGAAGGEEISETSSQFSKIQDEITLF
FT                   AQQLAQLVVRDGEGATKFITINVQDAQSYADAKKVASSIANSALFKTAMYGKDANWGRI
FT                   LCAVGYADADVNVLKTNVSFIPADGSAELKLLVNGEPEKVDEERASEILELEDLEIRIS
FT                   LGTGGGQEANFWTCDLSHEYVTINGDYRS"
FT   CDS_pept        361763..363502
FT                   /locus_tag="PAS_chr3_1159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1159"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70148"
FT                   /db_xref="GOA:C4R3R9"
FT                   /db_xref="InterPro:IPR006939"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3R9"
FT                   /protein_id="CAY70148.1"
FT                   /translation="MSNAAPNMQILQQLATLPPQQQQQILRQNPQLAMFLRQVQQRQQQ
FT                   FINKQGQAPPGMGVGAGIQAAQGMQGQGGPMMPEQIPVGAAGHPGSLAHGVPGVSPAIS
FT                   TPPVGSSFRPKLPGGSAPLQPELPRLSSLRYWSEKLEKEGKPVDTNTLLYEQIITRDKA
FT                   NIEARAQNEQEKKVLESLIKDLKFYNELKSYRMKSIQAVNNGMVEGPPSIWGEGYQGYG
FT                   HGFTGKTTTQFVYPQKRKKYSRIPESYIPDELMEQQAESIDEWVPIRMDFDIERDNFKL
FT                   NDTFLWNLNEKVVTLERFVAVLMEDYKFKNPLFLDTILANMKEQINEYRTATNTRPQDL
FT                   RVDIKLDIAMGNNQLIDQFEWDISDPNNDPEEFATVLCAELAVPGEFVTAVAHSIREQV
FT                   QIFIKALHLINYPFDGSVIEQEQVRRLVKPHILPNESILRSRTQFQDYSPNLLEISIEE
FT                   LQRLDKDKERESRRKRRGMGRVGRRNGLVLPELSDAPKTIRTPIASTVLPYGIEVGPSV
FT                   DSFVDIVESIEDPKDPKVVERVREPSAINSSTGTPNIGGNNGVVSVQHDYGNSLYVTIK
FT                   LRR"
FT   CDS_pept        363792..364988
FT                   /locus_tag="PAS_chr3_1160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1160"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70149"
FT                   /db_xref="GOA:C4R3S0"
FT                   /db_xref="InterPro:IPR019325"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3S0"
FT                   /protein_id="CAY70149.1"
FT                   /translation="MQTGTASFTNMSNEPQKVSKNQPTSHWSVSACHIYSSESIHDRLD
FT                   PSFETFPSSINSNSVAKDPLVSQSVHLLSSFEGDNSIKDSVHEHELDQMEPEGDSREIE
FT                   TAQDSGDALTNASFFMNMDNGVQQGTSSDAVDNGDIANEAQGSKGKTIFKQFRDKLKSL
FT                   PIFNQGRHFRYTRVEGEHPNVRGAENDGVFANITATSESGDPLGRGEEELPSYDEAAAD
FT                   SAPTYWESTVVTPGYEDEVFVEGLPVGNLLNFFWNLMVSVIFQYLGFVLTYLLHTSHAA
FT                   KEGSCAGLGITIITLGFDLLPFSIFHRNNGQASRFEPAAPNDYDVDTSETLDGYTDGFT
FT                   SALDSGAKVEQEPTRSPIAAYALIALGMFLFLRAIAGYFRAKRMERLILNPVTNPSPV"
FT   CDS_pept        complement(365003..365884)
FT                   /locus_tag="PAS_chr3_0177"
FT                   /product="Mitochondrial inner membrane citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70151"
FT                   /db_xref="GOA:C4R3S1"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="InterPro:IPR040062"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3S1"
FT                   /protein_id="CAY70151.1"
FT                   /translation="MPEKRKVDPFHSFIAGGTAGAVEGVVTYPFEFAKTRLQLVDKSAN
FT                   MSRNPLKLIATIARTQGVGALYTGCPAFVVGNTAKASVRFLGFDAIKKMLADKDGKLSG
FT                   PRGVLAGLGAGLLESVVAVTPAEAIKTAMIDDKQSAKPKYQGGIISGTVKLVKDLGFKG
FT                   IYAGVLPVSLRQAANSAVRLGSYNAIKTFLQQASSTDPGAPLSSSLTFAVGSFAGVVTV
FT                   YATMPIDTVKTRMQALGADKMYSSTLNCFVKIFKEEGLLTFWKGATPRLGRLVLSGGIV
FT                   FTIYEKVLLLLN"
FT   CDS_pept        complement(366120..367298)
FT                   /locus_tag="PAS_chr3_0178"
FT                   /product="TFIIE large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70153"
FT                   /db_xref="GOA:C4R3S2"
FT                   /db_xref="InterPro:IPR002853"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017919"
FT                   /db_xref="InterPro:IPR024550"
FT                   /db_xref="InterPro:IPR039997"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3S2"
FT                   /protein_id="CAY70153.1"
FT                   /translation="MDYELATSLIRFVVRGFYTKHYVLVVEALLMHWVLSEDDLIYLLG
FT                   MQRKGLRALCNRLVEDRLISAQHQKEENLHQRMTTRTYYYIRFVDAIDAIKWKMHSVVK
FT                   SLKDQMAHDSDPQGYVCPRCRKRYSQLDALSMVSDNKLNFVCDICNGVLIEDDSGIQAK
FT                   RRQEKLTQLMGELDPIIGYLKRIDEGHVVDNTFETSLTRAVPAQSSTVSAAESGSYALR
FT                   AGQESKRELSQSLKNATARSQAVLHVDITTSDENQTREEKVKAEKQEKLKQNALPSWHS
FT                   ESTVGKGTLGKLGTQDIASEILEKEVSADDHVVEGKDQVQEIPKVETTGTNLEDIEAQD
FT                   ALAAYYAQLAEKQAKEDADDDAEDGDEDEDFDIDDDEFEDILETGNNDEQDQ"
FT   CDS_pept        367451..368983
FT                   /locus_tag="PAS_chr3_0179"
FT                   /product="Glucosidase II beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70155"
FT                   /db_xref="GOA:C4R3S3"
FT                   /db_xref="InterPro:IPR002172"
FT                   /db_xref="InterPro:IPR009011"
FT                   /db_xref="InterPro:IPR026874"
FT                   /db_xref="InterPro:IPR028146"
FT                   /db_xref="InterPro:IPR036607"
FT                   /db_xref="InterPro:IPR039794"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3S3"
FT                   /protein_id="CAY70155.1"
FT                   /translation="MLRLLTIGSIAVSLFPASAEIPPLRGVAPDLLEKYVPDKDGNWKC
FT                   LGHPEIVLHFDQVNDDYCDCPDGSDEPGTAACENGKFYCANEGFEPNFIPTFLVDDGVC
FT                   DYKVCCDGSDEKSGKCPNRCLELAEKAELLRLERKARLENGLKAKRDLIVQSQNKLREI
FT                   SQRRAELEKTIQLEQQQLNYLNEQDPNDSALRKEVDPQLEKVVQILKVQKDEILLLKTK
FT                   ADSLERLLKELEKNYNPNFNDAAVKAAVQGFRDYSSNSNDDSYSDLDSVEPENIVKDIQ
FT                   KTINTFAFDTSNDSKYESIWSFWKEVLADKIVKIYQEFTAVPLKTASKPLKPISGTAQE
FT                   IQKSIDSHNKEIVKIDSDLENSESRYGLEDIFRAYDGRCFVEKIGDYDYEYCFTGSLTQ
FT                   ISSNGQRVSIGTRDKIEVLEDEQSVGGYSYRVYYEKGAKCWNGPVRKAIAVVQCGDVEQ
FT                   LVSVSEPEKCEYHLVVRSPVGCFSEDNVYLVKEIAEGESHAPFKVIPFKDEL"
FT   CDS_pept        369087..370631
FT                   /locus_tag="PAS_chr3_0180"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70156"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3S4"
FT                   /protein_id="CAY70156.1"
FT                   /translation="MEQLIPFILFAVISQWFDDSHYSAYAAVNYPPEIWTQILNQLNQK
FT                   DVIALMLTNRITCSLSATRLYRRVYITAENSQMPSTSYDEWNYTVTTATRFLKMLRTSH
FT                   GSKLAVETVYVGCKLNSVILFELASHLPHAALVCMDMAYVILPHHSWGSSFWIIGNAIT
FT                   NNIAQLRLEELAVDDSIPFYGLQRGRALHLPSLKKLSVKATHWSKTLPLVTDLFSAMHP
FT                   FQLESLEVGDPLVFCEVCSSLGTSEQFRLKSLTLDFGSSSDIPPDYDYTRLLEIMKNSI
FT                   QEVNELRLRFWTFQETDGISEFLRKIAVLLGPNLQSLGIFFLGETPRSIEDQDSIQLVT
FT                   TKLYPSYLPDIVGFFAAIQHLRLEEITLSVSHQIGLDELTANVSNSRFSILSAALLLSV
FT                   VRLNVFGNLCGPFFNGWVRRYDIGHGRIFRIAPRHNVLGGALPPIQDDHIQSLPDLEMA
FT                   QLVSQRQFICAARGQVSVPFTTANKNAPLLRERYRLLIEDHAGPLPADIHINGLPV"
FT   CDS_pept        371224..373119
FT                   /locus_tag="PAS_chr3_0181"
FT                   /product="Mitochondrial malic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70158"
FT                   /db_xref="GOA:C4R3S5"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3S5"
FT                   /protein_id="CAY70158.1"
FT                   /translation="MSSLYMPSKSMKRLTVSCRRFISSAQPKIVTHKILTPVGTEAAAK
FT                   VDVPKTTRLSVEGPIECHLQGFELLNSPLFNKGSAFTPEERAAFGLEGLLPPVANDLNE
FT                   QAERAYKQLSFLKTPLAKNDFCTSMRQQNKVLFYELVRRHIRELLPIIYTPTEGDAIAA
FT                   YSHRFRKPEGCFLDVTDPESIEDRLSRFGESKDVDYIVVSDGEGILGIGDQGIGGVRIA
FT                   ISKLALMTLCGGIHPGRVIPVVVDAGTNNKALLDDELYMGSRFPRVRGEEYYSFFDKFI
FT                   EVVKRRFPSAVLHFEDFGVTNAKPLLDKYRSVLPCFNDDIQGTGAVVMASMAAALKLTN
FT                   RDLLDSTIVIYGAGSAGLGIAFQIVNHMVNHGATKEEAYSRIHLLDRHGLILTNMSDVS
FT                   NKDQMLFADDPSSWDGINTKSLVDVIEKLKPTTLIGCSTQAGAFTEEVIKTMYKYNPRP
FT                   IVFPLSNPTRLHEAVPVDVMRWTDDNALIATGSPFKPVRGHVISENNNCFSFPGIGLGA
FT                   VLSRATTISDTMISAAVDELASGSPAFKDPKAGLLAPVEVINETSAKVAAALILQSIKE
FT                   GTARVEEELSPNGDKVSVPRDFEGCVAWVKSQMWRPEYRPMVKVERVPEIHTHQS"
FT   CDS_pept        complement(373171..374793)
FT                   /locus_tag="PAS_chr3_0182"
FT                   /product="Dicarboxylic amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70160"
FT                   /db_xref="GOA:C4R3S6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3S6"
FT                   /protein_id="CAY70160.1"
FT                   /translation="MSELKSELDTSTDLKKTLNARNVSIIAMGGGIGVGLMVGTAKALY
FT                   DAGPGAVLISFLAVGMIAFGVIAAIGEMATFIPCDFAGYAHRYCHPALGFATGWTYMLL
FT                   YLFSMPNQIVSTSLVMEFWVSTDQVNSGVWIFVFMVVVWVANLLPVKYFGNFECVLSSV
FT                   KIITIVGLWIVMMVIMSGGAPNRQPSGFRYWHDPGAFRDYHQATVIEGPKGKALSFMSV
FT                   MVNAVFSYVGIEFVCVAIVEAENPRRALPKAIKLTFWRIILIYCFTVFLLGCCVPSNDP
FT                   LMEQAIKSTTSAASSPFVVAMKIAKINGLPHLINGCILLFAVSSATSDFYVAVRTLHGL
FT                   AVKRQAPRIFAQTTKHGVPIYGVLVGCGFSLLAFMTLTSSARTVFNYFVNVVSVFGLLV
FT                   WISLLVAHISFMKAIKKQNFDRNSFLPWRAPFQPLYSYVCILFCIVIVLMNNFGVFLGD
FT                   KFDYKNFITGYIGIPIYLALLGGYKLMNKSKRVSSSECDLFTGKATIDEDEKRLKNKEL
FT                   EQRKGREGTVMLWLEDHLINHFV"
FT   CDS_pept        375658..377061
FT                   /locus_tag="PAS_chr3_0183"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70161"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3S7"
FT                   /protein_id="CAY70161.1"
FT                   /translation="MKKLQLMGLKKKFSKKVPKEPVVYPEIHLVSLPDEILTLIFKNLD
FT                   KKTLCALSQINKRLQAVSQKTLYRAIRVSSTLKLLQLCRTLDRNSVEQKPWLYAIDSLQ
FT                   LDIDIGNSANEFISVSIGKLGYSSSIKSTNYKDLLNTFNLYKNLMTHLLSLNSISLTQV
FT                   SPRLNFPIECSLYYKVNDRIECPKNYTYDDLRRDSIKTVRLESQDGISIPLRSHLLWSF
FT                   GLIKELILRNMNIDEESLVDTRYLVDASSGNWIIDPINQITQPITGFPTIDTIPKHKKS
FT                   YHSPIEKLTLNATTVSSSALHFLRNYFHNVTELCLLNIKNLHDLASITYFPNIKALTID
FT                   LDSKIFWNFLNDFPVQFDSFFSVLCSLHKIQTITFVNVKFFNLSLIPREPVNELDYNSY
FT                   KVSIYRLFTHLGRIENVSFILTTPKRITANTRYPLFMNRDWLSILWPFVDTGCKVSIKY
FT                   DEGSYEFQG"
FT   CDS_pept        complement(join(377187..377362,377467..378769))
FT                   /locus_tag="PAS_chr3_0184"
FT                   /product="1,3-beta-glucanosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70162"
FT                   /db_xref="GOA:C4R3S8"
FT                   /db_xref="InterPro:IPR004886"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3S8"
FT                   /protein_id="CAY70162.1"
FT                   /translation="MLYLVTVLLFLVHVVLGYIHPITIKGKHFYDSLTGELFMVKGVDY
FT                   QPGGASGVSTDKDPLSEIEECARDILLFQELGINTIRVYSVNPDLNHDKCMSLLASAGI
FT                   YLILDVNSPLPNQSINRYEPWSSYNHDYLYHIFKVVEQFSHYNNTLAFFAGNEVVNDKV
FT                   SATHSSNYMKAVVRDLKTYITHHSDRPIPVGYSAADDLSFRIPLAKYLECSNSTAELDS
FT                   VDFYGVNSYQWCGYQNMQTSGYDQLVAHYADYTKPIMFSEYGCNEVTPRIFQEVEAIYS
FT                   SKMSSVFNGGLAYEFAQEPNNYGMVEYLSDGRVKLLKDFETFKNQLAKASETYHIKQMN
FT                   ENVRSAPLKCQGTYENLGDKLVVPQSLGMAFITQGVKGEKGSYVELSDDDFVVKKEIFL
FT                   SDGTKFQKSKIVATHNLNGPDTQQTVPEKSQGSKNGQITNPNPKPKPQTRKIPNKKTKP
FT                   KQNKQEKSKVQKQIAREKKIRAIRQRQQEWNFKV"
FT   CDS_pept        complement(379205..380080)
FT                   /locus_tag="PAS_chr3_0185"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70164"
FT                   /db_xref="GOA:C4R3S9"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3S9"
FT                   /protein_id="CAY70164.1"
FT                   /translation="MSNMTFTLVVLLLSFYHPVGPCLQLLTTSIPPSFLTMVPEHYIGS
FT                   KSVDEVPTSEDPRVNACPYICDIGDCSRGYSRASHLKRHKETFHLKTRVFHCPIEGCGR
FT                   SFNRKDVRDRHYRRHAADISDNSLGSGPHTISIVGIERTDENTNPIEAQSIESLELMSS
FT                   TPLTPKSITYSTQKQYHVVQTPKFILGNLICTGRIFGINGRKGSIPQTTTDQTHHAIRN
FT                   VCDVLREAKASLDEVIRVSVFLVCLEECTAVQSICSQYFPDGAVYDFIHIKFSPGECFR
FT                   VQLQVVGRGE"
FT   CDS_pept        380477..381742
FT                   /locus_tag="PAS_chr3_0186"
FT                   /product="D-serine dehydratase (aka D-serine
FT                   ammonia-lyase)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70166"
FT                   /db_xref="GOA:C4R3T0"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3T0"
FT                   /protein_id="CAY70166.1"
FT                   /translation="MTTPPSSLTQSRNKYALSKQYLGKKVADLPTPSYLVERSRFRGNC
FT                   EKMLWSARRLNAPFRAHIKTHKTLEGTSLQLGINTDSEYKTDRIVISTLPEGWGILPLV
FT                   KQGLINDVHYSLPVVKSRLAELELYSFEVPHLRLMVDDIGQLEMLVRYSKEESKLATKW
FT                   SVFIKIDMGTKRAGLTHDSQELKELLDQLLNSEAKDYVSLYGFYCHAGHSYGSADKAEA
FT                   TNFLLQEIENANNAARVAKQIDGTLQLVLSVGATPTAHASAEWEAPDLGQLEGVLELHA
FT                   GNYPCCDLQQVATNCVSLDDVSAHVLAEVVSHYPNRNNRNPGEQLINAGVIALAREFSS
FT                   IPGHGIVVDPSTYGDWIVGKLSQEHGILFPFKEDSNCEFIPLGTKIKVVPQHNCIAAAA
FT                   FPWYFVIEEDTVVDIWVPFHGW"
FT   CDS_pept        complement(join(381786..382044,382090..382148))
FT                   /locus_tag="PAS_chr3_0187"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70167"
FT                   /db_xref="GOA:C4R3T1"
FT                   /db_xref="InterPro:IPR005349"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3T1"
FT                   /protein_id="CAY70167.1"
FT                   /translation="MEHPAFSLSGLSLVGGVMGYARKGSLPSLIAGVTFSAIYAGAGYL
FT                   LKNNMEYGVQTALGASTLMFIAGINRGIVSRYKKPVPIVLTILGAASTLYYAKKYEEFY
FT                   L"
FT   CDS_pept        complement(382287..383969)
FT                   /locus_tag="PAS_chr3_0188"
FT                   /product="Major of three pyruvate decarboxylase isozymes"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70169"
FT                   /db_xref="GOA:C4R3T2"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3T2"
FT                   /protein_id="CAY70169.1"
FT                   /translation="MAEITLGTYIFERLKQIDVKTIFGVPGDFNLALLDHIYEVEGMRW
FT                   AGNANELNAAYAADGYSRVKSMAALITTFGVGELSAVNGIAGSFAEHVGLLHIVGVPAI
FT                   SSQEKKLLLHHTLGNGDFGVFKRVFKNVSKSANFISDINEAQDMIDGAIREAFIYQRPI
FT                   YLGLPTNLVEMKVDRTRLNTPIDLKPVPNPVEAEEEALQSILELISKASKPVILVDACA
FT                   SRHFCQKEVDQLIDVTNFPVFVTPMGKGGVDEQKPQFGGAYVGSLSNPDITEFVEKADL
FT                   VISVGALLSDFNTGSFSYSHSKNIVEFHSDYTQIRSAVFQGVQMKALLQKLLPLVGKAS
FT                   KHITAQVPPKIAPPIEKGASEDLTQDWLWSNISKFLRAGDVVITETGTSAFGIVQSRFP
FT                   THVSGISQVLWGSIGFSVGATLGAVCATEELDPNRRVILFVGDGSLQLTVQEISTMARW
FT                   NLKPYLFILNNDGYTIERLIHGEKASYNDIQPWDHLKLLDTFKAKNSESTRVSTVGELT
FT                   KLFKDQGFNKPDKIRVIEIMLETMDAPISLVKQAEITAKTNAA"
FT   CDS_pept        complement(384516..386051)
FT                   /locus_tag="PAS_chr3_0189"
FT                   /product="Peripheral peroxisomal membrane peroxin"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70171"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3T3"
FT                   /protein_id="CAY70171.1"
FT                   /translation="MAYNNSTNGERLLNTSDALLNEDIGALGVFASHINSSRLVTPKRN
FT                   SRLDSLDSVSKPSTVDEITPPTSDKEGEIQENNQAWKTQNAPSLLSPDHMQHPAMTKHL
FT                   QNGNGFSHINNNTNTLKPFNLPPISPSPLPMNGGSLRNINGVLNDSSAVTDKQPTATTT
FT                   SPRVSAFTLLAAILEQLGGKDRLGKVIQYGLRILLIYSKRSSTFLSTVYEVSDASLNKS
FT                   GGRFSLLVSLLRRPELLLYWFLKQFEKKATGLSSGLSMYRQMLRAGKTPFRLVNLGYKI
FT                   NDTFQVFKKKGVDDGIVYFRKNWVNEKTVTELAQLYYSWFDESLLCFKLKMIDDPKYRG
FT                   IATRQERLAWLSTILLTLKKNIFKYQANKRKEQHIRINQQVKYRAKALLSNISDQHQQN
FT                   RSSPRSISNYSPRIQAYPSRMASPSPSMKMALTNSVSLQDTMDAELEALANEQYYVMLD
FT                   ILKGFCDLSFDMVNIFSIQIPEVLHLLFGFGAGSLALTGVVSKTRQELINKQI"
FT   CDS_pept        join(387257..387430,387508..387831)
FT                   /locus_tag="PAS_chr3_0191"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70173"
FT                   /db_xref="GOA:C4R3T4"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3T4"
FT                   /protein_id="CAY70173.1"
FT                   /translation="MLNPTVKFPIWQMCRLEDSYREMLNVLASFVDPSAVQPYIDLSLR
FT                   VCLQLRMLIVYLAYTMAIIIMFPIFLMMVVDLVLYATKVLHLRPDRKAPAPFQNEKSQD
FT                   SPIVTAEPMQLHKGSSLTSLSSLRSSTSIASSLNVPVNVTKYSPAIRASDIHRRIPRRA
FT                   ND"
FT   CDS_pept        388215..389252
FT                   /locus_tag="PAS_chr3_0192"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70174"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3T5"
FT                   /protein_id="CAY70174.1"
FT                   /translation="MHRIPLLSRLSDQAVVSNNPALRRSSNSTVDPTHSLSHRRLSQET
FT                   LTTLINPLAATGTSPAIVENVTMLNMESRIDSDTESLQATLTEDAFGSVFEVPAISYTY
FT                   IRKLPIVTSNFFGKSVHVFASKLDVEQFKAQGKNGEVTPILTLHSQRGIQSLKKNSPQC
FT                   ILYSYDGKDRVEHARMYHDILKNNNHKYTMVFRDSSIVVLINSKSGPFTDCEFKSTRLR
FT                   FLGTTGSYSTFGSRAITAVTVTNNDIELLTDGYSVDELASSNDLKPKLNKVAVKNIKEL
FT                   SKFIPFATLRLEPTSVITKRIQKVGEIQTFDHVDSRIPSSNCMAMLAVLLVLREQETMK
FT                   IQRND"
FT   CDS_pept        complement(389326..389928)
FT                   /locus_tag="PAS_chr3_0193"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70176"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3T6"
FT                   /protein_id="CAY70176.1"
FT                   /translation="MLFFNLLQYTLLLIIPMVQSYPLVIKKRDETINSVVVETSVVTVD
FT                   GNTYTTKITSTSTITVTAPDRTVYVTLDEDEPTNAPASSVNVQTTSTSPAQTSGAQAST
FT                   PITTSIAAQTSQVVLSSSRASPTSSQSSSSSTSSPTKTTQVSSTSSSEGTPYFTATDDG
FT                   TCYIYYAEDDETATYSDDAPYTTSTVYQVVATVTLTK"
FT   CDS_pept        join(390558..390561,390760..391076)
FT                   /locus_tag="PAS_chr3_0194"
FT                   /product="Protein component of the large (60S) ribosomal
FT                   subunit, identical to Rpl42Ap and has similarity to r"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70178"
FT                   /db_xref="GOA:C4R3T7"
FT                   /db_xref="InterPro:IPR000552"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3T7"
FT                   /protein_id="CAY70178.1"
FT                   /translation="MVNVPKTRKTFCKGKQCRKHTQHKVTQYKAGAASLFAQGKRRYDR
FT                   KQSGYGGQTKQIFHKKAKTTKKVVLRLECVVCKTKAQLALKRCKHFELGGDKKQKGQAL
FT                   QF"
FT   CDS_pept        391466..393436
FT                   /locus_tag="PAS_chr3_0195"
FT                   /product="Serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70180"
FT                   /db_xref="GOA:C4R3T8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3T8"
FT                   /protein_id="CAY70180.1"
FT                   /translation="MYSNQETDQNYAYQLHQQQLLQQQQQQQQHRPTNQASQQEFASQQ
FT                   QQYQQQHQQQFNSIPNIPPPPEHYSTYGSSPSNSLYSSSPFTEQQNVMSSSQPPSSPQR
FT                   SIRSNLVPVPTGNSLKNASKQGGGVFSLANPMSSNSNINQQSSFRNSLVDNLDNNRLST
FT                   ISQGRPQNMTDYVYFERRPDLLSKSAQDRAAAIKLKLEHFYKMSIDHAIERNQRRVDLE
FT                   YRLANEEGSTERKNRELHNLGKKESQFLRLRRTRLSLDDFTTVKVIGKGAFGEVRLVQK
FT                   KDTGTIYAMKTILKSEMFEREQLAHVKAERDVLAVSDSPWVVSLYYSFQDSLYLYLIME
FT                   YLPGGDLMSQLINWQIFTEDITRFYMAECVLAIEAIHKLGFIHRDIKPDNILIDIRGHI
FT                   KLADFGLSTGFHKTHDSKYYKQLLEKDPLPQPPVSNGGRNSMMVDAIHLTMSKRQQMQT
FT                   WRRSRRLMAYSTVGTPDYIAPEIFINQGYGQECDWWSLGAIMFECLVGWPPFCSDTPQE
FT                   TYKKILHWQETLYFPDDIHLSPESVDLIRRLLTSADHRLGRYGGADEIKSHPFFRGVNW
FT                   DTIRQVDAPFVPRLKSITDIRYFPADDLENVPDSPAMANAAKHRDRLAKQGKTEGNSKE
FT                   DLPFIGYTYSRFDYLTRKNAL"
FT   CDS_pept        complement(393932..394147)
FT                   /locus_tag="PAS_chr3_0196"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70181"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3T9"
FT                   /protein_id="CAY70181.1"
FT                   /translation="MNSGSESSFKSSEQESKKTVYFETKRQTTLLNLMENQDHLIVKAL
FT                   NMSADGKPVSLSDARHACLEMFLGRK"
FT   CDS_pept        394340..395281
FT                   /locus_tag="PAS_chr3_0197"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70182"
FT                   /db_xref="GOA:C4R3U0"
FT                   /db_xref="InterPro:IPR014802"
FT                   /db_xref="InterPro:IPR028143"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4R3U0"
FT                   /protein_id="CAY70182.1"
FT                   /translation="MSELTEAEKRQLLREKRKAKLSQGGGLDRLKKITGENNSKLSTDV
FT                   PTKEPTADATTTATELPTQGLETRINAHDDPVSEIPDPLNEGFDGKEPDLDQLIASMFN
FT                   KSAGHENPNSEEQGVPELMRRFSSILQGGDSGAAGLGAEAGGINPLDLLNSLGGSNIGK
FT                   AQEEYGSTPEEIEFNKKSIAYKKHQNEVLKAKILVVRLVLILSLLFVYGRDFSLSLFTQ
FT                   TYAPNGSSFMRVFLTLELIFQTSLFFFISKNKNFTDDSLISKLLNIGGAFIPATYRNLL
FT                   QTASKYQVLLSMFLFDLSIVVVVFAIRAAFNF"
FT   CDS_pept        complement(395294..396163)
FT                   /locus_tag="PAS_chr3_0198"
FT                   /product="Diacylglycerol pyrophosphate (DGPP) phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70184"
FT                   /db_xref="GOA:C4R3U1"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3U1"
FT                   /protein_id="CAY70184.1"
FT                   /translation="MIERIRDLIASWNGNKFILKWRICDVISLVIIIVLNFIFHRAKPF
FT                   QRQFTINDPTLSHPLVEIERVSGTMCWVYAMFIPFGFIGIVCLVVTERQSAAHMAFISL
FT                   LGLTSSVFTTSFITGILKGWIGRCRPDFLERCLPSETALEGVWYEAPDVCTTDDLAALY
FT                   DGFKTTPSGHSSVSFAGLSYSAFWLAGQLGAGVEGSDTWKSWVSSMPLFGACYIALSRT
FT                   QDYRHHFVDVIIGAIIGIVFAYTYYRKYFPGLRSEVSNIPMILEQFKNTDPSTLEEEAP
FT                   DFELQELP"
FT   CDS_pept        396296..397885
FT                   /locus_tag="PAS_chr3_0199"
FT                   /product="Putative protein of unknown function with
FT                   similarity to asparagine synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70185"
FT                   /db_xref="GOA:C4R3U2"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3U2"
FT                   /protein_id="CAY70185.1"
FT                   /translation="MCGILLRFSRSSNLEIDNDYTFQSAKQLVSERGTDYQNLIHIPAN
FT                   NGVASLYSSVLSIRSPFTQQPLRSELYTVQFNGELYNKETRDKNDGHWILELLNDYDDI
FT                   FKVVGTLEGEFAYTILAHRENKIYFGKDQLGKKSLAYTVIDGTLYISSCIPDVPTRTSF
FT                   HECKNLSMYIFDMETSEIVVLPFKDNDYFPKEYSVSDVRDIEIYQPLISQIVESLTSAV
FT                   CTRTNNIHTLNTSIAKYAILFSGGIDCSILASLAAKTSPAGTIIDLLNVSFYNPRTKTL
FT                   PQNTPDRKLGIQNWENLRKMYPSIRFQLVEVDVTYEEYMDHKEKVKQLIYPNDTEMDLS
FT                   IAIAFYFASRGKGFSRINANEKIPYESTCKVLLSGLGADELFGGYTRHERFFTPISNIR
FT                   KKQDKSTVPETVDANLYHLLQQELQKDLSNLWIRNLSRDDKVIACWSKEVRYPFLDTHF
FT                   INYATSVPLSLKLHYDPQSGDITRKWTLRHVADQLDMGWVSNEAKRAIQFGAKSAKMEA
FT                   GSGKMKGTDKLA"
FT   CDS_pept        complement(397919..398737)
FT                   /locus_tag="PAS_chr3_0200"
FT                   /product="Sumoylated protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70187"
FT                   /db_xref="InterPro:IPR013536"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3U3"
FT                   /protein_id="CAY70187.1"
FT                   /translation="MPIKGRFTKKKPKRKDEPNRPSPTQFIKKIASLKKQTRRDEALDV
FT                   LHELAVVVSPLMKENGFTVGLLCEMFPKNASLLGLNVNMGSKIMIRLRPSHNMNLFLPK
FT                   REIIGTMLHELTHNRFSAHDVRFYDFLEGLKSRFFEIQVKGSLQTTGYVNFSEVLSGNA
FT                   ARGQLIQKEKEKGQRLGGNKHAKPMRVLILEAAEKRMIDSKWCGGASNEVGLPKIEDLM
FT                   DDEEAQHSELKEENTKKVRKIVQPSKKKIVDLENLPNGKSIIIDLTNDDD"
FT   CDS_pept        401425..402888
FT                   /locus_tag="PAS_chr3_0202"
FT                   /product="Protein involved in 5.8S rRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70189"
FT                   /db_xref="GOA:C4R3U4"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3U4"
FT                   /protein_id="CAY70189.1"
FT                   /translation="MPEQDPLPPQNAGKKSKKSKKKGAMNPALLTPEYIAQQRALKLEE
FT                   KNKKRDLLTKLGIDPVSTIEKPYLKFIKRKMLQVAVPSDERLNISIMTYNMLAQALIRR
FT                   KLFPTSGDALKWGNRSVVLLNELKYYNCDIMCLQEVDYIQFNSFWNDELGKLGYDSQFY
FT                   REGTKNHGVVVFWRKALFNCIKVSHINHDQEKTSDIAPRTVAQNVGVLVALEFSEKIKQ
FT                   KFPFSNRKGILIGTTHLFWHPFGTYERTRQTYLILKKMKEFHMSLTGSEKEDKMNDEWF
FT                   TLFAGDLNSQPFDAPYLSMTSKPVLYSGRAKTVLECSTSFQYSKKRNGESTEDEDGGNI
FT                   EKFGPEQPQTPVPDQFSPTDEQKELVKKIQVLHNSLPVIATSLYSAAYAKIHSENAGKD
FT                   NDRNEPLISNWAHAWRGLLDYILVIQDWGFGDRTAPIDNVQLFQQTGIAINSLLRMPLP
FT                   AELGNEGFPKAGMFGSDHLCMAANVGLAM"
FT   CDS_pept        complement(402910..404733)
FT                   /locus_tag="PAS_chr3_0203"
FT                   /product="Guanine nucleotide exchange factor"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70190"
FT                   /db_xref="InterPro:IPR003123"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR037191"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3U5"
FT                   /protein_id="CAY70190.1"
FT                   /translation="MSFNKSFNKLGSAKATASVSTAKGDSVSANPTRSESESDRGHKQL
FT                   INILGQFEPHHDNKQWTSIEASTVSDQDLFANDDDSDDDGDEDDEEEEGDVIENEKLPF
FT                   KEGPSIAEKDEQRIDKKPESSKLAAEVEPQVNVSNENEDSSEPDHSAIPSTAKEGIENI
FT                   TKGVDSIQVKSENKSKSERLTKQNSAKKTLTKFDFQRFLKQLRSKDCEPVLKYIKSFLT
FT                   QFQARTWSVDEQIKLVKEFQQFIFGKLIECKPFDNLSTDEDVNNTMEGLEKFIMSRIYN
FT                   DTFPPLMVERKLSPSHREDLSRDKIYHINLKKYRWIQPKHLDIHLKIDSETSFVKLAGT
FT                   ELSKVNDYKSPRDKIICILNCCKVIFALIRQQQKIHKVEENADIFVPLLVFVILKCKTR
FT                   NLISNLSFIERFRNDRFLVGESSYYVSSLQIAANFITTIEQSLLTISAEDFAAEIENNE
FT                   RKLKEESIKRKREQKILEEKKAQEDAQKQGLFSPLTEMIAGTGKGEDFAPSQVLKSSAG
FT                   IFQQSLSTLFSSPSRESSPVSSSVDELKTAKKQSLEESKKEARIKSERETTLKNLKQMF
FT                   PDMDSEILLDIAIAKNSNIGDCIDACLELTE"
FT   CDS_pept        405076..406047
FT                   /locus_tag="PAS_chr3_0204"
FT                   /product="Protein required for pre-rRNA processing and 40S
FT                   ribosomal subunit assembly"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70192"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3U6"
FT                   /protein_id="CAY70192.1"
FT                   /translation="MMSDSEKLDALEIQRRNFEAQFGSLEDMGYIDKTKVRKSSKKNKE
FT                   HNDSEDDSGSGNDSSNDSESDSEEFNGFSENEEKGEDDYDENDTQLKGQPKTVKFTENF
FT                   NTFKGPSKDELKMARAGKPISLKELKEKQRLALKNATANNSEEQEHLVNDLQLQRLLDE
FT                   SHLLAGSSERFSGADLLDTIDFEDPIGKARLRTLNARVRKLASINGKNGGLPARLEKMP
FT                   MSMRKGMIKKQLEREAEFEKEAKEAGIVLSKKRKGEFRNLATGDRVTNKSDRIGTGIKK
FT                   ATKMRDRGLKINSVGRSTRNGLVITPKEIAKVSGPSNKRKKR"
FT   CDS_pept        complement(join(406092..406845,406901..408645))
FT                   /locus_tag="PAS_chr3_0205"
FT                   /product="Chromatin-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70193"
FT                   /db_xref="GOA:C4R3U7"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR022100"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3U7"
FT                   /protein_id="CAY70193.1"
FT                   /translation="MSLEPVNQLVFSGGGQTIVKVTDDFKHLLVASQKGLLKIFDADHQ
FT                   ENEPTTIDILQDISSFSTCTNTDNIIATSKKGTVGFYSFSNHSLNNILFSSVLPLRDSC
FT                   LTNGGNLAVVGGDDSELILLDPQGETKLIKKIGLNNEITSLSYNRVSNLVAVSLSSRVV
FT                   RVYSLSSQSPEFVSSIEGQIPKKLFQDEFDDSLEDEFDELDEEDNFTFKDDKTKNKAKD
FT                   NNRVSTKPSWRPDGEVIAIPCEDNIIRLFSRSDDFSEGVAFPGKHRLSLVDLSWSPNGN
FT                   YLASVDLDDRLIIWDTQQKIVTHSYNLPKPVYNVDWISIGDRFDVVLGTFDGHILRFNG
FT                   VVPRTGTTSVDKATSLFIDAEAGVSDVENNGNVAEAIPDADGDLDDFIIDTETSTTKRP
FT                   PNGFLDEDDELFGEHSKKRKPPTIVSSSWKITPYSPGATPWSYDKRYLTINSFGYCWSV
FT                   EQTANYTITVDFFNKDLHRSYHFKDVYGYDLASMNENALVLATSGSNSINPKASSTKRI
FT                   LFRPHDTDISQNWEREVPCQKDEYITCVSVSNSVVVVATSYGYIRSYSLFGVAQTIEKN
FT                   FSISCIFSMQDLDGKYYQRDAALPVNVDGKNDFVFKGLFFSDDGDPCLVGHDDMLLVLS
FT                   RWRDPLQARWVPILDIAAGIKKAASSGDKIKSWPLGLMGEKFNCIIQRTGIIQSSSYPD
FT                   FPLRLPTEIEIELPVNSEAYSEEEESLNSEENYVKAKVLGELLNDAIQNADEDEDSLED
FT                   SELRLFEYSRLYDKSLLLLLADACSKENSMKAFALANELRDDKALSSAIKIAERSNLET
FT                   LVQQIAELREERLEQSQSQT"
FT   CDS_pept        409001..409882
FT                   /locus_tag="PAS_chr3_0206"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70194"
FT                   /db_xref="GOA:C4R3U8"
FT                   /db_xref="InterPro:IPR009316"
FT                   /db_xref="InterPro:IPR024602"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3U8"
FT                   /protein_id="CAY70194.1"
FT                   /translation="MATTSSVNIDSLLADDQFNDQQENQDEDSDFPFTQHMTKDLFDYQ
FT                   VDQVEQENDGKFDADLLLYQNYRFMMLEDLRKELGDLLDQLDDQLVDLINRDYQDFITL
FT                   GQSVGGTVETIQMVKFDVTSYKNSLASNQKYIDNVINTVKKLKSQKTNLSKLKWKAEAL
FT                   VLLHTQVDMFEKYIAKKIQDEVVTFEQINKLTSLYLSITSILDSILEEHKPEDGPIVIL
FT                   EKLKSQVNSSRYEYQSIMDTYISGLKSEIKKMTSSQPQDPKSVSELQEQVMTILTFYPY
FT                   TGNNKLFSEPDE"
FT   CDS_pept        410099..411685
FT                   /locus_tag="PAS_chr3_0207"
FT                   /product="Protein involved in pre-rRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70196"
FT                   /db_xref="GOA:C4R3U9"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR039241"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3U9"
FT                   /protein_id="CAY70196.1"
FT                   /translation="MAKDPFLSDGSRKRKRTNPPTSNVNRISKTQNKNQTERADEDITS
FT                   ESETENLSSDGEVKEEQSSESEDEEDFAETAADKRRRLAKQYLENLQAEQESYEFDAQD
FT                   LDNDILARRLQMDVNENKGTLYKFIADKLLVRDCKPTISRVGSKGMTCVSASYPFCYTT
FT                   SKDMELSKWKIDDFNKKPQKVKYVKGGVKYRNLNKEQHLNGHCGEVLTCSASSNGKYVV
FT                   TGGRDQRLIVWSTEALSPLRVWEIRNRNGVIFSTVFRKQSDQLYAACGDLKVRTYGVAQ
FT                   MSQLETLYGHQDFVADISALSQERCVTVGSRDRTAMLWKIPEESKLTFRGGDSEEKKNK
FT                   FGNLNSKESDKLSFYAEGSLDCISMVDESHFVTGSDNGNVSFWAINKKKPIFVIRQAHG
FT                   LEPRIPSGDASGEINEQAAEFQVPKRNPYWVTAIHSLPLSDVFFTGSWNGTIRVWKINS
FT                   NLRSFELLGELPNANGVVTKIDSCEFDGKIRLFATLSKEHRLGRWIKTKGRNALYSAVL
FT                   DLQNLKRPKNS"
FT   CDS_pept        complement(411805..412455)
FT                   /locus_tag="PAS_chr3_0208"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70198"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3V0"
FT                   /protein_id="CAY70198.1"
FT                   /translation="MKLLNIASLLAIAASASAEATTTLQTTITITETQLSPEESSSLLS
FT                   VSSASVASEASAASAASEASAASVASELSAASEASVASEAAHQTLFRNYAIAINSTVTP
FT                   SVSSSSPTIAANSTVVSSTLTPYLNTTSALPTNRTVTTTASFYSNTSSFHNSSTISSTR
FT                   RSSITSSSSSSSSSSSESGAPTTSSTSATDGAAIYQVSGASLGLAAIAAIALL"
FT   CDS_pept        complement(412934..414088)
FT                   /locus_tag="PAS_chr3_0209"
FT                   /product="Cytosolic protein required for sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70200"
FT                   /db_xref="InterPro:IPR006595"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR024964"
FT                   /db_xref="InterPro:IPR027711"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3V1"
FT                   /protein_id="CAY70200.1"
FT                   /translation="MNIVQEEVERLGKNKALEKCIKESNDLLSYLKQKQEQLNQDTDDL
FT                   KVQDVQIKINYWANQSLKHEKSLNTVIKKYQKSIDKVFNFDLSEVYRHRIPLESTRCRQ
FT                   LVDRALIMHLLRIGDFEAANTIAKMDNIQVPDQLLNKFHELEEISEDLTVHHRLEKAIA
FT                   WANVNKHNLQRIGSDLQFNLHKLKFIDIYKKNPSSPYPAYEYAKINFPHFGNTHLDVIS
FT                   KLMSSTIFTPNEPENPYLDSIDLTSSPYQKLFTQLSRDFCSFVGLSSESPIFNTLQASY
FT                   IAIPNFVKFNKISKMKNEKLDWTSENELPFEVELPKSLQFHSIFICPVSKEETTPQNSP
FT                   MALGCRHLISKDSLAKLKKRNSSIKCPYCPKTFAANEIQEVQFI"
FT   CDS_pept        414276..416783
FT                   /locus_tag="PAS_chr3_1161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1161"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70201"
FT                   /db_xref="InterPro:IPR004328"
FT                   /db_xref="InterPro:IPR025304"
FT                   /db_xref="InterPro:IPR038499"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3V2"
FT                   /protein_id="CAY70201.1"
FT                   /translation="MTKTELGFRYLISSLALCLLTSSNPELHYSKMDKDPGSYNSSIKL
FT                   VPNPQLMKTPLITLPLKKTKDDTDWKSALDSHIKLAYGANHEFSNEIDTFSAIRSDIHN
FT                   LKPDVLGRDILYKYYGQLELLGLRIPIKHLNVSFTWYDAFKTSSKVKQHSTAFEKASVL
FT                   FNLAATFSELGKSSLSEGNFKASYTNFQYSAGILQFIAENFLHAPSGDLDPEVVTTFQK
FT                   VMIAQAQEIFLLKMFDDDSANVKHSLAAKLAKAASNMYESITEPLKGFLSKGVPITFSQ
FT                   LTAYKAIYYDALAHYHNALHNKATSKYGAAIADLKEAESQLKECENTFLPSDFKQIGDF
FT                   QSELSELIKIELPSIEKDNEFVFNDHVPSTAPIIKPLEGARPISLADQDFSATVGKDLF
FT                   EKIIPMSVHEQSSLYSEMQAQLLREEGSNVELLDEELSSLMSYLNLPKSILELKELLEI
FT                   KPDELRLDFSDSTQELDPRILSAALEIQDSSYVTEAQAVRRIKEELLSKLNNTQNLLLN
FT                   EERNYSENKLRYGAKWTQQPSTMLNSSYKQNLTRTRKSLEDASLSDKKLESMISPYQYV
FT                   LNILSGGPHSSELRNAFNPSLPDSEVSLLDIDDRSFNTKAKIGQLDSKVQELHNLRKER
FT                   ANTYNDLKTAVRKDDISSIILINKDNPNMEENVFRKELLKFQPYRNRIEATGERQNLLM
FT                   QEIKVLMSEVLNDPTIKKNRLSKHSQKETQSKQLNNYLDAYKQWKTYVTGLKQANSFYK
FT                   QLFNLVNEQHNSVVNYTNQRQMEANALGQDSLSYGLGSLNLEGTSQPPPRPPKDSDQDP
FT                   YKNPSVFDPLLYASFSDNNQSRR"
FT   CDS_pept        417461..419890
FT                   /locus_tag="PAS_chr3_0210"
FT                   /product="Subunit of the vacuole fusion and protein sorting
FT                   HOPS complex and the CORVET tethering complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70203"
FT                   /db_xref="GOA:C4R3V3"
FT                   /db_xref="InterPro:IPR006925"
FT                   /db_xref="InterPro:IPR006926"
FT                   /db_xref="InterPro:IPR016534"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR038132"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3V3"
FT                   /protein_id="CAY70203.1"
FT                   /translation="MNNPSLGWERLDTVFYRLRECYSPLQWDIELDEQPVAISNSAAAI
FT                   AVFNSHSSHTSIDIFSGSGVLLNSIPWLLSNGQIVSMSWTDNEELLVVLQNGTIRKFSD
FT                   LTSEFDEFGLNLPEDSIVQEAKFFQDGIVVLTNEKKFVFFSSFSQVPRHFTLNVDSIDC
FT                   WNILYSDRVLQLFVSSNKSIHISTLTTETSVKFGQVITGIEFPPNGSFASLLTPDNLII
FT                   ATSDLENLLSEFSHNFKHIRSMQWCSNDAVVLATNDELQVIGPGDDSISFYYENRPFIR
FT                   SQNDGLTVLTQSKLEFLSRVANFTEETFRIGSTKASAILLDSIDQLDRHSPKADENLRI
FT                   VKPNLVEAVDNCIRSASEEFDPQWQKKLLRAASFGKSILDFYSSEEFVEICNNLRVLNA
FT                   VRQPEVGMFITYAQLLNYGHQGLIQSLIRRRLFLLASKICKFLSSFPDNIYFAWAKLKI
FT                   KSSYNTNDKELSEIILDKLAETKRVSYTGLSEVAYNEGRVELAHLLLDHEPVLENQVPL
FT                   LLQMGQDKNALLKSEQSGNVDLICSVLLRLYYKFSLSQFFILLSDSTDVSIGIFKDIIG
FT                   SVKPDLLLEYYYQDDQLIKIAESNLLQDSTYSLDAETKRNRLLELLKAYEGKKFYENDV
FT                   PIIESHLKLLNYQETLTNKFNHSFVAFSKIETISELARLDDEKLTETQKYAYQFGISST
FT                   QLYHSVVKSLAKSHQWDKLFQFAKSKKSPVGYELFFRECYLQNEKRQAGLYIGMCKELT
FT                   YKARADLYLKIGEYRLAADEASKKKDIDLLQLVKDTAGSTNVGITRLIEDYVTRIG"
FT   CDS_pept        complement(419912..421165)
FT                   /locus_tag="PAS_chr3_0211"
FT                   /product="Outer kinetochore protein required for chromosome
FT                   stability"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70205"
FT                   /db_xref="GOA:C4R3V4"
FT                   /db_xref="InterPro:IPR007902"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3V4"
FT                   /protein_id="CAY70205.1"
FT                   /translation="MDTTASQVISNSYIPPRLAEQNSRFLNRVALKSLLELVKIWSRWP
FT                   ATKPKHNIGSEVDLFTESNITKKKLIDKILVEYWPNGLNLLQLSQIDTQLIVKKPSASS
FT                   MGSSGWTSSMAKIPLSGEELMITIEPQLFLDQLMTHLSKVYLCHSYVAKHPVLPLTIIR
FT                   VQVFDFIPMKKRIPSKDELVSHKPFFLAIPQNSPFVIHTAFQDSVTKTIMQSIELTLSS
FT                   STRQVVLAPTNDPPVKTLEALHIFKGNSRFSNSLGSWQPYADGDVDMPVLGEEKNHPIV
FT                   KVNRIDNNAVSNRPTREQIAMLRFKGTVDPLKSERLFEDTRAIKEVEEDNTNPYSSIAP
FT                   VQFVKLALKSADDSNENPITIKFTGTDVYAGLYELAVKGPVDAALIPEALTGEYGVESG
FT                   TLENGKFTKEETILLDNN"
FT   CDS_pept        421295..423256
FT                   /locus_tag="PAS_chr3_0212"
FT                   /product="Nucleolar protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70207"
FT                   /db_xref="GOA:C4R3V5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3V5"
FT                   /protein_id="CAY70207.1"
FT                   /translation="MSDSNKEGKVDKNTLFVRGIPTNASKEQLSDFFSQFAPVKHAIIV
FT                   TDKAEDSKGFGFVSFTSEDDSVLALAGAKAKKFNKVLLKVDIAKRRERKEKKASGEIAR
FT                   EKPKYDKESIEKRRPRLIVRNLPWSARSSQDLKEVFEKFGNVVDVIIPRKAGGRMSGFA
FT                   FVTMRKQSGAEAAVAGSKDLKIDGREVQVELALEKEKFLEKKKVETKEESDDEDDDDDD
FT                   DEDEVDEDGEIEDDEDEDEEDEDHKPNRQTPYCIFIRNLPYDASEETLQEHFEKFGPIR
FT                   YALPVVDHNTGQAKGTGFVAFKNSQDYEDCLLNAPKPTSNSVLLPDEVSPLYVYQGRVL
FT                   SIAPAVDRDSAGRLMERNEKKRQEALGKGEKDKRNIYLLHEGRISENSVLASLLTPADL
FT                   KAREESYKLRVQQLNKNPTLHLSLTRLAIRNLPRAMTEKSLKALGRKAIVEFATELRQG
FT                   KRNPFSKEELVRSSKHRFEMEGGNFQELLDEATTGHASVTLQKKNKKKGVVLQSKIITE
FT                   VKGTGEQGRSRGYGFLEYRDHKHALMGLRWLNAHLVTPEEIFEGLNEDEKKSINMEGFS
FT                   KRRLIVEFAIENAQVVRRRKEKAINFRKESLKRKADEMKKTEDELKAEAKKAEEDKKAE
FT                   DVRQIIADKRRRKKRQKH"
FT   CDS_pept        complement(423308..424990)
FT                   /locus_tag="PAS_chr3_0213"
FT                   /product="tRNA(Ser) Um(44) 2'-O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70209"
FT                   /db_xref="GOA:C4R3V6"
FT                   /db_xref="InterPro:IPR011671"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3V6"
FT                   /protein_id="CAY70209.1"
FT                   /translation="MENLKPDELPNILPGQSLLGKEWHGLFETKVDFSSKHFKKAMLNL
FT                   IREPNINSTVILRADILIENDYIDKSFVDKASDHIDLPNMENKENSVLTKNIDDTTVRT
FT                   IPLSSNLKLVPALEIVRRIIPRNPFKDCIINQTCLLLQDSLNDDAEVTQSLIVYVAHLD
FT                   DPEDIPFYLPCVKAVALFFDKGSLSVHYLPFDIEEVQKWKPTDRPVRTAYRLLKTCKKH
FT                   SEGVMSGYEKRVNHDLIVPKEDFQNRYISLKRKYSKNLVDNWKESTDPRKHVFEDLAIA
FT                   AFLIELWSQKYPSKDSFQFRDLGCGNGLLVYILIMEGYHGMGIDARRRKSWDSYPESIQ
FT                   ENLLEQVIIPSVLLRPHPAMIAVNPYLTDNGCIFQVPVPLKHIHDTTSRSLIDSNVPIM
FT                   AYYSSATLLESPHVNTAEFPPNTFLIGNHSDELTCWMPLLRFPFLVIPCCSHALDGSKA
FT                   RFPPRKVKRNDKVQPTSFQSASSYAGLVDHVEDLATQVGWKVEKEMLRIPSTRNAALIG
FT                   FDCLNPETDGPFKSIYEILAMEGGAEGWVENAMALSSRSPRGH"
FT   CDS_pept        join(425378..425391,425528..426386)
FT                   /locus_tag="PAS_chr3_0214"
FT                   /product="Cyclin-dependent kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70210"
FT                   /db_xref="GOA:C4R3V7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3V7"
FT                   /protein_id="CAY70210.1"
FT                   /translation="MSSSQLEKLGEGTYATVYKGRNKTNGTLVALKEIRLDSEEGTPST
FT                   AIREISLMKELKHDNIVDLYDVIHTENKLTLVFEYMDQDLKKYMDTHGDSSGALEPQVI
FT                   KSFMFQLLKGVMFCHDNRVLHRDLKPQNLLINSKGELKLGDFGLGRAFGIPVNTFSHEV
FT                   VTLWYRAPDVLLGSNNYSTGIDMWSCGCILAEMVTGKPLFPGESNESQLTKIFRLMGTP
FT                   NEHTWPGVSNYPHYKADFPVYVPQDLGTILPKIEPLALNLLTNLLQLRPEARISARQAL
FT                   QHPYFREYV"
FT   CDS_pept        427436..428578
FT                   /locus_tag="PAS_chr3_0215"
FT                   /product="Alpha1,2-mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70212"
FT                   /db_xref="GOA:C4R3V8"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3V8"
FT                   /protein_id="CAY70212.1"
FT                   /translation="MVHIGFRSLKAVFILALSSLILYGIVTTFDGSRASRYQPPYVNHS
FT                   QDPLYHSGNSYNRENATFVTLCRNEDLYSIIQSIKKVEDRFNNKFAYDWVFLNEVPFTD
FT                   EFKERTSVLISGQAKYGLIPKEHWSYPDYIDQERAAESRRQLEDQHVVYGGLESYRHMC
FT                   RFNSGFFYKHPLMLDYRYYWRVEPEIEILCDVETDLFRYMRENNKTYGFTISIHEFEKT
FT                   IPTLWETTKEFMKQNPSYIAENNLMNFISDDNGKTYNLCHFWSNFEVADMDFWRSDVYE
FT                   KYFKFLDDTGKFFYERWGDAPVHSLAVSLFLPKEKVHFFNEVGYKHSVYSMCPIDKDIW
FT                   KNRKCYCDPNTDFTFRGYSCGRQYYKATGLTRPSNWKDYD"
FT   CDS_pept        428902..430113
FT                   /locus_tag="PAS_chr3_1162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1162"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70214"
FT                   /db_xref="GOA:C4R3V9"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3V9"
FT                   /protein_id="CAY70214.1"
FT                   /translation="MAGATRINSRVVRFAIFASILVLLGFILSRGSATSYSLPSGLTSD
FT                   TSQSTGSSPKSESKPSSQGSSGATELKKTYTTDGKEKATFVSLARNSDVWSLASSIRHV
FT                   EDRFNHKFHYDWVFLNDEEFSDEFKRVTSALTSGKAKYGLIPKEHWSFPEWIDKERAAK
FT                   TRKEMAAKKVIYGDSISYRHMCRFESGFFFRHELMQEYEWYWRVEPDIKIYCDIDYDVF
FT                   KFMKDNNKMYGFTVSLPEYVATIETLWDTTRAFIKENPQYLPEDNMMDFISDDDGLSYN
FT                   GCHFWSNFEVGSLSLWRSEAYLKYFDHLDKAGGFFYERWGDAPVHSIAAALFLHRDQIH
FT                   FFDDVGYFHNPFNNCPVDADLREERRCMCNPKDDFTWKGYSCVPEFFTVNNMKRPKGWE
FT                   AFSG"
FT   CDS_pept        430272..433010
FT                   /locus_tag="PAS_chr3_1163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1163"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70215"
FT                   /db_xref="GOA:C4R3W0"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011494"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019015"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR031120"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3W0"
FT                   /protein_id="CAY70215.1"
FT                   /translation="MQIIKLPWLCHQEEQRKFEVYTISVSADGKRLASGGLDGKIKIWS
FT                   MDSIYQYKRSDKENDLRYLQGSVQSDESKNALKVSENICRPLCSMSRHTGAVTCLRFSP
FT                   NNRFLASGSDDKIVLIWEQDEEYEYDSSVMEGMNPVFSNGSSGDQMDMERWTVRKRLVA
FT                   HDNDIQDMAWAPDGSILVTVGLDRSIIIWNGQTFEKMKRYDIHNSHVKGIVFDPANKYF
FT                   ITSSDDRTCRVFRYHKTSPTEMIFSVEHVITEPFTKSPMTTYFRRLSWSPDGLSIAIPN
FT                   ATNGPVSSVAIVNRGSWESDISLIGHDSPCEVVSFCPRLFEVATSKEEKQLCSVLATGG
FT                   QDKTLAIWNTARPKPLVVIHDIVYKAITDLCWTPDGDVLTISSLDGTITVIVFENNDLG
FT                   VKTPIERNQEQLEIYGGEREGMVFPESVEQLILEEKSHNAQLLLRNPHLDQMMEKRIPQ
FT                   TAIRTTLQHKVVKPKKVNNINVLKTQKITMKNGKKRVSPLLLTSSSSTSNRFIPVPNKE
FT                   RENLTSNLLSKSTYKFPKNGLPSLTTSLRPNVEIQTPKEESVLQEEDINIDHIEHHHHL
FT                   KNSVPKTNNSSNAFKKKRDLAFPEFLRPAIRSVVTVFPEMKFQPKVLVVLAPPTTETNI
FT                   ETNEKVELESSIEIRNQVEPKDLNLSKVYSSDTNGNRRFELTFQMNLNNAISTSDNQWA
FT                   LSSDTGSIIVVSSAGRITSPILEVGASVCVLRSYNEHLLAITCEGTCFSWNLKKQECVL
FT                   NSISLAPIVNSHMLVKKVGDARNYSIVSAEGDNNPLPQILDCELSKNGAPIVALSTKDI
FT                   YSYSKKMKCWIHLIDSKYFELLGADNALFECVEALEGPIGMLIHRLVDEFFHENTAGKK
FT                   LKLYNKRVLEDLSNSLEELGENASQLREKLDKLYGDEVEAS"
FT   CDS_pept        433442..434689
FT                   /locus_tag="PAS_chr3_0216"
FT                   /product="Arginosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70217"
FT                   /db_xref="GOA:C4R3W1"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3W1"
FT                   /protein_id="CAY70217.1"
FT                   /translation="MSKGKVCLAYSGGLDTSIILAWLLEQGYEVVAFLANIGQEEDFEA
FT                   AREKALKIGATKFIVSDVRKEFVEEVLFPAVQVNAIYENVYLLGTSLARPVIAKAQIEV
FT                   AEQEGCFAVAHGCTGKGNDQVRFELSFYALKPDVVCIAPWRDPEFFERFAGRNDLLNYA
FT                   AEKDIPVAQTKAKPWSTDENMAHISFEAGILEDPNTTPPKDMWKLTVDPEDAPDKPEFF
FT                   DVHFEKGKPVKLVLENKTEVTDPVEIFLTANAIARRNGVGRIDIVENRFIGIKSRGCYE
FT                   TPGLTLLRTTHIDLEGLTVDREVRSIRDTFVTPTYSKLLYNGLYFTPEGEYVRTMIQPS
FT                   QNTVNGVVRAKAYKGNVYNLGRYSETEKLYDATESSMDELTGFHPQEAGGFITTQAIRI
FT                   KKYGESVREKGKFLGL"
FT   CDS_pept        complement(434738..435685)
FT                   /locus_tag="PAS_chr3_0217"
FT                   /product="Type 2A-related serine-threonine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70219"
FT                   /db_xref="GOA:C4R3W2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3W2"
FT                   /protein_id="CAY70219.1"
FT                   /translation="MPERGPDQWFEEVKSCKALSENDMKHLCERVKDLLMEESNIQPVQ
FT                   SPVTVCGDIHGQFHDLLELFKISGGFPGSSSNGIKQNYIFLGDYVDRGYFSLETFTLLM
FT                   ILKIKFPQHITLVRGNHESRQITQVYGFYEECLNKYGSTTVWKYCCQVFDFLTLSAIID
FT                   GKILCIHGGLSPDIRMLDQIRVLSRAQEVPHEGGFCDLVWSDPDEVDSWAVSPRGAGWL
FT                   FGARVAREFNHINNLQLIARAHQLVMEGFRYHFKEKDVVTVWSAPNYCYRCGNVASVMN
FT                   VDDELDVNFKIFSAVPDDTQKMNPVKNQRNEYFL"
FT   CDS_pept        436426..437808
FT                   /locus_tag="PAS_chr3_0218"
FT                   /product="Diacylglycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70221"
FT                   /db_xref="GOA:C4R3W3"
FT                   /db_xref="InterPro:IPR007130"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3W3"
FT                   /protein_id="CAY70221.1"
FT                   /translation="MPEKKNSRSADEALSFLAKTNVERPMHYSKTGNITPDTVSSREDH
FT                   YQDYDDSQDDIINNKLLQRRQGGPHNKIEKQRRFALLRSSLNRRLETLVILWHTITIPF
FT                   LASLFFVLCTIPMLWPLIIVYLVYFYIDANTPSNGKSADRRVEWFRSLHIWKHFVNYYP
FT                   ISVYKTVDLEPTFKTKKIEIILPKYHQVTTYLPSSVRKYIPTHRVLIEKEIKTGPRYIF
FT                   GYHPHGVVSLGITGAFGTNGCNIGELLPGIRIYLLTLITQFKLPLLRDYLMALGISSVS
FT                   KRNVTALIKRNQSVCIVIGGASESLLSKPHTIDIVLKKRKGFVKVALELGDTELVPVFG
FT                   FGENTAYNVFDPSVSGKSCSVLNYVRKQMCGFQLWLKQHFGFTFPFFHARGVFNHDFGL
FT                   LPYRKPINLVIGRPIPVPYIHSPTQEQIDHYHSLYVEELKRVFEQNKERFNAGSLELRI
FT                   VE"
FT   CDS_pept        437955..440363
FT                   /locus_tag="PAS_chr3_0219"
FT                   /product="DNA helicase and DNA-dependent ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70223"
FT                   /db_xref="GOA:C4R3W4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3W4"
FT                   /protein_id="CAY70223.1"
FT                   /translation="MLASLNSQQYEAVTADIHKPLQIIAGPGTGKTKVLTSRVAYLLIE
FT                   HKIPPSNIIVTTFTKKAANEMVERLQVLFAKENLDPDKYLKGLLIGTFHSICVKLLRRY
FT                   GTQIGLTPKFKIADERDSNTILSKILTTLSDDVVRLKFHPSSVSVDIYQKDPKETDKLH
FT                   GYDLKKAKSQISKLKSLTTTPQTYSTTSARSFDLAVIYSLYQESLRKHNLIDFDDCLLY
FT                   TYLLLSETRKKGRVLLKELKHVLVDEFQDTNKIQMELLYLLGQCTDDQNFEDNVTVVGD
FT                   SDQSIYMFRNAVASNFENMIIHYQNCQEITLKENYRSTSNILNFSEQIMTQQKDRKQKS
FT                   LRSQISHLNIPIVYVRTQNTFKEADHIASEVAKLGLMSGLLTSYNDIAILLRSSFQSRV
FT                   IEQSLVTNRIPYEVVHGRAFWELKEIRVAMDYLRAIVNNSDNLAILRTLNFPPRGVGNK
FT                   TLQRLEELIDKSDCPVIETLEMAIHDKKNGFLNVKSESGVRQYIDILKECGRLLDSTSL
FT                   DCEASLEACFDQIVQLANLKEIKKTPETSKGTHDSENALKAVEENLNEFKRQLIEYKPI
FT                   IDQIITAEAGDTPLTTRDVLSSFLDSIDLYETSNNENKKDSKKGRVTISTIHGAKGLEW
FT                   PVVFIPGCTDGVIPSKWTLEDDGPDSSTNLDEDRRCFYVALTRAKSMLYLSSYKERSTP
FT                   WSGEESNEVSCFLKPTLKMFQNQLVTSISNMSKNSWRDLYEAMGKEYKPVSNILTESNR
FT                   SRNHIVSTKDFLKNKQFKSPLLTKSTTAPSYVPDRSNNKKRRLGVRRRI"
FT   CDS_pept        complement(440370..444494)
FT                   /locus_tag="PAS_chr3_0220"
FT                   /product="Mitogen-activated protein (MAP) kinase kinase
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70224"
FT                   /db_xref="GOA:C4R3W5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3W5"
FT                   /protein_id="CAY70224.1"
FT                   /translation="METDSANHLDPVEPTYDTTLLPYLHSRKSSRKSFGGDDITNPNAD
FT                   LSTTPSRIPLPSSFMSEEGSKGESRFSFELNGMDSSTPEKSAWTGILESPKPSESFSFF
FT                   TEHPSIAHFNNSSGNHIESLSNSTSPSNADSDLSKRLSRIKKSATHSRQSSISWNVDLP
FT                   EEWTLNNITFWLNLYNFNESWLSMIKAHNLVGASFLSLANYPVLKTYTHEVDTVNDSTP
FT                   SRFIHLLRKTMGRKTSETLSLASANVNDYYASNVSAESFDSIIQSPVEEFHETSNLETK
FT                   SSSESPKSSVKHFADPAKLTTNIPKPSPLRSSSPSSSSTTLKHSVSQRTTNTRQATENV
FT                   KRPVSTIEYSTSRSDSPTSTFSYNVFRKHQKSNSSESNFFSKIYSNAPTNEVEVERRSS
FT                   VKSKKGLLTKFKKIGEEISKSNKSRDKLSESPISPASATSLVGGKDRWKRHQSSVTTEL
FT                   SNKDWKQASRKSVDKTKNNVETNKERLSISKKDKVLSDIYEKHKPTPLKDTHTKTSSSF
FT                   VLATSNDNNFIPIDVSEVQDLRQFKVVVIKALNIMNIEPISFHLTDFGHIHGAELDDES
FT                   LEKFRLDGFRNGSLKLHVKGTKFETSSSTASSMTLSFKSIEEGKLEKGSSRYPTTPQYL
FT                   LDTMNAHSKDMSVDYLNIKDKVRESQELKNELVPQSASTTTVPMSKERSFSFRSTKEEH
FT                   QNNTFRVIRNKSWEVDFDKKRKSPYERTRQLVAKRDPPPPPSPYSPPKNSLANREKREL
FT                   PVLNPANQSSATSRTFGLDHNLEFPSKTNDEPTRISPFTPGSSNTLIPKPYKGSSPHER
FT                   RPVLSNERRGSRRRSSSLLTTSSIVSGNSYQNFNTKSESFHDPSSGDSHGTFEESNTFD
FT                   ELPTFDISNPIESCSEEEEEDFWAKPPSSTTNTQPAAVAIDAKEDQEEKITRMPSMAVR
FT                   PPAEVVYDNLELFFPNTDLDKPLMDDASPPPSPNSPIPEVSPVNNTRPQIHRKISSVRS
FT                   ASDHLARPNELGRGRVKTIRIVAQEAKKSRARLAENFESNKKADGLLRRRSTKFWGRKV
FT                   VEMKPGDARNLSKLKDGNGDYKQFSWVRGEMIGKGTYGKVFLALNVTTGEMMAVKQVDL
FT                   PSSGHNSSVFKEVVDAILSEVDTLSDLDHDNIVQYLGFEQRAQTYTLFLEYVAGGSVGW
FT                   CLRVFGRFPEEVIRFLTKQVLEGLAYIHSRGILHRDLKGDNLLLETDGTCKITDFGISK
FT                   RSRNIYSNDAEMSMQGSIFWMAPEVIDNVVNDKKQGYSAKVDVWSLGCVVLEMFAGKRP
FT                   WSNFEVISAMYNLGRSKSAPPISDEVKAYISSDGIDFINKCFTVDPDERPTAQSLICHP
FT                   FCKTSSDFKFESTELAKLVKVNDKQANLVFE"
FT   CDS_pept        complement(444718..445200)
FT                   /locus_tag="PAS_chr3_0221"
FT                   /product="Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70226"
FT                   /db_xref="GOA:C4R3W6"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3W6"
FT                   /protein_id="CAY70226.1"
FT                   /translation="MNLIPRALNSAKICFQRIPTRSFTTQFALLQNQQKQTISSKLPDL
FT                   QPLKFEKDLYATIRIHNRPYLITEGDKIILPFRLKNAEVGDVLNFDDVTTIGSRNFTYS
FT                   DTPIDSSLYSIKATVIEKTKKPMYTKEITKRRQRHVRHVNVKHDLTVLRVSELKLS"
FT   CDS_pept        complement(445350..446039)
FT                   /locus_tag="PAS_chr3_0222"
FT                   /product="3-hydroxyacyl-CoA dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70228"
FT                   /db_xref="GOA:C4R3W7"
FT                   /db_xref="InterPro:IPR007482"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3W7"
FT                   /protein_id="CAY70228.1"
FT                   /translation="MPVSGRNPNSSFLPVQATHHFIMTTPAWLVSYNALSSIAWFSVLV
FT                   LATSYPEAQPQFFQDTQAYVRLVQTFAIVEVYNSLVGNVRSPVFTTAVQVASRLLVVWG
FT                   VFYVLPNSPANTHWAYITLCLSWSITEIIRYGYYALNIVTEGNPPKFLTWLRYNTFLVL
FT                   YPTGVGSEVTILFKSLDEAERVVGAWYKYLFIAILATYIPGFYMLFSYMLKQRGKTLKK
FT                   LSPKKEK"
FT   CDS_pept        446438..448546
FT                   /locus_tag="PAS_chr3_1164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1164"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70230"
FT                   /db_xref="GOA:C4R3W8"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3W8"
FT                   /protein_id="CAY70230.1"
FT                   /translation="MKRLATFFLLLVYVTAYNGTDSLSDPSSPSSCHNINHLPLKQQCS
FT                   FVRENCQDLQVGTLNYFELYYCKIESPAARPLLVIPLTLGLMSVLFVSLGLTSSEFLCP
FT                   NLSTISHFFDIPDNLSGLTLLAFGNGSPDIMGTYASFMSGDGSLAIGELIGSAYLITSF
FT                   IVGAMVVVRPFRLFKDGSSDFTIRNEKLVFVRDLLFFALAVVLVIIFLSDRELSLVECL
FT                   VMVSLYALYVAVIVSWNWIVKFNEELIQRDQTVRSLYDDDEVDGELNIFHQLNDIEVED
FT                   NENSHVLNELMNVTGTQNNTSRIRSSVLGALEFKNVFENLSKEQSFPVDRHALINLRPE
FT                   SEPAYFDDPTDVENRPVTEPILAYRDGDYEARTHDIDLDVDDSENLKTLMSAFYKKRHS
FT                   SPRRRFQRLVLLLIPTFANFKDSSWINKIFILSSAPIVLSLTLTIPVRLISDFQDIPES
FT                   ETIEGSGTTTNRTTSLRAQVSLLITQAFFSFLLLTFATVGTSDGFAIYVVFSLICSSIV
FT                   SMIIYSVLVSPVSKSPTKSSNLVNIALSFIGFASSIAWISIFAEELINIFKFYSVFFKI
FT                   SEAILGLTIFAIGNSIGDFISNLTIAKMGMPLMALAACFGGPLLNLLMGIGVNGLIVLL
FT                   SNNETSFHIDISSTLFTSSLFLLLSLVFLLVAIPLNNWYFERWIGTVIVAFWCVGTTIN
FT                   VLIELFGY"
FT   CDS_pept        448741..450153
FT                   /locus_tag="PAS_chr3_0223"
FT                   /product="non-ATPase regulatory subunit of the 26S
FT                   proteasome lid"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70231"
FT                   /db_xref="GOA:C4R3W9"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR013586"
FT                   /db_xref="InterPro:IPR035267"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3W9"
FT                   /protein_id="CAY70231.1"
FT                   /translation="MSSTTEETIPTNEDIELRFQLIQKSVSHFDPRFTLKVFRELGPLR
FT                   RRLDVNSLLQVVEKNYPQDENRQYLKDILVKLGAHSSQEGDHMEVDSGSVNTVLPEIDI
FT                   FIHVLILIYLHDHKEIKLANKFVPFTISALKSYNRRTLDYISSRAWFYIARIKELAGEL
FT                   TSIRPDLLLALRTSTLRHDIGTRASTITLLLRNYILSNDINQASNLVEKTEFPEDASNA
FT                   LVARYYYYLARIHAVQLAYSTAHNYAVTSIRKAPQSELATGFLQTATKLNILVELLMGE
FT                   IPSLDTFRDPKLEKSLLPYLAVTRAVRLGDLNLFNKALAEYGDTFKDEKNYNLVLKLRQ
FT                   NVIKTGIRIISLAYTRISLKDICIKLHLDSELSAEYIVAKSIRDGVIEATIDHEKGYMQ
FT                   SKEVLDVYSTREPQSVFDERIKFCMQLHNESVKAMRYPLSANRIDNKNAPDNKDSEEEL
FT                   LAYSLSVFDDEL"
FT   CDS_pept        450270..451046
FT                   /locus_tag="PAS_chr3_1165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1165"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70233"
FT                   /db_xref="GOA:C4R3X0"
FT                   /db_xref="InterPro:IPR016689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3X0"
FT                   /protein_id="CAY70233.1"
FT                   /translation="MKRLGLSALDNVQNHNQRYQEVGKKLLEDQTNQLQTQLTVFQNGL
FT                   ISFIKEHKKDIEDDPKFRTEFSQICLNFGVDPLAAFSIAYNGEGGQSTEKSKQKVVKND
FT                   STANQSEQDFYNDLGIKIMEICQDTADINGGVISIKEILQILSNKPLTKLFGIQLTQDD
FT                   IVKSINALTEALGTELQIITIGHKLYCKSVPQELNKDNSTVLETCGNIGFVTVSLLIDN
FT                   FRWKKARATTVLEDMVANGLLWIDEQASEIQYWELS"
FT   CDS_pept        complement(451071..453587)
FT                   /locus_tag="PAS_chr3_0224"
FT                   /product="DNA-dependent ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70235"
FT                   /db_xref="GOA:C4R3X1"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR013967"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3X1"
FT                   /protein_id="CAY70235.1"
FT                   /translation="MAKKLHKPTNELGTGAGLPLDKRPRPVSNPLAIISRPFKIPVARD
FT                   TSRNHSTLNGRQVRKARLKGPSSYALMEIDTNIVADSDLSVGADGEVVVRGKKGALTSR
FT                   RMLDSEGRSSPILNKKFTVPIKIDKENAFERQNSQPPPPLGTKRKPTLPPRPLHDPMSE
FT                   YAIVLYDPTVDIIPEIKEEDDRLRKEQEELEMERKKAEQITNKNKRIKPGKSLAEILGI
FT                   AKDGSSLKKYPNVPVVIDPKLAKILRPHQISGVKFLFRCTSGLVDASAKGCIMADEMGL
FT                   GKTLQCIALLWTLLRQSPRGTKTIEKAIVVCPSSLVKNWANEFDKWLGKGTLTPLAIDG
FT                   KSAKGSTISSQLSQWAMATGRNIVRPVLIVSYETLRRNVESLKGTKVGLMLADEGHRLK
FT                   NGDSLTFTALNSLDCERRVILSGTPIQNDLSEYFSLLTFANPGLLGTRNEFRKNYENPI
FT                   LRGRDSLADDKEREKGDQKLKELTEIVARFIIRRTNDILSKYLPVKYEYVIFCNLSETQ
FT                   KSLYQRFTASKSISKLVKEVGGGAQSLQSIGLLKKLCTHPNLLNLPEDIEGCENLLPDD
FT                   YDYGHGNRRNREVQVWHSSKFLILQRFLYKINKETNDKIVIISNYTQTLDLIEKLCISS
FT                   RYGSLRLDGTMNINKRQKLVDKFNNPEGKEFVFLLSSKAGGCGINLIGANRLILVDPDW
FT                   NPASDQQALARVWRDGQTKNCFIYRFIATGSIEEKIFQRQSAKLQLSSCVVDSNDDVER
FT                   LFSADNLKQLFQFKENTFSETHSTYNCKRCHPDGKQFIKSSAMLYGDPTTWNHIHPGSL
FT                   ASNEDTLIANEAQFNDISYCFQYISH"
FT   CDS_pept        453965..455437
FT                   /locus_tag="PAS_chr3_0225"
FT                   /product="Soluble fumarate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70237"
FT                   /db_xref="GOA:C4R3X2"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR010960"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3X2"
FT                   /protein_id="CAY70237.1"
FT                   /translation="MSVIPLFPNLPPNPIIVVGGGLAGVTAAIQSVNSGANVVLVEKEA
FT                   KLGGNSMKASSGISGALTSQQISLHVNDSVDSFLEDSILSARSGKDHARSLLEILTDES
FT                   ADAIKWLTKVCKIDLSTVSLLGGHSQPRTHRGLSKPPGFAITSTVISILSDISERYPQN
FT                   VKVINQAKLTDIIVHDHEVDGVVIEFQDSKYRILGPVILASGGYSANKELISKFRPELS
FT                   SLPTTNGPYASGDVLSLALEKGIAGIDLDKIQVHPTALVPFDSKIVKDDQFLILGAEML
FT                   RGAGGLLLNARGERFCNELGTRDYVSAAIENTIKETGDDRVLLVLNEEAAKQLQLNVQF
FT                   YTAKGLMKKLTAEELIEEIGCDQQDLHQTFSNYNLFADLQRDEFGKVHFPNIPFNLLNS
FT                   ESAQESFYVSYVSRAVHFTMGGLKFNGNAEIEHQDGRVVSGLFGAGEVTGGLHGDNRLG
FT                   GNSLLECVVFGKRAALTASSYLLKSLSNYHKL"
FT   CDS_pept        455581..457113
FT                   /locus_tag="PAS_chr3_0226"
FT                   /product="Vacuolar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70238"
FT                   /db_xref="GOA:C4R3X3"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3X3"
FT                   /protein_id="CAY70238.1"
FT                   /translation="MNLNKTNSTGIHSVTSEALSRRSSRRSSILDLVASPTLTDYTSSW
FT                   KRSQSFGHLDVSDLRETLSRKNSNRTELSIDEETSLISGRHPINKYHYPESTIEEEDED
FT                   RLLSIGLDKSNNHQTILNAVNVLIGIGLLSLPLGLYLSGWILGITFLSGAAFLTKYTAI
FT                   LLGRCTERDPALRSYNDIGKKVLGRKVNYAILLVFLIDLLGGAASLAILFVDSLSSFFP
FT                   EVSRKALRLVFGGVVIVFNFLPLSGLSFLSFIGIVSTSSVAVIVVVSGLLKKEAPGSIF
FT                   QPEVTNFWPTSFVNVLIAYGIFLCPFGGHPVLVELYRDMRTPEDYPSCMSKSFSFTLVV
FT                   NLFIGVFGFLMFGMDADSEITRSIMLTEGFPKWIPTVVCLFMTLLPLSKTPLVLRPVVT
FT                   AIDDLTFSETELLNSSQGIISPSTQVKRIFSRITAVVIAIMLSVTFNSFSQVLAILGSF
FT                   ICTTICIILPTTFYILLFKDELSYNQKAGFKLVIFVFIILAIMGTIAAALYA"
FT   CDS_pept        join(457382..457487,457561..458996)
FT                   /locus_tag="PAS_chr3_1166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1166"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70240"
FT                   /db_xref="GOA:C4R3X4"
FT                   /db_xref="InterPro:IPR006910"
FT                   /db_xref="InterPro:IPR039781"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3X4"
FT                   /protein_id="CAY70240.1"
FT                   /translation="MCKFINNNRSISLRFTSNLLFGVTVCYKKKIEYFYNDTIIAKTKL
FT                   SKKLFTPYVTFNKYVVPKQKKNILSDDPCFNIEVDILQKVSYLQDISPSNSINLNDIEN
FT                   ENLSSIFEGNAENHQSLKGNTFEGRDININNLDLDDIIPDVDFLFDGQEFASVHGNDKD
FT                   HESSFVAAENVDLGLEFDVLNLQTENEGDSNALNTEPKSPQKKDTVPKKLSKRQLVFDN
FT                   KITVSVSEFNDWTGNYLQRMIPENVTKTNAKMLKETNPFTTLLSQLSPSGKAAPDETLD
FT                   AYVRNAASRRESTTSNELEYARNQSHSRHSSRTSLASFNLNENILDEMNQDEHYEQPLN
FT                   NDSYFEENDSFFDIPDFRLRIGNSSSSSSTISRRRPTSTLDGFNRHNIIDEALYEQSFD
FT                   AEFTTHDSLYNHLEDKAPSNPRDERFYHFLRNKSSIVGQRKVNPISNKVFSKVTFQELV
FT                   SSNITEAGCNKSIAASVFYGILTLATHNLVAIDHEPLQNYGILEGKDITITLIVG"
FT   CDS_pept        complement(459104..460012)
FT                   /locus_tag="PAS_chr3_0227"
FT                   /product="Primary component of eisosomes"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70242"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR028245"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3X5"
FT                   /protein_id="CAY70242.1"
FT                   /translation="MHRTYSLRSGRAPTAADVNNPPPPTSTTKSKFFGKNSIASSLRKN
FT                   AAGAFGPELSKKLAQLIKIEKNLERSIELVARERRTVAKQLSLWGEENDDDVSDVTDKL
FT                   GVLIYEIGELEDQFVDKYDQYRITLKSIRNIESSVQPSRDRKQKITDEIAHLKYKDPQS
FT                   PKIPVLEQELVRAEAESLVAEAQLSNITREKLKAAFNYQFDALAELSEKLALIAGYGKA
FT                   LLELLDDSPVTPGETRPAYDGYEASKQIIIDAENALSSWTQDNAAVRPSLSIRNSEYDE
FT                   EPNEEWEEKEEGDETRDETQA"
FT   CDS_pept        complement(460386..461516)
FT                   /locus_tag="PAS_chr3_0228"
FT                   /product="Catalytic subunit of the Hat1p-Hat2p histone
FT                   acetyltransferase complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70244"
FT                   /db_xref="GOA:C4R3X6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017380"
FT                   /db_xref="InterPro:IPR019467"
FT                   /db_xref="InterPro:IPR037113"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3X6"
FT                   /protein_id="CAY70244.1"
FT                   /translation="MTDLSSLDPNIYTSSSNEALSISLAGNGKAVSFHPDFTYPIFGDA
FT                   EQIFGYKDLVIHLVFDSMSLYPFLNVRYSEKRDDADEVESKLLELLPEETVVKDEALWQ
FT                   DKIDGENFEIPGEILSTYTHKDENYHVYKLSINKCAESLQLHRRMQIFVLFFIEAGSYI
FT                   DAKDDMWEIYVVYKEDKTFIGFATGYSYWKYPGHEIFDSDAKYLWRKKISQFVILPPYQ
FT                   GQSHGSQLYKTIFEQWFKDDQVAEITVEDPSEAFDDLRDRCDLERLYQRGLLETLPEPV
FT                   ISPEWFQTQQAKEKIEKRQFQRCVEMLLLHALKSKKNTRLQIKKRLFIKNRDALLDLDE
FT                   ATRKDKLQVAYERLEEDYQRILEKVRFVKKRPHQDT"
FT   CDS_pept        461789..462604
FT                   /locus_tag="PAS_chr3_0229"
FT                   /product="Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70246"
FT                   /db_xref="GOA:C4R3X7"
FT                   /db_xref="InterPro:IPR005344"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3X7"
FT                   /protein_id="CAY70246.1"
FT                   /translation="MPPPQPKRQGLLQLAKSAQLYWFLGHAFAILFTALTFATSFFRSP
FT                   FSDTPLGFYKNALNAIIITYVIVLRQVHKGKPVTMIISQLRSLLKESNVQYLLLALVFR
FT                   LTATDPGPVFGGLYPFTIYSLFHFLNYLDTTLLATLPVSNADQVRNLIRMFVSSYNEKS
FT                   MYLAASCELFLVPSLLLSSLKSIILLEWYRAPFSFIRQLIVVFSVISFLRLRYQQNVYM
FT                   KQLVDSYDLKISQLLYHPQLPQGFRLGYLRFKSLLTSTLGYLELEKKTR"
FT   CDS_pept        463134..465107
FT                   /locus_tag="PAS_chr3_0230"
FT                   /product="ATPase involved in protein folding and the
FT                   response to stress"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70247"
FT                   /db_xref="GOA:C4R3X8"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3X8"
FT                   /protein_id="CAY70247.1"
FT                   /translation="MGKSIGIDLGTTYSCVAHFANDRVEIIANDQGNRTTPSFVAFTDT
FT                   ERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDDPETQADIKHFPFKVINKGGKPNIQVE
FT                   FKGETKVFSPEEISSMVLTKMKDTAEQYLGEKINDAVVTVPAYFNDSQRQATKDAGLIA
FT                   GLNVQRIINEPTAAAIAYGLDKKDAGHGEHNILIFDLGGGTFDVSLLSIDEGIFEVKAT
FT                   AGDTHLGGEDFDNRLVNHFIAEFKRKTKKDLSTNQRSLRRLRTACERAKRTLSSSAQTS
FT                   IEIDSLFEGIDFYTSITRARFEELCADLFRSTIEPVERVLKDSKLDKSQVHEIVLVGGS
FT                   TRIPKVQKLVSDFFNGKEPNKSINPDEAVAYGAAVQAAILSGDTSSKTQDLLLLDVAPL
FT                   SLGIETAGGIMTKLIPRNSTIPAKKSEIFSTYADNQPGVLIQVFEGERTRTKDNNLLGK
FT                   FELSGIPPAPRGVPQIEVTFDMDANGILNVSAVEKGTGKTQKITITNDKGRLSKEDIER
FT                   MVSEAEKFKDEDEKEAERVAAKNGLESYAYSLKNSAAESGFKDKVGEDDLAKLNKSVEE
FT                   TISWLDESQSASTDEYKDRQKELEEVANPIMSKFYGAAGGAPGGAPGGFPGGFPGGAGA
FT                   AGGAPGGAAPGGDSGPTVEEVD"
FT   CDS_pept        465380..465991
FT                   /locus_tag="PAS_chr3_1167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1167"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70249"
FT                   /db_xref="GOA:C4R3X9"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3X9"
FT                   /protein_id="CAY70249.1"
FT                   /translation="MNSEYDYLFKLLLIGDSGVGKSCLLLRFAEDTYTQDYISTIGVDF
FT                   KIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVNQWLQ
FT                   EIDRYATGGVMKLLVGNKSDLKDKKVVDYTVAKEFADALEIPLIETSALDSTNVEQAFF
FT                   NMARQIKSQMVNNQAGSGTEKASINLRGQSVGGSQNSSCC"
FT   CDS_pept        466178..466732
FT                   /locus_tag="PAS_chr3_1168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1168"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70251"
FT                   /db_xref="GOA:C4R3Y0"
FT                   /db_xref="InterPro:IPR008506"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3Y0"
FT                   /protein_id="CAY70251.1"
FT                   /translation="MAGNAEKKQATKNTKILKEIHLISLGVNALTLLIIFLLNRPSNKK
FT                   PFFFFNVPLVICELIVEKIGRPRFTLEKVSGGRTVPKLVSSGEDLSQSGLTEYLFDIIY
FT                   FTLLQNIVLVILGTNNVWYLSLVIPAFAAYKLYGLFLGGRQLLGGRSSFKEEEPASGSK
FT                   EKGQSKRQQKLEKRGQKVRYR"
FT   CDS_pept        join(467400..467409,467749..467762,468021..469127)
FT                   /locus_tag="PAS_chr3_1169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1169"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70252"
FT                   /db_xref="GOA:Q9P4D1"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR004001"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="PDB:4PL7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P4D1"
FT                   /protein_id="CAY70252.1"
FT                   /translation="MDGEDVAALVIDNGSGMCKAGYAGDDAPHTVFPSVVGRPRHQGVM
FT                   VGMGQKDSFVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRLAPEEHPV
FT                   LLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYASGRTTGIVLDSGDGVTHV
FT                   VPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYTFSTSAEREIVRDIKEKLCYVAL
FT                   DFDQELQTSSQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLEASGIDQTTYN
FT                   SIMKCDVDVRKELYSNIVMSGGTTMFPGIAERMQKELTALAPSSMKVKISAPPERKYSV
FT                   WIGGSILASLGTFQQMWISKQEYDESGPSIVHLKCF"
FT   CDS_pept        complement(469165..470121)
FT                   /locus_tag="PAS_chr3_0231"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70253"
FT                   /db_xref="GOA:C4R3Y2"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3Y2"
FT                   /protein_id="CAY70253.1"
FT                   /translation="MTIKKDSNVANSPRVWTTLITNTAYLPGLLNLDYSLKKVGSKYPL
FT                   VALYTDTFGPEGHAELDARNIPKLRIEYLLPLESKDYSNDTRFYDCWTKLQPFSLVQFE
FT                   RVVQIDSDMLVVQNMDELMELDLGNYDFAATHACVCNPYKKPHYPSDWIATNCAYSSGN
FT                   HQQRAKISPHLLEFAEEYNLVGPPATLSLGTCNGGLQVVNPSKERYEKIISALSAPEKT
FT                   SNYEFADQSLLSDVFRGNWLPLSYKYNALKTLATFHSDLWKPEEVKNIHYIITPKPWDV
FT                   TSNDEKFQDDTGTFVHWWKINEQRLEAERQVDTTNQS"
FT   CDS_pept        470570..472141
FT                   /locus_tag="PAS_chr3_0232"
FT                   /product="Transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70255"
FT                   /db_xref="GOA:C4R3Y3"
FT                   /db_xref="InterPro:IPR001083"
FT                   /db_xref="InterPro:IPR036395"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3Y3"
FT                   /protein_id="CAY70255.1"
FT                   /translation="MVLINGVKYACERCIRGHRVSACTHTDQPLVMIKPKGRPSSQCAF
FT                   CREQRKLRNHHAKCTCGKKTNTKMKYHENGCACSNDVGTVKLEGHCTCCHPKKKKSPPE
FT                   KEKLDEQDKTKNPGHKLKTDTKNGDDLFLEQQPINSELVSWDMGLSPSVSTSIMEYPSS
FT                   TNLLAQVEKSMSSGSAVSGPRQVGMEQLDNFHRVGDDTKHAGEISVPLTEYTQPLLSMD
FT                   QNLNHLLRDRKLDDALSSASREASRSASRASRRAGDNEETPNTYQNIPYPFSSGGLLEM
FT                   LNEEKSYKSEIHSSRTASKQQQYPLQPQSTWNSGGNTSTNTNGAASFGPEEVFPLYPLI
FT                   GPGGTPDYEPYTSPPSNLQANLTGSSHISSKSGTYSSHAPHHHGHHHHHHLMHQFTPYS
FT                   APKPANSIHSSSSSVSIGAQVPGSVSPSLSSQRSFRSMDSTDSLVGFQLNNTKTNATLT
FT                   RLDEEFGDMPMMKPVATVVMDDILAGPSNIGENGNLPGNNETGTLSEEQPDDFFFGLDM
FT                   GVPLNR"
FT   CDS_pept        472348..473124
FT                   /locus_tag="PAS_chr3_0233"
FT                   /product="Proliferating cell nuclear antigen (PCNA)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70256"
FT                   /db_xref="GOA:C4R3Y4"
FT                   /db_xref="InterPro:IPR000730"
FT                   /db_xref="InterPro:IPR022648"
FT                   /db_xref="InterPro:IPR022649"
FT                   /db_xref="InterPro:IPR022659"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3Y4"
FT                   /protein_id="CAY70256.1"
FT                   /translation="MLEGKFEEASLLKKIVEAMKDCVSSCNFNCTENGISVQAVDNSRV
FT                   LLISLLIEKDTFEEYRCDRNITLGVGLGSLSKIIGNGANSDYLTISADDDADKLNIIFE
FT                   DKVKDKISEYNLKLLDIDADLLDVGPMDTDATITLPSADFAKICKDMKVLSESLQIIVT
FT                   KDSALFQSVGDIGTGNIVIRPKTDIDHPEESVTISLDKPIDLSFGSKYLSDIIKATSLS
FT                   QKVTIKLTDQSPGVFEYKLPSGYLRFYLAPKFDESN"
FT   CDS_pept        complement(473178..473702)
FT                   /locus_tag="PAS_chr3_0234"
FT                   /product="Catalytic subunit of N-terminal acetyltransferase
FT                   of the NatC type"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70258"
FT                   /db_xref="GOA:C4R3Y5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3Y5"
FT                   /protein_id="CAY70258.1"
FT                   /translation="MISYKHLEFHPEKPTDNNEINQIIELVKVNLSEPYCIYTYRYFLN
FT                   QCPQLCYIAYDDEKPKGQNIIAVSISKAETHQGVRVRGYLGMIAVDPAYRGKGIAKTLI
FT                   DKSIDVMIDSYHCDEIVLETEVDNPQALNLYESFGFIRTRRLFRYYLNKNDAYRLVLPL
FT                   TEKSTIRTYFL"
FT   CDS_pept        complement(473969..474811)
FT                   /locus_tag="PAS_chr3_0235"
FT                   /product="Zinc-finger protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70260"
FT                   /db_xref="GOA:C4R3Y6"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3Y6"
FT                   /protein_id="CAY70260.1"
FT                   /translation="MSVMNFHNSTMFMSQQPNNSYQLPPLLPPPLPLAYASAPNHPGHA
FT                   IPYPINTIPSTHPTTTTTTTIVPPNNNTLTLRGSPPYFDHLPHFKHVLPPISLPIVPPL
FT                   VPELHPVEVNDQKVRKTKTPRKKRQCPECHLFFSNLATHKSTHLSVMARPHLCPTCHRG
FT                   FARPNDLIRHKKRHLQDLGENGYKCPFYSFDNKEQGPEKSTTPKCHSKGVFSRCDTYKN
FT                   HLKALHFEYPTGTKKKDRSSVAGHCKSCYQRFNTLDEWLTNHIEKGQCPNMHLENLHK"
FT   CDS_pept        complement(475354..476346)
FT                   /locus_tag="PAS_chr3_0236"
FT                   /product="Elongase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70261"
FT                   /db_xref="GOA:C4R3Y7"
FT                   /db_xref="InterPro:IPR002076"
FT                   /db_xref="InterPro:IPR030457"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3Y7"
FT                   /protein_id="CAY70261.1"
FT                   /translation="MSDINTLSQKIPSYVQYGIPSIDHPFGIRLWPIFSHFFEAVVGYP
FT                   AEDFRFIQGLTTMANLKDALGVIAVYYFVIFGGQWLMRTLNARPFKLNFLFQLHNLVLT
FT                   GASFTLLILIVEQLIPGIYRHGIFWAICHKDSFTNELVTLYYLNYLIKYVELIDTVFLV
FT                   LKRKKLLFLHTYHHGATALLCYTQLLGHTAVEWVPIALNLAVHVVLYWYYFLSARGIRV
FT                   WWKQWVTRFQIIQFLIDLGFVYFATYTFYADKYFPELPNMGTCYGTEEAAAFGYLILTS
FT                   YLVLFILFYIRVYKSGPTTSKGKSKAAATTGQKTETASPSGKSTSVRRA"
FT   CDS_pept        join(481331..481336,481396..481917)
FT                   /locus_tag="PAS_chr3_0238"
FT                   /product="Subunit of the ARP2/3 complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70263"
FT                   /db_xref="GOA:C4R3Y8"
FT                   /db_xref="InterPro:IPR007204"
FT                   /db_xref="InterPro:IPR036753"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3Y8"
FT                   /protein_id="CAY70263.1"
FT                   /translation="MPAYHSTFLNESSDFRVVGNTSILPIKTKFRGPAYPSNSDYDIID
FT                   ECLDLFRANSFFKNFEIKGPADRLLIYGILFISSCLQQLKSNTTKNEAVRILSNLSLDD
FT                   FSIPGDVGFPLNSLYQPPRDKTEADLLRGYVQQFRQELATRLIERLYSESDSKPSKYWL
FT                   AFTRRRFMNKSL"
FT   CDS_pept        482144..483025
FT                   /locus_tag="PAS_chr3_0239"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70264"
FT                   /db_xref="InterPro:IPR031349"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3Y9"
FT                   /protein_id="CAY70264.1"
FT                   /translation="MSTPITPPHPNANSEVDLTNIREIPRELENELQLNPDLSDDEEEP
FT                   IKIEQDKSFKEEDVYKSDTFKQDLTEELVLDFKLPSGLGPALSLTQQSRFISFVDDKLL
FT                   QIQRNFIKYLSEEDSTYTLSQLIRQINETISILWYSIFRVEQIPVVFHSAILGRNSTSL
FT                   NHASSVDLFGQPHYFIRIIGDLIDYVEKFPLSSVDELRELLALVAKLDNVVIVLVDQDT
FT                   VSTPSAKKDFIDKTEKVRLLSLATRFKLLLLSKYEELKTVRHPITAEFNIWPEYDQLVG
FT                   QVYEGIIDRTSI"
FT   CDS_pept        483172..483882
FT                   /locus_tag="PAS_chr3_1170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1170"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70266"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3Z0"
FT                   /protein_id="CAY70266.1"
FT                   /translation="MVWPFTSKKIQTRDEFRIPNDLDELLKQEEPTLSEREFKSNLKHL
FT                   SELTNHRPIDPNPTLVPKDSTAEEQSEILPSEPKDKIFTVKTALFENGPLLPDSRQDPK
FT                   PLTQEQLKNARELSQYKRENPLHASVLVNCAELQLAFLNCLTDGKFAERMRGCNVKNNF
FT                   YQSCLTKQSMIFKFFDYNSMTSIREFEEIKYVADSLFTKYYQCYDDLFEEEKNEKFTKE
FT                   LRAKREEFHSKFGK"
FT   CDS_pept        484244..485623
FT                   /locus_tag="PAS_chr3_0240"
FT                   /product="Essential protein required for biogenesis of 40S
FT                   (small) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70267"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007287"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3Z1"
FT                   /protein_id="CAY70267.1"
FT                   /translation="MKIKTISRSSDAYVPVRNTEESAIPRNLNPALHPFERAREYTKAL
FT                   TATKLERMFAQPFIGQLGKSHRDGVYTLAKNFKIVNRVASGSGDGVIKYWDLTSRDEIV
FT                   SFKAHYGMVSGLCVTPSQKLLSCGDDKTIKMWNINNETMYGQNLTDDQETKVSSQGLVK
FT                   TYLGEHSFKTIDHHRENDVFVTGGRRINLWDVNRKSPVSDLSWGADNIVSVKFNMSETS
FT                   VIASTGSDNSIVLYDIRTNSPTQKVRTSMRSNALCWNPIEPFSFVSASEDHNCYLWDMR
FT                   NLSRSSNIYKDHVSAVMDVDFSPTGQELVTGSYDKTIRIYETTKGHSRDIYHTKRMQHV
FT                   FVTKFSMDSKYILSGSDDGNVRLWRSRASERSGVKSSRLKTRLHYDDKLKEKFAALPEV
FT                   RRIARHRHLSQVIKSAQEIKRTELQSLKRREENERKHSKPGTVVTKPEKEKHIVGTVHK
FT                   K"
FT   CDS_pept        complement(485768..486904)
FT                   /locus_tag="PAS_chr3_0241"
FT                   /product="Plasma membrane associated protein phosphatase
FT                   involved in the general stress response"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70269"
FT                   /db_xref="GOA:C4R3Z2"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011948"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3Z2"
FT                   /protein_id="CAY70269.1"
FT                   /translation="MSFFSFLCCSSPSNDRKLKSEITYSKPLSSTQKNLRKTLERDNMN
FT                   IRGKPAGPSKPTQKATLVVAARSDDNKSSESKETVTIKESSSSSGETNNAHTDQDGDLV
FT                   MKGSEPFSNSSSPKFSSGKLPTVESDTVNQEYEHDLDNEHNKTINENEANPLSNISSNS
FT                   ELPVLNNDEFDYLSNELDLTEIQPGQVVASSGWLLNPAPSNLKKRKCLILDLDETLVHS
FT                   SFKYIRQCDFVIPVEIENQVHNVYVIKRPGVDQFLKRCGELYEVVVFTASVSRYGDPLL
FT                   DILDQHKSIHHRLFRESCYNYQGNYIKNLSQIGRPLEDLIIIDNSPASYIFHPQHSVPV
FT                   SSWFSDTHDSELIDLLPFLEDLARDKVDNVSLVLDVNI"
FT   CDS_pept        complement(487726..490017)
FT                   /locus_tag="PAS_chr3_0242"
FT                   /product="Topoisomerase I"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70271"
FT                   /db_xref="GOA:C4R3Z3"
FT                   /db_xref="InterPro:IPR001631"
FT                   /db_xref="InterPro:IPR008336"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013030"
FT                   /db_xref="InterPro:IPR013034"
FT                   /db_xref="InterPro:IPR013499"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR014727"
FT                   /db_xref="InterPro:IPR018521"
FT                   /db_xref="InterPro:IPR025834"
FT                   /db_xref="InterPro:IPR036202"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3Z3"
FT                   /protein_id="CAY70271.1"
FT                   /translation="MATEKRQSTPALSESHDGFSVTESLSNTDDTSMKDETSDSPVPPV
FT                   SPIKTKSHKRKTSDESEKKRKKKKTEKHKHKHKSGTKKESDDDLETVKTSKEKKKRVKK
FT                   EETPLDSQSSQAIEMKDEEEEKYKWWEENNDNDEIKWHSLKHNGVLFPPEHVPLPSHVK
FT                   LYYDKKPVDLPIQAEEVACFFGAMLNTEHAQNPAFQNNFFSDFKKIVLEHGGANVEIES
FT                   FDKCDFSKIFDHYETQKSLKKSLTAAQKREIKSEKDKFEEKYKYCLLNGRRERVGNFRI
FT                   EPPGLFRGRGSHPKTGRVKKRIYPEDVSLNLSEDAPIPPPPEGHQWKEIKHDNTVAWLA
FT                   TWRENVTNTVKYVLFAADSSLKGRSDFKKFEKARELKKYIHRIRKDYKKNFSSKVMLER
FT                   QMAVATYLIDVFALRAGGEKAEDEADTVGCCSLRYEHVTLKPPNTVVFDFLGKDSIRYY
FT                   QEVNVHEKVFKNLRLFKKSPKQPGDDLFDRLTPNILNKHLQNYLPGLSAKVFRTYNASK
FT                   TMQDQLDLIPNEGSVGEKVVKYNAANREVAILCNHQRTKPKSHDMGVQRISDNIRELFW
FT                   QKLRLKRMILELDKSLKKTKPYYFEELDDLSVEEEQAIQDRVIAKEREKATKKFTRDNE
FT                   KLKTEDSPLLPEAMLEEKLKKIDELAAEYKKELKTRKPEIKSVTVTVEKLESQVEKLEQ
FT                   RIRNATLLLQDKEDNSQVALGTSKLNYIDPRLTAMFSKKYDVPIEKLFSKTLREKFAWA
FT                   IESADENWTF"
FT   CDS_pept        490478..492508
FT                   /locus_tag="PAS_chr3_0243"
FT                   /product="Polo-like kinase with similarity to Xenopus Plx1
FT                   and S. pombe Plo1p"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70273"
FT                   /db_xref="GOA:C4R3Z4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000959"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR033695"
FT                   /db_xref="InterPro:IPR033701"
FT                   /db_xref="InterPro:IPR036947"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3Z4"
FT                   /protein_id="CAY70273.1"
FT                   /translation="MASARGSLPLQSLNNGQINSRSNAFNVQTPIKTGPLKPPGPAATA
FT                   NQIAQQQDQKKKKKKEKLSSLCKTPPSIVRTRTGIGYHRGLFLGEGGFARCFQMKDESG
FT                   KLFAAKTVAKASIKSEKTKTKLLSEIKIHKSMVHPNIVRFIDCFEDDVNVYILLEMCPN
FT                   QSLMELLKTRKALTEPEVRFIMVQIIGAVKYLHSRRVIHRDLKLGNIFFDPDMNLKIGD
FT                   FGLASVLPSKGSRKYTICGTPNYIAPEVLGGKAVGHSFEVDVWAIGIMMYALLFGKPPF
FT                   QSKDVQVIYEKIKKNDYIFNPTKDVSYQAKVLIKDILATNPLERPSLDEILEYSWFRNG
FT                   SFPSSFTVESLTQTPRNVMDISKEESAKNLAAAKAKAGFNEWHRNPVQILKSDLESERP
FT                   KALLPTSLSPSNVKQKYEEVSPVIASRETRPKTKIEQVSKIINNHPILLEKLNHNITST
FT                   LENMQTIQEYIRTGNSVKQFIDIDHERPVLVSKWVDYSNKHGFSYQLSTNDIGVLFNNG
FT                   STVLKISDEESLWHIIIDNSYGWTAHRYLAHDIPTRLKKEIEVVDFFSKYMKANLCEVS
FT                   EHSGKNVNDDVFLRRYTREDHCIMFELSNGSFQFNFKDHHKLCLSSNGLVITHLSPHRT
FT                   IETYPLAQVLEKGDFPGASDPMFAVKWEYMIASLRNKLEMQ"
FT   CDS_pept        complement(join(492700..493003,493063..493115))
FT                   /locus_tag="PAS_chr3_0244"
FT                   /product="RNA polymerase II subunit B12.5"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70274"
FT                   /db_xref="GOA:C4R3Z5"
FT                   /db_xref="InterPro:IPR008193"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR037685"
FT                   /db_xref="PDB:5X4Z"
FT                   /db_xref="PDB:5X50"
FT                   /db_xref="PDB:5X51"
FT                   /db_xref="PDB:5XOG"
FT                   /db_xref="PDB:5XON"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3Z5"
FT                   /protein_id="CAY70274.1"
FT                   /translation="MNAPDRFELFILPDDVPKLKITPDSRVPNCIIIKFEREDHTLANL
FT                   LREELALYPDVTFVAYKVEHPLFANFVMRLQTEEGTRPKQALERACASIINKLKTLDHK
FT                   FNEEWNIKNFSLND"
FT   CDS_pept        join(493629..493705,493809..494010,494088..498158)
FT                   /locus_tag="PAS_chr3_0245"
FT                   /product="Component of the Sin3p-Rpd3p histone deacetylase
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70276"
FT                   /db_xref="GOA:C4R3Z6"
FT                   /db_xref="InterPro:IPR003822"
FT                   /db_xref="InterPro:IPR013194"
FT                   /db_xref="InterPro:IPR031693"
FT                   /db_xref="InterPro:IPR036600"
FT                   /db_xref="InterPro:IPR039774"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3Z6"
FT                   /protein_id="CAY70276.1"
FT                   /translation="MSGKDTWSSNNNPVKELNKNSIPPFQTPTVLPPPPSSLDKGMFPI
FT                   RAAAPDELLLTRSGQHYYPLPSLPGLGSGLNNGSHFPIPSIGPQGLSQEKDSNNNGATT
FT                   LPPPHLGSQQSPVLSQPQPQSQSQADSNPQPQQLPPPTALHASANQYRPLNVKDALSYL
FT                   DQVKVRFLDQPDVYNHFLEIMKDFKSQSIDTPGVIERVSTLFRGHPNLIQGFNTFLPQG
FT                   YKIECFVDPLNPNAIRVTTPMGTVTMTDGQSQVSLTQQPHTQLDQSPQSSSTQPKLEQD
FT                   QQASRLPSQDMLEKQLHQQQEQQHHHQQQQQIPQPHNSSLPQQLQQPQSQYLSHQGPDV
FT                   AYSQGNLSAEQVQNGAQVGFNHAISYVNKIKTRFANQPDIYKSFLEILQTYQKEQKPIN
FT                   EVYQQVTVLFQNAPDLLDDFEQFLPETSGQSLNVHQGGYEEKHNGHGTIQLPPVGNFPP
FT                   PSYGQNGNVINEAPGGKRRSISHGMHRIPSLGAAHFQGQPVGMPHDQQQQLAQIGQTQE
FT                   YPVSDLRGPVNTGPASLLMGVPQPVSTGISDSNLSEEISFFDKVKKSISNKQTYNEFLK
FT                   LINLYSQDIIDKDVLVAKVECFIGAFPELFSWFKTFVGYEEKSLHIENITFKKHQLELS
FT                   LCKSCGPSYRLLPKAETYMPCSGRDDMCWEVLNDEWVGHPTWASEESGFVAHRKNQYEE
FT                   VLFRIEEERHEYDYYMEANLRTIQTLETIANRIANMTPEEKAHFKLPPGLGHTSSTIYK
FT                   KVIRKIYDKDRGFEVIDALHENPAVAVPIILKRLKQKDEEWKRSHREWNKVWREMEQKV
FT                   FYKSLDHLGLTFKQSDKKLLTTKQLVAEVSTIKVEQSQKRLHPLTPVSKEQLQYHYKDY
FT                   DVMFDIINLVYIFLGHSSSYSQQDKKKLAEFVKFFVTTFFMLPNEQVDDALQRRKTKEA
FT                   DAEAENGDSNSASLADDEGNLSSASTESSFSSKKRPRNDGDLLRDVLKKNKKVVREATP
FT                   DSTTASPTPETYSTQADVEEKLAKPTEDWINVSGHLGEPIFDQTKERTVYNMFCNTTIY
FT                   VLYRYLNVLYERLVEVKAMTKDVDADIKGRNEVQFAKELDLLSHQLEDMGINITGDNSY
FT                   LQVLELSKKLIEGDVEHQWFEESLRQAYRNKAYKLFSIDKVIQGLTKHMHSVVSDAKNS
FT                   EMITLMAADRENSNTTARSQILYRIQVRSLMSPEDNMFKISFDKSQDRTQITFIALEDL
FT                   TLGDLKSERDKWNYYMTSYILSQPTESVPKSKINIPFLRSAIAAEDDEKSSDIQGIANS
FT                   NLKVKLDLNTYKLFFEEGSYDYFVKSSALKPQPASKKDNQEKLQHLQSLLKSGDKSAKL
FT                   LETLAKGPDEYKAFVSQLSTSEVSNTTQGGSKGDALKHSEITVDAESTIGQDDSLQEDV
FT                   FKTAVDISVDQDKTVDQSTLSEAKADNDTIPNEEEQDTQMEEGKVSR"
FT   CDS_pept        complement(498257..499447)
FT                   /locus_tag="PAS_chr3_0246"
FT                   /product="Palmitoyltransferase with autoacylation activity"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70278"
FT                   /db_xref="GOA:C4R3Z7"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="InterPro:IPR033682"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3Z7"
FT                   /protein_id="CAY70278.1"
FT                   /translation="MAVQLKWPWLGIAIPCFLISFIGYNAHYFIFTNYMTKRNQWWFQF
FT                   YLTMVWISYYLAIKKSPGTPPPNFQPEPNEWRKWCRKCNNYKPERSHHCKTCKICVLVM
FT                   DHHCPWTANCVGYQNMPHFIRFLGWVVFTTSYVLLQICKRFYFFYQNRNLPSYLFKKTE
FT                   IVFAVILFFMDTLVLVTVSALLFRTLYHITFTGMTTIESWEHERLEDQFYTNRLWRKIA
FT                   YNYYQFHKKKLPALKSWTNITGKNDERLDSMSNELAETECPTSPEYQFDDDENLVPDQF
FT                   TIDDIIFPYDTGYWSNLTNTLGPIYEWVLPWGCPHGTGYYFSKSDFYQDDQLTIPWPID
FT                   GNHTLKPDQDSKDTATSSSYQLSPYKLDDEPSPRNTDWSNDFGERMDDFGVDTDVE"
FT   CDS_pept        499558..500937
FT                   /locus_tag="PAS_chr3_0247"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70280"
FT                   /db_xref="InterPro:IPR018812"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3Z8"
FT                   /protein_id="CAY70280.1"
FT                   /translation="MLCEYENDPKLEFNAHERDVLSEIVVNENNSQESLVTTKEKIRAH
FT                   QSTEYELDTFSVKLYEDKINLASKIGRPVLDPISRWDFDVEELPYAPIVKIIDFYEFDG
FT                   TLFKSPVLNDELFRRSSIHMIESGAGLRDIDWWNFHEAWSCYTNESVRDNKKWKDCWSL
FT                   PIRELMKSSKQSDTTVCVLICSLRDAEMYNDLREVLASEDIAADAIITRPKHIPTADFK
FT                   KIVVLDFLHYYSMCQEVNIYDWDKEFLTSMDQLFLKWSNNGDSMIDGTTVITPRLYSHL
FT                   DPLIERQLVENLIDEHNRRLVEFQDQNLDCLTVRQSLLGTVYFLTQTTRIEVLKHCIEN
FT                   QKDFLPDDTDSLVFECEEIYISLNNSQSAIKALGGIGAQIRFGVSHYGSFDDQFYALKL
FT                   LGDKELPSLTKSPILLIARHTDAIVKPLDCDKITNWQVMDDLLLVNTVVGNKGYLKVKK
FT                   M"
FT   CDS_pept        501008..502189
FT                   /locus_tag="PAS_chr3_0248"
FT                   /product="Component of the chromatin assembly complex (with
FT                   Rlf2p and Msi1p)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70281"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C4R3Z9"
FT                   /protein_id="CAY70281.1"
FT                   /translation="MRWIKAKTLTVHWHDDNQPVYSCDLQQDKVEGFRRLATAGGDGNV
FT                   RIWRLIYGREDNEDRESVSSVEYLSTLAKHTQAVNCVRFDPTGEYLASGGDDGVVLIWR
FT                   LSSEGGVVLEFGQDDDDIKESWIQKITCRCNTSEIYDLCWSPDSKYILAGSMDSTVRLF
FT                   EASTGKQVATIGDHNHYVQGVAWDPLNEFVVSQSADRTICVNRVTASTSGEISVKSMAK
FT                   LSRLELANSGDSNKRTIALYHNETLQSFFRRMAFSPDGNILATPAGIFKSSDDSPESHT
FT                   VYLYGRGSLSQAPIAHLPGLKKPAVAVRFSPVKLDLIPGLPDESVFSLPYRMLLAVATQ
FT                   DSVVIYDTQQTGPLALVTNIHYAIITDLTWSSDGKTLIVASADGFCSSVGIDV"
FT   CDS_pept        502293..502766
FT                   /locus_tag="PAS_chr3_0249"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70283"
FT                   /db_xref="GOA:C4R400"
FT                   /db_xref="UniProtKB/TrEMBL:C4R400"
FT                   /protein_id="CAY70283.1"
FT                   /translation="MVDNSTIAFAVSLVAAFVFLRVFVRPPELIESRDAELKIKEAIES
FT                   RKRTATTADSKRDVSEGMVEVVKTVVPQAKDADVREVLNKTRSVERAVELLLEQVREAK
FT                   PEKSGMKEAEQKPEPVKLQNPGWADTKEERARNMELKRKQMIEQARKRCQSQG"
FT   CDS_pept        complement(502831..503307)
FT                   /locus_tag="PAS_chr3_0250"
FT                   /product="Subunit of a histone deacetylase complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70284"
FT                   /db_xref="InterPro:IPR024145"
FT                   /db_xref="InterPro:IPR025718"
FT                   /db_xref="InterPro:IPR038291"
FT                   /db_xref="UniProtKB/TrEMBL:C4R401"
FT                   /protein_id="CAY70284.1"
FT                   /translation="MPPRRDASASESESRRPHSSAPKQTKSRSHITQQVQKEFVAKYVN
FT                   SNGPNDRILPDPLDFNEYPTSNLRNYARKLIKNEQIPDCKTVFGSMLESKIGEESFSYK
FT                   KNHAPNTYRISKPQLASIVHQHFVSHLPVKESDTITNFIYKVKNQDKSFKLNIT"
FT   CDS_pept        504046..505203
FT                   /locus_tag="PAS_chr3_0251"
FT                   /product="Putative protein with sequence similarity to S.
FT                   pombe gti1+ (gluconate transport inducer 1)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70286"
FT                   /db_xref="InterPro:IPR018608"
FT                   /db_xref="UniProtKB/TrEMBL:C4R402"
FT                   /protein_id="CAY70286.1"
FT                   /translation="MQSYHGVIVTPKDAIILVDAALKKMIPQVTRRLTEFERQTQIGHG
FT                   SVFVWDEKESGMKRWTDGRSWSASRVSGSFLTYKEMENAKSGNSNSYIYGKQSESYRYK
FT                   DNGLLKQSFSVTLKNGKKLHLISYVYATYLKTLSGPNSSNKSVSSNPMSNSVGTLSGSS
FT                   SDMTQDGLLKRPSEDDRFQSLDLNSDLYPETVLNETYTLQYPPSSPISSTTSANSGGVS
FT                   KPKKSKRVASRITDERVISVPKSPSPVSSSTTPSTTAFSTMGGGASSVGSHLSTGTAGV
FT                   LRFPPQNQMMMNHQVITLPALHTPASTLPAYKVPRSYLDDPTPKNTFLLPRSHSITPIP
FT                   YVQQQQQQYFPPQQPMQHLAPPVRAPGYVSHEDGRALSALDRAFC"
FT   CDS_pept        complement(505277..506647)
FT                   /locus_tag="PAS_chr3_0252"
FT                   /product="Steryl ester hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70288"
FT                   /db_xref="GOA:C4R403"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4R403"
FT                   /protein_id="CAY70288.1"
FT                   /translation="MDTPVKSDVEDSMSQTVRGWLVVLPSVLLVLFEGLVSLITANLPK
FT                   FVLRQCTAVVRFLFGVAGDKGAKLNGDIKSTDYLGRRELLHGALDIHEMAGVFNFTIED
FT                   HIVQTDDNYLLTLHRLNPVSHGIRPNGRVLYFHHGLLMNSEIWLCREDVHENLPLHFLL
FT                   QGYDCWLGNNRGNKYSGKHLKYKPSQREFWDFSIDEFVRFDIPNNVDYILETTGKETVS
FT                   YIGFSQGTTQIMAALSVNVALNSKIDKLCVISPATTPRGLNNGLLNSILHFSPNLMYLL
FT                   FGRNILFAHAGLWAQVMYPKLYLISIDIATNFLFGWKNENMDEADKYVSYYHLYSTTSV
FT                   KTVVHWFQIMNGARLTMYKDSSSLGANFYTPEYPTRTSLAVPTIIIYGTGDSLVDIDQI
FT                   RQQLPRKYLKKVVGLEGYEHLDLIWGRRVGDVIKSVGKFLHYNELDGESGKSIIINT"
FT   CDS_pept        complement(506956..508527)
FT                   /locus_tag="PAS_chr3_0253"
FT                   /product="Acetyl-coA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70290"
FT                   /db_xref="GOA:C4R404"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:C4R404"
FT                   /protein_id="CAY70290.1"
FT                   /translation="MSSILKQRVRYAPYLKKLRTPEQCVELFKDGQYLGWSGFTGVGAP
FT                   KVIPTALADHVEKNKLQGKFQFHLFVGASAGPEEGRWAENNMILTRAPHQVGKSISRGI
FT                   NENRIQFFDKHLSMFPQDLTYGFYTKEKENDLLDYTIIEATAITEDGSIIPGPAVGGSP
FT                   EMLSVSDKVIIEVNTKTPSFEGIHDIDLPVNPPLRQPYPYTSVDQRNGRVAIPVDPSKV
FT                   VAIVESTENDKVPPNTPSDAMSKAIADNLLEFLEHEVKAGRLPENLHPLQSGIGNVANA
FT                   IIEGLAGGNFKNLSVWTEVLQDSFLDFFESGKLDFATATSIRLTESGFERLFENWDTYS
FT                   HKLCLRSQVVSNSPEIIRRLGVIAMNTPVEVDIYGHANSTNVLGSRMLNGLGGSADFLR
FT                   NAKLSIMHTPAARPSKTDPTGVSCIVPFASHVDQTEHDLDVVVTDYGLADLRGLAPKKR
FT                   AQEIIKNCAHPDYVPILQEYYDRANFYCQKKKSLHEPHILRDALKMHLNFEDFGTMKID
FT                   NWDKKF"
FT   CDS_pept        complement(509330..510640)
FT                   /locus_tag="PAS_chr3_1171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1171"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70291"
FT                   /db_xref="GOA:C4R405"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033133"
FT                   /db_xref="UniProtKB/TrEMBL:C4R405"
FT                   /protein_id="CAY70291.1"
FT                   /translation="MVSAVEPVPVRVSDRSDDLISEPSSFVFRSLSKEIYNTVHNNQET
FT                   VEEEYFCPNLDTDLHHEMAALKKALKQISEKLECLSQGGSTPSRGRPISRFQETSINFD
FT                   ALVDRIVKKDDQYASYQLQQKLECRNNQELVEIMDSIQRCSLELMVNRFGNFLIQKCFE
FT                   VLENSLIEGLIITIARNIVQVSTDAFGCHVVQKALEMIQEGHKKFLVEYLLEHLESTLL
FT                   DSSAEHVWKRVLEIKWAIHPEMEEAITAKLSSTLQSRWLQVATTPRGSLIVQNILTNLP
FT                   PTIQKTCLEELERDIPTLLTDRSGNWVIQFILQHFETSEIHQTIFQTILDNSQLYSTQM
FT                   YSSKVIQKCLKAERFKSTFIDPYIDAICSTKPSKRRKPGAKPVVIELAVDIYGSGIIRK
FT                   ILVEGSVDEKSRVNGLLQEHMETVCTTKWGSKCAAVL"
FT   CDS_pept        complement(510816..511721)
FT                   /locus_tag="PAS_chr3_0255"
FT                   /product="Mitochondrial GTP/GDP transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70292"
FT                   /db_xref="GOA:C4R406"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="InterPro:IPR040062"
FT                   /db_xref="UniProtKB/TrEMBL:C4R406"
FT                   /protein_id="CAY70292.1"
FT                   /translation="MSPTPSNADKKQSGVARILGSASAGICEIGVFHPVDTISKRLMSN
FT                   NTKVTSLSQFNKVIFREHAADPLGRRLLTLFPGLGYAACYKILQRVYKYGGQPFANEFL
FT                   TTNYRSSFEETFGKKTGKALMSATAGSLIGIGEIVLLPLDVLKIKRQTNPESFKGRGFF
FT                   KILADEGLGLYRGWGWTAARNAPGSFALFGGNAFAKEYVLGLKDYSDATWGQNFIASIF
FT                   GASASLIVSAPLDVIKTRIQNRNFDNPESGFTILKNMAKNEGITAFFKGLTPKLLTTGP
FT                   KLVFSFALAQTLIPMFDKVL"
FT   CDS_pept        511989..513620
FT                   /locus_tag="PAS_chr3_0256"
FT                   /product="mRNA 3' end processing factor"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70293"
FT                   /db_xref="GOA:C4R407"
FT                   /db_xref="InterPro:IPR002014"
FT                   /db_xref="InterPro:IPR006569"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR021605"
FT                   /db_xref="UniProtKB/TrEMBL:C4R407"
FT                   /protein_id="CAY70293.1"
FT                   /translation="MASNSIGEDFYQSLLELTFNSHPIIHSLTTIAQENMANADQIVEA
FT                   ILKRINSSAPEHKLYTLYLIDSICKNVGSPYNLMFGDSLYQLFSRCYSLVADPVRQRMI
FT                   HIFETWKVTRTPSGSPLFPPDQLAKIDRFLTEVAKPKPVMITQQSLIEQLRQLQGLVGQ
FT                   RLHSNPNDIKAKERLQILGDLLKIITSQPMSPQELTLVNTQVQGIRKDEEFKLKSPTPA
FT                   AAIPRPALSSDAMSVLGGVLQSVSMAPQYQQQQPKSPPPNILGGNVSSILSSLAESGLI
FT                   NNINSKHSNNLVSPINDILSSNDLSGSLAIDSGYINNHKPTQTEIDTLYRDKPNQCSSC
FT                   SKRFTEDDAGRQLKSLHLDWHFRINKRIKDYSNIQSRGYYLDDSAWVKFKEIEIIGYKD
FT                   SDDQTDSSNNTKISTTGGQSLNTRPAELDPAELARHYVVVPDDVTDMTTSCGICKEEMV
FT                   GKFNDDSGEWVWSNATQSGDKVYHYSCFRETQQERSLHNVVEKRERSDDSVVSAAKRPE
FT                   TSSIGSSILNIDFSKLRGLTDNLANR"
FT   CDS_pept        complement(513752..514507)
FT                   /locus_tag="PAS_chr3_0257"
FT                   /product="Adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70294"
FT                   /db_xref="GOA:C4R408"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028587"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:C4R408"
FT                   /protein_id="CAY70294.1"
FT                   /translation="MSPVEELKEYIHKLQDRVTELEIKAGVLPEPKLPAAIRMVLIGPP
FT                   GAGKGTQAPNLKEKFCACHLATGDMLRSQVQQKTELGVAAKKIMDQGGLVSDEIMVNMI
FT                   KAELDSNPECQKGFILDGFPRTIPQAEKLDSMLVESNKPLQKAVELKIDDELLVSRITG
FT                   RLVHPASGRSYHREFNPPKKDMTDDITGEPLVQRSDDNADALKKRLVTYHQQTEPIVEY
FT                   YRKRGIWAGIDASQSPKQVWGDILKCLRN"
FT   CDS_pept        join(514810..514845,514898..516121)
FT                   /locus_tag="PAS_chr3_0258"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70295"
FT                   /db_xref="UniProtKB/TrEMBL:C4R409"
FT                   /protein_id="CAY70295.1"
FT                   /translation="MGLFGRSKRKSRETLGFHKPISATDQYYLNQAQQKASDNFNIGQT
FT                   QPSRAYSLSGQAASTALYAHNQRQNSLTSYRPPSIIPAYERRTMSLNSGSLRNSQTPRM
FT                   RMNSITSTTTSVLVKTTKETLQDGSTRSITRQTIQDLGDYEIVQTTRIIPKHVVTASDN
FT                   DLEALIGDFDQDFHNEIDYIPEEDEAVEENQGNSNDTSSGYYSVYSDAEEAPTRVIPRS
FT                   NVPSPRQPIEHSDSITSSNLRKNVKFHAPPQQPKKEMKPKKSVQLTDEEMYSKAMEVAM
FT                   AKVYGDRLNSMNKRGDATNPAVTATPSLTEQSIDGKHASKEQIKIEADAQASRVQEKKG
FT                   EPASNGKSDGKFDNSHSDASTGPTTPPASTTPSPASAQRKFFKMGSSSETKRHSSTKSK
FT                   HPSPQKSQLMRRLLALFDLA"
FT   CDS_pept        516430..519183
FT                   /locus_tag="PAS_chr3_0259"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70296"
FT                   /db_xref="GOA:C4R410"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C4R410"
FT                   /protein_id="CAY70296.1"
FT                   /translation="MGPQKRYICSFCAKAFSRSEHKLRHERSHTKEKPFVCNVCDNSFV
FT                   RRDLLQRHCRTVHGMLLKENIDAAVNIKQYATGLAESSANDLVEPSPSQNPTLNTPSSV
FT                   PVGDSFLEKNIISLLTLCKKFSQVSIDLQLDNNISGYLLTYCNNFQFRPEYPSFFKVFD
FT                   TSSTVNPSPEPFSSHFLTNSSSTSSRFLSLDGNSEFLYLIICLGACEQSQSLDAIKLFN
FT                   KSWAIIINKISNQLINYNSDNFSEFIENLILLCFIYLNYFANHDFEDIDNHNIDHDNIN
FT                   IVLPCPVITLDVLFEYLNNIISTHINNNSSNPLETVEPFYWYAYVLLSKYSFIYNKSPS
FT                   SLHMFLADKFLPNTQVTMAQLLRNLSVTSLTDQPETIVSQLEYSQDDISKNVFLNNMNL
FT                   VVNHRISNIEQTLICALLNELQMIKFNDNQIRKSTSKIQHGIFNDSKNFLHNAIILANK
FT                   SFNNIYNAVSDDPGSSALPSGKETSFNDSVGATAVNIIQENNKGKLEANYPPKVADLMN
FT                   NNKFVEFVNSLILNKKKLLINCPLKFHDLLFNYLFLPLQDYNWVLLSLTLKDFMYEVES
FT                   LYNTLTSTSQHVPSENAEFDIAKFCHSSLTVPDIKSNLEKFIFHPFNKMLVVNNNLGLT
FT                   TLPLLFISLIYNNKQSFASIKSFLSLPSNKLLLLEFIIGNFLLLIRILVQRRISYSSQV
FT                   VEDTEEDTPILNVIIYLISELGSGFSAIHNSEGHKNRSYSITIGILQSQVQQSKSKKSS
FT                   GSKKYVGSENDLDVSGMTLQQILTNDDLYKFILQNIEKSLINWISILVSIQMSTTNLIL
FT                   ALNVVMKSIYASAAMEKFNGAANKSPTNFNNNHNNNNALDLATYQTNVQKPVVEHESSA
FT                   QDLPNKRIRLPPILQSPIPGSKDADYMVNGGNANNGKQDGLLWGFN"
FT   CDS_pept        complement(519238..520365)
FT                   /locus_tag="PAS_chr3_0260"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70297"
FT                   /db_xref="GOA:C4R411"
FT                   /db_xref="InterPro:IPR003656"
FT                   /db_xref="UniProtKB/TrEMBL:C4R411"
FT                   /protein_id="CAY70297.1"
FT                   /translation="MSLPPLINGFDRQTSESVESTLAQALNQYEPSVQLHNTGNAGSKN
FT                   RQQQQQQPQFVVDKSKQPVMPGASVGGTPSSLSHHNQLVHVNVGDSGPGRSGSNVDDTV
FT                   SSSPGHGSSTNAGGVVMSRASMHDESQHPRPATTSNITRVRHNRPGMKFGAKKKSWVWD
FT                   WFVQDSTDPNVAICDQCGRIIRRLPSDKGSPKKLSEHLRTHKIDKDTVIPNRDALMNNY
FT                   AANGITTQLNGSNSLTQLTSSSNNGSGYPNVSNSMVSNNQVNNNNNGPRPNVVPVGGLA
FT                   HVPQHLLSEFDISPYSQMKFHKDIMRFLTEQKLSIDVVKTHAFRQIIFTLRPDAIVDLN
FT                   DLDHIYSSFMEVLKNNAAAENKKDSRVDGPEHSWL"
FT   CDS_pept        join(520684..520745,520846..521806)
FT                   /locus_tag="PAS_chr3_0261"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70298"
FT                   /db_xref="GOA:C4R412"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR038872"
FT                   /db_xref="UniProtKB/TrEMBL:C4R412"
FT                   /protein_id="CAY70298.1"
FT                   /translation="MSLKSLKKSDLIQLAQELGLSYSSRDLKEELVENIARHFLEQDEL
FT                   ESNPKYSKFYLSIRKGSPAKKPVVYERIGSEEELEESKKGLQIDGDEGEEDDEDSEIVD
FT                   EEVEDDDEDEEGGEDNESVDSLQYKVKSLKRTLFGRLEYFKEYLLDSNELVRDVLSTPE
FT                   TVFLIELLFELALIELHYGETIPLYKVSFLPKALKKALPIRVKNLKVFNLQPLLTISFF
FT                   QLFVTWFLSSVLVPLIASYYFNFSEYLQGYKYDPVIFGIAKLILTLTVVKSSITLSDVK
FT                   DELFNEFNLPSTVLTHTYFAAKSFFLHGSVELRLIFGNVSIVSTLITTFVAFYSVLQYV
FT                   "
FT   CDS_pept        complement(521900..522508)
FT                   /locus_tag="PAS_chr3_0262"
FT                   /product="Thymidylate and uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70299"
FT                   /db_xref="GOA:C4R413"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:C4R413"
FT                   /protein_id="CAY70299.1"
FT                   /translation="MRAPLIVIEGLDRTGKSTQTAKLCHRLNGFLVKFPNRETPIGKLL
FT                   NQYLTDASNPMPLEVAHLLFSANRWEMVKNIEDLLSKGTPVVMDRYVYSGVAYSMAKGL
FT                   DIEWCLAPDKGLPKPDVTIFLKANDLDSISQREGFGEERYEVASLQTSVRNNFEILRSR
FT                   YDEWKVIIIDGKDIDQVHEHIWELVCPLTRGVTTGLNRF"
FT   CDS_pept        complement(522531..523442)
FT                   /locus_tag="PAS_chr3_1172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1172"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70300"
FT                   /db_xref="GOA:C4R414"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C4R414"
FT                   /protein_id="CAY70300.1"
FT                   /translation="MYIRKFHSLAALSKQQINHYDILGVPPHASKDEIKKRFRQLSKKY
FT                   HPDLNTHLEEPDKKANHDKFIQIVNSYEVLSDDSTKTQFDRNRGVNEEQLRKAKRQEFH
FT                   DRYYGDAKTYSHRPSGYYNTKKNRVHYGEGVRFRGKSQFHGEFNEPSNYDVPHFDYDKH
FT                   LAKNIAYEKRFTGARGYRGGDLRSHQMTHRSINHGVRKDIFIDKESGWGGVMAGLVISF
FT                   FGLSFTAWALSTKEARPGQYHREPTQKTTSKVQSSSSQTDSAPSHEFAKSPESPSKSPS
FT                   EKSPPESNSSNITSTLISRASR"
FT   CDS_pept        complement(523580..524389)
FT                   /locus_tag="PAS_chr3_0263"
FT                   /product="Mitochondrial outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70301"
FT                   /db_xref="GOA:C4R415"
FT                   /db_xref="InterPro:IPR019411"
FT                   /db_xref="InterPro:IPR027532"
FT                   /db_xref="InterPro:IPR031468"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4R415"
FT                   /protein_id="CAY70301.1"
FT                   /translation="MSLEVNWEQIASSEAIREQLVDWLNDQLKAVEVPKYLADIHVTSL
FT                   SLGSKAPEITIRDIGKPFDDFYDIEEERAGTGEGDEDDGRVAPTSTPMKHQTSGSSDQT
FT                   DASNPISPSTSHDHENDMQFVTEIKYDSDICVEVAAQLLMNYPAEKFISLPVRLKLSDL
FT                   LIHTLAVVAYVNHRVFISLLCDISENEDTDNTESHSGNLRALSSKTASRIDVVKRLKVE
FT                   SELGSYEPDNGSILRSVGKIETFLVDTIRNLLVQEVGWPNWIEFQGV"
FT   CDS_pept        524540..525664
FT                   /locus_tag="PAS_chr3_0264"
FT                   /product="Ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70302"
FT                   /db_xref="GOA:C4R416"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:C4R416"
FT                   /protein_id="CAY70302.1"
FT                   /translation="MLNRRFQSTVSSSLNKGTGIVFMNMGGPSTVKETYDFLFRLFSDG
FT                   DLIPFGRFQNILARFIASRRTPKIESYYKAIGGGSPIRKWSEYQSSKLCEKLDIISPQS
FT                   APHKPYVAFRYANPLTEDTLQKMKNDGITKAIAFSQYPQFSYSTTGSSINELYRQSKIL
FT                   DPDQSIKWTVIDRWPDHPALVKTFAAHIKDTLNRFKTENGLTDTKDVVLQFSAHSLPMD
FT                   IVNKGDSYPAEVAASVFAIMKELNFSNPYKLTWQSQVGPKPWLGAQTEKITKQLASSDV
FT                   PGVVLVPIAFTSDHIETLHELDIELIQELPNPSKVKRVESLNGDQTFIDSLAELVKSHI
FT                   DSKVVFSNQLPLDSMLGVVSDNSLTDPKEFFRAH"
FT   CDS_pept        complement(join(525717..526296,526353..529153))
FT                   /locus_tag="PAS_chr3_0265"
FT                   /product="Non-SMC subunit of the condensin complex
FT                   (Smc2p-Smc4p-Ycs4p-Brn1p-Ycg1p)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70303"
FT                   /db_xref="GOA:C4R417"
FT                   /db_xref="InterPro:IPR007673"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024324"
FT                   /db_xref="InterPro:IPR026971"
FT                   /db_xref="InterPro:IPR032682"
FT                   /db_xref="UniProtKB/TrEMBL:C4R417"
FT                   /protein_id="CAY70303.1"
FT                   /translation="MDFTFVVSEALTEFQATEKGQLTLEDSHSKLEEVTDALALSPEAI
FT                   GRSEIFDLLKDLVLASPTLNQKQRDQIGYLICSTISSIAKNTSTLIESGEVDSFPVYKK
FT                   YLELYGFLMHCHLTFLALEDHSAAVTTQKIRRATKKDVDLFKNHCLQLENALEATCTVF
FT                   GVNLERLFETTPERDLFVNLFTRPVYLLMESEQRIKVTSVKLHIFKVICIGIRNHGHAP
FT                   AAESSILQNLTYFLHLAVIMAELLDNLSEQYNYSQLTDEILRNVSLKEFNPNDANGPRS
FT                   ISLFIAKLSELNPRLVLRQMTFIAQLLDNSSHMLRCAVVEACGNIVITLAKDDISLENH
FT                   QSQIETLLKLLEQRFLDQNPYVRTKAIQALLKLCELKERFSRRRYRFLKLAVRSLNDRN
FT                   PLVRRNAIKLICKVILTHSFSAMHGPQLGLSVWQKRLVDIQEQINSLDGSFSSELIPTG
FT                   DANNTSNTINLEQDQDFEGDITMRTIEEDSTMPTPGSSEQDADKDEHNEKEVVDYEALN
FT                   KLKLTHQYYKDAIKFIKTIHRGTKLAAVILYSKNRTEVLETMDFFVLADAYGIEIAELG
FT                   VKKMLHLVWIKNNNDEGTSVSSHLMECYKQLFFTTPATATPLEKATYIASNLVALTKSA
FT                   SASDLASLEKLLCMMYTSTENDLIDDNTIKVLWKIYQAKDNSVSIEQKHGSIIILSMLS
FT                   LADNQIALRGLDQLLNIGLGGEKVEDMILARFSCVAIQRMVPQGKKIGHEKFTLERKDE
FT                   IINKLVDMAVMYSEDGEWYGAAEHALNAIFIISSHPIEVGSSLLKKKIETTFGEVLQEK
FT                   TRIRNLTQLLFLVGHISIKTIVYLEKCEAEFKRRKLEASSSQGKQKPDESKEVENELEM
FT                   IGGTSEDDFSDAIAFIKEKELLFDENSLLAKFGPLVKEICANNLEYQNTELQRSAVLCL
FT                   EKFMKNSPDPIIRSNAVLGLGDMAVCFNNLVDENTDFLYRRLHDDNIMVQRTCLMTITF
FT                   LILAGQLKVKGQLATMAKCLENEDQGISDMCKLFFTELAAKDNAIYNGFIDMFSGLTND
FT                   KTLEKDAMKRIIKFLVPFIGKERHQKQLAQKLLHRLEKVETEDQWNDVAFVLQSLPLKN
FT                   NEQVQEALAEGFKVVQARS"
FT   CDS_pept        complement(529727..531373)
FT                   /locus_tag="PAS_chr3_0266"
FT                   /product="Putative protein with similarity to the
FT                   allantoate permease (Dal5p)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70304"
FT                   /db_xref="GOA:C4R418"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4R418"
FT                   /protein_id="CAY70304.1"
FT                   /translation="MTSQGSSEIKQEHAAVADSVNSSDDGFQVLTIINRETRETIVIKK
FT                   DWTDAEEQRLVRKLDFIITPLIFFGFFLLQLDRGNIANAYTDVNLINMLELNNYRINIA
FT                   SALFSLGIVIFEIPFNVALQRVSPSVFLSFQIFAWSLVATLQSQFTNLAGFYVTRFLVG
FT                   ALEAGYIPGCLYFLSTWYKRSELGLRHTLFFYGNLTASATSGLIAAGILRDLSGVGGMS
FT                   GWQWIFFVEGIVGVGFSFIFFAFLPDSAAHPAAFWNKRWFYFTKEEARILRDRIYVDDP
FT                   AKSVSTRTTNHKDVWETFKKPIPWLHVLITISSMQTTAALSSYIPLIIRSMGFGVFESN
FT                   ARSSIPQWCSMVLILLLSISSKHIKPRGGSIAFVLIWQLAAQIALRELPASASPTARFT
FT                   ALCFLVTAVANGHILNTSWLSVNIKSPRERSIALAMLIMAANIGGICGGQILRDNDRPL
FT                   YRKGFLALIILDVFSVLLVFFTIWYYHNLNRKLEKLHGKEELVDEEEEKEAETVESLHE
FT                   TVYVGFNTSEVMDKEEEENTFVRKPKYRYIP"
FT   CDS_pept        complement(531692..532549)
FT                   /locus_tag="PAS_chr3_1173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1173"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70305"
FT                   /db_xref="GOA:C4R419"
FT                   /db_xref="InterPro:IPR007590"
FT                   /db_xref="UniProtKB/TrEMBL:C4R419"
FT                   /protein_id="CAY70305.1"
FT                   /translation="MSERKAINKYIPADFDPSQIRRTKKKKSTALPTVRLMAPFSMKCS
FT                   NCGDYISKSKKFNARKETTKEDYLGVKIIKFHFRCPLCSGEIVFRTDPVNADYVVEKGA
FT                   VRNFLRSNVKEPEKLETLEETLDRLEKQAEQDKKEELAKQKGIHKKLNDPDEDIIVQVE
FT                   KKMIEQREEQRRMDELDDLRSKNARIERIKRSEISLEDRILNDDSESLEKEIASRTREA
FT                   FENKRPLEIRPDDEFSSKEAKSVKLTVTAPKRASRALINSLSGNREHYNGMPRLSLGYS
FT                   SDSE"
FT   CDS_pept        complement(532695..533930)
FT                   /locus_tag="PAS_chr3_0267"
FT                   /product="TFIID subunit (48 kDa)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70306"
FT                   /db_xref="GOA:C4R420"
FT                   /db_xref="InterPro:IPR007900"
FT                   /db_xref="UniProtKB/TrEMBL:C4R420"
FT                   /protein_id="CAY70306.1"
FT                   /translation="MSSTPDGSTPVDSGKRTSDQIDVGEYKRVKVERGNRSETVDSGLI
FT                   DMSNSVGASLDIPTPDQLNPTNTGVQTPSLHQPGESISAHSLSLPGETSVGGSTGISRE
FT                   NTPQVRPDVSVSQSSSQLHQRNESFPGLSVSKSTTSLNKDTMFDNRKRLLGNNGANPNG
FT                   QKSSDPEKLSDALTAAGVDLKEEESLLSQSTVIQQSRRQLSTLSSFLHPVHLATFMRRV
FT                   MENNGLRNYVDHDTELLSYMSSACEGFMAGILTDSVILANHRKRPIKSKLKHSTTPRSD
FT                   VSKVLRDIATKQKEREEQRVQKRVTLDIEGQEDDGKSKQDNEEVLHRAANATAMMMTSK
FT                   SKKKKYSWMNADSGAQGGKTNSVLARGDSGIRYRDAREEPGLVLRDLLGALEGRRMCVA
FT                   NTVVKGYARMND"
FT   CDS_pept        534314..535420
FT                   /locus_tag="PAS_chr3_0268"
FT                   /product="RNA terminal phosphate cyclase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70307"
FT                   /db_xref="GOA:C4R421"
FT                   /db_xref="InterPro:IPR000228"
FT                   /db_xref="InterPro:IPR013791"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR016443"
FT                   /db_xref="InterPro:IPR020719"
FT                   /db_xref="InterPro:IPR023797"
FT                   /db_xref="InterPro:IPR036553"
FT                   /db_xref="InterPro:IPR037136"
FT                   /db_xref="UniProtKB/TrEMBL:C4R421"
FT                   /protein_id="CAY70307.1"
FT                   /translation="MAKGQIITFQDHENFRLRLILSTLAGKPIKIEKIRSHELNPGLKD
FT                   YEVSFLRLLEKVTNGSVIEISYTGTTVIYRPGIIIGGVLTHDCPVSKPVGYFIEYMLFL
FT                   APFSKEKFSIVFKGITSSKEDVGVDLLKWGFLPVMENFGVRECSIHTLKRGSPPLGGGE
FT                   VHLLCNSLIAQPITIHALEINKISSIRGIAYCTRVSPSIVNRIVSSVRDVLRNTIGCEV
FT                   NITTDVWRGETSGKSPGFGLTLFSESKKGKNWRYCIEDIGLARETPEDIGEATSYKFLE
FT                   LLENSGVIGRNQLPLALTYMTIGKEDIGRLKVHKSQIDAKLVTMLRDIKSVFNTQFLFK
FT                   PSPEEAEEDYLVATVKGVGFTNTSKKVA"
FT   CDS_pept        complement(join(535660..535681,535842..536586,
FT                   536654..537251))
FT                   /locus_tag="PAS_chr3_0269"
FT                   /product="Protein required for sorting proteins to the
FT                   vacuole"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70308"
FT                   /db_xref="GOA:C4R422"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR028662"
FT                   /db_xref="InterPro:IPR035704"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="InterPro:IPR039358"
FT                   /db_xref="UniProtKB/TrEMBL:C4R422"
FT                   /protein_id="CAY70308.1"
FT                   /translation="MSDSLFGSNILESEDPWAEPGAFSSNKLNSSEFKPDWHPSGTADL
FT                   QTAEDPLVDPFKQEDVFIKSTFEEPTSSRSIEAVKSAEIDSELGEADVEIPNLWSDTVQ
FT                   EFNPLSPHNNSSNHMVTVKEIPEKQGLLFKHINYLVTHNIKFSGEYLKHAEQSTQNKKG
FT                   EFKVIRRYSDFSWLLEILLKKYPFRMIPDLPPKKFSIGATSSSNDSLFLQKRRRGLQRF
FT                   LNQIIHHPVLIKEPLVIMFLTVPNDFTNWKKIANIDTSDEFEGVKVRIPTRFRLTLDKL
FT                   YLNDEAQESQEEYEEDRAGAAANEHAINLQTTFKNIEHVWEENPTNYHNKDFMDNINLI
FT                   TVNLGKIHEIWTKLCILVERSERREHALALDKAKFGDFLGIFIKHNHTVYDLNNLANPK
FT                   IIKHQRPNEEQQNLGIINNILLSVTNLTKKSKELKDEEVKIIGSDILESAQMLTG"
FT   CDS_pept        complement(537367..537930)
FT                   /locus_tag="PAS_chr3_0270"
FT                   /product="Coenzyme Q (ubiquinone) binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70309"
FT                   /db_xref="GOA:C4R423"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C4R423"
FT                   /protein_id="CAY70309.1"
FT                   /translation="MMAKRSRIQHFKSISWVSSRTFLNLGRLAQNSELKGNGQQYVVKK
FT                   TFHQPKSVVYNVISNVDKYHEFIPYCEASFINSRDTKGEPTEAGLTVGFKSFDETFLCT
FT                   LECQKDKQVIAKSITHSLFHNLLTEWNVTEASSSKTNVELILSYEFKSDLYNQVSALFA
FT                   SKVTSIMIKAFEKRAYTEHKQFCK"
FT   CDS_pept        join(538327..538870,538984..540128)
FT                   /locus_tag="PAS_chr3_0271"
FT                   /product="Lysophospholipid acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70310"
FT                   /db_xref="GOA:C4R424"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="UniProtKB/TrEMBL:C4R424"
FT                   /protein_id="CAY70310.1"
FT                   /translation="MVQWVQDQIRYMAYSTGLDEESTKIVMCLLLSFPLSALFKRLPDN
FT                   KYTLKNLVVIGVSFFYIFIILELKGGFVTLLISTTFTYLITKYLKSDLMPWFNLAFLMG
FT                   HLCINHLKAQFWQAEYDPTKIDITGAQMVLVMKLSSFAWSYRDGKLLKRDPKAFQEKLN
FT                   TYQRSRVVVEHPSILSFLGKRRKRMIPKSGRIAFAKVVQGAAWAAIWITSLNYITTDYL
FT                   FTVEYQQKPLIVKGIVLTILGFTYRLKYYAVWLISEGCCILVGIGYNGYDASTGKFYWN
FT                   RVQNIAPWEFETGQNVRTCLEAWNMNTNKWLKNFIYLRSAKNNKPGFLSTLLTFATSAF
FT                   WHGTKPGYYLSFVSGAFYQTIGKIFRRNIRPIFTTKDAEPVTRYKTLYDIVSWTVTHLA
FT                   FGYLVQPFVILEFKKSIKVWSSVYFFPHIAIGIILFAFKGPFSRSVTGFLRKYHLKSKG
FT                   ESETISAPKKDTITVHPNASDASLIPEYDNQEELNQPIILPEIDFSKEDYDELMNKIDE
FT                   LQKLRSSKDFSLIENEEKQALYEALDSLSKDIGKVMGNIRSFKND"
FT   CDS_pept        complement(540156..541013)
FT                   /locus_tag="PAS_chr3_0272"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70311"
FT                   /db_xref="GOA:C4R425"
FT                   /db_xref="InterPro:IPR019258"
FT                   /db_xref="UniProtKB/TrEMBL:C4R425"
FT                   /protein_id="CAY70311.1"
FT                   /translation="MNTGTPSQSSAGSWSAHATGSLTNSKVNENRSEKIFQQLDNLEQD
FT                   LSKLVTSINRFQPSKEAAHRLVSDVDELNYTIDDLLYIHDKRRSQVLNQEVENRHLNKS
FT                   MINIMIGLTECRKELKKLPNLTEEQLEKVYTEKLKREMNDGDVDMDAPIKPLPSAEENL
FT                   KDVETLLEYAMKLSKFSKIPASVDPNTLNPRNFIWPGEDSMRRGMLALASIHHERLIET
FT                   LNESTINPGGESTINNEQEVAETPSPSKSTKEHNNTTTKGPNQETDAQAAIDGLDLFDS
FT                   DEDL"
FT   CDS_pept        complement(541108..542034)
FT                   /locus_tag="PAS_chr3_0273"
FT                   /product="Non-essential hydrolase involved in mRNA
FT                   decapping"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70312"
FT                   /db_xref="GOA:C4R426"
FT                   /db_xref="InterPro:IPR008594"
FT                   /db_xref="InterPro:IPR011145"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:C4R426"
FT                   /protein_id="CAY70312.1"
FT                   /translation="MPPIRDLLPGFEFEKILNSDPQTKSIVLLGKIDEQNAIVSLEKSH
FT                   FQFNDLQLNSLFESDNGVIGQRIRDININDVYHWGMCLVDQDLETAPSAKINVIYPATE
FT                   THLKKYAAQQYHLIKETPEAYQRIVEPYIKTMKGDRIQWVRNILFNNYEADKILLRDPD
FT                   PKTGFVVLPDMKWDGDTLDSLYCVCIVNRGDISSVRDLNHSHVPWLKELNTSLRQTISK
FT                   RYNIPRTQLRLFVHYQPSYYHFHIHIVNIRHPGLGDSIAAGKAILLEDIIENLDSGESK
FT                   SYVSKTLHYVLGENHNLWNLGLKDHTV"
FT   CDS_pept        complement(join(542341..542951,543009..543042))
FT                   /locus_tag="PAS_chr3_0274"
FT                   /product="R-SNARE protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70313"
FT                   /db_xref="GOA:C4R427"
FT                   /db_xref="InterPro:IPR001388"
FT                   /db_xref="InterPro:IPR010908"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniProtKB/TrEMBL:C4R427"
FT                   /protein_id="CAY70313.1"
FT                   /translation="MVKSTLIFRNDGLPLSATVDDDQTQNLTEQKNQAKAIVNKVNSNS
FT                   ATEASIRSGNYTIHYLLRESIVFLVIVDKSFSRNLAFAYLQEIANEFINSHGNAALRSD
FT                   TRPYQFVSFDSFMSKTKKLYQDSRTQSNLDHLNNELSDVKRIMTKNIEDLLYRGESLDD
FT                   MSDLSYNLRAESKKYRKAARRINLEALIKQYVPVAMVGIFFVFIIWWIFLR"
FT   CDS_pept        543228..544370
FT                   /locus_tag="PAS_chr3_0275"
FT                   /product="Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70314"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C4R428"
FT                   /protein_id="CAY70314.1"
FT                   /translation="MNQQDQSDFMDIEDGSELQIITNYVNNQKLTNDFVLSIENDLDSR
FT                   YKQSKDDTYEHSILFVADTNFVLSHLKLLSQIHNIALTNEQMMTHLKVVIPITTITELD
FT                   GLKSSSRKEDGFNVGMLARSAVDWIYTHLASNDPIVKGQKLYQRIERDLTPDASILDCA
FT                   LYLQSEYRSSLVVLLSNDKNLCNMALTNQVLTVSYRTGMTAELILSTTFQELQNRGLLD
FT                   VNNDDHEIIDYEPTVQPADKTSIEDAIATVYSEIKMVALDSLDALMIQEYGDDLEFTGY
FT                   EKKNIVELSDCFDLISRYGVSTFFHLFKRSRLIDSKMFQRNSATKQKFFKTPPSDAPEF
FT                   REFVEFWCELLTCLYQAREPSQKKALSQLTARWLAISSRF"
FT   CDS_pept        complement(544377..545537)
FT                   /locus_tag="PAS_chr3_0276"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70315"
FT                   /db_xref="UniProtKB/TrEMBL:C4R429"
FT                   /protein_id="CAY70315.1"
FT                   /translation="MIPDTWSKWYDRDTGIDYLYGLKSKKPDTAKQDNKDPLLTFILTN
FT                   IRQTWMLEINNLKDFIELSGNNGVEVSSVDDLYKTMLFLDQNISQLDSKIAQVGFLYPK
FT                   NGRSMFQLTNISESMPKKETFKWVFPLNLVSDATSLAISQGINFQVFKALSIERFQRNY
FT                   ILHEIEKKDKLISKLLDSVLETYSFSSGNGESSAENSLQEKNKILNNKTLTKIIPEGHS
FT                   LRQSLLKFDPATLQGQDPYKNTCIWDLIGELLKERDNWRHSNEYSVSRTVTESIEKRDK
FT                   NDNNNNNSFYHEYMEVDESPKNKKHIESQFEKNPKKRKFGKVSASVPVLHEANHDKVNM
FT                   FGKDSNVNVEDVNAEIYKPKRRKFGVIKSLKRKLDSSSEVAIKSQK"
FT   CDS_pept        complement(546054..547532)
FT                   /locus_tag="PAS_chr3_0277"
FT                   /product="6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70316"
FT                   /db_xref="GOA:C4R430"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4R430"
FT                   /protein_id="CAY70316.1"
FT                   /translation="MVEATGDIGLIGLAVMGQNLILNAADHGFTVVAYNRTVQKVDHFL
FT                   ANEAKGKSIIGAHSIEELVANLKRPRRIIILVKAGNPVDAFIQQLLPHLDQGDIIIDGG
FT                   NSHFPDTNRRYEELKQKGIHFVGSGVSGGEEGARYGPSLMPGGAKEAWPHIKEIFQSIA
FT                   AKTDGEPCCDWVGDAGAGHYVKMVHNGIEYGDMQLICEAYDLLKRVARLPDSEISKVFA
FT                   KWNKGVLDSFLVEITRDILAYNDDDGKPLVEKILDSAGQKGTGKWTAINALDLGMPVTL
FT                   IGEAVFARCLSAIKDERVRASKILSGPSVPENAITDKAKFIDDLEQALYASKIISYAQG
FT                   FQLIREAAKEYKWDLNFPSIALMWRGGCIIRSVFLGEITAAYRENPDLENLLFHPFFNN
FT                   AISKAQSGWRATLGKAIEFGIPTPAFSTALSFYDGYRSEKLPANLLQAQRDYFGAHTFK
FT                   VLPEEANERLKVGDWIHINWTGKGGNVSASTYDA"
FT   CDS_pept        548266..550068
FT                   /locus_tag="PAS_chr3_0278"
FT                   /product="Protein with similarity to monocarboxylate
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70317"
FT                   /db_xref="GOA:C4R431"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4R431"
FT                   /protein_id="CAY70317.1"
FT                   /translation="MKTKTSRKSSSDSYSIDSLEATDSNAENQHDILPYFNDVPLQNIS
FT                   QEPTRRSAISSILEAIDDENQQTRNGATSLYSNDRVIPIDDSTIMEAVDLAVHKVKTGA
FT                   HECDDDSAEKISLISETPEKNVIDQPPDGGITAWLTVTGACLFVMSTWGANAAYGVFLN
FT                   YYLTNHIFSGATPYDFALIGGMVIFLAQVLAPVAMILQRTFGYYPAVIFGIVVQFTGWF
FT                   TASYAKTIWHLYLSQGVCVGLSASFLFVPVSTLIPEYFMKNRAYAMSIAVAGSGFGGVL
FT                   FSLSVNAVIDRAGDQRWALRMVCFVVTFISVIGLIISRPRVHRPRITNSLDLKAQCKII
FT                   FNFRIALKQQVCLVASWFAIVNLGYVVLLFSISPFATMICGLSAKQGSILTAVMNTGQI
FT                   VGRPCMGLMADRFGRLNFTITINLFVAILIWGWWIPVRSFAALLPFSFILGAVIGIGSV
FT                   MNAVLTADSVSTTQFPAAWSFVNIVGGCLSLIAEVMALGIRDFSMSNPFLNTQIFSGFA
FT                   FFIGVILLLALRQWKIYRLLVQRQSHNESQLQEINSKSNLECTELTEDYVPYEIMIKRK
FT                   QKYDVLLKDGIKAYILRTLYPIKT"
FT   CDS_pept        complement(550571..552928)
FT                   /locus_tag="PAS_chr3_0279"
FT                   /product="Protein of unknown function, contains two
FT                   predicted GTP-binding motifs"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70318"
FT                   /db_xref="GOA:C4R432"
FT                   /db_xref="InterPro:IPR008803"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030386"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4R432"
FT                   /protein_id="CAY70318.1"
FT                   /translation="MTDLEVSAIQVIDENKVFNSLLVDYMKQFYSQNNSSDDKGLNYHI
FT                   VSVFGSQSTGKSTLLNHLFHTKFDVMDESQRQQTTKGIWLAHANHISSSNESGDFANNT
FT                   KNVFVMDVEGTDGRERGEDQDFERKAALFALSTSEILIINIWEHQVGLYQGANLGLLRT
FT                   VFEVNLSLFAKNKQRCLLLFVIRDHVGNTSLESLSDVLTLDLQNIWSQLNKPQGTEGFE
FT                   LDDFFDLKFVALAHKLLQPDKFIEDISVLGDKFISEDQLFNEGYHRAIPIDGWSMYAEQ
FT                   VWEQIETNQDLDLPTQQILVARFRCDEISSQVYESFHEQFVKSNWDDLSFTEIGNSLKE
FT                   LRQNAVQQYDILAGRYSESVYLQRKKLLVQKVDLSILEVYTSVLQKLIRQSRDLYLKQI
FT                   ESSLTKKEAGIIFYQVLDNAERESLKYFNENTSLISFVDVDDSEARSYDPSPKLRELEE
FT                   ELSNLRTELVNKEQENIKTKIPRKFKSHFKLIVQDELSNIKPSSWEELLDQFRQVSEKL
FT                   LAKYKSPDSNYDFHLGLSKEKNKELHEQVLIKFWIKFKEILNDFVTETNVLRLLVSKFE
FT                   DEFRYDEEGLPVVWKNSAEIDVKFAKARNSALDLLPLFSLAHTAEGEILPDYDIAHDEA
FT                   EAESDNEEDDGFKESHKFAHLLSARDQDAIRNKFKKQTDALYVETKRSVINSKTEVPLY
FT                   IYALLLVLGWNEFMIILRNPLLITLLLIGLTGLYLGYKTKLLGPIVQVVQAMIQELQDQ
FT                   AKNKLRDVLVSEPEAPSQVRIGKEVDATKDED"
FT   CDS_pept        553408..554412
FT                   /locus_tag="PAS_chr3_0280"
FT                   /product="Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70319"
FT                   /db_xref="InterPro:IPR007317"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C4R433"
FT                   /protein_id="CAY70319.1"
FT                   /translation="MSSPSAKLEKTINRFKARIDAGSYYEAQQTIRTIVNRYIRAKDHD
FT                   AASELLYHSSLIFSENGRFDEGTDLLNYLLDVYLLQEDDISSYKEIQLPRIIQILASYP
FT                   DNDSNIPTLGEKLTSFANKKTGSTLGDSKLNLIIGEKLYYSGNPDSVSNSEKYLLLTDS
FT                   DKANELLVDLCLQEYLDQENNSHNLHEYLERLIIPYLKINNIKLVKHTVEEFFTKRVSS
FT                   LKDDYKNFQTVTFEGDTFFLYDVSSSDDSNLTASKRIINYLQLLIALIQRNHPSNAQNF
FT                   KLLFGRYKEDISQADITAKINELGQAVFNVAVVANNGNFLQDMMSGLLGGGPK"
FT   CDS_pept        complement(554429..555028)
FT                   /locus_tag="PAS_chr3_0281"
FT                   /product="Polyphosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70320"
FT                   /db_xref="GOA:C4R434"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:C4R434"
FT                   /protein_id="CAY70320.1"
FT                   /translation="MAAEFVPLAVAREGRESQLYSKTSGARLIAGCVPLNEAKDKVIMI
FT                   SSSKHKDRWILPKGGIEKDEEDDYRNTALRETWEEAGIFGEITKKLKVVFDHRFQKGSG
FT                   DLKEKDLDIDGERIPRSEFHLYEMIVRELSQEWPESAKRERKWCTYSEAKHELTKSKRW
FT                   ELLDALNDSSIEKDVQSVFIDQKGNHKDAAIHSDHY"
FT   CDS_pept        complement(555577..555780)
FT                   /locus_tag="PAS_chr3_1174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1174"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70321"
FT                   /db_xref="GOA:C4QXU7"
FT                   /db_xref="InterPro:IPR000289"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR028626"
FT                   /db_xref="UniProtKB/TrEMBL:C4QXU7"
FT                   /protein_id="CAY70321.1"
FT                   /translation="MDTKTPVTLAKVIKVLGRTGSRGGVTQVRVEFLDDSSRTIVRNVK
FT                   GPVRENDILCLMESEREARRLR"
FT   CDS_pept        complement(555949..557973)
FT                   /locus_tag="PAS_chr3_0282"
FT                   /product="Plasma membrane transporter for both urea and
FT                   polyamines"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70322"
FT                   /db_xref="GOA:C4R436"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR031155"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C4R436"
FT                   /protein_id="CAY70322.1"
FT                   /translation="MTEFILTQGFGYGIALGLGAAFALLMMATTYTAKKFLGQKQDSER
FT                   FTTASRSVKQGLISSCVVSSWTWPGTLLTSSQWAYQYGVVGSYWYAAMGSFQVLLFTLV
FT                   AIEIKKRCPGIHTIAEVARVRFGRGGHLVYLSYCLGTNVIVSCMLLLGGSQGFSFSTGM
FT                   HIVAACFLLPMGVCVYTLFGGLQATFLSDWTHTVIIYVIILVCLTTVYGTSDLIGSPGK
FT                   MYDLLTEIAKESPSSAANGSYLTFDNRAMIFTAWNLLMGGASTVFGDPSYSQKAIAASA
FT                   KDVMFGYITGGLCWQIIPWGLGTCTGLAALALTNNPASYTYPNALTVEEAEKGLPLVYG
FT                   MAAIFGKSGAAAAVVMIFMSVTSAMSAELISCSSILTYDFYRSYVNPKASGKQLVTASH
FT                   IFVIAFSIFMGGLAVVFNYIGVTIGWILNFIGIALGPVLGALLGMLFYPKMTKHAMWFG
FT                   PTMATLTGVACWLGSCHHFYGELNKDNLAGNYPSAIGNFVSVFTSPLYIFLISLIKPQS
FT                   FDLSTLNDQFEAGDDAEETELERMKVQETDLDQLNKSLIQTRIFLIIHASIFVFILPLS
FT                   LYGSGYIFSKRFFTAWVVITIIWEYLAAMWIIIWPLYESRVTLRYVIMKLLGKEGHLYY
FT                   GAGEVKEISTSDQSFATPSVAEAKNEHHVNVITDSDHDM"
FT   CDS_pept        558706..560385
FT                   /locus_tag="PAS_chr3_0283"
FT                   /product="Putative amidase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70323"
FT                   /db_xref="GOA:C4R437"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C4R437"
FT                   /protein_id="CAY70323.1"
FT                   /translation="MPTCIETTTANWESISEQKRNDIISAIPEDWILKNIPSSEKEPNA
FT                   KLYLDKVLPEAEQSITSLDTIELRDKIANGELSSYEVCFAFCHRAALAHQLVNCCIEIF
FT                   FDKALERAKELDEILKATGKPVGRLHGVPISLKDQVNLEGFDSSIGYAALVGKPKRADD
FT                   VSLLAKILYNEGAVFYVKTAVPTAMMCVETYSNINGYTTNSNNRNLSSGGSSGGEGSLI
FT                   GCQGSVLGIGTDIGGSIRIPSALNGIYGLRPSHGRIPYMKVFNSYLGQEVMPSVIGPMS
FT                   VSLKGLKLFTQVVLDSKPWLWDPKSMPIPWRYDQITDQYSNKKLCFGVWKWDKLVMPHP
FT                   PVLRAVDECVAALKKAGHQVVEWDPPCRKSLVDIGLEVLSADRYKEIEENCAKTGEPLF
FT                   EALRNLCVDSGSKQPIEVNAWWDISERKYALQQTYSEYWNNTVNSTGTGRPVDGIIAPV
FT                   WCSASYENDNSYKTPFNYTVPFNVLDFPSVVVPVLRSDKSIDLKDESYVPVDEIDNTVQ
FT                   EYYDAEKFDNMPVSVQVVGRRWEDEKALFMAEVLSESLSSNP"
FT   CDS_pept        560538..562466
FT                   /locus_tag="PAS_chr3_0284"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70324"
FT                   /db_xref="GOA:C4R438"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C4R438"
FT                   /protein_id="CAY70324.1"
FT                   /translation="MSKEAIRISKACEGCRRRKVKCTGGNVCDSCKRWNDICRYREFSR
FT                   PSKERKKRRKIDPEVKLKKPEEENGVLNLQLPGLLSANSAEFFQNKYFGPASNFSFVTH
FT                   LNQYLQAAGLQDGNNGIDRFGMQLVTLRNFEHVDIESELAKLSYHQAYSLLEFYFETWH
FT                   IPYPIFDPELMFGKFKDVWLYLKGDKKSSIVNKYDKAVIYLLMSIGGVVSCFDSNSLAP
FT                   HIPLARILFEMARREVPNIQLDISYEAVKVLYLFSLSSANFGDTSISYLYSGSAVRSAF
FT                   ILGLHKNALSLDNQFQGKGKKQEMYERHRIWVATWVWEKYWSFCMGRPSCIKDDIPIPH
FT                   PIPEVYTSAGYTSSKLFPINLPHMKLRVYFTHFCTKIQASLYNTSDEFPTVFKLVESIS
FT                   QKLDEIYPESNENRLCFSDNSLAQNLSDQEWREWFWIRAYYLYLKMLSYRPILVFSAYL
FT                   KLRTNCIPKDLRIQLDEGSEKCFAIALQFAEFLIESNRYKKHMRLPIFFIATYVESACT
FT                   VLLFYIVSNYNYISPEQVSKVWDTLHKTCAFLEGVSGPYIESSRLIANDAIKSLQTVLL
FT                   SRQNQAEPYKIPVPPAGLSDDIMINRMKKLHGESVDSSNCIQLDTPINEEDFESFWQDT
FT                   INWLSST"
FT   CDS_pept        562967..565384
FT                   /locus_tag="PAS_chr3_0285"
FT                   /product="Glutamine tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70325"
FT                   /db_xref="GOA:C4R439"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR007638"
FT                   /db_xref="InterPro:IPR007639"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="UniProtKB/TrEMBL:C4R439"
FT                   /protein_id="CAY70325.1"
FT                   /translation="MSTTDEELATLFGKVGFDEAKSKEILKNKKVSLSLAQIIEEVEAD
FT                   EPLSKSKTALLHNLATLVKGENLPKRELITRAIADERLTTNLQVSEAYKYVKEAKESST
FT                   EEGMNVRSGVGIVITREQVDEEVAKYINDHKQEIETKRYSCVPALLGNIKALPQLKWAS
FT                   PALFKPIIDEQVLKLLGPKDERDVVKKEKKKKAKQPETATKQSAVTGDVKQRSMFSEGF
FT                   LGDLHKPGENPQMWPELMKEHLKVTGGRVFTRFPPEPNGYLHIGHSKAIMVNFGYAKYH
FT                   DGVCYLRYDDTNPEAEEEKYFVSIKTMVEWLGFKPWKITYSSDYFDQLYELGEKLIQVG
FT                   KGYVCHCTAQEVKLQRGMKEDGTPGGKRFACPHRERPVEESLQEFRNMRDGKYQSGEAT
FT                   LRMKQDLESPSPQMWDLVAYRVLNAPHHRTGDKWKIYPTYDFTHCLVDSFENISHSLCT
FT                   TEFQLSRESYEWLCDVLHVYRPAQREYGRLNITGTILSKRKIAKLVNEGIVRGWDDPRL
FT                   FTLEGIKRRGVPPGAILSFINTLGVTTSTTNIQATRFESAVRSYLDVTTPRLMMILDPV
FT                   LCVIDNVDDTFEEKITIPYKPGDAKLGDRSLTFTKEFYIDRSDYRDETSKDYFRLAPGQ
FT                   PVGLMKVPFTVSVSSVERDDHGKVTTIHVNYDKVEGKPKKPKTYIQWIPKSTKQNSPVH
FT                   IKETRIHNVLFNSENPSSHPDGFTSDINKDSEEVITTAIIEPAFFDIKSRSPLNLPTVN
FT                   EEFNIKEQPNTPESIRYQALRVGYFCVDKDTNGDQEIILNRIVTLKEDSSKD"
FT   CDS_pept        complement(565611..567137)
FT                   /locus_tag="PAS_chr3_0286"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70326"
FT                   /db_xref="InterPro:IPR005036"
FT                   /db_xref="InterPro:IPR038175"
FT                   /db_xref="UniProtKB/TrEMBL:C4R440"
FT                   /protein_id="CAY70326.1"
FT                   /translation="MAYLGPKVYKTTPLTSNNLAFLNSSSSSNSSNSSNDDTLSSTPDS
FT                   VLSLNSDSVSTYSSTSSEINQRSHYGWEQMDIKVSSTSTLSRNDSTSSLSTIVDAQNEI
FT                   TSNNNDLIVSPVASPRPKAGGLLKPSLKLPILKRCSSVPNYNEETTKVGAKSVRFSEDL
FT                   ERIKIFNKSSTPMALSTDNSPISSPLRREKMVWDEFSLEYDDDDDQSGVSDAESESDSV
FT                   SSVYDYNIWRLISSALPLSGPSINFQRFVNLPPVVIESIKLSSNKTSIIGFIYVKNVSF
FT                   EKRISIIATTDNWKNTFNFNSCCNYISSNHIFNYEKSHSPSDMYDKFSFIIKIDDLVPH
FT                   ESLGNNLTIQLCAKYETAGQVFWDSDFGRNYRISLTKITKHQVNSAPYDTSFLDVLDYK
FT                   LGSNASNSQFKNRYQFSLDSNYSVDESYFSARPLFRPSSSSSSSSASSKKSIQRTPLGV
FT                   PKRSFNTPQGSDPKFFDKSNDSKYNDLVRKYCFYQTASPSSPSTSEPLAG"
FT   CDS_pept        complement(568785..569624)
FT                   /locus_tag="PAS_chr3_0287"
FT                   /product="Integral membrane protein localized to
FT                   mitochondria (untagged protein) and eisosomes, immobile
FT                   patch"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70327"
FT                   /db_xref="GOA:C4R441"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniProtKB/TrEMBL:C4R441"
FT                   /protein_id="CAY70327.1"
FT                   /translation="MGQLFRKIIQWIPLLFFAGSVLLQFFVILSGARTTGVLKDFYWLE
FT                   VEGTGAIDPQFGTTRWTNYRMCNWENDELSNCEGPQPAYPFSPDNNFSDGENRALIPSD
FT                   FINHRDTYYYLSRVGWSMLLVGLVFTVFSFFSTLLRIFLKWKLVSGLNWLNSVFAVFFV
FT                   ALGASLMTAAYVKGRNSFNDASEFDASLGVKMFAFLWTSLALLLLSLPIFCFKKPLSSF
FT                   HGGTGTASHDDSIEYKEDYIPPATGDAYNPEPAGDYPPTQKRKLNFFKINRKTTIED"
FT   CDS_pept        570416..570703
FT                   /locus_tag="PAS_chr3_0288"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70328"
FT                   /db_xref="GOA:C4R442"
FT                   /db_xref="InterPro:IPR031452"
FT                   /db_xref="UniProtKB/TrEMBL:C4R442"
FT                   /protein_id="CAY70328.1"
FT                   /translation="MLNKLFIAILIVITAVIGETTTSSTTASLSESPTLVWVTGTDASG
FT                   RLATTQSAYTQQFSQLYSSIASPSSGSIGLGTIQGTVGIVRTYETITLAS"
FT   CDS_pept        complement(570833..571336)
FT                   /locus_tag="PAS_chr3_0289"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70329"
FT                   /db_xref="GOA:C4R443"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:C4R443"
FT                   /protein_id="CAY70329.1"
FT                   /translation="MASSSRSIIRPSDVPDRIISRRNTVTRDRVPRAVSRRNSAPVSRD
FT                   GKEPSSFLYYLLRKISRKKIENKGAVCRDNLANERTVLAYLRTALTMMTVGITFSVLFQ
FT                   TKLLLLYTESEDEVNDHANATMSTLQTNRAYAALNRFHTPLSCTFIGVGGPHYDVWKFQ
FT                   VLFQ"
FT   CDS_pept        join(571585..572247,572799..572987)
FT                   /locus_tag="PAS_chr3_0290"
FT                   /product="Protein component of the small (40S) ribosomal
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70330"
FT                   /db_xref="GOA:C4R444"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="InterPro:IPR006846"
FT                   /db_xref="UniProtKB/TrEMBL:C4R444"
FT                   /protein_id="CAY70330.1"
FT                   /translation="MADIILAHIYEIETHQQHLVWSMQASVSSLPESRLGYRSITDDDS
FT                   EVSNRLTGSSRPNASRTLSIQDTVPLTAQTSNNSIRSLTPLVTTAPMKVRLLRGWSNKG
FT                   VLLLENKGSVARDHLASERTFLSWLRTSLGLASFGIAITQLLSLTDGDNSSDFSGTDSG
FT                   PMEVEKIIGLSFVALAFVTLLIGFARFFLVQELLLESSFPVSRFSMGTVVFGTTALFIG
FT                   KVHGSLSRAGKVKSQTPKVEKTEKPKKPKGRAYKRLLYTRRFVNVTLTNGKRRMNPGPS
FT                   SQ"
FT   CDS_pept        complement(573046..574143)
FT                   /locus_tag="PAS_chr3_0291"
FT                   /product="Para hydroxybenzoate: polyprenyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70331"
FT                   /db_xref="GOA:C4R445"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:C4R445"
FT                   /protein_id="CAY70331.1"
FT                   /translation="MNNHSRYLLLGRHRLGLKWLAQKSVNQKFRLISSSTKKLNTVVQE
FT                   TPIFDADKLAAARQARLDGLGVIGKLPEKWIPYAELMRLEKPIGSWLLYSPCTWSITMA
FT                   AYSTTAPLSSTLWMLGVFGVGALIMRGAGCTINDLLDRDLDNKVERTIERPLASRRVTP
FT                   KQAITFLGAQLAVGLGVLLQLPADCFLLGAVSLVPVAVYPLFKRITYYPQVVLSSCFTW
FT                   GALLGFPAMGVWNWSSMIPLYLSSFAWCMTYDTIYAHQDKKFDVKAGIKSTALAWGDKS
FT                   KPIMYGLTTIQMATFALSGYMNSMGPGFALGAIIGGYRVFQMVRKVDLDNPKDCWYHFR
FT                   NNINNGHIFFAGIFLDYILRLLGYI"
FT   CDS_pept        complement(574232..578197)
FT                   /locus_tag="PAS_chr3_1175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1175"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70332"
FT                   /db_xref="GOA:C4R446"
FT                   /db_xref="InterPro:IPR001180"
FT                   /db_xref="InterPro:IPR032914"
FT                   /db_xref="UniProtKB/TrEMBL:C4R446"
FT                   /protein_id="CAY70332.1"
FT                   /translation="MARKQRQGRNSGRNKSKPSVSAATSVAASASPSEEGEGESPHCAS
FT                   RDTSKSNTPTLEEDNVIDGGDKSEVSAILNQPQQLVENVSLSSNGLEKVDDSSKKTTET
FT                   YEASGEAHQENQKEEQDMIEGIRHQEGLVGPEQPPEQSPEQSPGGPDVSEVVKVSPSPL
FT                   DISSQNRVNPLENSANEEGKKSQQDLEEDSVDKKIETREEFLEDDNNRQIEQPAIPKIT
FT                   DEFTTARDVQEIPLGTPEFQEDQIDERYPENHEPNDSEQQELKELHQNNSQEYLKPDDY
FT                   LAPQQSQESRHVRSSSGSPQLGNQEPRVSPGPFILSSVVKDIPIQNSGILGSNDATITC
FT                   IEAWDQNLYIGTSVGEILHMFKLDDETGYILISRQSFHTSKVKPIKKILLLPSIDRALV
FT                   HCGSLVSIFMLPEFSPASVGKIKDVTDVSLDYDSLSIDRVRGNLVHSSQTKSPDFVQVS
FT                   VFTSKFLRLVNVFKESIKLHKDISYANAITGLIRSHFALISNGIEYDLLDVNNLFKVKL
FT                   FPVSSGPSPSKIKPLIAPVSQNEFLLSCGTKQDEPAMGMVVDTDGNISRGTIPWNTYPS
FT                   SLNVDYPFSIGGFSNYIYVHSLHNQQEVQSMKFSHRVKISQVSHLFYTNFKDLKDLVTK
FT                   IPVNPQSTPAELERITVENDLATKYSQVPSSTVVYSTYEGVKLLQQIPRLMQFMENFTL
FT                   TQEYTANELSTFIDDIQDEMNVLNKSSGSNTHFESIEWQFLNDLCQLLFIESGQYQQLL
FT                   DYSISAFEGDPRVLVNIFQGSDDIIGESIWMFQGLIPKMNQVSDKHINQLSEGTEAYSF
FT                   FESYLLKWFSKKSFRHDYDKASMIETLEIALMKLYLLNNRVTSENFSKVQKSLIKNVQR
FT                   VSAKLEQLLIDGNHWTLLIKYYQRSNENLAALSVWRNLIKGDYKDEIYNELKMQFSIDQ
FT                   FIKYFISQITDETVLWDYGNWLLGYSPSAALRLFSSKDLRISVPEIKVLHLIDQMSSNK
FT                   VQTKFEYLDILVNERHELQFLGDYLLELLPPFLLKLQDQNGRLDELVKMYQDLKTPKLV
FT                   FTTFLRLQAAKPEYKEILATYHTFSKYLSQITRNTASLSNRKTLNVVNECFKLLEPYEN
FT                   QIPYLIAMIESKRDDHEKVIDILLNLTDFHTAEEYAVSFRLAGTFPDTEEGHTSQLEAV
FT                   QNLVVESDNLFEQDTDISADENTNVHDLLLMSIFDRYLILNDSQLIEHFLNKYNIFKTE
FT                   QLDGNSDMLPALVQLDNFNGLLNKIPDNLRIQQINSFLLGNLLSIEDSYNDVLMRKNLT
FT                   KGKLSAIENLYRDILNSGEEPDNSEESKGRNGHIPEL"
FT   CDS_pept        complement(578358..579857)
FT                   /locus_tag="PAS_chr3_0292"
FT                   /product="Essential protein possibly involved in secretion"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70333"
FT                   /db_xref="GOA:C4R447"
FT                   /db_xref="InterPro:IPR012617"
FT                   /db_xref="InterPro:IPR025160"
FT                   /db_xref="InterPro:IPR039223"
FT                   /db_xref="UniProtKB/TrEMBL:C4R447"
FT                   /protein_id="CAY70333.1"
FT                   /translation="MARKTLAETLAELSQPASGDFDIEDQEGGAVLDYGDNSSFGSESE
FT                   EDKSNHYVKVGKSRIRENAVKLGGQYEGKKSSRADVFGDEDDEEEDDEDVEHSETEDAL
FT                   SVSGSESESDEKNSDQSQGDSESEEESNSGEDLDYKRSKLQQLISSERKTIVNQLSTSN
FT                   KQDALKGFAVLNQQKQYDQLVDLRIKLQKGLVASNGLPINKEYYEQNKAPKSSKHLDKL
FT                   QDKLYNLLDVTLELRGKLLNKSKIVSQEFPPIPSKKRSLQHYLEESSKLDNIVNEYRRN
FT                   VLVKWSQKVQNASGATALSSSKFKAINQDSSTQVDNYLADMDRLIKRTRLNRRSVVPLG
FT                   YTETEEVVDDDELIDNDKDNNETKYFSNIDRSLKENKYIYDDDDFYRVLLNDLVDKKVS
FT                   DTQKLTSTSTVITFSKSKLHKSYERKATKGRKLRYTVQDPLLNFEASNPHAYKWNDYQI
FT                   DEFFASLFGQKVNMNEDEHNEEVQGESEGEDILKDDIKLFG"
FT   CDS_pept        complement(579957..581228)
FT                   /locus_tag="PAS_chr3_1176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1176"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70334"
FT                   /db_xref="GOA:C4R448"
FT                   /db_xref="InterPro:IPR007307"
FT                   /db_xref="UniProtKB/TrEMBL:C4R448"
FT                   /protein_id="CAY70334.1"
FT                   /translation="MGRKKFDKKSAQTFKLVYRSREDPLYYDEDAPDLVLKPLPKGDEA
FT                   KRPNLRLKTKKELDEELKDQVRKNEGEAALYGIIYDDSSYDYMQHLKPIGEQQGVFIPK
FT                   KEEPVKKKASDIVIKEPQEFLDPKLFQSDSIKEYDHRTQQDVPDEIKGFKPDMDPRLRE
FT                   VLIALEDEAYIDAEQDAEEGDIFDDLLKSGAAEDQEFENQDFDEWDIDNYADELAEYDS
FT                   DNNNAEFDWQKDFQKFKIAQKQGKIANTWDSDDDFDSDEEEGDIVGELPDLSKEPKIAA
FT                   TAESSNKKKQKQRRKKGAMTDTSSFSMSSSASYRSEGLELLDDKFELIKRQYEEEDEDE
FT                   DEEYQPFDMKEERQDLEGMIDDLLGNYELQRGGRRLAKKSEDLAAFKRGADSVSKGRAG
FT                   RSFKKEQSQVDSLSNGVSSLKLSK"
FT   CDS_pept        581365..581784
FT                   /locus_tag="PAS_chr3_0293"
FT                   /product="Catalytic core subunit of the Anaphase-Promoting
FT                   Complex/Cyclosome (APC/C)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70335"
FT                   /db_xref="GOA:C4R449"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR024991"
FT                   /db_xref="UniProtKB/TrEMBL:C4R449"
FT                   /protein_id="CAY70335.1"
FT                   /translation="MKVTIQNWHSIFAWHWDVPGDEVCGICRVAFDGTCPVCKFPGDQC
FT                   PIGKFFDCLFCFVILRSHVGHVLTFCPAIGSCHHSFHMHCILKWLDTDTSKGLCPMCRQ
FT                   IFTLENSNNKEVFEALSGRPSPLEEGILEQEGTPV"
FT   CDS_pept        581935..583290
FT                   /locus_tag="PAS_chr3_0294"
FT                   /product="Gamma-glutamyl kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70336"
FT                   /db_xref="GOA:C4R450"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:C4R450"
FT                   /protein_id="CAY70336.1"
FT                   /translation="MGENCYTIVVKLGTSSVVDEETREPRIATMSRIVETLVKLRRKGH
FT                   RIVIVSSGAIAVGMKRVNMKRKPKKLQQVQALAAIGQGRLIGLWDDLFRQLNQPIAQIL
FT                   LTRTDLVDYTQFKNAENTLEQLIKMGIIPIVNENDTLSIQEIKFGDNDTLSAITAGMCH
FT                   ADYLFLVTDVDCLYTDNPRTNPDAEPIVLVRNMRNLNVNTESGGSAVGTGGMTTKLIAA
FT                   DLGVSAGVTTIICKSEHPEQILDIVEYSIRADRVENEAKYLVINEEETVEQFQEINRSE
FT                   LRELNKLDIPLHTRFVGHSFNAVNNKEFWLLHGLKANGAIIIDPGCYKAITRKNKAGIL
FT                   PAGIISVEGNFHEYECVDVKVGLRDPDDPHSLDPNEELYVVGRARCNYPSNQINKIKGL
FT                   QSSQIEQVLGYADGEYVVHRDNLAFPVFADPELLDVVESTLSEQERESKPNK"
FT   CDS_pept        583435..585927
FT                   /locus_tag="PAS_chr3_0295"
FT                   /product="Vacuolar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70337"
FT                   /db_xref="GOA:C4R451"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:C4R451"
FT                   /protein_id="CAY70337.1"
FT                   /translation="MSSTPKKEPDLTPKKSQPPKNSLGGGKGFSEEGFSQGDFSAKHIL
FT                   NRRPNTEGSSVASNVISSSSLQRLPSSGSGSVAVGSVLGSSPLTLSGGFHGLDPTKNKI
FT                   DVPKSKQSRRQSVLSDMISTSHAARNDHSEQQLQTGQQSEQKEEDGSRSSFSVSSPARD
FT                   IRHPDVLKTVEKHLANDSEIDSSLQLQGGDVTRGIYQWVTGESSQKDNPPLKRANSFND
FT                   FSSVHGDEVGKADADHDRESVFDEDDISIDDIKVPGGMRRSFLLQKHRDQQLSGLNKTA
FT                   HQPKQLTKPNFFTNNFIEFLALYGHFAGEDLEEDEDEDLDSGSESVAVSDSEGEFSEAD
FT                   NNLLYDEESLLLAPSTSNYARSRIGSIRTPTYGSFSSNVGSSSIHQQLMKSQIPKLKKR
FT                   GQHKHKTQSKIRSKKQTTTVKAVLLLLKAFIGTGVLFLPKSFSNGGLLFSSGMLLIFSC
FT                   ISIVCFIELIQVGKLTQIASYGDIGGFLYGRTMKASILTSIILSQIGFASAYIVFVAEN
FT                   ARVLCDSWLNLGDYSIEVFIFLQLIVFIPLSLTRDINKLSFTALIADLFILAGLILVYY
FT                   YSTYHLVVNGISKNVRLYNESEWPLFIGVAVFTYEGIGLLIPINESMAKPEKFNKSLVG
FT                   VMAVITVVFISIGSIAYMSFGSDVNTVILLNFPQNNKVFSVQLLYAIAIMLSTPLQLFP
FT                   AIKIIENFVFKKRKHSDSIESKTNRNTVQTDSENVFSGKNNTRIKWSKNLLRLLIVVGA
FT                   SIISYAGSSDLDKFVALIGSFTCIPLIYVYPPLLHIKGNLELGTLSKTNMITDMAICAL
FT                   GATLMLYTGFQGIKSWIG"
FT   CDS_pept        588983..589885
FT                   /locus_tag="PAS_chr3_0297"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70338"
FT                   /db_xref="UniProtKB/TrEMBL:C4R452"
FT                   /protein_id="CAY70338.1"
FT                   /translation="MDEFQTSSTNSPRKSGLNLGISVLETRRRSPAPNSSKVTKASSTP
FT                   RKESSGNSSVDSPSLSSNNDNHLSDKLRVLATTEMEILEIKEQIKALLEKKRQKEHRVN
FT                   KLKTEIERSLYKQVHDQVQSVEKISSNPPPVVTRSPSSSQRPHKLDVEVGVHKDPLRTT
FT                   NPNEGLKSVDGKQKDTPNSWLSKPLSYLQQFDTLIQHEFEKLNLMDELSAPNSHATNES
FT                   NKTQNSMSSQLWTFMNEVKSNLMLNVEEDSTDTQSNIPESWGNSQETQQTDYKDVELHP
FT                   MEKESSFTTLNSLGKPQDS"
FT   CDS_pept        complement(590012..593641)
FT                   /locus_tag="PAS_chr3_0298"
FT                   /product="Protein required for proper cell fusion and cell
FT                   morphology"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70339"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:C4R453"
FT                   /protein_id="CAY70339.1"
FT                   /translation="MAPFFRKHKKSGSTSNSQKETPENSNHAFNQDVQTPQRRVTGESE
FT                   SSLKTDLSSPATPINPFLKKNQNQNQNQNHQRPPQAPSYQHGISTPPTQYSNFASPNSY
FT                   PSVATPSVNTPPTSAQHGNLPRSAGNYNNGSYSDLSPRYSQGQQIHNPQIQQHQQHQPM
FT                   PQDAPQKIGNYRYPPPVSPSTSSPSNAASRGLHHPSGKPLPTVSYNTMIAKTLEPPTPT
FT                   PWTKKFLYNSPFPRFMHTASSFLTENGSFFVMGGLRDANVYGDIWILQPTNAKSSSNED
FT                   SGPSNYCYLAKPIENFEGIPAPRVGHSSVLIGNAYIVFGGDTLQTNEIGELDNNLYFFH
FT                   VGAYKWTIPNPTGEKPTGRYGHTISIITLSSDPENIQETTPYLYLFGGMLDNDIHNDMW
FT                   SFDLSNFRRTQWSKVIPSKESPVPPRLTNHTMSIFDEKIYIYGGFDGVKLSNKLWSFDP
FT                   TEKIWENIQLKGYQPPALREHAAATFNNLLFIYGGKDKNDNPSDEFFCINLEKFICFRI
FT                   KNDVFSSPGKRMGHSLTVDLAQEKLIIVGGDPDDSDLTDPYVQKDYVLEGANLAYDKTV
FT                   LHEFDLNKLPNFIIQEDLELAAKPREQEISKEDSPTQEKEIAEFSSLNENEFTSSTPLT
FT                   TPNKQDISSPTHKEESPSNSPEMLTFPNHEEMELSPTKPLVNPAEHKLSSETEESVAKS
FT                   TTTLNASSPRTANGVQSESSFLKHYANVTDNGEIDNENEADPTETEVKSVPKSEYDELV
FT                   QLVDQLRFTLDSKVKEANDQVISIEAKKNKEIEGLKIQLADVKSQIQTPTIPVSSPSNA
FT                   IIAGSLFSKSTSTRAIQEGTEAPEDQNVTDENSEAKEGAIEDKTIDTAETTTVGLKRQV
FT                   LTLQNKLVHLEKEKVERDSQLTKFKPLLDNQIVELTSLNSLIKTQESKILELEDYVKDQ
FT                   TSLQKEILEWKNKYEEIQLELEESKKLAFADISINGEKSINGEEGDENKEPVGIHKSVH
FT                   RITQGIDNLINVWSGLSTETGPLDESVDTDEEDLPTRLQKQIDQLLELNATQEEEKHAF
FT                   KEELDTLKNELSDVSKEKEVLETKSVTNRDLETNYKQSVQSLKNTHKALNLSQIELEKQ
FT                   KDLNKKLSSEIEELRLFKLNKRNTSRNVTPVIVNDSDSFQNDTNESKEQRNEDADDDDD
FT                   NNELNDHYDLKIKDLEADLFILKQERDQLKDEVHQLKKTLYTK"
FT   CDS_pept        594608..596191
FT                   /locus_tag="PAS_chr3_0299"
FT                   /product="Aspartic protease, attached to the plasma
FT                   membrane via a glycosylphosphatidylinositol (GPI) anchor"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70340"
FT                   /db_xref="GOA:C4R454"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR033121"
FT                   /db_xref="UniProtKB/TrEMBL:C4R454"
FT                   /protein_id="CAY70340.1"
FT                   /translation="MNPSSLILLALSIGYSIAESNFSFKPSKLPLKKHRDSSSPHERFL
FT                   KRDGPYHPLEADAYFYYTTSILVGSEEEKVEVTVDLGTSDLWVVDYNTGLCDRSFDETY
FT                   LKRSLDTSEEDYSAGDLGSSVGVRSARKFLRKRDTNQTEVNEANYGACPNSITFNPENS
FT                   SSFQSNDTAFNISYFDGTSASGFWATDTIYFGDLEVSEQFFGLANLTISYGGVLGLGPS
FT                   NLQTTNANPNGEEFIYSGVLDSMRDQGLINSASFSIYLNPENFRDEDNYSNEGAILFGA
FT                   IDNAKIDGSLKLLPYVTSGGHSQIDANFTYITLNNIAVADNDTALIVETNPQLAMLNPK
FT                   FIYTYFPNEVLTRLVNSIDNLEYDPVEGLYRIRRTNIRDINKKIIEFQFGDEIVIHSPL
FT                   SNYLSDTWVPSTNYTYLEIQDSREDFFILGNAFFKSAYLFFDNDNSEVGIGQLKVTDKE
FT                   DIVPVGEFSLDQDSGYSSTWSTFSYETGSAPLGTSTFETSTKTSSDGAAPSVSHINTSS
FT                   YLFAFVLLFL"
FT   CDS_pept        complement(596446..598134)
FT                   /locus_tag="PAS_chr3_0300"
FT                   /product="Subunit of the cytosolic chaperonin Cct ring
FT                   complex, related to Tcp1p"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70341"
FT                   /db_xref="GOA:C4R455"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012721"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C4R455"
FT                   /protein_id="CAY70341.1"
FT                   /translation="MSSLKLPSAPNSGLFKQGYQTQSNADGAINRNIQACREISSMVAT
FT                   SIGPCGKNKIIVNHLQKIIITNDAATMLRELDVVHPAVKVLVMASDQQEREMGDNSNYV
FT                   LVFAGELLSLAEKLVILGLTPTEIIQGYTLANKFALKELESLVVDQVDDVTVKSELLKI
FT                   VKPIISSKQFGSAEIISELVTEAVLNVLPRGNPQAFNVDSVRVVKIMGSSLESSFVLRG
FT                   MVFPRPPDSHVKSVKQKSKVAVFTCPIDITTTETKGTVLLHNAQEMLDFSKGEEQQLDT
FT                   LVKEIHDSGVRVIIAGAGVGELALHYLDRYGLLVIKVPSKFDLRRVCRVCGATPSPRLG
FT                   ALSPEELGEIDVVETTEIGSDQVTVFKQDKNTSSSLTSTIVIRGATQNNLDDIERAIDD
FT                   GVSAIKGVLKDSRLLPGAGAVEAELVRRVTAYGEKTPGLLQLAIKKFAEAFEFLPRTIA
FT                   DTAGLDTNEVIPKLYAAHTPAEEQSSSEGLSIGINIEAESLEDSLVDISNEGIYDLFIS
FT                   KKNAIDLATEAVNTVLSVDQIIVAKRAGGPVMPQQPRPGNWDQAD"
FT   CDS_pept        598400..601021
FT                   /locus_tag="PAS_chr3_0301"
FT                   /product="Component of the GARP (Golgi-associated
FT                   retrograde protein) complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70342"
FT                   /db_xref="GOA:C4R456"
FT                   /db_xref="InterPro:IPR007234"
FT                   /db_xref="InterPro:IPR031745"
FT                   /db_xref="InterPro:IPR038260"
FT                   /db_xref="InterPro:IPR039766"
FT                   /db_xref="UniProtKB/TrEMBL:C4R456"
FT                   /protein_id="CAY70342.1"
FT                   /translation="METEDYDPKIDLWKLLDTPNSLRQLDDLLNYTSGYKRVLDNSISL
FT                   NITEYKGFQEMMGDETKLENLETDIVDLISSFTKTWELADDTEKAIQSMTGNIRKLDNC
FT                   KRNLTLSMTVLKRLQMLIGAFYNLTDLLKNNAKNYSMIYQLLSVVLELMQHFQSYKSID
FT                   EINDLNRTISRIKNQIVDGIFSDFEDLSSNPNPELLYACKTLDSLGPAYRSKLINWYVN
FT                   LQLKEVNSIFGPTEEAGSLSNLGRRFIFFKRLLMQLENQTSKVFPKDWKIELVLAQKFC
FT                   EATKSDLNRVIARERASNTSGSLDTTLLMNSLEETLDFEAHLNQKFKYYDDSNIESTKA
FT                   VPVFDRMISEVFEPQLQFWMDYQDSKLNERFSQFLTPDNLLKKTGPLSDDKSALDDSSI
FT                   NVLDSSTELFRVYRQLLVQLSKLSHGEPLLNLSNMFVKYLYQYKNQVLQPLIPPAKKIS
FT                   SLTTEEASQVLPHICLILNTADYCCSTISQLEERLSKLIEDPKISERMGFDPVKESYLV
FT                   LINSCLNLLLLKLDRDLDMSWREFTNENWKNLTEVTGESRFLTSVKRTVMENCTVLFRN
FT                   FDKERYIRNFTDRVIELIITDFTAQIVKIIPIHEIVAEQLLLDLQSLRSLFLDIPNLSP
FT                   KQTELTNTKPIVSSRMFKKFVDTNVNNLERILKMVMTRTKPFDNFVQSYFMVIGDKKFD
FT                   NFFKILILNGTISLPRGFSNAASHHASLQNERLKYQDIFNQQLLAYEDGDTEQEQLEES
FT                   FAFLDNFDIDRYRKNLYKPTVDTVPQVEGNVTFSPNSTTSPTAKTISNFFNNIGHSNTD
FT                   SIDDQFIDSGINSLAKKIDKQAIINTKENLEKNLARTFSGDHKLNINENFKNFSKLFGK
FT                   KN"
FT   CDS_pept        complement(602055..603386)
FT                   /locus_tag="PAS_chr3_0302"
FT                   /product="Mitochondrial cell death effector that
FT                   translocates to the nucleus in response to apoptotic
FT                   stimuli"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70343"
FT                   /db_xref="GOA:C4R457"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4R457"
FT                   /protein_id="CAY70343.1"
FT                   /translation="MAHFRINMLQKRSVRRQIVIVGAGSYGIALAKELAPLVESMADVV
FT                   LVSDSEQVIFLPSLVRLDALKNVANLFVGLEGLFAKTKVKLVVDHVVNITKRGVQLEHT
FT                   GLLQYDYLVIATGAVWDNSILPAPTYNGDTNSFPGEAIQEARDIVIAGGGPLGVELAGE
FT                   YASYFQEKSVTLVHSREKLLNDSYLDKVRDRAFLQLHKLGVKIILNRRATIKDQSVFLD
FT                   DFQLKCDYLINCTGPKANPPPNSFKNFVNDKNEIIIGTKFRSLTNPQVFAIGDVTNFPR
FT                   KGLEHRAACIKVVVHNLRQVLKGTSSYLIVKWRPDFMPSSAISIGPSGGVGQRHSLLRG
FT                   VVSMGKRQSAKAKKHERYPQQLEDMICGDYYRFAFAGGCDSGRGGTAKDIRNSWSEVKG
FT                   SVRRRRGDGGGGAGGGGYVGYGGDGGCGGDGGGGGGGCGGDGGG"
FT   CDS_pept        complement(604555..605976)
FT                   /locus_tag="PAS_chr3_0303"
FT                   /product="Aspartic protease, attached to the plasma
FT                   membrane via a glycosylphosphatidylinositol (GPI) anchor"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70344"
FT                   /db_xref="GOA:C4R458"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR033121"
FT                   /db_xref="UniProtKB/TrEMBL:C4R458"
FT                   /protein_id="CAY70344.1"
FT                   /translation="MLPIRLSKLLLLLSLKLKLGTAEEKYQKLDLKRIDKDYYAVDVKV
FT                   GSDEQEIKEVLIDTGSSDFWILDKSFCNSPTSEEEENSNGRSNKESCGVYGSFDSNKSE
FT                   TFQATGQVFDAAYGDTTAESTGSSGVRGIDQLRVGDIHIEELYFGLVTNTTSLPPVLGI
FT                   AQLSEEFSNNSYPNFPYQMKEEGLIDVVAYSLSLGQSKGELLFGAMDHSKYNGTLLKAP
FT                   ILQAGTPGMQVLLTGVALTNGSSSVFNETDNKGFIYFDSGTTASTLPSEHFDDLFNHHG
FT                   WAYDGDTLTYSIQCDSEGEKSLLDFTLEYTIAGNIVIKVPFEDIIMKNENDGECLSTVM
FT                   VSNQTSFSYSDDTPFFVAGDEVLLNAYVVYNLETQELAIAPAVDNPEDTEEDIEIISAD
FT                   FDISEARDYSVGLEFRNTTIPATTDYLPSSMSSGSVSEETGSKSESSTSEDFAAATLKP
FT                   FTFWGFVLFFFHFLI"
FT   CDS_pept        607346..608284
FT                   /locus_tag="PAS_chr3_0305"
FT                   /product="Phosphatidyl Glycerol phospholipase C"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70345"
FT                   /db_xref="GOA:C4R459"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:C4R459"
FT                   /protein_id="CAY70345.1"
FT                   /translation="MPSKNLISSHRFLLHRRMAITVGAHRGYRKLFPENTILSFDQAVN
FT                   HGADMIELDLHLSSDQVLVVIHDQSTKAVFGTDYNVCKTSYKDVLSKLRTIRHPPQPMP
FT                   TFSDVLEWLSDYPDVKLMLDIKRDNPAKDVIRLILEELTKKNTDVNFWRKRIIFGLWSV
FT                   DYYLLNQELLEGFDVVNIAVDLKKSFQFANTVAAEGGKLHGISFLHLIWYHQKYRTELV
FT                   KFANSNSLVLYLWTINDPYLVKECGVNLITDDIGMAKKALSGVPVASGPTWRYSVGCYF
FT                   KAGLFSTVQFLLGRDYNLKYLALAMKKFKLL"
FT   CDS_pept        608614..610404
FT                   /locus_tag="PAS_chr3_0306"
FT                   /product="1,3-beta-glucanosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70346"
FT                   /db_xref="GOA:C4R460"
FT                   /db_xref="InterPro:IPR004886"
FT                   /db_xref="InterPro:IPR012946"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C4R460"
FT                   /protein_id="CAY70346.1"
FT                   /translation="MLGFKDFFRLLILFVTAFASDSYEFSSSVKHIASPTTVERIRKLT
FT                   PTIEAYGSKFFYSNNGSQFFIKGIAYQQDFTEYLRRPESLVDVDAPKTQTLCELNFRNG
FT                   RHFVDPLAWPDICTRDLPYLQELGVNTLRVYSIDPRANHDVCMERLAEAGIYVILDLSN
FT                   VDCSINRDDPSWDLEIMDCYTSVIDTMAPYDNVLGFFAGNEVNTDVANTYTMPFVKSSI
FT                   RDIKSYIKRKNIRKIPVGYSSNDDSLTRNNLADYLVCGENDLAKIDFFGINMYEWCGYS
FT                   SYATSGYKERTLEMAGYPVPVFLSEFGCNLKRPRPFTEVEAIFNKPMTNVWSGAIMYMY
FT                   FEERNEYGVVKVKGDYITDPVEKLPDFNLLKAQYRNASPKGVNKQDYSSHGSKDVQCPV
FT                   ASEDWKVSEELPSTPRAPKCDCMMAALKCSIEEVPNRSELAEIVGYICGEISCHNIVAN
FT                   GTTGWYGEFSDCSFHQKLSYVAQLYYNYHNSTPDACYFEGYGRINAYPNTLEALAMFKT
FT                   LKGTRCKEELGPVKEISRLITGEPFGSQNRDSPRRILVDSRLKNTNLDTSESKAITAKI
FT                   ISKSSLLTNLIAMFLVILFT"
FT   CDS_pept        complement(610470..611204)
FT                   /locus_tag="PAS_chr3_0307"
FT                   /product="Constituent of the mitochondrial inner membrane
FT                   presequence translocase (TIM23 complex)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70347"
FT                   /db_xref="GOA:C4R461"
FT                   /db_xref="InterPro:IPR013261"
FT                   /db_xref="InterPro:IPR038552"
FT                   /db_xref="UniProtKB/TrEMBL:C4R461"
FT                   /protein_id="CAY70347.1"
FT                   /translation="MSVRTIRPTFRILNSAIRTQSLKKNFIGPKSGIFLPAYSFLGERN
FT                   FHISSIRIQQQQNQQQQQQQKKNRSTGPNLFLRIKNAVTFTASTALVIGALGLAGISLY
FT                   LLFSELFLPSGDTTTFNHAVTMVEKDPGAQKLLQIDPGTRLKAYGEATGDKWTRNRPLR
FT                   TSRRIGKDGYERILMRFHVESDNQVGVVSLEAVDKTVFDQEFAYVYLDVPGKKRHYIIS
FT                   PQLPQKTQNTGFLGVKWGPKSN"
FT   CDS_pept        complement(611464..613338)
FT                   /locus_tag="PAS_chr3_0308"
FT                   /product="Required for a post-incision step in the repair
FT                   of DNA single and double-strand breaks"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70348"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011084"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C4R462"
FT                   /protein_id="CAY70348.1"
FT                   /translation="MSQREKVQRSLFTYYKVNGNKNVAYTNNLVKDFIRETSSVIELLS
FT                   DEETGNEAVDSAGCSNYNVKDEEMPAKIEKNKSEGETVMTSSTMTSISLKQENALFVAS
FT                   DEEQEVAVDEDEGFDTIKQEDKIEPDFSQGLDSLGCPEQLLEDVKCPVCEIQLDKLSIL
FT                   ERTTHVDGCLFLTSTKLVYKSLKAASKQKVKKPKSAPKITSEERIEKSKDAIRNRAKQI
FT                   PDVKILNFTSCKFAVDAFCYGQHPEITHYFLSHFHADHYMGITKNWHNGIIYCSRITAE
FT                   LLVLKYNVSEEILRILPFNETMEIEDTQVKVTMMDANHCPGSSIFLFRDSKEHCILHCG
FT                   DFRINKEMIQKLASYKINEIYLDTTYLDPTYNFPKQENVIDVVGTFCENIFRGVYQHPL
FT                   QQRITDFFTFRKRSKTLKPLICVGTYTIGKERIAIDIAKRLKTKLYAQSSKREILNTFH
FT                   WEELDTLLTSTPTEANVHLIPMQYMNLEQLEKYFHSYRNDFSQIIAIRPTGWTFVSAKN
FT                   NSTKWMKELSKSQILARIVKTKNDASRFDLESIEKQFNSDKVTQIYQVPYSEHSSFREL
FT                   SFFSILLDHTRIIPTVNMNNMQSIKNMDSWIFEWQQARAVQLVTIDDF"
FT   CDS_pept        613730..615778
FT                   /locus_tag="PAS_chr3_0309"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70349"
FT                   /db_xref="GOA:C4R463"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4R463"
FT                   /protein_id="CAY70349.1"
FT                   /translation="MILSRLSRISGLHFRQQYVLSLSQRSTLIRQVCGTRVRSATASEE
FT                   TLVARELETPSTVRLRPYQKDCIESIMKVIRGGETRLAVSLATGGGKTVIFSNLLNEIP
FT                   SNKYNGQKTLILVHRKELADQAARTIKRFFPHMKIEIDMAGLRPTHDDDVDVVVASVPT
FT                   LARNNSKNPRLFDYDPNEFKAIIIDECHHAISDSYIKILQYFNALSKDSSDGIIVVGFS
FT                   ATLKRHDAQPLDKVFNTIAYEKDLISMVKEGYLSELSITKVEGAFSLDDVKLDKTGDYQ
FT                   LQSLESSVNTAAVAELVLKTYLERKKVLGLKSSLFFCVNKQHVQDLCELFCANGIKAGF
FT                   VSGNTPLLEREQIIKNFIDGKLNVLMNCNVFTEGTDIPNIDSIFLLRPTKSRPLLSQMI
FT                   GRGLRLHSGKTKCYVTDFVGTTHSGINVDATLEGITKRQMNSLLQFDQEMVHGNRDYSK
FT                   MLEEVPDYLRYTSFNDITSYINSIPKNLSKENQRSIEYKLYKQHSLPWIQLGIDSWGVS
FT                   LADRSYLRIDKTKGKFELKRYIAVPYPKNGIKRKKLIFHSENLEEILTDAERFLKEKGS
FT                   KPLFLGSYPISNKQYEYLCKEFINVAQGSSGIQMEYFVPFLKRYLRKLTKHQASVLIFA
FT                   KMAGGAFALQRYIKYKMLSTKNIQDEKVPILKEEVMDKLAQKIKDNK"
FT   CDS_pept        complement(615821..617152)
FT                   /locus_tag="PAS_chr3_0310"
FT                   /product="UBX (ubiquitin regulatory X) domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70350"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR006577"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4R464"
FT                   /protein_id="CAY70350.1"
FT                   /translation="MSSVDTFLAITNTEDAAVAQQFIEMAGGDIDTAVSLFFEHGTDAT
FT                   ATDNNPVRSDEQLAQDLQNDAYNDEVRAPIQPVTEQLVDTLYPVSGNGIPIDPSTAIFG
FT                   SRPTGIFNQTFGGDQEEIDDDVDNQFETIMDEEGNIVQRHRSNYSRGIDVDNMTATQRR
FT                   LANLFRPPFDIMEKYNLATAKTEARSKQKWILINIQDPTEFQCQMLNRDFWSNTDIKDI
FT                   VHENFVFLQYQKDSVNGDDYTNFYHFESFPHIAILDPMTGERLKVWSTVPNISDWIEQV
FT                   VDFLSSHSLTGATGSVTPLPQQRSNQAELISLDSAWEDAEEDGDEEESAPGSSESEGSS
FT                   IQIINNNTTLAIKPIENEEPPQGPDSTRIQIRTSDGKRVVRRFLSSDTVRSLFEFVKFY
FT                   FKDIIENHEFQLTSQRVNLFESLGNTIEEANLKNASVLLEVIKD"
FT   CDS_pept        complement(617219..617971)
FT                   /locus_tag="PAS_chr3_0311"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70351"
FT                   /db_xref="UniProtKB/TrEMBL:C4R465"
FT                   /protein_id="CAY70351.1"
FT                   /translation="MTLSKSKDPPHGEDLDLQEKNASESDPEDEILSLSQTETLHKHVD
FT                   EIDDLDIIEELQCKLKNDYKEISGALAGNYLERIDEMVDQIDSTMNRLNKDLSTFEKKQ
FT                   KQAKRNNELAAANPIDIPIFKHAFQQALEPYVTEMKILENQTRYDFELYDQELHRDRDI
FT                   IWKQYLADVSKAREEIRERLSKELEEEIKPMPTPSLLNKEDTVWDPSRMFPAQQRSSQG
FT                   PENSIEDDDELDRDILLLRTLINRKANK"
FT   CDS_pept        618158..619693
FT                   /locus_tag="PAS_chr3_0312"
FT                   /product="Component of the ESCRT-II complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70352"
FT                   /db_xref="GOA:C4R466"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR021648"
FT                   /db_xref="InterPro:IPR031558"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036443"
FT                   /db_xref="InterPro:IPR037855"
FT                   /db_xref="UniProtKB/TrEMBL:C4R466"
FT                   /protein_id="CAY70352.1"
FT                   /translation="MTWKKIKATQSGRPFFDDIDEVIVYIQDDIGLYQDNTKLDKFQTV
FT                   RFYLTNKRLIFINELFPEENYYILLHEIQEVSLYQGFINSSPKLILDLVKTEGEETKRM
FT                   YRISWICTICSFSNHVQLDKPLAKFNEANNEINFKCSMCGIKPERLILKDGSSKADSFE
FT                   PELKPVEATTASKRKHRCPQCTFVNHPSMLNCEMCNFPLRDKDSFDDSDILLGSKDSTT
FT                   FKLSFHDKKVQPFSDKLQHYIEKSQHDFLKRFNRMNMNVVQQPASPVGPSKETPKKGIH
FT                   DLENNSSNFIDSSFLNDSLSGLGRLMRHAEKLIRLSESMKPLMMNLHQCSHENHQLISL
FT                   LKSNKPPHKINNGIIVESDTKKSLYHKEVARQLVEFILNYDLVQNDFISLCELYKLYNK
FT                   SRGLNLLSPSTFKLICEQLENVNSIVKLYQIEYHNNNSFYIISKTSSTNYNLSNKVNTL
FT                   LEENPSDLKQLQIAMNNCNFSILKSVVDELCSEGVIVLDQSIGGNVYYINHYF"
FT   CDS_pept        complement(619710..620876)
FT                   /locus_tag="PAS_chr3_0313"
FT                   /product="Component of the RAM signaling network"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70353"
FT                   /db_xref="GOA:C4R467"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013878"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C4R467"
FT                   /protein_id="CAY70353.1"
FT                   /translation="MAFLFKRNPKAQELVRNLNDSLTKLESYPTDNSNRKKVVADISKN
FT                   LSQIKIILQGKIDNYEELDDENDDRLDMADSPSDYTDRVGSNTADLSIPGLAGSNVGSP
FT                   ETDSTIDQISQLANECYITDLLYRLLLNIETLEFNSRKDVYILCTSLLRREIGNRSPTI
FT                   DYLLTHDYVIQLLMKAPEYHSNINILLSNILRECIKFEKVCRYCLNSELFWQYFKYSQQ
FT                   SSFENSTDALITLNDLLANHHGLVQEFFSKQSNLDRFIENINKLITCNNYVTKRQSIKL
FT                   LSKLILQRSNYNLMTDYVNNSSNLKLIMINLSDKSKNLQYESFQVFKVFVANPKKNRQI
FT                   LDILIKNREKLLFFLKEFNYNDKDTVFNEEKEFLIQQIEELPSKNNST"
FT   CDS_pept        join(621802..621908,622019..623726)
FT                   /locus_tag="PAS_chr3_0315"
FT                   /product="Transporter, member of the ARN family of
FT                   transporters that specifically recognize siderophore-iron
FT                   c"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70354"
FT                   /db_xref="GOA:C4R468"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4R468"
FT                   /protein_id="CAY70354.1"
FT                   /translation="MKFNVFRKSQNESASGSPESQNTDTEAQTHVTLLPGRAYTPYATS
FT                   SFRQHSMLTTATVVYKIVCVISLPWVARIVDCFSRVTGFFIALVFLIATYVMFAASKNV
FT                   GMYLASQIFLGIGIPSYVMMERVFIADTTQILNRGLWTALPTAVASIPTLYVASIVAEK
FT                   MLEHSTWRWGYGMWAIIIPVSLAPLILIMWKLDRRAKRYGVTHNIKSTLNLPEGSWYKK
FT                   VAHLLYVELDIVGGLLMLTGLSLFFLPFTLTGSASILRWNEATTIVLLVIGFLILVLFV
FT                   LWVLSKFPKRPFLSVSILKRPSVLMACTLPLFDAINTSLSGAYFPSVLQVSGHFTVGEA
FT                   ARIPRAANVCQMVGAVLVGLLIKYTKTAKVFMVSGVCLIVLTQGFFCYLANNNGGFGSE
FT                   LHWTVIKVFEGFGRGFYNIPTIISVQANSDPSQIAPSIAMFTMFNQMGAVIGNSISASV
FT                   WNELVIKRLTQYLPEASKSRAREIFGNIRVAIGYAEGTPEREAIDRAYREVLQKQGYIS
FT                   LGFLIPALILVFFIKGFDPTQRTSVNVGDDGEVVLTSAPGKDGEAQLNTIAANLSSSPS
FT                   NSDISEERESSEITSQEKKSELNESEAK"
FT   CDS_pept        join(624226..624261,624314..625249)
FT                   /locus_tag="PAS_chr3_0316"
FT                   /product="Cytoplasmic GTP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70355"
FT                   /db_xref="GOA:C4R469"
FT                   /db_xref="InterPro:IPR006762"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4R469"
FT                   /protein_id="CAY70355.1"
FT                   /translation="MSTNSRKKLLLMGRSGSGKSSMRSIIFSNYSAFDTRRLGATIDVE
FT                   HSNLRFLNNMTLNLWDCGGQDVFIENFLNTSSQNPNSNNNIFKKCEVLLHVFDVESKEV
FT                   NKDIEIFQRVLKNLHQFSPNVKVFILLHKMDLIQVNKRDELFKIMFDNLQKIANPFHFK
FT                   LTGFATSIWDESLYKAWSSIICSLIPNISFYQQNLSKINDILNAREIILFEKTTFLVIS
FT                   STDRKLITNNDELDPKRFEKISNIIKTYKQSVNKIRTNFETIILNGMNTSIYLAELTNN
FT                   IFIMIVMDNQRNDDDSTAIEDENLILEDIKIARSLFEKVENV"
FT   CDS_pept        join(625496..625554,625625..626894)
FT                   /locus_tag="PAS_chr3_0317"
FT                   /product="Farnesyl-diphosphate farnesyl transferase
FT                   (squalene synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70356"
FT                   /db_xref="GOA:C4R470"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR006449"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="UniProtKB/TrEMBL:C4R470"
FT                   /protein_id="CAY70356.1"
FT                   /translation="MGKLAQLVLHPLELRAAIQFKFFKQSLHPRQPTNERETLKHCYEL
FT                   LALTSRSFCTVILELNPELRNAIMIFYLVLRALDTVEDDMTIKPDIKIPLLRSFDEKLN
FT                   LKSWSFDGNSPDEKDRQVLVDFTDVLEEYHRLKPVYQDVIKDITHKMGNGMADYITDEE
FT                   FNLNGVATVKDYDLYCHYVAGLVGEGLTHLIVEAGFGDPKLEDNMQLSESMGLFLQKTN
FT                   IIRDYREDLDDGRSFWPKEIWSKYADSLSDFSKRENYEKGLDCISELVLNTMDHIKDVL
FT                   VYLSSVYDFSSYNFCVIPQVMAIATLATVFRNEKVFETNVKIRKGTTCYLILKARTFEG
FT                   ACEIFSYYLRQIHHSCPITDANYIKIGIKCGELEQFLESLNPAPHVPPGATIPQTPHFV
FT                   KAERKRKLDRELVPTLAIESLKCDVFLSLVALGFLGVIYSISS"
FT   CDS_pept        complement(626931..628724)
FT                   /locus_tag="PAS_chr3_0318"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70357"
FT                   /db_xref="UniProtKB/TrEMBL:C4R471"
FT                   /protein_id="CAY70357.1"
FT                   /translation="MLIFKRYKHIRPIFKTHAGGNSINVSRKQDLIHRDITEIRKNSKD
FT                   NNQLNLNICLKMKAYNRTPQTINNVFRLCNVLKQEKDFIPDNRVYYEIIKSINHKCDLI
FT                   GNTDRLLKDEKIQEIQILANTSLDLAQELISHNGPRCKISAPLREQLEKVVTKCQSVLL
FT                   LRRYLGLLKTIGTSDKYEYLRILTRFYFNSNQYELCFDSFWIMISKYEAGFTTKPLNNV
FT                   LNEFHLGYLIRWSSERNDEANILKMIELLEKNNKVHDFITDKTLYRLTTHSVQYNNHKV
FT                   LARLLQLKDDNSLFFNDYNFNENTLKEFLNCFSENGLVDETLTVIERILLLRNQSTLDN
FT                   ELASHLIQCYANNKETNYLTVWDICKDINVDINTKDLYVLRYPQLATTADIRNNFKALL
FT                   DDLINHDSPLELKKKLLESIFVHIKTRVQTLALSSVPVELLSPKLLELYSYYFKSTFPS
FT                   KLTAYQFTILHKSITNEKLSPKCHYHLMLSQCHGNSHSTLNYFLFNYLNEYQYLTPKIL
FT                   ELIQMVIEETNDFQLKEFLNYYVQHSNNPDGGRWRELLHPEDDYFSIRILTRKNHQIID
FT                   GFGEYSYGIDHTNATRLASIG"
FT   CDS_pept        629037..630023
FT                   /locus_tag="PAS_chr3_0319"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4R472"
FT                   /protein_id="CAY70358.1"
FT                   /translation="MLRQIRTFCRSASAKQESKFNVFDRKVKLLQRTRAANDEESLQVE
FT                   YLRDEIARRTVHRLSFIKREAMNLLDFGCGSGNFVKTLLTPTEDELMKDNIDNVRPKLK
FT                   HVYMVDSCLPLLERNSFDDSFVTKINADEEEYSHEILQRKDFFDCAISNLSLHWINNLP
FT                   GTFRNINDSLKEDGLFMGSMFATDTLFELRTSLQLAEMERRGGISPRISPFVDSSDLGN
FT                   LLQKANFNLVTVDVEEIIVNYPDVWCLMRDLQLMGENNAIANPPGPITKDMLIALDPIY
FT                   RSLHGDEKTGALPATFRIVFMIGWKKSDKQPKPLERGSGQISLKDVL"
FT   CDS_pept        complement(630044..633178)
FT                   /locus_tag="PAS_chr3_0320"
FT                   /product="Tubulin folding factor D"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70359"
FT                   /db_xref="GOA:C4R473"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033162"
FT                   /db_xref="UniProtKB/TrEMBL:C4R473"
FT                   /protein_id="CAY70359.1"
FT                   /translation="MENSEIAIAKVADELLDQIDTLLEQVLSKERSSQQEKDLIQKIQQ
FT                   FQPCPQLIDKSLKKFVSSLLSAYQSNNMLDYLGSTEFSNTIGVIFYEITKLRGYKTVQH
FT                   CLDSNFYLIDSLIIRLQNSREYGIGWQENCLLLLWLGVLILSPFPLTPEKNQSIFRLGS
FT                   TFLNKVGKENEAASYLMANFVTRFKNSEVMSLFYESLPLRGTVNDKISFLRCNNLVLKK
FT                   ANHADILPYLDMQFDTFVTELAETEDVVLLKLLIKNIGKIGVIFESTYQVDKVEDIINI
FT                   LLNYIDSKETVIRYTVSRQFGKLSHKLPEEFRKDIVNCLIEELDINLLSTKLNLDIQVD
FT                   GDVIDINKYHGVLLVFSELALESLIPCEYLQLLTSIICQTIFVVQQRLSYSIGNNVRDS
FT                   SCFLSWSLIRKQMFHSREDCECLVVLFKQLMFSTCFDTDLMIRRASAAVIQELLGRYGD
FT                   FVLATIAPRSEINKLKIKLIELLDYVKLGNLQRSFQLPIEIGDELEGFMRTDFIEFLKH
FT                   LVIGWNYTVRCESSDILVKLLIKEGSPPDDIIDYLACMPTTDGSLMAISKLSSLLTNDK
FT                   ITELASRLKPALDTFEFDFHISPFHKGEEYLLILNSLQYDLTDTNWETTFNIIRQDSRE
FT                   EVYEAFKTLIINLRTEIPKKYTEKWKYYIENKNKITSKALGYCPSILSSNFEEFLSLVF
FT                   NQKIDYEVRAGLIGSISYFLSNHDHDLHLERMIDLLEDYTITNQGDVGSYIRMAMMNLI
FT                   ENNLHKFKDFENSIDVQLFRLSVETMERLRWKSLELLLLIHPEWQGYLQKEPRTNATHF
FT                   RNILEIYRHEILIPLIGAKNEQLSEISRSFWKGYAFSVGSSRSVGPEVKAALRPLVMMI
FT                   IAHEFNDDEFSQIIVNIMSNLKLVANPTDKDRANKLYNCTLSLIVKLIDSNILTKIERD
FT                   SLKTLFVRVYNLQLKAPIMRLGNCLAILKWIYQKAEECSDSKSIEMQHGIMKRLIDLSL
FT                   KHKSSNVRQISIQVLFELYYWKHQKQGAYDGTLELLEKLDWNDNGLEKYVGRLPF"
FT   CDS_pept        633575..634375
FT                   /locus_tag="PAS_chr3_0321"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70360"
FT                   /db_xref="UniProtKB/TrEMBL:C4R474"
FT                   /protein_id="CAY70360.1"
FT                   /translation="MAVVERIFNNMMPQKTKGPKRSGKGKKVGDNADNGNRNQALGHID
FT                   EVNSIADIKDKPSLLGCDHYDDYFPKVSPYEIIGLEISTTSKPVPIEVSSIKRLNVCLK
FT                   STFKQTLGLEEFSNARNDPIERLVTFKRDQENFIMADQGFNRSQNFTFDKPTASKRSIV
FT                   DNLEFKFTTNSNSSNGAKTPMSIFKIQNKLFSDVPTKSKRRRNEKLDNSRTISVRTVLR
FT                   MVDYSLVSDGEFTSMSMSECNTPTKHCNVLINDDDLAQAKRLVF"
FT   CDS_pept        complement(join(634558..634812,634920..636157,
FT                   636258..638327,638374..638845))
FT                   /locus_tag="PAS_chr3_0322"
FT                   /product="Essential type II topoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70361"
FT                   /db_xref="GOA:C4R475"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR031660"
FT                   /db_xref="InterPro:IPR034157"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:C4R475"
FT                   /protein_id="CAY70361.1"
FT                   /translation="MSSSEGFSDDDFIVSSASSSPKAKRHKPAAKPTRKTPPASNGSAV
FT                   NNSENGTTRSSTANNVNVSDQYQKLSQLEHILKRPDTYIGSVEKHESEQWIYNKETESM
FT                   ERKVVSIVPGLFKIFDEILVNAADNKIRDPSMKNIEVTIKPEENLIEVKNDGKELIFGN
FT                   LLTSSNYNDDQKKVTGGRNGYGAKLCNIFSTEFIVETYDKSSGKLYTQRWSQNMGKTDK
FT                   PVIKSIKKATEYTKVSFRPDLAKFNMTELDEDILGVLRRRVFDLCGSVRDISVKLNGEK
FT                   LKIRNFKQYVEMYVKALEHKNDPIKTEDSSLLPPPSSSSPSQTIVYQTLNDRWEIAFAV
FT                   SDSTFNQVSFVNSIATTSGGTHVNFIADQIVKKIEKEIKTKNKKAMIKPFQIKNNMFLF
FT                   INCLVENPAFTSQTKEQLTTRASQFGGKKTEVPDDFIKKILRTGIVDAILDIAAMNADK
FT                   ALKKNDGSRKNRITGYPKLEDANKAGTKEGYKCTLILTEGDSASSLAVAGLAVVGRDYY
FT                   GVYPLRGKMLNVREASADQIMKNAEIQAIKQIMGFQHKKNYTPENINSLRYGHIMIMTD
FT                   QDHDGSHIKGLIINFLESSFPGLLKVPNFLLEFITPIVKVTITSGPEKRKVIPFYSMPE
FT                   YEAWREQNTESFKQKYYKGLGTSLAEEMREYFSQLDKHMKTFHALQDVDPGFIDLAFSK
FT                   KKADDRKEWLRGFEPGVHLDPDLSIIPISDFINKELILFSMADNIRSIPSMLDGFKPSQ
FT                   RKILYGCYKRNLRSEIKVSQLAGYIGEHSAYHHGDQSLIQSIIGLAQDFVGSNNLNLLQ
FT                   PIGGFGSRAQGGKDASAARYIFTDLSKITKKNFSCQGIGTGWSTNIPPFNPVDIVANIR
FT                   RLMDGQEMEEMIPWYRGWNGSITKISADKFRMEGNIEQIDDETIEITEIPAKTWTINMK
FT                   EFLLNGIAGSEKQKSWIKDMEEQHGMDLKFVITLTKEEMKKSLQMGLKERFKLITTINV
FT                   GNMVAFDAAGKIKKYDNVNEIIEDYYHVRLDFYQRRKDHLAEVLGNQLEKISSQARFVK
FT                   MIIENELRVNNRKRIELIEELQRLNFPKFSKDGKPIWQQVDQEEITEAEIKVEEEEEEE
FT                   IDDENLLNKSVNIFASYDYLLGMPIWSLTRERYHKLLLQKAEKEDQLTELLKLSAKQIW
FT                   NKDLEVFLEEWHAFLKEDEEKRASSFKKSGPAAKKKRVRRVKKENDENDPDFGSKKPKT
FT                   VAKKVLNPKTKPKSASLMGSLSDITSELDKNLESFMPYFKVTQLRSAIAMPQKYKDTLF
FT                   KLGLGKRGKISFRKVNPQQAGMLATVKELVKVELSEENVSQKQLRLQRKSNPGFTLERK
FT                   D"
FT   CDS_pept        639080..640456
FT                   /locus_tag="PAS_chr3_0324"
FT                   /product="Component of the commitment complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70362"
FT                   /db_xref="GOA:C4R476"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR031150"
FT                   /db_xref="InterPro:IPR032570"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="InterPro:IPR036875"
FT                   /db_xref="UniProtKB/TrEMBL:C4R476"
FT                   /protein_id="CAY70362.1"
FT                   /translation="MEGQLVERTRGRPSERRSANKWGEVKNRILTRIKYPTNIVGQLTP
FT                   EQLDAFQLVFRIEEITQKLETHQVVPEEKLRSPSPTPIYNSNGKRINTIDIRYTEKLEK
FT                   ERHVLVERAMKTVPGFTAPINYKRPGKTSEKLYLPTKDYPDINFIGLLLGPRGNTLKKL
FT                   QDESGAHIGIRGKGSVKTGRNNNAAGSHQSHMDDELHCLITSESQEKIKKAVALCNEII
FT                   EKAIVSPEGQNDMKRGQLRELAVLNGTLRTTENRACTLCGELGHLRHDCPKKQSFTQTV
FT                   VCRNCGQTGHFARDCKFSGFENERAEDREIDQMMNDLNGDAPSYNMKTLNSSTEPGSVP
FT                   IPQQDQINNLFQNPSKRPHIDDEASESKRPAIKAPLGLSVSVDPQPIQSLPFPPGAGNS
FT                   SFLPPPPPPMAGSSIPPPPPPAVTTKLPPPPPPPVSTRKPPPPPPPSVPTAKPPPPPPQ
FT                   "
FT   CDS_pept        complement(640536..642605)
FT                   /locus_tag="PAS_chr3_0325"
FT                   /product="Essential splicesome assembly factor"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70363"
FT                   /db_xref="GOA:C4R477"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C4R477"
FT                   /protein_id="CAY70363.1"
FT                   /translation="MSVMKNKAPADLQITAEQILLEAYESKDPSLKLTEHKINDLEELQ
FT                   QMQLKKRTEFENALRMNRLNVGQWLRYATFEVEQRDYRRARSVFERCLEVDPTNVTVWI
FT                   RYSQTELKGKNINHARNVLERATILLPRVDKLWYLYVNLEETLGNVVGTREIFLRWINW
FT                   RPSASVWKHFIYFESRYGELENCRKIFEKFVVASPKTETWLYWASFEKQHGDAVDIRNV
FT                   YTLAIDSAMSLGKEFLDESIFVSWCDWETQQKEFARVRALYKFGMDHLTGEKRDRLFEQ
FT                   YTVFEKQYGDREGIEETIMQKRKIKYEQILSENPYDYDNWWLYIELLENYNDTTELLEQ
FT                   AYTKVLGAVPQSESKPDWEKYICLWLKFLFVTELESKDISKAREGYKKLISLIPHKKFT
FT                   FAKVWTNYAYFEIRQDDLSQARKILGQSLGLCPKRKLFKSYIAMELKLKEFDRVRKLYE
FT                   KFIETWPRDVSIWIEYAEFENQMDDDERCKAIYEIATSEPEILPDEERKEAFNKLIDYL
FT                   LSTYQYSEARNAYSRFLILFKHDTVIWIKKAIFELTIPSEEQLNEYLLHSNQNEDLEFQ
FT                   FEVTEESKERSRKEFEKALAFAKATNNKSMRVMLFQAFKEFESVYGTKGSQEEINKRFP
FT                   SVVRRREGDEEVVDYVFPDDQLDSKQVEDVEDSKPKSAMQKFLENAKKWKEKQS"
FT   CDS_pept        join(642694..642706,642784..643328,643435..643590)
FT                   /locus_tag="PAS_chr3_0326"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70364"
FT                   /db_xref="GOA:C4R478"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR031778"
FT                   /db_xref="UniProtKB/TrEMBL:C4R478"
FT                   /protein_id="CAY70364.1"
FT                   /translation="MTSLQTAVCTVSLSAVVLGYEFEGVLFLFILLINISLAVPMECKV
FT                   LSASQRLDDSVVQNVYLEAGDDDALSAETILLRTQRNNVYVSYDGGIVFHQIELRDKGR
FT                   IIDIIVNKHFPAYVYLITVDGYIYISSNGAVSFKRVKAPSKRSVDFALMKNPLSFHKYD
FT                   PKKFIYAGMKGCHFWNNVADCRTSSVNSLMLMERHLQIHVCLLALIILNLIDEKCSVIL
FT                   SNPSKLLMSCGTNYR"
FT   CDS_pept        join(643646..644267,644387..644934)
FT                   /locus_tag="PAS_chr3_0327"
FT                   /product="Putative membrane glycoprotein with strong
FT                   similarity to Vth2p and Pep1p/Vps10p, may be involved in"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70365"
FT                   /db_xref="InterPro:IPR031778"
FT                   /db_xref="UniProtKB/TrEMBL:C4R479"
FT                   /protein_id="CAY70365.1"
FT                   /translation="MFPPELGFDGSWAGATCKVFEGEETEHPLFFHLRRSVPSKYLYLF
FT                   YGALFKSNIEDGSYKLVSDYVNSDRRGVDFELISGLKGTALINIVINHEAIESGTVDEK
FT                   STEIKTKITYDDASSWSYITPPPFDLERNEFICKGEEKLLEDCSLNFKGPTERRSIEIK
FT                   SSCDSGKGLLFGVGNVGKYSDRDPSNLALYFSNDGGVSWRVVAKVFTDKKIKVYDLVYS
FT                   SSGASRKFIVLENEYSVPDRERNIRNLYTIGFSYGDDDSEFWNSKTVFGGVQYNDKHGT
FT                   LFTLLSVSILGGAWFVYNRGIKRNGGFSRLNNFAGQNVESSSRPIEENNTDKVVNCIIR
FT                   VFFSTYQLFQRSVSTVFKELLPNRRSSSQDDVDQPFLGNQMDSERLVTF"
FT   CDS_pept        complement(645442..645639)
FT                   /locus_tag="PAS_chr3_0328"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70366"
FT                   /db_xref="GOA:C4R480"
FT                   /db_xref="InterPro:IPR031459"
FT                   /db_xref="UniProtKB/TrEMBL:C4R480"
FT                   /protein_id="CAY70366.1"
FT                   /translation="MFIKAATRSKMTSSLFSTTFVVAFGLVASNNLLPCPVDHSMNNET
FT                   PQELKPLQAESSTRKLNSSA"
FT   CDS_pept        complement(645856..647718)
FT                   /locus_tag="PAS_chr3_0329"
FT                   /product="Subunit of the telomeric Ku complex
FT                   (Yku70p-Yku80p)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70367"
FT                   /db_xref="GOA:C4R481"
FT                   /db_xref="InterPro:IPR005160"
FT                   /db_xref="InterPro:IPR005161"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR006165"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="InterPro:IPR027388"
FT                   /db_xref="InterPro:IPR036361"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C4R481"
FT                   /protein_id="CAY70367.1"
FT                   /translation="MSVVSKQYDIHEGIIFVIELTPELHAPASEGKSQLQIILENVSEV
FT                   ISELIITLPGTGIGCYLINYDGGQNDEIYPIFELQDLNLEMMKQLYQVLEDHVSGLNPL
FT                   EKQFPIEHSKPLSATLFFHLRSLFYMAKTHKRTGRHYNLKKIFLFTNNDKPYNGNSQLR
FT                   VPLKKTLADYNDVDITLIPFLLNKPSGVKFDKTEYSEILFYDKDACSMSIEEIRQRISR
FT                   HKEIKRVYFTCPLKIANNLCISVKGYSMFYHETPRKIKFVVNEGSTFKDVETKSQFVDP
FT                   TSGKEFSSEQLIKAYPLGADAYIPLNSEQVKTINRFNDIINIPSLEILGFRDISNWLPQ
FT                   YQFGKASFLSPNNYGDFTHSQRTFSCLLQSMTKKSKFAVLFGTLKNNAAPRLFGMIPST
FT                   LPQYESCNLPQGFFLIKLPYLDDVRQLPPKIAPVDADLDVLVSLFSNLVGKIHIKNGYQ
FT                   PQEYENPSLQWHFKMLRDDYLQLEHDIDISDPLEKQKYINSLDETKTKIMKLRDYVKET
FT                   ADDDDPSRLANTLKELNQELNKISNFDIIANKKPKTPTTVDPVPTDDDIINAWKAGTLN
FT                   GFKVDQLRKYVRSRNNFLETASKKADLIANIDKYFQQKFKETKA"
FT   CDS_pept        complement(647848..648675)
FT                   /locus_tag="PAS_chr3_0330"
FT                   /product="Trans-aconitate methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70368"
FT                   /db_xref="GOA:C4R482"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4R482"
FT                   /protein_id="CAY70368.1"
FT                   /translation="MATFTSTEFNSENYDRFRPVYPDELYQQLVDYHVGAKGLCVDVGC
FT                   GSGQATFTLKKYFDKVIGSDISENQLAVARKRQPAGIEFRLGTGEDFSWLTETPDVITA
FT                   AECLHWVDPQKFVANVANSLRDHGTLSYWLYTEPIFQNERANQVYNKFTYGSDYLGPYW
FT                   DPGRTHFRNHLKELNHILLDSELFDEVKISNFKQEEGVKNGDILYLEKEMTISDFINFV
FT                   SSWPSVFSWKQQRGKEGILDDFYNELNDCFEGGNMKVIWNSVLVFARRKQRVV"
FT   CDS_pept        648941..653278
FT                   /locus_tag="PAS_chr3_0331"
FT                   /product="Protein involved in bud-site selection and
FT                   required for axial budding pattern"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70369"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniProtKB/TrEMBL:C4R483"
FT                   /protein_id="CAY70369.1"
FT                   /translation="MNSLEMEGAIPLLKPSRGSSSSNLYETRNDSMEKLLQDIDDETKS
FT                   MATTNSGLERSNSKLRGPRILMNEEEEVCSLAIAEPGNNSETADLLDLSPSKKSVTIDI
FT                   SPPEVLEYELQSSEEEIEEKYLGYCSDDEAIRGKRSELNWKPVPLKIDTQHIGKPLPPI
FT                   VPSPSEVSLKDEADQDLDDSIDDATIKQIVTKSTMDEKIEALLSEPLRAQDFDHQSYLE
FT                   DERLGQLKTPTRIHNNRLKKKNYVQEILLSKNTSTNDMEENLIGLTNIFETDVRNTPNN
FT                   GSLILQLNRSNSVASQASIISGDRKLETSTTNKVSVPITLSDGIKGLSNEIVEQLIPEL
FT                   QPAELFDQDLLESPRTLVGSVSIGEEDLDKVEGVVTSEVSNDIESSILQLLDTNEAEPD
FT                   NSHNEEDKESKDTKLKNRLEESGLSKQLEQLKEIKPVEESEESEDSEQSDHSALSSHPV
FT                   EEEEVPKETDHTHSRSPSITQFLYNVGKGFKEIITPTSSSKNLDQLAEKSPENNEPELH
FT                   TKEGEEFKPPEVIKVVTPNTSSLESLHGSEIVNTIDYSICNPVTIEHKSSSDVREVKLE
FT                   DTILNENDSILGNSTGINNIDEPEPISLENKESDDSEQTLASVSSLKKDETFGLPELEQ
FT                   DSSFGRDLKVFIEDTGEKKVYDDDEEPPLLKKPKKHLPDEYSPQQEVMSIWQTQPVAHH
FT                   AVPKTFKPDIPSKISTLMNKKFRVLSNESTVVYEDTQVQGTSTRNSSGSSGYRSISNNS
FT                   CFSQLSNVSLGSDFGSQFQQFKYRKESNTNPVPKPNNIRRPSLKVSQIWNRGSPYSSSN
FT                   QLDQSMEGNFELHRLKKLVSNTDTDQIAFRKIQVGAKNNQKQDFDMISERGSIMCLDNS
FT                   LEIEDFNTMAPPKATSVFNTQAKNSSYLPTSLTEEIDKDLEYTRKRRVSGLLQSPLLAY
FT                   DNELRKQNHLEASANMNVRRTIEKNSPTKSVISNMSNHTMKKQLYYPTTPTSRMVDESA
FT                   QLPFVSQSAKSNVHTGSSKFLNRIRAESDEVVEPHTPIVNSYSPSKEDQHLTSVVIPQK
FT                   STASKFNINVEKNTKVLSTPQSRSKPTLAEMKRKAMSSPSKPRPLSADLVSGERGRFFL
FT                   NIKGIKDIELPELQEHNATFTMTLDNTIHTIKTPPSSLLEGSIDQEFEFIVPSSPLEVF
FT                   LTFKLEYTKQKEILTEVTETKLVKSGNFFGRLFGFKHKITTTKVVPKKTKADSWEHKVA
FT                   IDGSFAKGYISFQDYETSTCGKLRAFTLNLFNEWETYKDIGVQERKRKKPYCIAKLEME
FT                   MLFIPRTNVYEIIPPSIESAQEQIRQYNQIHDAFHEGFLYQEGGDSPIWTRRFFKLEGS
FT                   DLIAHTETSKKPRARINLRRVTDISYPGKVYEGAESEKRVFSDSLVLNDGFKLVFIDGE
FT                   VIYFGADSKAERDIWVDKLEFALARHRFGLQPWVKLMSQQSHD"
FT   CDS_pept        653646..654776
FT                   /locus_tag="PAS_chr3_0332"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70370"
FT                   /db_xref="GOA:C4R484"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniProtKB/TrEMBL:C4R484"
FT                   /protein_id="CAY70370.1"
FT                   /translation="MTVSGKLEITPLPNKPLGASVTLPRGVTDPSKLSDEDFKTLQAAL
FT                   ETYLVLVIPNQAELPPTSQYDLTVRFDPSCQGSYGHDEKLFHHKESVLAKDGKCIPDRT
FT                   EVVMVGNGSFEAGHAPGMKAFELEHPSQSTFHKDVLTEEEKANGQTRFYRWHIDSALYG
FT                   LSPPKVTTLLGIQVPKCDEKQKIIYEDNGEEFELVKGATAFASGATAFKLLSPEDKEKA
FT                   LNTTVVYAPHPYIFIGKTKATSDGLTIVSEGKEIGLDKLPPWEESKVKKLPMVWTNPTT
FT                   GEHHLQVHGCCVYQLINNKTGEVTELEEARKEVHRLMRPAISPQHIYAHAWNKGDLAIF
FT                   FNQGVWHSVTGEFQPHENRLMHQCNVASGYDPVTKV"
FT   CDS_pept        complement(654855..655799)
FT                   /locus_tag="PAS_chr3_0333"
FT                   /product="Subunit of cleavage polyadenylation factor (CPF)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70371"
FT                   /db_xref="GOA:C4R485"
FT                   /db_xref="InterPro:IPR007854"
FT                   /db_xref="InterPro:IPR039849"
FT                   /db_xref="UniProtKB/TrEMBL:C4R485"
FT                   /protein_id="CAY70371.1"
FT                   /translation="MDEDDEYLYGSDDEQPQQIGAPETKTASSEKSSTAVKTETGPVSD
FT                   DEDDNDNSDYSDSDSDIDIVIGALEPSTQPAASTTASSAVPEDNPGENDDAATQVPSAA
FT                   GKLRIATGSLDVDKVGEYDGKPITQLELQDLKEKPWRLPGSDLADYFNYGFDEFSWSYY
FT                   CSKQDKTRKEFNPAKLMNELLPAGGFPPSGMPPMPGMPGMPPMPGFMPGMPGMPPMQGM
FT                   QGMQGMPPMQGMPSMPSMPSMPGMPPMFNNNPANGSSSSSAQQQQAPKRPVNERDSADR
FT                   ERERNRERDRERDAYRDRDRDRDRDRDRRRRRN"
FT   CDS_pept        655890..656438
FT                   /locus_tag="PAS_chr3_0334"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70372"
FT                   /db_xref="UniProtKB/TrEMBL:C4R486"
FT                   /protein_id="CAY70372.1"
FT                   /translation="MNICFAECLVELFNERDINKLVNQLLRDTRGYDGLLTWNSLLKGN
FT                   AQVLTESVLDNYDNQGYDICSFLQELMVKLSQELDLVKGMRGKRCRYQFQSTFASIKGG
FT                   SHQYLIESHDLAKADVILSRCLFVLNEQENIFINGDYNLVGSIYYNTELQHYFYVKGEC
FT                   RSNPNDLRRVDVFLESSWS"
FT   CDS_pept        join(657295..657296,657495..657771)
FT                   /locus_tag="PAS_chr3_0335"
FT                   /product="Protein component of the large (60S) ribosomal
FT                   subunit, identical to Rpl43Ap"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70373"
FT                   /db_xref="GOA:C4R487"
FT                   /db_xref="InterPro:IPR002674"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:C4R487"
FT                   /protein_id="CAY70373.1"
FT                   /translation="MSKRTKKVGIAGKYGVRYGSSLRKQCKKLETQQHAKYDCAFCGKK
FT                   TVKRQATGIWSCKACKKTVAGGAYTVSTAAAATVRSTIRRLREMAEA"
FT   CDS_pept        658126..658866
FT                   /locus_tag="PAS_chr3_0336"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70374"
FT                   /db_xref="UniProtKB/TrEMBL:C4R488"
FT                   /protein_id="CAY70374.1"
FT                   /translation="MSSKNIENTTSSRGSDNTVIVQDSFTDVLTGWKVEQQDPSGTVTA
FT                   RDGILEIIQPSGATIWLKQKLVGNYEITFDATPIPFTIEGTKFIDRISDLNMFWNATDP
FT                   TTEDGDVTKNHFDASLNSYNSLNLYYVGFGANSNGTTRLRRNDGSVGRPQITGYSTDEH
FT                   RTVDDHAGPMSEYTRLYANTPTRVKIASIRPTKDDPVNLKWYANEKLIFGYEDAKPYLE
FT                   GWFGFRTITSHWKISNFKVTRLNE"
FT   CDS_pept        complement(659902..660771)
FT                   /locus_tag="PAS_chr3_0337"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70375"
FT                   /db_xref="UniProtKB/TrEMBL:C4R489"
FT                   /protein_id="CAY70375.1"
FT                   /translation="MFNLKTILISTLASIAVADQTFGVLLIRSGSPYHYSTLTNRDEKI
FT                   VAGGGNKKVTLTDEGALKYDGGKWIGLDDDGYAVQTDKPVTGWSTNGGYLYFDQGLIVC
FT                   TEDYIGYVKKHGECKGDSYGMAWKVLPADDDKDDDKDDDKDDDKDYDDDNDHGDGDYYC
FT                   SITGTYAIKSKGSKHQYEAIKKVDAHPHVFSVGGDQGNDLIVTFQKDCSLVDQDNRGVY
FT                   VDPNSGEVGNVDPWGELTPSVKWDIDDGYLIFNGESNFRSCPSGNGYSLSIKDCVGGTD
FT                   IGLKVWEK"
FT   CDS_pept        complement(661108..661725)
FT                   /locus_tag="PAS_chr3_0338"
FT                   /product="Flavin-linked sulfhydryl oxidase localized to the
FT                   endoplasmic reticulum lumen"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70376"
FT                   /db_xref="GOA:C4R490"
FT                   /db_xref="InterPro:IPR017905"
FT                   /db_xref="InterPro:IPR036774"
FT                   /db_xref="InterPro:IPR039799"
FT                   /db_xref="UniProtKB/TrEMBL:C4R490"
FT                   /protein_id="CAY70376.1"
FT                   /translation="MITFNKRIATLAATLFSFIVLYTLFNSGAQFSNQLDQPVPLKTPE
FT                   LIIPNQSTENDPPLPFMPKMANETLKAELGNASWKLFHTILARYPESPSENQKSTLNDY
FT                   IYLFAQVYPCGDCARHFNLLLQKYPPQLSSRQVAAVWGCHIHNQVNKRLEKPQYDCSNI
FT                   LEDYDCGCGSDEKEVDDTLNNETIEHLQSIKITEKESEQFGR"
FT   CDS_pept        662065..663132
FT                   /locus_tag="PAS_chr3_0339"
FT                   /product="Protein that interacts physically and genetically
FT                   with Tap42p, which regulates protein phosphatase 2"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70377"
FT                   /db_xref="GOA:C4R491"
FT                   /db_xref="InterPro:IPR007303"
FT                   /db_xref="UniProtKB/TrEMBL:C4R491"
FT                   /protein_id="CAY70377.1"
FT                   /translation="MTDRKINIDSIHIDNARKMSQLTQKSRIPARPGQSMTTNLTQKWS
FT                   SSPKVAHHVSVPALSTKTSTSSHNSCSNPQCDHCGSVIVPAPVATLPLTDAPSISIGNW
FT                   EVFTTRKPILNSQDTEQLEKTLGFPIPEMTFGHNKVQVFKLSEDRSIEWSIDFNAIDAL
FT                   KMVRKNVDPSELLQVSYAQDWVNARQHRKGDEIMEIFRPFDWSYTSDYKGTITSEVPMT
FT                   IDNSKAIPTSKLQTGSILFFNDMILFEDELGDNGISLLNIKIRVMKDCLLILQRLFLRV
FT                   DNVIFRVYDTRVYIDFEKLEVIREFKRLEASYQEIRLQINVGTGDPRALMRDTAWVADH
FT                   CKEVFKEREYVQLSG"
FT   CDS_pept        complement(663233..665257)
FT                   /locus_tag="PAS_chr3_1177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1177"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70378"
FT                   /db_xref="GOA:C4R492"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4R492"
FT                   /protein_id="CAY70378.1"
FT                   /translation="MSQNSSIGKGNQSPPLFDLYEGHQEGSETEATSAAKYPNLFKSET
FT                   TITDLPELVKLLHKFLETKNVTGLALIARQKGLPPSMRAKVWPLLLRTHPFVLKPYITS
FT                   DDDDGDDVDGEEEEQEDDLHSSTPDNSTTSSNDTEGSDNEYPSSIPIHRIRSELQRYTI
FT                   RSNYNKDIIMSLSPQVRQLFEVQEQIFHTIERAVARFLKKWGSIVHYDPGLVWLGLALA
FT                   EWIPPLPEYSYILCGREHVARNGTKLRDINDDNFQRLYVNDDISSIILNYQSEDAKFSI
FT                   NENKEPSNDKSNKHQKNLSFAELYERMVLVVLHSPEQSDVVETDSMHERTNNILQTIPT
FT                   KGGSISERVSFFLHCFRHLLPELSNYFSEEDILNGYNNSDEWVIWWLKWGGARAWSRFD
FT                   RGRVWDYLLGWRNGLPANPNSKTEILRHQEELEEVRSCLDSHTLELLGPDLFWNPLVKE
FT                   DVDSTKKPEPESCALSRKESLKSMLSTLSLTNNTALEWSSSSVGLDERERQSNHRDTLL
FT                   QIPYSQIDPHSALVFIAVAFLKSKEFALLELESTEILEFLNKSSSLKFNGFQSLISDPK
FT                   WDTEDADVRKIMDSYNNSPEDRDVRHLPSSGISYTAEKDSKTNSKGKRAFSPSPPSDLS
FT                   LTGRYRSQPKRSPRGIENVITEAGELWRKWSWQELVEDN"
FT   CDS_pept        complement(665692..668235)
FT                   /locus_tag="PAS_chr3_0340"
FT                   /product="Subunit of the core complex of translation
FT                   initiation factor 3(eIF3)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70379"
FT                   /db_xref="GOA:C4R493"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR027512"
FT                   /db_xref="UniProtKB/TrEMBL:C4R493"
FT                   /protein_id="CAY70379.1"
FT                   /translation="MAPNYNHYNFRPENILKRAEDLIQVDQSDAALETIYEFFTSKRVR
FT                   TGQVSEFEPIALLFVKLSVDLRNGKLIKDGLHQYKRIVQNSENGFQSVETVVKKFLQLA
FT                   EEKLVNAQEKADDLAADEEDDEDQDVSPEAILLSAVSTDDTKGRSDRALVNPWIRFLWE
FT                   SYRSVLDVLRNNKNLEVFYSVVAQQAFQFCLKYQRKNEFRKLSEILRYHLLGVQPQQGI
FT                   VKNDYNVDLNDPETLKRSLDLRFQQLNVSVKLELWQDAFKSVSDVHNLMTVSKRQPNPA
FT                   MMVSYYENMAKIFAVSDNLLFHAAAWRKFFNLFSQSPFATKEQLNHYSSIYLLAALSVP
FT                   DEISSEESASSSLKLASLLNSSTIPSREYILQNLVSRKILQHVDEELLQLYNYLEVDFN
FT                   LITLKQRIAPILSKIESNDSYKAYVKPLSQILLRKLIRAVGDVYDTIKLEYLVALATFE
FT                   GSFKLSPQEVEDVVLDVAREGAIHVKINHDSKIVTFKWNPFDELDLADSKKSSLSPANL
FT                   IRYQLSALAETLSVAVDRTKGGALEVEKAKSHSLVEERINSQFPSEHKEISSRHEVLGE
FT                   RAKQLKAREEERKAQEAKLEQERLLAEKKAQEERAEAEALRKQEEMLKLEREKIIMSEK
FT                   KKVADEINKKGIIKVTDEQLKEMSANDLKALQLQQLSKDKEQLDIMLRSLSKKSDYLER
FT                   ALRKYEAPLLVKKLEEKEAEDEAAAELIKKEIVSKAKEAHDRKVETHNRLKRMEGEFGQ
FT                   FVGELRREFLDAKRDKARQALEKAKQERIAEVIAERKKEIAEEASRKAAEEARKVAEES
FT                   RRVAEEARKAAEAEAAKPKPMTFAQKMALKRQGRI"
FT   CDS_pept        668691..669209
FT                   /locus_tag="PAS_chr3_0341"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70380"
FT                   /db_xref="GOA:C4R494"
FT                   /db_xref="InterPro:IPR025187"
FT                   /db_xref="UniProtKB/TrEMBL:C4R494"
FT                   /protein_id="CAY70380.1"
FT                   /translation="MAKRLTVGKGEDPYNEPIPDSELKFYQRKGAKRKRPIPKFLSKHD
FT                   QKVLKQVRNKAYCLDLVFNLCGFRFGWSAIVQLIPVIGDVISLMLGLRLIRAAQKIEGG
FT                   LPQVLVSQMTMNSIFDFAIGLIPFVGDIINIAYKANSRNFMILEKHLTKGHRKEFEKLV
FT                   SLQEEEPPV"
FT   CDS_pept        complement(669237..671513)
FT                   /locus_tag="PAS_chr3_0342"
FT                   /product="ATPase required for the release of Sec17p"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70381"
FT                   /db_xref="GOA:C4R495"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="InterPro:IPR039812"
FT                   /db_xref="UniProtKB/TrEMBL:C4R495"
FT                   /protein_id="CAY70381.1"
FT                   /translation="MEKLGFTKRNAPKVHVLKIVNSPGNEFAIMNTLAVHPNDFPDNHY
FT                   VICDNRYVLTTKTSNKLEPGTVGAYINQRLWASWSIGQEIPVSSFDMFKSTGQQSYLGS
FT                   MNLEISFRSKGKATQREFDQEELAEQFIARFESQIFQPTQLMIFEFQGNLFDIGVKSVQ
FT                   IVDLGQISLDSVPTSTSITSKGILIKQTQINFFKGSDGLVNLKASSTRPNADAVIRPDF
FT                   KFEDMGIGGLDLEFTKIFRRAFASRIFPPGLIDKLGITHVKGLLLYGPPGTGKTLIARR
FT                   IGSMLNAREPKIVNGPEILSKYVGSSEENIRNLFKDAEVEYKAKGDASSLHIIIFDELD
FT                   SIFKQRGSRGDGTGVADNVVNQLLSKMDGVDQLNNILVIGMTNRRDLIDEALLRPGRFD
FT                   VQVEIHLPDEAGRKQILEIKTKKMRENNMLAPDVNLDELAHVSKNFSGAELEGLVKSAS
FT                   SFAINKHIKVGTVGDISGNLANVQVTRKDFFGALDEVKAAFGVHEEDLHTSIAGGILKF
FT                   STTIDEILSHGQRYIKQVKESRNTKFISLLMHGPSGSGKTALAASIALASKFPFVRLIS
FT                   PEAMVGMSESSKINYIDNTFRDAYKSPLNILVIDNLEGLIDWVPIGPRFSNPVLQALKV
FT                   YLKRQPPDGHRLLIISTSSSYSVLKQLDILNCFHNELAVPNLKSLEEFKSVMDAAEFMN
FT                   DEIRRTVVKQLYGVFGTNKLDIGIKRALVNIDTAQFDEDEVNELVELMAPSLVRENQSG
FT                   SPSHY"
FT   CDS_pept        complement(671904..672437)
FT                   /locus_tag="PAS_chr3_1178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1178"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70382"
FT                   /db_xref="InterPro:IPR029615"
FT                   /db_xref="UniProtKB/TrEMBL:C4R496"
FT                   /protein_id="CAY70382.1"
FT                   /translation="MATTLQSLVTLFLFLGSTFAYQLKAIDFAQNSFNLATLEFDSKWK
FT                   LHTGEQLDLPSDLYRICLDEGCFNYKRLSSPIAQDIKLTINKHNDIENVAFFDASQKGL
FT                   NLIVEQIRQAPIPKLPRKEKKIKKIRSDNKLELKEVIDEEAEVNVDNRSFIQKYWMYIV
FT                   PALLIMLISGNQNQ"
FT   CDS_pept        join(672548..672652,672710..673711)
FT                   /locus_tag="PAS_chr3_0343"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70383"
FT                   /db_xref="InterPro:IPR009011"
FT                   /db_xref="UniProtKB/TrEMBL:C4R497"
FT                   /protein_id="CAY70383.1"
FT                   /translation="MVNRPLDIMIKVLLFLLSLSSLVKALDDSIDKNSVYTINYLNHAI
FT                   SPTSEKIVTLRSTDDQYFECLFNDEIDTDQKLHQKQILKTLPAQYNLSEIPELQTEINS
FT                   AFNILENYNLNDAQPTKDRYWTYQIINGKLYQYNGNLRIVLANIPKNLTREDIVLEKNM
FT                   HQSVFLSLSLQNGAICDLTFTPRKTNIRFQYVNKLNTLGIVSADEIQTCEYEILINVPK
FT                   FKDTIFQYGFLEPLKKIDCYSSDSSMINLADYQISVLSHKWFLGAKDFRLILITDVSNP
FT                   PVISIEELNLIFQTFPKYGPPELGITGEISPHDTFIFRIPVYSYNRTKFGDVLVEQNIR
FT                   GEKRFLFTEDRIPHDTPNFRVYNGVNVN"
FT   CDS_pept        complement(673741..675261)
FT                   /locus_tag="PAS_chr3_1179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1179"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70384"
FT                   /db_xref="UniProtKB/TrEMBL:C4R498"
FT                   /protein_id="CAY70384.1"
FT                   /translation="MTRTNESSKDIFNEFTADYFEVVKHLQKPQNFITELQFPKVINVQ
FT                   DPSLIAGSYYQLVDGKDLKPTELVTISDRIKSGHYKTIYSIFHDLTLVCLILINERNRD
FT                   SEDYVKIDLFYKSMVELLIREAGRFLFNYRQLRESVDSRVLDDYTSEFEESMTKDFNKV
FT                   STFFVSSNGECLTTFITPNAPLFSSLNNKSSLDAREAVVNEGDFNLTKVIPHVPSISSQ
FT                   PLNKISPQYNNEPHPATKPTDLLPNLFHLNWYALPMGQWLTHNKGNDFSFAPTIDEEKS
FT                   AISSELKGLRWLEQAGFRKLGDIAEKLSRPSKNETDNELQKDEPKRIEKELPAPVDQET
FT                   KNGHTGTDTSTKLENTDKEVQVNGSEDYKIKLDNLLSWTPGSFVEEDEIEAIRSNKEQE
FT                   LISKLLIDLSQLRQERYKASPKIDPANPVTVLKPSLKEKRLYFKIKRLIQLVIQTRNVT
FT                   PKDLKLDVSFKLPICQTTYSGTLPASVPIYTKNPSSRVSALTKKRRKY"
FT   CDS_pept        complement(675417..679229)
FT                   /locus_tag="PAS_chr3_0344"
FT                   /product="Essential DEAH-box ATP-dependent RNA helicase
FT                   specific to the U3 snoRNP"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70385"
FT                   /db_xref="GOA:C4R499"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4R499"
FT                   /protein_id="CAY70385.1"
FT                   /translation="MGKYRKRFNEKARSGMLLKQATLKRARNKQFFRQPDEIPEDSPDQ
FT                   NESKDEIVDTNAEYLKPETDKEKEERKRQMHEMLFEQHKESKVSRNKRKRMEKYIDHQL
FT                   KREEKQILLQKLQETKFDTSLLQSSKRLGSSKLTRKEEIVEALSLEKQGRGNDRTNDIL
FT                   YEEREVKQWDEINDGDDISEDSGKDEKEDMAAARVSGFIDHRPTALGGTGSGFSFQNIP
FT                   KVAKRKNEVIKKYNWRQRLEEEESKKKRQELENDFHDSDEDGNENENDSEVPDEASESS
FT                   QPDGSGLDDEDDDFRGFSDNSDNENGFDQDNAIENLEDTSDSDSSTSEDSQHSSFEEDS
FT                   DQTEIPTSSRGKSFKDWAESQLKEINGEANIIQTELPHRDYTPLDRPEDKEDDLEDSYI
FT                   PIDGNNKRKVFYVTVNRSETIQNIRSKLPVFGEEYRIMEAIHNNDCVVICGETGSGKTT
FT                   QVPQFLYESGYGHPDSETPGMIGITQPRRVAAVSMAERVGTELGDHGSKVGYQIRFDAT
FT                   IKEDTAVKFMTDGVLLREMMNDFLLLKYSAIIIDEAHERNINTDILIGMLSRILKLRAK
FT                   YHEQDPSKFKKLKLIIMSATLRVSDFSENRVLFEVPPPILKVDARQFPVSIHFNRRTAF
FT                   NYVEEAVRKSIKIHKNLPKGGILIFLTGQNEINQVVKKLRNQFPTGNSQESVPQVAVHP
FT                   ENAVVEPEEVDLDVNIAEMEDDYDSEGDREEGEEEGFTEELEEDQTSNDPLYVLPLYSL
FT                   LPTREQMKVFKAPPNGARLCVVATNVAETSLTIPGIRYVVDCGRSKERRFNEDTGVQSF
FT                   EVDWISKASADQRSGRAGRTGPGHCYRLYSSAVYENDFPQFSIPEILRMPIESVVLSMK
FT                   SIGIDNIVNFPFPTPPDRNALSSAEKLLWYLGALTRDKKITSLGKTINFFPLSPRYSKV
FT                   LITGNQHGCLPYLIAIMSALSVGDPFLYEHELGIDSRIQQKDEDDDSSDSDEDTKKERP
FT                   VRESVEDIEARRNLRRKFNESRNQFSQLDKNSDAFRLLSVVCAAGHVPRDKLGQFYQEN
FT                   FVRPKIMEEIEKLRKQITHIVKVNTSKDRIGIVEEVDLKLGVPTKVQIAAMKQMIASGF
FT                   IDQIAIRGDLASQDCSVTNKTAIMNIPYATLFPSKTYDQEDIDQFVYIHPSSIICSSAS
FT                   VPPDYLVYFSLNLGSNRRAVNKLRMKPLVNIAGKPLSNVAKSSGLITFSKPLEYPYAPK
FT                   YITSQKRECYVIPRFGASIGSGGIGWDLPAMKVIQEKENGTWVVK"
FT   CDS_pept        679743..680726
FT                   /locus_tag="PAS_chr3_0345"
FT                   /product="Histone acetyltransferase (HAT) catalytic subunit
FT                   of the SAS complex (Sas2p-Sas4p-Sas5p)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70386"
FT                   /db_xref="GOA:C4R4A0"
FT                   /db_xref="InterPro:IPR002717"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4A0"
FT                   /protein_id="CAY70386.1"
FT                   /translation="MSDNEGYYGVTQKRNIRRVRLGDNEFDTLYGNSVYFLEGHHDMLG
FT                   YEAVNAHQRIHHRKHSEPQINGDTDSYWLDTLYVCDLCFKYTRDEALLNSHLSVCKHNY
FT                   RFPGKTMYKDNFTIKKVSGYRHTILCQNLCLFAKLFLDSKSVYFSIENFDFYVVLGESN
FT                   GRRVPMGFFSKELLSWDENNLACILIFPPFQRKRLGHLLIEFSYELSRFEGKVSGPEFP
FT                   LSAFGKIGYLKYWSKVICRELLYGRFSDCQSITLQKLSKFTCIRVKDLISTLDYMGSWF
FT                   TTSDIENSKSLDQYPLAISRSVLKQWIKGESSNCQKLIQEDSLVLY"
FT   CDS_pept        complement(680762..684073)
FT                   /locus_tag="PAS_chr3_0346"
FT                   /product="DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70387"
FT                   /db_xref="GOA:C4R4A1"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014905"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4A1"
FT                   /protein_id="CAY70387.1"
FT                   /translation="MASDQPKRPRFFDDRLEQLDPDEDSPKKVKLFVSDLASDEESPSR
FT                   EDLHSDDEFVLFQSEISSIVTNISETAIMRLYDKVKGHSNILESALNLFYDQPETFTET
FT                   DESKRKDLKEIRTIESKINNLANQRFTEKQKEKYKYIGTLVCDGWCSRPRVQKIQYGSR
FT                   LNISTPPKSSPAKTSKKKASASLVRLTIPDTSNQNYQREVGRLPENIAKTISPLIEMGI
FT                   GKFEVTVIFTDQRTIRMGDSFLIQLDCFIKDSAFTSPDSEHCLTSDERKDVLKKGAKEL
FT                   DTEVLMRKKQKSLFDLFQLLGLKELTEHNKLEGENSEPVNLDSGSDNEDEKAPKSSTAD
FT                   HLDLNQLNQFYKSAQLSHEKVHLPDTTPNKTAFSLDLRTYQKQGLSWMLRREASYSLIG
FT                   NPEGSQDARLVNSFKDHDLNKLHPLWKAYKWPEDRSWSNVKLSENSHDSSFSSSKEFYY
FT                   NIYSGNFSFTKPLLKNASKGGILADEMGLGKTITSLSLILTSSEDTELANESNIPNDYA
FT                   YKTTLIIVPMSLLSQWEQEFDRCNADSQKRCFIYYGNETLGDMKQLLCNSKDPPVVVLS
FT                   TYGTIQNEWARGHKVTDGNLLNEGLFSVKFFRIILDEGHSIRNRSTKTSRSIFDLKASR
FT                   RWVLTGTPIVNRLDDLYSLVKFLRLEPWDNISIWKHFITIPFETRKNLDQSLEVLSAIL
FT                   EPIILRRTKNQKDEFGNPLVVLPSKEVVIDRLKFNEKELTLYNWFRYRAETTFKESLFK
FT                   GTVLQSYSDILTHILRLRQICCSIKLVGNLFKDSFMEDDNFTLDQKLILTQSDESVEVL
FT                   ASFEKKMEEEKLGPDEIISIKEGIYKLYPSFEDTECAICTTSPISIEDCMITECKHCFC
FT                   IGCLMEHFEFQQRKQENEVLCPNCRSKISKLRLFKTHLVEDSERGYSVTLFHPYGSSSK
FT                   INALLRHLKTIHETKEHVVVISQFSSFLDLIQAELSKYKKEFKVMKFDGQLSLSERQVV
FT                   LKEFNDNPENGGINVLLLSLKAGGVGLNLTNASRAFMMDPWWSPSVEAQAIDRLHRIGQ
FT                   SKNVNVVRFIMEGSIEEKMLKVQERKKQLGEAVGDDEERRQRRIEEIKLLFNDDE"
FT   CDS_pept        684535..687855
FT                   /locus_tag="PAS_chr3_0347"
FT                   /product="Serine/threonine protein kinase involved in
FT                   regulation of exocytosis"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70388"
FT                   /db_xref="GOA:C4R4A2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001772"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR028375"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4A2"
FT                   /protein_id="CAY70388.1"
FT                   /translation="MDREQGILPQDPFSNSVHVPKLRASSGGQPQKPVIQNSAPATARM
FT                   LRNASSSTSAALLKELNTHEHSQRQHTPQKQPSLDAPAALVPVESATKQFHRTSIGDWE
FT                   FSNTIGAGSMGKVKVAKHRVTHEVCAIKIVIRSAKIWQRNHQNDPEPETEEKRKKLRDE
FT                   YKKELERDERTVREAALGKIMYHPNICRLFECYTMSNHYYMLFEIVQGVQLLDYIVSHG
FT                   KLKETRVRQFARSIASALDYCHSNNIVHRDLKIENIMINNKGEIKLIDFGLSNMYDRRN
FT                   LLKTFCGSLYFAAPELLSCRPYIGPEIDVWSFGVVLFVLVSGKVPFDDDSVPKLHAKIK
FT                   RGKVEYPEFISPLCHSLLSQMLVVNPDHRVTLKAAMEHPWMTLGFAGPPSNYLPQRSPI
FT                   VLPLDLSVVREIANLGLGNEEQIARDITNLISSREYEACVERWKLDQQKANIKGYSARD
FT                   DSAIIAFHPLLSTYYLVDEMRKRKLAKGALKGQTSVLDTVKVSPDIPKTPAIPQKLETT
FT                   DVEQPLLATVPPAYTSPHGQPAELEAMIEPAQPLSSAHPFEMDMTQQQHASRKTHIKHA
FT                   PERQDRGGYNVHKNNSGGLNSLFRRLSGKRPHKNEAEWEPSSPPPQVHPFSVNDADRTS
FT                   VRGVSPITQPAAVKNVTSNNSKNYLDPVDDSKLVRRVGSLRITNKEKQQVTSDFPRLPN
FT                   FTIPEQPPKNAPIPIHAQPTTTGTTFQSNDHEIKKKLQASTSPNEQRGPPTLAPSQQRR
FT                   LHPTARAKSLGHSRKQSLNFKFGGPANNQLPALPTKENYDVFEDAQITDNNLLNPEGKY
FT                   SANTNVHIKPMTESQILFEAEHAPPGTMPSVEYPRTLFLKGFFSVQTTSSKPLPVIRYN
FT                   IIAALCKLNIQFTEVNGGFVCVYRKTENLQIGDIRSPVIESRVTDDTDSDVANSSKLSS
FT                   SSTANTRVNVIEDDSSSPSSARLKHRRKFSLGNGILNHIRKPTLDGTEFDDYDATVNTP
FT                   VTPAPANVHSRSSSYHTESDNESMESLHDIRGGSDMILKNVPERNARQIDTVKEEETDD
FT                   DDLGSINEGSTHRTPLKFEIHIVKVPLVGLYGVRFKKILGNAWIYKRLASKLLQELNL"
FT   CDS_pept        complement(687934..689223)
FT                   /locus_tag="PAS_chr3_0348"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70389"
FT                   /db_xref="GOA:C4R4A3"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4A3"
FT                   /protein_id="CAY70389.1"
FT                   /translation="MLTPQYRQHVLSPFEYVKPGTAIVNNSPDVTMTHNTIDNSTSDFT
FT                   SEMDFETAYNMLMTHDTLPSMGTSPSSSHGFGTLATSPGAGQQVFNGFQGYSSSSPDQQ
FT                   QKVKTPSNQIIPDPSAEFEYHRKQILKNSGANGSQPYSTANGVSPNTRNLLHSINSKSY
FT                   KNMFGMFSNTPTSSSSGPSSDLLSLSESSVLTEFLDSLVDDVKLSSLSKHWSSIDPLAT
FT                   EKPLETGSPLNTMTLPELKLQNSDLKTNLASIPSMHKINLNFSNNSSADTSRCQSPSIL
FT                   SFKTKSDSLQPPLTSVKTEITHERIPRSPNKSTATKRRATTCTNANKRKRSNDGRPLLS
FT                   EDEKRRNHTSSEQRRRMIIKEAFEEFCSLTVRPDEKIRTAPSASSKPAAQKTRGKDAKK
FT                   SLSKYLIMTKAINEIERLVEVNQKLKELLS"
FT   CDS_pept        690318..691127
FT                   /locus_tag="PAS_chr3_0349"
FT                   /product="NADP(+)-dependent dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70390"
FT                   /db_xref="GOA:C4R4A4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4A4"
FT                   /protein_id="CAY70390.1"
FT                   /translation="MSYGLAAASRLAGKVILITGASSGIGEATALEYANAAKGEIKLAL
FT                   SARRFEKLEGLKEKLTTQWPNIKVHIALLDVSNIAKLTEYVESLPEEFKAVDVLVNNAG
FT                   KALGIDRVGQILQEDIDGMFQTNVIGLISLTQLILPGMKARNRGDIIQLGSIAGRDPYP
FT                   GGGIYCATKAAVRSFSHSLRKELIDTKIRVIEIDPGAVQTEFSLVRYKGSKESASKVYE
FT                   GAEPLNALDIAELIVFASTRRENTVVAETLVFPTNQAGAGYVYRKKD"
FT   CDS_pept        complement(691149..692522)
FT                   /locus_tag="PAS_chr3_1180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1180"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70391"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4A5"
FT                   /protein_id="CAY70391.1"
FT                   /translation="MRAISRVTTLFRCYSTIPIPKAGLPLGDCTIEWVKSLISQEVMLQ
FT                   DQQDKLMKFAMPYYGQEKGVDGFKAVNEKIVINGSGDTINGIRVENLKDQDTMGKKPLP
FT                   LVMLHGYGAALGLFFKNFHGLVKDQPGSTVYALDLPGFGLSSRKPELDVMDETLKHLHI
FT                   QFDSQTVEHYKHIHRSLRMPDMFSLDYNEFENYKKGQKELIEHVESIYIDVLKRWLDAK
FT                   LIDKIDLLGHSFGGYMSIAFALKYPERVNKLVLVSPGGIERSPYAITNKLRKPKEGTLV
FT                   ELKPSGNPADYRFLGRLPVMSSTFMKFWEKDITMFDLLRLSGPIGAQKLTEYIFSKYNR
FT                   NNQFNSYEELKTMSLYMYHCFSKASFSDRTILKIFSPTVVAKYPMLDRIHELKVKESLW
FT                   IYGEFDWMFNSCGEEAVKELTGYGKSAKFDVVSRSGHNLYLDSPEEFNQKVKKFLQWK"
FT   CDS_pept        complement(692788..695094)
FT                   /locus_tag="PAS_chr3_0350"
FT                   /product="Ferric reductase and cupric reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70392"
FT                   /db_xref="GOA:C4R4A6"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4A6"
FT                   /protein_id="CAY70392.1"
FT                   /translation="MKVLLLLFMGCFFKLGSSKGISDETGAACLFVASNFSNYPFDCAQ
FT                   PDLEYKCRCLSPEFLGTVLLCIDDNTDEIDELTRAFDYIKEVCGVQGSKKYSFTQLIDV
FT                   FDNATSHAIPVSVVNGLNKSQLHNPVIPDAQRFASSQESVRRLLNHRYKSTKYGVGLIG
FT                   YWGLSLILATTNNVLQWCFPYIYMNMNGDTTRWLREHVICPQLISESHFRKNSRINTFV
FT                   NSLLRSFPIRVQSITVAFYMALVTIFCTVDYQLYRPNSIFPWKNAQLFAYIADRTGILA
FT                   ITQLPMLILFSGRNNVLQLITGWPYRTFNIFHRWIARTVWILVLLHAVFYVAFTASCSN
FT                   YRERWMINKWRWANTAFVAASISIFLSSRYFRRKCHQLFVSSHQILAIIFVLGCWYHCL
FT                   TLGWMEFLYITVAIWALEYFSRFGKIMLSGGIVQGKCTLVLNKKLEPHSLRITVHHSGW
FT                   WRSFPGAYSYLYFLKPKFFWQSHPFTILGPARQEDFNKLVFLIRIKNGITKKLGNYIMR
FT                   QENLMCTLPMLVEGPYGSTIPFKAYQHSIFFAGGVGITVVYTFAMDLAHTYLADKAKNH
FT                   SINVIWSAPTISAIEEFVDEIEALSRFEMVKVIIYLTRELEAILPIDDQELKIAPKEMG
FT                   DPIELVNSCTDLSNNELVHLLDPLSTGSKELPTELNQRMNEIISTTEERVSPVEYDATR
FT                   EKLQNVFFRCKVNLGRRPSIKKELPGLLKLIPDTTAVVSCGPDKMNRDVRNAVAKSLRE
FT                   PNKGRIDYFEEELVW"
FT   CDS_pept        complement(695252..696274)
FT                   /locus_tag="PAS_chr3_0351"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70393"
FT                   /db_xref="GOA:C4R4A7"
FT                   /db_xref="InterPro:IPR021264"
FT                   /db_xref="InterPro:IPR023278"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4A7"
FT                   /protein_id="CAY70393.1"
FT                   /translation="MEDPENKFDDYIVIGQVRDKLEIQASPRFQKYLDNLSLVFQYLLE
FT                   NPNRNILNDLTSKTSPIELRSPPPTNGFQPPMNEPTQMFTIDLQNKFSMNEQYKMYFNL
FT                   LQQIVCKEIAKLWIKVIEPKKQTKFPYKGGYCTRPPWWPNEVPHREPDHLNKSDRITLL
FT                   ITICHLDVTYLQDLYKSTQSVEFTPEKRELYNELFYLLYKEFDFQRHRTDSKVVVSLFS
FT                   RKQKQLSKNRTAKSQPRRKSISKPPLKKANDENLQMAKLLYEHLNLTANPENPSSINDI
FT                   DITNEYLISSAPSHSNVNFNNSFGLGFNEGHDLPDQTDHYSIYNKSPILPTDKQPNIPL
FT                   "
FT   CDS_pept        696575..697663
FT                   /locus_tag="PAS_chr3_0352"
FT                   /product="Putative SCF-ubiquitin ligase F-box protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70394"
FT                   /db_xref="GOA:C4R4A8"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4A8"
FT                   /protein_id="CAY70394.1"
FT                   /translation="MTLDSQLQTLSIKSDGAVDLSKLDDKQRRAYDLFHQANEKEMEGA
FT                   MSDAVELYRKAYKLDEKVDRWYRYQDITKQASPHNKNTIEKPAVDLELVKKINVQELLN
FT                   SFNEDQITPEEENEPSPLHLLSDDLLIYIMELLCDADSSSWFYFAITCKKLSYLGFHNK
FT                   SIWEKLCKIVYSRQRYDEDTPCSQDQICQNTWKGDWHLMLSQRPFLKFNGAYISIINYY
FT                   REGGRPDMSNSWSNPIRCVTYYRFVRFYPDGTCQRLLTFLSPKIVVPRLNKNYHELGLE
FT                   NVFRGTWKMTMDGQVLITGEGSVEGYSFSETLQIKNLGRMKHHKLHWISAYFQNKDDGE
FT                   MKHFSLAKERPFTFSRVKSYSV"
FT   CDS_pept        complement(join(697676..697865,697909..698075))
FT                   /locus_tag="PAS_chr3_0353"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70395"
FT                   /db_xref="GOA:C4R4A9"
FT                   /db_xref="InterPro:IPR004910"
FT                   /db_xref="InterPro:IPR034751"
FT                   /db_xref="InterPro:IPR039058"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4A9"
FT                   /protein_id="CAY70395.1"
FT                   /translation="MGLRNSVLLEAPQVVFGEKCITFGCKNCSTHLSQSKQVISDKYRG
FT                   RLGNAFLVNKVVNILRGQAERRHMTTGLYMVCDIKCHQCKKVIGWEYLSADDDTQQFKV
FT                   GKFILEANGIIYVQ"
FT   CDS_pept        join(698438..699964,700032..700133)
FT                   /locus_tag="PAS_chr3_0354"
FT                   /product="Phosphatidylinositol 3-phosphate [PI(3)P]
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70396"
FT                   /db_xref="GOA:C4R4B0"
FT                   /db_xref="InterPro:IPR010569"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR030564"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4B0"
FT                   /protein_id="CAY70396.1"
FT                   /translation="MEYIKIAQVPDAVLHKKGNTVKGVLHLTTHHLIFTLPQVETAPRG
FT                   SQELWLCYPMIERVTFTKGSALLYAPDKDESFQLTKGANLRIICRDYTFLAFDFKDVKQ
FT                   CNDVFESLLKLTCVNSLENLYAFLYSPVKIEAPLNGWKIYEPVREFARQGLKLNSPNSS
FT                   SEHPGDKMWRMSNINESYRVCTSYPSVIVTPASISNSVLHHASKFRSKGRMPALTYYHK
FT                   YNGCSIIRCSQPLVGLKQNRSMQDEKLLLEVTKTNDASSVLIVDARPVANAIAQTALGA
FT                   GSEIVEYYPNAKKVFLNIDNIHVIRDSLNKVTEALKNTDISMEPPNQDLLIKSGWLKLI
FT                   YTVLTGLDMIVKSLHLNKQHLLLHCSDGWDRTSQLAALAQLLLDPYYRTLEGIMVLIEK
FT                   DWLSFGHRFNERSGHLQSETKFVDNSEYSSTNQAQHAIKQVTTHFRHRKHVKYTSPIFH
FT                   QFLDCIYQLLKQNPTIFEFNERFLRRLLYHLYSCQYGTFLYDSELERRQAKTIKGWMKL
FT                   YIPIFRRFRFGTNCLDGLTRNSMVS"
FT   CDS_pept        complement(700288..701073)
FT                   /locus_tag="PAS_chr3_0355"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70397"
FT                   /db_xref="GOA:C4R4B1"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4B1"
FT                   /protein_id="CAY70397.1"
FT                   /translation="MSVITPQRLVHLSTQYKSLTDSWFLISIVALNICNLPEEIPKVYH
FT                   YALELYANNGSPTIQTAERSLKTCQTLIDRYAVSLEFQNDKDLIKQKHVTSRAREALLK
FT                   SAALGGLPKCINSMMLLKEATPLSLRETAVKRDFLLSEEAVRTERERGRQFWNSVYGKI
FT                   SNRVMGQMNTAYPDLWHYTFNHVYAPLLSFTDVLSVKETSLVVISCLIPQDVNPQLKGH
FT                   LKGAVNNGCTLEEIRDARLLTIQLSNWCGVKWKGEVASL"
FT   CDS_pept        complement(701254..701883)
FT                   /locus_tag="PAS_chr3_0356"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70398"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4B2"
FT                   /protein_id="CAY70398.1"
FT                   /translation="MSLAPKFIPSHIYKASSGTVPANVHRIQLFLDYDCPFSAILFFKF
FT                   YKSVIPETEKLYPGKFQFVFYNVPQPWHPTSSLLHEVSLAVAAVAPSKFWDYSNILFEN
FT                   QSQFFDTETYNETRKETYQRLIDLATPLGIEAAELWKFVEIKASDSPSNAGNLIGKDFK
FT                   YFIRLHRTIGVHVTPTIAINGILNTSLESSTSVDDYLKVFGQQLES"
FT   CDS_pept        complement(702047..703576)
FT                   /locus_tag="PAS_chr3_0357"
FT                   /product="ceramide glucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70399"
FT                   /db_xref="GOA:C4R4B3"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4R4B3"
FT                   /protein_id="CAY70399.1"
FT                   /translation="MIMQLGLTSLAFLALKCDAYNIAPKIDTPNVEPFAPSGGLKLLAI
FT                   VAIIWYVVVLLVAYYGFFEIMQKFSKRKTLPVPPQVEGVTILRPIKGIDPEMELCLQSA
FT                   FDQDYPKFEIIICVESENDPGIGVAEALIRKYPHVDARILKGDSHNPDHFGPNPKVNNL
FT                   AKGYSAGKYDIMWILDSNVWVCSGALSRSVDALNRSLDNGRSTFDFQTGKGRKVNLVHH
FT                   VPMAISINPQTGTNLDEMFLFTSHSKFYISINKAALAPCVNGKSNLYRRSELDLAVKRL
FT                   GKGSEPSLDGTTGILAKDAAYYGSKPGQGLRFFARYIGEDNMIATALWFQNGGRTGLTG
FT                   DAAIQPLGGVNSTSLKNYLLRRIRWLRVRKHMVLEATLLEPTTECLLCGTFGTFAISTL
FT                   FLQSYFNWKFFIFHLLVWMVTDYTQFHILLTNASQDTATCNVPYFAEPNFNAYGSPFES
FT                   SNLRTFHRWVLYWLLREVLALPIWISAMLGTRIIWRNRPFRINVDLSAEEL"
FT   CDS_pept        703775..704566
FT                   /locus_tag="PAS_chr3_0358"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70400"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4B4"
FT                   /protein_id="CAY70400.1"
FT                   /translation="MMPSVRISTRCKAPNVRFLSAQVAPKKKLSAAQLRKERNILAKSS
FT                   LRDILDSIVPGSVQDDDVTKYDPTPVYDDYRKYDSLSYPQQRYIIDSFKDDKFRKPWGK
FT                   IPKSMKRLNYYISYGNYGPRDGFQPVESDQPNFDLPFRLPSIITTHNPKPSTLVRKLPP
FT                   VNYKTCGEKRKEQYEKERRMDPISKIIIFSTLILTVINFKRDRKVVNTDHVPVNEYEEY
FT                   QKVLEQEERDYREMLEARDNPQPFNPDSKAQKRRWYYLWIR"
FT   CDS_pept        complement(join(704742..705224,705281..705322))
FT                   /locus_tag="PAS_chr3_0359"
FT                   /product="Ubiquitin-conjugating enzyme (E2)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70401"
FT                   /db_xref="GOA:C4R4B5"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4B5"
FT                   /protein_id="CAY70401.1"
FT                   /translation="MSTPARRRLMRDFKRIQQDAPGGVSASPLPDNVMTWNAVIVGPAD
FT                   TPFEDGTFRLVIQFDEQYPNKPPSVKFISDMFHPNVYASGDLCLDILQNRWTPTYDVSS
FT                   ILTSIQSLLNDPNISSPANVEAANLYKDHRSQYIQRVRDTVEKSWSEDILDEDEDDEDE
FT                   DEGEVDNEDAQ"
FT   CDS_pept        705392..706903
FT                   /locus_tag="PAS_chr3_0360"
FT                   /product="Mitochondrial protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70402"
FT                   /db_xref="GOA:C4R4B6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR018955"
FT                   /db_xref="InterPro:IPR036784"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039028"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4B6"
FT                   /protein_id="CAY70402.1"
FT                   /translation="MEARPYGVVFLHNQNLSLDLELKHSLNLSQRPIHMPKLSTIADNI
FT                   FRLGPYPEYSMLLNKYHFYQNSMLLHWAERNAHPVTLKHLANYGKTLNKDKIIMSANFV
FT                   RNEIPVRLALRIKSLQKLPFDVVNNFHFAQVYECYYHCFNSFRKYSRIDNLEENDKFCE
FT                   FIKDTLDEHLTVLPHLMMGALENSILNSLPQKELDEFMSSMLRSRVSRRVILEEHISLT
FT                   TRFQKNKSSDSLGDLFSECSAFEQLEICTGILINYLRGLYPNLQLPELIIEGEDAKFPF
FT                   MLSHLHFIFGEILRNSYKAVITNCLRINDHLGEDQLSKIKPPPIVVSVANNAKDVVFRF
FT                   SDQGGGMPKEVLQDIWSFGKSPKKAQVYLNTFHSLPGLDLNPHFQVKDSFSGQHKKQPP
FT                   LDGSANALLKNITHMEEIVTQRMGIQDKESQEGLYSRKKSFMRSLIARPFDLTLGVSLP
FT                   MCKVYTDYWNGDLRMHSLEGYGSDTYLRLSKLGSFNSDKVQLDRA"
FT   CDS_pept        707000..707659
FT                   /locus_tag="PAS_chr3_0361"
FT                   /product="Nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70403"
FT                   /db_xref="GOA:C4R4B7"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4B7"
FT                   /protein_id="CAY70403.1"
FT                   /translation="MSKSALLIIDLQNDFLEGGSLAVPDGNEIIDPIIELAQKKDWDLV
FT                   IATKDWHPQDHTSFASNHGVKPYTELEFTNPENEAEKKIQVVWPDHCVQNSNGSEFPPK
FT                   FKAFWEQFTGPKELVKKGYLSDREYYSAFSDVWKLHKTELDSLLKGHGIRNVTIVGLAL
FT                   DFCVFHTASDALRENYSVTLVTNLTRSVADREGPPSKLQSLGAHLAEYNGSEIIIK"
FT   CDS_pept        join(707697..707811,707871..708175)
FT                   /locus_tag="PAS_chr3_1181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1181"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70404"
FT                   /db_xref="GOA:C4R4B8"
FT                   /db_xref="InterPro:IPR007262"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4B8"
FT                   /protein_id="CAY70404.1"
FT                   /translation="MTVKPITKIIFLSVLLSIGILLVVLSCALFHNYHPLYVIAVFLVA
FT                   PIPNAIFSNLNANYQSDFLSDSAPNGNPFKDFGEFVTGIFVFSGLVLPIVFWHVQLIVF
FT                   WSMIMSLSGGFIVYASIILFSMFFHMSDDDEGFDF"
FT   CDS_pept        708252..709109
FT                   /locus_tag="PAS_chr3_0362"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70405"
FT                   /db_xref="InterPro:IPR035187"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4B9"
FT                   /protein_id="CAY70405.1"
FT                   /translation="MSRLIVALHTVLKRFKEMGLFTDSDKDNSDKLSESSSSTSSNWLD
FT                   RYLSIAREAKHSLASKIEDVALPGEDGTLFNKNIDTNRPDSIFRAVFGDDFETTFNKVD
FT                   SLVNAIAPVFDQDVWSELFTGSKLVSSKYGLWAYPIPSHQLYKDCNSKQGLSVWDEHGY
FT                   WRCLFPKAQLPENYKSIDSNIISKEDVEQDDSHKLGRFFTNFSDYLNWRSVMEENIKKQ
FT                   RVSFSKPQKSSGSSTSYSERTLPNGEIEKIEKKHEWFVDGTERSKETKTIIHPDGSVTT
FT                   ENIK"
FT   CDS_pept        complement(709157..709585)
FT                   /locus_tag="PAS_chr3_0363"
FT                   /product="Conserved ubiquitin-like modifier"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70406"
FT                   /db_xref="GOA:C4R4C0"
FT                   /db_xref="InterPro:IPR007242"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4C0"
FT                   /protein_id="CAY70406.1"
FT                   /translation="MSDDIKEASPPVNNPTLSESAVLDKVPKTSSLLDEIKERHAQEVC
FT                   KISIRFIPIGSAPEITPKVFKISSSNNFGALLSFLDKRLGNNLIYKNQINHLTGGRIFG
FT                   YLHNSFAPSPDENLDNLYKNFGINGELVVSYSDRVAFS"
FT   CDS_pept        709831..711768
FT                   /locus_tag="PAS_chr3_0364"
FT                   /product="Protein required for oxidation of specific
FT                   cysteine residues of the transcription factor Yap1p"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70407"
FT                   /db_xref="GOA:C4R4C1"
FT                   /db_xref="InterPro:IPR013877"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4C1"
FT                   /protein_id="CAY70407.1"
FT                   /translation="MTDSNSTDSELEKSSKELLTVDTICHYLDDAAQDALETKDYLSYL
FT                   TVIDIHLATDPEKFSVEERIQLLEKLLKILQENDELLYEIGWDIPALLFQYHGLEWDDL
FT                   RIELKNSKGRMAMFHIFELLAEKGNAKELLLKCCELLPRCVDSSSENNDIIFKLRFHSL
FT                   FELMVASQRRIVSNYPSRFLAMMIPPVINLLSNKLESPIFVLRRIYTLLRDYHPCLRPD
FT                   VSENTTAEDIRELSLLHTQENYLQRKLLTTFLTHSIELQSNTIKVLVAPTVFEKLEKSV
FT                   HSQKLGLHLNSEFHRENMILLGRFVTLSQSYDINLEEEIKKQIEETETLFSQLDHNQEL
FT                   DTLNDKIFSLVIENFNGTGLHDKDLKELPLSSIGCIILYTFNVLIENPSAKSYSILDFE
FT                   KVVKLSLRFLLPSMLNPNLTSYSLDDALYAWAWVTVSKENNLSQIPEILITTYLQLLIT
FT                   KSTINFSDYLAPLEAKSRNIILYTLISRVLSLVHESTSWNFLKDSLTTCPFNNARSVLL
FT                   SILKDLCLRSRNITVASLNDKLEKVDLNTKPTIPARDIPYITLSQARGDDIVRLATDTV
FT                   NKTLAGKEVKEDEVILLLSYINFITALKSKIEPQSINRFIELVNKKLKNIDPEDNNGHL
FT                   IKLAVERVSQ"
FT   CDS_pept        complement(711790..713361)
FT                   /locus_tag="PAS_chr3_1182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1182"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70408"
FT                   /db_xref="InterPro:IPR014840"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4C2"
FT                   /protein_id="CAY70408.1"
FT                   /translation="MNSQLGTVKSEEPSRQLQQDSSEKPASINSSTAPRLDSFNTFNLG
FT                   NGFICPPVNLDVADRNHPLDKVQSETKPATTDHNLPPAKLKSSKISLASIINPPDPEIT
FT                   AFSSGLLIAPRPPSTALSIHELTSNPEPVKHARIWESTQSSPKPIAQKRKSPEKEDLVS
FT                   TKAPSTPTGPEPKKRKQKTTTSKDTAVTAGSAETATKPVPPILSKTPSVKSTTKNATKQ
FT                   PTKQPTRPKKKSQNTTPKLISATTGGTNTAAIGPKLQGSTSVDEKKTNSTATSTTQQKS
FT                   LVELPVPSLLDTESIKGKNIPAEEPVVALNILLSDSDKPNPGSAQLVFNLMKVCEEKYG
FT                   FKAMHPNAKFVVESDEDDDDIAEDDEQTETDTKEVATPPPAIPKTPVAAPIREDYNDAE
FT                   RRLRNQNRKIGKYDIMDPFIDDSELQFEEERAATKDGFFVYYGPLIEEGQMARIERADG
FT                   TLKKGTQGTSSRGKKVSKKATTSTSTGNITQKKTVTQSTAPQAVAPQAIAPKEDKQLLG
FT                   SVLAKD"
FT   CDS_pept        complement(713546..715489)
FT                   /locus_tag="PAS_chr3_0365"
FT                   /product="Mitochondrial matrix ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70409"
FT                   /db_xref="GOA:C4R4C3"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4C3"
FT                   /protein_id="CAY70409.1"
FT                   /translation="MLSNFSRNIRSPVSRAALQAVRYNSNAKISGQVIGIDLGTTNSAV
FT                   AVMEGKSPKIIENAEGARTTPSVVAFTKEGERLVGVAAKRQAVVNPENTLFATKRLIGR
FT                   RFEDAEVQRDIKQVPYKIVKHTNGDAWLEARGERYSPSQIGGFVLNKMKETAEAHLGKP
FT                   VKDAVVTVPAYFNDSQRQATKDAGAIVGLNVARVVNEPTAAALAYGLEKTDANVVAVFD
FT                   LGGGTFDISILDIDNGVFEVKSTNGDTHLGGEDFDIALVRYIVDAFKKESGIDLHDDRM
FT                   AIQRIREASEKAKIELSSAASTEVNLPFITADASGPKHINLKMSRSQLEQLVDPLIKRT
FT                   VEPVKKALKDASLSTSDVSEVILVGGMTRMPKVVETVKQLFGKEPSKAVNPDEAVAIGA
FT                   AIQGAVLSGEVKDVLLLDVTPLSLGIETLGGVFTRLIPRNTTIPTKKSQVFSTASSGQT
FT                   SVEIRVFQGERELVRDNKLIGNFTLAGIPPAPKGVPQIEVTFDIDADGIINVSAKDKAS
FT                   GKDNSITVAGSSGLSESEIEKMINDAEKFAEEDKVRKEAIETANRADQLCNDTENSLNE
FT                   FKDKVDKTEAEEISKKISELKEIIAKVNSGEAIEAATVKEKTEDLQNASLKLFEKMYKD
FT                   NASSSGSEEPKN"
FT   CDS_pept        716053..717210
FT                   /locus_tag="PAS_chr3_0366"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70410"
FT                   /db_xref="GOA:C4R4C4"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4C4"
FT                   /protein_id="CAY70410.1"
FT                   /translation="MPGTKSLPVIDLNLALSEDTKPKLVEDLRRALTEVGFFYVINPPI
FT                   ENFPQLINGVKEQAFKFFHDLPADEKDKIEMINSKHFLGYTRLGNEVTSNKVDIREQID
FT                   LATELPAPKIASHDEIWKNIEGPNLWPNQELLPDFRPTIENYLEKVYQFSQWFSELVRE
FT                   ALQLPEGAFSKYFKPRQQCKMKLIKYPEYKDAESRLDLLPENEGVPLDETQGCGPHRDS
FT                   DFLTYLFQATAHEALQVQDIYHSGEWITVPPIENSLVVNVGQTLEYLTKGVCHATIHRV
FT                   ITPRNGSGDRLSIPVFQTIDVNCYKSQLKDIPQELLDLRDKRDKEIKGEAIGYQFSVAD
FT                   DTSEDVRPVGWTVFQNRLKSHRNVAAKWYPKEYKDTMKQIGVFLA"
FT   CDS_pept        717360..718256
FT                   /locus_tag="PAS_chr3_0367"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70411"
FT                   /db_xref="InterPro:IPR032054"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4C5"
FT                   /protein_id="CAY70411.1"
FT                   /translation="MDLESEASLLKKVVRQTFNALSIHFSKSFNAPYLHSLSPHVDRLC
FT                   GFTVSLDHYLKIYNMNDSIFELTITDEGNYIINFSKDMQGIPNLSRIRLIKSRVELFNA
FT                   TLDSYLQSHSTISAYSTARLPVIPDPYTIDYTKKSNTKKRLRNDSAKFNFKERKVETSN
FT                   FGDYKMSVLDRIRLKEKSTKETSSRMEEKLKHENYVRSQMLKFYEILYQLSPKPSSKVT
FT                   LKTFSTKQLISTIQDSISLPLSDSICLDVLIKLCDTLNQPEKLSIIEKNAIKVVKISLL
FT                   DREGDHKIISSHNPHHH"
FT   CDS_pept        complement(718315..721968)
FT                   /locus_tag="PAS_chr3_0368"
FT                   /product="P-type ATPase, ion transporter of the ER membrane
FT                   involved in ER function and Ca2+ homeostasis"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70412"
FT                   /db_xref="GOA:C4R4C6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006544"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4C6"
FT                   /protein_id="CAY70412.1"
FT                   /translation="MSSIVNNPTVLDAKLLVPKALVARPYVWPWTIIYPIWGNIYFNHY
FT                   DEYIKGPEWTFVYFGTILSLQLLFWLMPHWNLNIRAKFQYNPVDKISEATHIRITPAPN
FT                   TGLGEICEIRTDKFEDGETQVSFLYQKRRHLLHSDNVFSPPQFIVDENPQLGVFQESTG
FT                   LSGPLSKMQRLYGKNLFDIPIPTFLELFKEHAVAPFFVFQIFSVALWCMDEMWYFSLFS
FT                   LFMLVSFECTTVFQRRSTMNEFHSMGIKPYLIYVFRNKTWVNIQSDDLLPGDLVSITRT
FT                   AEDSAIPCDLILVDGSCIVNEAMLSGESTPLLKESIKLRPATDSFDPEGLDKNSILHGG
FT                   TSCLQVSSPEDPSVPLAPDGGALAIVTKIGFETSQGSLVRVMIFSSERMSVANKEAFFF
FT                   ILFLLVFAIVASWYVWVEGSKMGRIQSKLILDCIMVITSVVPPELPMELTMAVNSSLAS
FT                   LGKYYVYCTEPFRIPLAGRIDVCCFDKTGTLTAEDLVFEGLAGFDESDVHSLKKPNDVP
FT                   EETLHVLGAAHALVKLDDGEVVGDPMEQATLKAAGWKLGDKDQLYKTDGKKQEKIKILR
FT                   RFQFSSALKRSSSIATVHKKNFVAVKGAPETIKERLVDAPKHYENTYKTFTRAGSRVLA
FT                   LAYKPLPDNLSSNKITKFTREEVETDLLFAGFIVFHCPMKGDAIETIRMLNESSHRCVM
FT                   ITGDNPLTAVHVAKEVEISKRPTLILDLPEAHHGDHELIWRSVDESELIPFSSTDKIDE
FT                   SIFDKSDICLTGYALAKLMDHPQLTKLIRHTWVFARVSPSQKEFILNSYKEMGYKTLMC
FT                   GDGTNDVGALKQAHVGIALLNGTEESLKKIQENKKIEAIQKMYQKQVDLMKRWNSPPPK
FT                   VPPLIAHLYPPGPLNPHYLTALEKNGKTITDEIRASVAAANDGQVSAAVGASLNASSLA
FT                   DSLTGSMTDLEEEMEAPTLKLGDASVAAPFTSKLANVNTVTHVIRQGRCALVSTIQMYK
FT                   ILALNCLISAYSLSVLYLAGIKFGDMQATVSGMLLSVCFLSISRGKPIEKLSKQRPQPG
FT                   IFNIYIMGSIIGQFAVHIITLIYIAIEIYKLEPREPQVDLEKEFKPSLLNTAIFLLQLA
FT                   QQVATFAVNYQGKPFRESISENKGMYYGLVGVSFLCISGATEFVPELNQGMKFVPMDKL
FT                   FKTKLTSCILLDVGLCFFIEQVLKYFFSDFKASDIAIHDEDEEEIEIKKNI"
FT   CDS_pept        join(722218..722310,722357..723814)
FT                   /locus_tag="PAS_chr3_0369"
FT                   /product="Protein involved in the inositol acylation of
FT                   glucosaminyl phosphatidylinositol (GlcN-PI)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70413"
FT                   /db_xref="GOA:C4R4C7"
FT                   /db_xref="InterPro:IPR009447"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4C7"
FT                   /protein_id="CAY70413.1"
FT                   /translation="MSTLKERKEEFVSDLTGGSISEIYVVTFVSLLSYIAWCWLKQRTS
FT                   VFDTRSILGSLLDFALNWNSLLLSITLYSARPLTLNVLIILPCLALSFIKWKKGNEPSN
FT                   RHIRGALSLQSLSVKQFLPHKPFITVYRSQMMVITCLAILAVDFKIFPRRFAKVETWGT
FT                   SLMDLGVGSFVFSMGLVSCRSVLAATFTKSKTFTASQLIHTLVGVTPVFVLGLFRSISV
FT                   KSLDYQEHVTEYGKHWNFFFTLGFLPPIAVLLSPLTKFIPHFWLSLLIGGFYEFILVNT
FT                   NLLHYILLAPRVDLISDNKEGIFSLFGYLSIFLGGQATGLFLLPVCKTRNNLFWPSSKN
FT                   EVVRFQSSPHPFKLLSLSVSPFQGLVYLATFYHVSFYVINTCYIYTVSRRVANLLYILW
FT                   VCGYNTTFLAGYVLVDQYFWPNSDVKFTDQPLTPLQEERYNNVSKLIYVQRTPPILHAL
FT                   NNNSLLIFLAANLSTGVINMALNTLDCTDGKAIVVLIGYELFLASLSGLLLYFNIVIR"
FT   CDS_pept        complement(724700..726679)
FT                   /locus_tag="PAS_chr3_0370"
FT                   /product="Alpha-1,2-mannosyltransferase, responsible for
FT                   addition of the first alpha-1,2-linked mannose"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70414"
FT                   /db_xref="GOA:C4R4C8"
FT                   /db_xref="InterPro:IPR022751"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4C8"
FT                   /protein_id="CAY70414.1"
FT                   /translation="MFGKRRQVRKLLIWVVLLLIVYFFGLQFRAKNSAHQSSIRSFYAD
FT                   NKEFFDRQYSRYDEYDIIDNMNSHNELLQEQFRNGKLAAGLRGVAEEPNSDEVTDDTAI
FT                   EEDEQAAMINFPKRSPQREKSLVELRKFYKNVLSIIINNKPAMPIENPRDPTPNENALK
FT                   RKFGKSGIINIALHDTDPSLPILSEAYLRDSLQLSPSFIASLSKSHSAVVKAFPPSFPA
FT                   NAYNGTGIVFIGGQKFSWLSLLSIENLRKTGSKVPVELIIPFAHEYEPQLCEEILPKLN
FT                   ATCVLLQETVGIDLLKSGHLKGYQFKSLALLASSFEQVLLVDSDNIIVENPDPIFDSEV
FT                   FQRTGLVLWPDFWRRVTHPDYYKIAGIKLGSERVRHVVDSYTDPSLYTSSSEDPFTDIP
FT                   LHDREGAIPDGSTESGQILISKTKHCQTILLSLYYNFFGPDYYYPLFTQGASGEGDKET
FT                   FLAAANYYKLPFYNIKKGVDVIGYWKPDQSAYQGCGMLQYDPIVDYQNLQTFLKTHKGS
FT                   RVNKLEQSELDKPGLLSRLIPKFFFRKTFDEHQLQSHFTKDRSKIMFIHSNFPKLDPFG
FT                   LKLHNYLFVDQDTHKPRIRMYADQTGLSFDFELRQWIIIHEYFCEYPDFNLKYLENANV
FT                   KPQDLCMFIKEELNFLQNNPIQLT"
FT   CDS_pept        727363..728514
FT                   /locus_tag="PAS_chr3_0371"
FT                   /product="Delta(24)-sterol C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70415"
FT                   /db_xref="GOA:C4R4C9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR013705"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030384"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4C9"
FT                   /protein_id="CAY70415.1"
FT                   /translation="MTTSTTEQESQPLAPKNYEQDREFAKALHGKDAAKKTGLGAWVTK
FT                   DASAQEVAVDGYFKHWNGKTDQEAEHSRKSDYSELTKHYYNLVTDFYEYGWGSSFHFSR
FT                   YYRGEAFRQATARHEHYLALKMGITENMKVLDVGCGVGGPAREIARFTGCSVVGLNNND
FT                   YQVERAEFYSKKYNMTKQLSYVKGDFMQMDFEPETFDAVYAIEATVHAPVLEGVYSEIY
FT                   KVLKPGGAFGVYEWVMTDAYDETNPEHRAIAYGIEVGDGIPKMYKRQVAEDALKNVGFE
FT                   VEYQKDMADMDDDIPWYYPLSGQLKYVQTLGDIFTIFRTSKIGRTVTTETVGLMEKLGL
FT                   APKGSRQVTNALEDAAVNLVKGGELKLFTPMMLYVARKPLDAK"
FT   CDS_pept        complement(728614..729522)
FT                   /locus_tag="PAS_chr3_0372"
FT                   /product="Putative vacuolar Fe2+/Mn2+ transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70416"
FT                   /db_xref="GOA:C4R4D0"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4D0"
FT                   /protein_id="CAY70416.1"
FT                   /translation="MAVVTLKNAILSLFPANTSDSQNEPLLGEDSTGNAGYAARDVQGL
FT                   ESEIESNSTKTQNISEDNQNQTVLWGLFEKVDPRVMSDIIIGLSDGLTVPFALTAGLSS
FT                   LGDSKLVITGGMAELVSGSISMGLGGFLAARSESEFYKSQVRKEKQLFFNNKELLEEEL
FT                   EDIFLDIGMSETTTESAIRDLSKSPKAMIDFIIRHGKGLEEPADGRQVTSALTIGLSYF
FT                   LGGFVPLVPYFFTAIVQTGLIISVLVMGVTLFWFGYLKTAISMGEDCSLWMRVSEGLQM
FT                   VLIGSIAAGSAWGLVRVIDTN"
FT   CDS_pept        730544..732433
FT                   /locus_tag="PAS_chr3_0374"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70417"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4D1"
FT                   /protein_id="CAY70417.1"
FT                   /translation="MTVETNQFTYLQGSTFDKKMTTLSLKQTAYEFVEGMTGDYHYLKN
FT                   LDASDSNLRYLKDYSFPTLQELNLSNLSYLKKLVSDGDQLSGLEKLTADGSNIELIDIK
FT                   GDVLASISCSNTKELKAIKGELPAINYIYADNSSLESVSLLPYEDEKFQFKRMFFLYLV
FT                   NCPNLISFQRGQYPKLRTVDLSNSTIQVLHSSLIKHLGALYLGNATIKEFVIDDNDNED
FT                   ELTLRQLKTLNLSNSRIPTNMTDFLLRHIFRKKSNPWDKEWSSLIWQSVNTDQEVQEVQ
FT                   SFIKRIPQLKKLDISNSSKANSLLSNLVSDIPEFWNSLEDLDVFNSNTEGFNFSNSKSL
FT                   IHLGCSDPDATVLKVDDMPALKALDVLGPSNIETVKLSNCIRLEKVDFTGCYALKRFES
FT                   DSLSLLQLKFSNNSLETWSLNDSSIRSITLENNTGFRRLEGNFPNLETLDISNSAVEVI
FT                   NIHDGSKLKKLSILRTRSVEEIQIDNLSTLQELRYDTKDEKNTKAVKEFADKILSKREP
FT                   SFTAKVLQRVRFEHRGLFTGGFRFFDRRTEELVCCFKDINISENKINAKCGICEENYEE
FT                   GQKCQILYCKHAFHTDCVEQMLQMGNDRCRHCNDEIDIASVGLSSDPLPFRWL"
FT   CDS_pept        complement(732875..734404)
FT                   /locus_tag="PAS_chr3_0375"
FT                   /product="Cyclin (Bur2p)-dependent protein kinase that
FT                   functions in transcriptional regulation"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70418"
FT                   /db_xref="GOA:C4R4D2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4D2"
FT                   /protein_id="CAY70418.1"
FT                   /translation="MSQGSTPQKSYPQRRFYGISALRDYKIVGKLGEGTFGEVSKALQR
FT                   RTGRVCALKKLMVLNSKDGFPITSFREVSILKKLKHKNVLQLVDMIYEKPEKQESPGIF
FT                   YTVSPYMASDLTGLLNNPRVHLTQSQIKGIVYQMLEGINYVHQNHYFHRDIKASNILID
FT                   SQGIVKIADFGLARIYYGPKPTPNGGPGGYDSATGMGLASYTGLVVTRWYRPPELVLGE
FT                   KNYTTSVDIWGIGCIFAELFKRKPILEGKTEIDQGHLIFNLCGPLTPTSFPNADKLPGY
FT                   NNYVSARYTRTLEQNYRKHLCSEGLRLLASLLEIDPVKRINALDALAHPYFKAHPHPAP
FT                   TKRLADFEESHELDVKRFKEERKTTDLQPPPPQQTRGFHSAQQGYRKDRRLNNHHQNYS
FT                   NGRNANFFPSGPRIGRSAQSQYTHSNDEANQHRTNYDHSRNQDRHRGGSFRKSNSVTSL
FT                   TSINPETDTASTQVVKSYGFVGLSKGKNQETRSEIVKKSSPKHQESNENPE"
FT   CDS_pept        complement(734925..735296)
FT                   /locus_tag="PAS_chr3_1183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1183"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70419"
FT                   /db_xref="GOA:C4R4D3"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4D3"
FT                   /protein_id="CAY70419.1"
FT                   /translation="MVSLRNAFAPFDLEMLLKHFERSSTLHNLFSMVTKALILMIPYLL
FT                   HIYGNEAIVKLGQFQQFHTGHGEYFSTLPQILSVCATMTIGLISLVCLTIFHGLCQIEN
FT                   LKKNTKVVSMLLRQLLDWE"
FT   CDS_pept        complement(735564..737525)
FT                   /locus_tag="PAS_chr3_0376"
FT                   /product="Cytoplasmic and mitochondrial glycyl-tRNA
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70420"
FT                   /db_xref="GOA:C4R4D4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4D4"
FT                   /protein_id="CAY70420.1"
FT                   /translation="MTSQETTAFTFSREKLESVLKRRFFFAPAFEIYGGVSGLYDYGPP
FT                   GCAFQANIVDVWRKHFILEEDMLEVDCTMLTPLEVLKTSGHVDKFSDWMCRDLKTGEIF
FT                   RADHLIEEVLEARLKGDQEARGQVVSEGKSDDKKRKKKVKEIKAIKLDDDVKEEYEQIL
FT                   AKIDGYSGEEMGELIVKHNIGNPATGDPLEPPIEFNLMFETAIGPSGNLKGFLRPETAQ
FT                   GQFLNFSKLYDFNNEKMPFASASIGKSFRNEISPRAGLLRVREFLMAEIEHFVDPEDKS
FT                   HSKFDLVKDIKLNFLSKSTQIEGKTECAIKSIGEAVSEKMVDNETLGYFIARIYQFLIT
FT                   IGVDPSRLRFRQHMDNEMAHYAQDCWDAELLTSYGWIECVGCADRSAYDLSVHAARTNE
FT                   KLCVREKLPEPITVDRLEIDIEKKKFGPKFRKNAGAVEKWLLARTECELETLQKDLSTD
FT                   GKILVEIPGIEEKIELDDSLIHIERRTRTEHIREYTPNVIEPSFGIGRIIYSIFEHAFY
FT                   PRPDDADRCVLKLPPIVAPTKVLLVPLQTNAEFKPIVKEISQVLRKEKIPFKVDDSGAS
FT                   IGKRYARNDELGTPFGITIDFDTIADGTVTLRERDSTTQVRGSVADIVKAIKTITYDGL
FT                   SWETGTKDLKPFESKSEE"
FT   CDS_pept        complement(737866..739095)
FT                   /locus_tag="PAS_chr3_1184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1184"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70421"
FT                   /db_xref="GOA:C4R4D5"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4D5"
FT                   /protein_id="CAY70421.1"
FT                   /translation="MTVSDLKETNLFKPIKVGNVNLTTRVTYAPTTRRRATVDFIPSQL
FT                   QLQYYGDRSKDNGGLIITEATFVSKQGGLYDQAPGIWSERQAKAWRAITDKVHENNTAI
FT                   SVQLWNLGRVASPKLAKEHGLKLLGPSAFYESEASEKAAQEAGIEIQAATIEDIENFKK
FT                   EYVVAAKLAVEVAGFDFIEVHGAHGYLFDQFLQGKGVNERTDQYGGTIENRARFLLEVI
FT                   DLLIDTVGAEKLAVRLSPWAEVQGSAGVNGDPHPIVLYGYVLSELEKRAKQGNRLAYIS
FT                   IVEPRVSGVTDVSAEEAQRKGIASNDFVLDIWKGVVVRSGAYLSTPGFPSLIKDVNAND
FT                   RTLIGASRFWTSNPDLVQRLKNGKKLTPYDRSTFYLHTNYGYNTWKKYGDDTVVSEDDP
FT                   EAKKTPVALA"
FT   CDS_pept        complement(739916..741145)
FT                   /locus_tag="PAS_chr3_0377"
FT                   /product="Widely conserved NADPH oxidoreductase containing
FT                   flavin mononucleotide (FMN)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70422"
FT                   /db_xref="GOA:C4R4D6"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4D6"
FT                   /protein_id="CAY70422.1"
FT                   /translation="MTVPDLKETNLFKPIKVGNVNLTTRVTFAPTTRTRATDDFIPSQL
FT                   QLQYYGDRSKDNGGLIITEATFVSKQGGLYENVPGIWSERQAKAWRAITDKVHENNTAI
FT                   SVQLWNLGRVASPKLAKEHGLKLLGPSAFYESEASEKAAQEAGIEIQAATIEDIENFKK
FT                   EYVVAAKLAVEVAGFDFIEVHGAHGYLFDQFLQGKGVNERTDQYGGTIENRARFLLEVI
FT                   DLLIDTVGAEKLAIRLSPWAEFQGSAGVNGDPHPIVLYGYVLSELEKRAKQGNRLAYIS
FT                   IVEPRVSGIIDVSAEEAKRKGIASNDFVLDIWKGVVVRSGTYLSNPGYPTLIRDVNAND
FT                   RTLIGAGRYWTSNPDLVQRLKNGQKLTHYDRNSFYRNDNYGYNTWKKYGDDTVVSEDDP
FT                   VSKKTPVALA"
FT   CDS_pept        complement(742440..743636)
FT                   /locus_tag="PAS_chr3_0378"
FT                   /product="Peptidyl-prolyl cis-trans isomerase
FT                   (cyclophilin)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70423"
FT                   /db_xref="GOA:C4R4D7"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4D7"
FT                   /protein_id="CAY70423.1"
FT                   /translation="MFAFLDVTIGGSKIGRIVLQLDNVNCPLASTNFLNLCNQVGKTFH
FT                   SKEYGDIKLTYQGIRFHRIMKNFIVQAGDLVFGRDDSFNQEQVGGGGVSTYINDLSNNE
FT                   KGPIYGKFDDEALDNNPVSKFDRPFVLAMANSGPNSNSSQFFITTYPCPHLQGKHTAFG
FT                   SVVHGKSVVRDIEKVDTTKENNSPLQPVVIVACGEWKEGDPVPVFNCSNSQIGGDVFEE
FT                   YPDDDDNFDKDSLEKALEAVEIIKESGSLLFKQNQIQNALFKYKKSYRYLNEFSPDQDQ
FT                   SPQLYNRFLALKKKLYLNLSLVYYRLGQFSRARDYAEYLLEMEDNQAITDKDRAKAFFR
FT                   KGLAQIALNDFENGLHALKAAQDLTPTDSMISNEILKASKSFELFKKREKNKLEAFFK"
FT   CDS_pept        743857..745023
FT                   /locus_tag="PAS_chr3_0379"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70424"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4D8"
FT                   /protein_id="CAY70424.1"
FT                   /translation="MLGRRRFHAAARRLNVHAVHQQFTSPPDLQYRQSVMKARTDCTEM
FT                   LNKFDKSSYLLAHYIPEPARDTWMAIRCFLLEVNKISDSNTRANSQFRANVGVGLLDVK
FT                   FKFWEELLQKVFLGGYQKPLGEPVATLLRDGINKELNLDIGMFQQILTSRLHYLKNTSK
FT                   LGFKNMDEVCSYGEGIYSQSNYLTQRLLLSPNISPSAVELLEQAPFLETNLTEVAAHLG
FT                   QATGVATMLIGLKYYATTQNHIPLPLDLMAKHDLSQEQLLRLFHGYLEGSDLARASDQL
FT                   SNVVFDVATTANDHILTARQKFDQLKQDICQVLDVDQAHNEFLQSRAQNWTKKVPDVLY
FT                   VPFMSSIPTQLYLSKLEKYNFDINNGNLQSKDWKLAWKSYSNYSRRSI"
FT   CDS_pept        745156..746313
FT                   /locus_tag="PAS_chr3_0380"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70425"
FT                   /db_xref="GOA:C4R4D9"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="InterPro:IPR040062"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4D9"
FT                   /protein_id="CAY70425.1"
FT                   /translation="MNSGIVFQKPMEDNDDSKKATLSNKNTQVVSASTAGIRAVLVQFS
FT                   SLYLRTPAKLFRPTRFDYMAPIRIFFGAHLKGKPYSPFSHSNPALLLRAVKTHGWELIP
FT                   NKVLPPLVANSVMGIVLYTTYLSCLQSYTDGQEGRSIANPRLVDVFRAGFLAGAAQSLV
FT                   AAPIDAIYARSNASEIIGGKNDNLWIYGLHKLKTSGFLGVFAGYSLSLVKESTSFAIYF
FT                   TTFEAIKNRGYRITENTMERIDRMKNSLLGRPQGDTVKTKSENILRTTFILLAGASAAC
FT                   SLLAVQYPFSKVQSIHLARLEALDIFNENSWDKKSKFRLYYRSYLDTFHQLVSLHEKSK
FT                   LSWTRWFYKGFVRNALTTIPATSVGLLVFEILRQKLSDEIEDRFS"
FT   CDS_pept        complement(746353..747144)
FT                   /locus_tag="PAS_chr3_0381"
FT                   /product="Orotidine-5'-phosphate (OMP) decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70426"
FT                   /db_xref="GOA:C4R4E0"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4E0"
FT                   /protein_id="CAY70426.1"
FT                   /translation="MARSYAERANTHQSPVARRLFALMEQKQSNLCASVDVRTTKELLE
FT                   LLDKLGPFICLAKTHIDIIDDFTYDGTILPLLELSKKHKFLIFEDRKFADIGNTVKHQY
FT                   QGGVYKIAQWADITNAHGVIGSGIVKGLKEAATETTDQPRGLLMLAELSSKGSIAHGKY
FT                   TEETVEIAKSDKEFVIGFIAQNSMGGQDEGFDWIIMTPGVGLDDTGDALGQQYRTVSQV
FT                   FSTGTDIIIVGRGLFGKGRDPLKEGERYRKAGWEAYQNILR"
FT   CDS_pept        747315..747578
FT                   /locus_tag="PAS_chr3_0382"
FT                   /product="Mitochondrial intermembrane space protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70427"
FT                   /db_xref="GOA:C4R4E1"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="InterPro:IPR035427"
FT                   /db_xref="InterPro:IPR039094"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4E1"
FT                   /protein_id="CAY70427.1"
FT                   /translation="MDALNAKEQQEFQKLVEQKQMKDFMRLYSDLVSKCFTDCVNDFTS
FT                   NKLTSKEEGCINKCAEKFLKHSERVGQRFQEQNQLMMQQLRR"
FT   CDS_pept        complement(747615..749321)
FT                   /locus_tag="PAS_chr3_0383"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70428"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4E2"
FT                   /protein_id="CAY70428.1"
FT                   /translation="MTALPVLYKVITLQNLHSLYIQSYQRQEKEITLDMDKLRSNINAS
FT                   PLIDPAYDLCQIDTQKVHKDNQTSQVISGEQIVEIINEFFSENGGQALIPISTNVFKIS
FT                   ETISINTIKDRLIKVLNHYKNTTLREVAALEAQYHLLRTQKEKVIASEVLKEDEDESID
FT                   EVEDNKPEEAETARKDYKVDEPQEEQQDEDEKSPAPKEPSKSELSTGGEFSNGSKEEEN
FT                   MEQAEILKEEDTSEEHKENKNEEPVKELEETENTKDENTEKKVESTAESQIEQQHDIDV
FT                   KSEKADDEIGEKSDLSEKTEENHSEKEELVDSTFNSGIQPTETTDSDQQMVADRTKQDQ
FT                   AIGEKKPIDNDFDGDSSSKEKSSEVISETLNGESSPEKSQEEDNNQEANATEESPEEQE
FT                   GQPEESRAEEKLSVETTDDKSLLDRESPSKESERKRSHDADESEQEISPSKRQKKEDTQ
FT                   KSIKKFQTIASNLISQISSNRFASTFLAPVNKSEEPEYYKIVKQPQDLKTILKHCRNGE
FT                   ITTFDELTKVLQIMFTNAIIYNDEDSDVSKLTIEMMEETTKIIELFRESLD"
FT   CDS_pept        749438..750337
FT                   /locus_tag="PAS_chr3_0384"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70429"
FT                   /db_xref="GOA:C4R4E3"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR004181"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR026846"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4E3"
FT                   /protein_id="CAY70429.1"
FT                   /translation="MKTEPTGNGGLAGLSAIKLPTSFPLVPEAQQELSKVNLYDTQFRS
FT                   MVSRYTDQLEQTASKFISNKLEMEALQLIDDPLEKVRESIQKDCKNLIDEFTSSGRKIT
FT                   EEELERSRYQVALTAIKAQKRINYRESAEVSLDNLDVLRDQREEISCADQLESLLSTLE
FT                   VDSATFETANNRLQLLQEHLFVTLNPESELPDAEDDDVAISGGKVSLICPISKRPMKNP
FT                   VKITVCGHCFERTHILEFLQQSQGSGFCPECRTLFKKQDLIDDDLMKLRLEAHNRDLLI
FT                   LQYREKKSSQIGKKENGT"
FT   CDS_pept        complement(750346..751086)
FT                   /locus_tag="PAS_chr3_0385"
FT                   /product="3'-to-5' phosphorolytic exoribonuclease that is a
FT                   subunit of the exosome"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70430"
FT                   /db_xref="GOA:C4R4E4"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4E4"
FT                   /protein_id="CAY70430.1"
FT                   /translation="MELYSPEGLRVDGRRWNELRRFYCRINTHPIVADGSAYVEAGNTK
FT                   IVCLLNGPHEPTRSQMNTQKGSLDIKLHVSPFSTTERRKVTRNDRRIQELSTILKNTFE
FT                   QVVILKNYPRTIIEVNVRVLAQDGGLLAACCNAITLALVDAGIALYDYISAVSAGVFDN
FT                   QILLDLNRLEEQDLSSVTIGVVGKTKKLSLVLSETRLPQDRLAKVFEVAVNGCHQLKDQ
FT                   MDAQVAKKGREKAITEELKTNWVQ"
FT   CDS_pept        complement(751239..752480)
FT                   /locus_tag="PAS_chr3_0386"
FT                   /product="Glycosylphosphatidylinositol-alpha 1,4
FT                   mannosyltransferase I"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70431"
FT                   /db_xref="GOA:C4R4E5"
FT                   /db_xref="InterPro:IPR007704"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4E5"
FT                   /protein_id="CAY70431.1"
FT                   /translation="MEINSRNLLTIGILLRVGFFIYGLYQDSHLEVKYTDIDYYVFTDA
FT                   AKFIANDRSPYARETYRYTPLLALLLLPTTLGGFYFQFGKVLFMLFDLLTGILILRILE
FT                   LTKTRERNRLVLASLWLLNPMVITISSRGSSESILSALVLASIYSLLKGNIFACGLALG
FT                   LSIHLKIYPIIYLPTMIVFLSRDGKVVKGMKEMSQYFTKDAIYLVCVAGFTFSSLTVLM
FT                   FHLYGMAFLRETYIYHFIRIDHRHNFSLYNTALYFVSSLEHQGLKGDLLSFEKWAFIPQ
FT                   LGFSAVLIPWYLTKKDVTSTFFIQTFVFVLFNKVITSQYFVWYLCLLPFYLRQYSSWKQ
FT                   WPEWAGLVIWSASQGLWLYFAYQLEFKGRSTFYPQLFGAASLFFAGNIYLTGLFVKRTK
FT                   SLSEADQDKEKKLR"
FT   CDS_pept        complement(752705..753313)
FT                   /locus_tag="PAS_chr3_1185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1185"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70432"
FT                   /db_xref="GOA:C4R4E6"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR005873"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4E6"
FT                   /protein_id="CAY70432.1"
FT                   /translation="MSEVQIAPKEVIYCEVCSFPPEYCEFGGTFNKCKAWLEKEHPQLF
FT                   QSLYSADALAAATSSLSLEKEEKISQDLQKKRRKEEKKQERELQQKLASKVLIKKIART
FT                   KRKQVIAISGLEVFNIDMKKLAKTFASKFATGASVTKNLEKKDEIIIQGDVGDEVEQYI
FT                   LELLEKDGLTEVKVEQVDEKPKKKKPTAPGTGTGTATST"
FT   CDS_pept        753542..754069
FT                   /locus_tag="PAS_chr3_0387"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70433"
FT                   /db_xref="InterPro:IPR022036"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4E7"
FT                   /protein_id="CAY70433.1"
FT                   /translation="MIGSLPISWDQLIEIVNRNDIDKLYRSRDCKKCYDMHKQHLIYQG
FT                   SSVENYVLQKLKWHKGDDGNYFGESSRPYHVERNQFPYFFTPDLVHLVAWLKTEIPPDP
FT                   HSPLGDISEETRKRLDALITELFVLRVGIDRSRLIWFRNWGALQSIKAVPHIHIVVKNL
FT                   SKEEEFKISTEL"
FT   CDS_pept        754197..755315
FT                   /locus_tag="PAS_chr3_0388"
FT                   /product="Methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70434"
FT                   /db_xref="GOA:C4R4E8"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR031615"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4E8"
FT                   /protein_id="CAY70434.1"
FT                   /translation="MIHSCASAECSKATESTLKCPLCLKQGQIQYFCNQKCFKNGWKIH
FT                   KAVHAKDGDIDGSYNPFPNFAYTGELRPAYPLSVRREVPENITLPDYALDGVPVSEIKN
FT                   NRMNKINLVTEPEDLAKLKNVCRLAREVLDAAAASIKPGVTTDEIDEIVHSETIKREAY
FT                   PSPLNYFNFPKSVCTSVNEVICHGIPDRRPLQDGDIVNLDVTLYKDGFHADLNETYYVG
FT                   EKAKTNKDLVNLVETTREALAEAIRLVKPGMPFRQIGTVIENYVTERGCETVRSYTGHG
FT                   INTLFHTEPTIPHYARNKAVGVAKPGVVFTIEPMLTLGTHRDVVWPDNWTAVTADGGPS
FT                   AQFEHTLLVTEDGVEILTGRTETSPGGAISRL"
FT   CDS_pept        755564..756016
FT                   /locus_tag="PAS_chr3_0389"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70435"
FT                   /db_xref="GOA:C4R4E9"
FT                   /db_xref="InterPro:IPR013251"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4E9"
FT                   /protein_id="CAY70435.1"
FT                   /translation="MFLESCINSLEASVELLDSSTEVLSRATTSFPKLSTILKTNRVFG
FT                   LIPEADVLQSKKTLRHSVEPNIVLLLNRLDHELVKLERKRNSLIRKCELNKIRLENVSS
FT                   LRKKRLSSGIPSRLELLRSKRRQLEYQVQERNSLQENKHTEEIRED"
FT   CDS_pept        complement(756405..757493)
FT                   /locus_tag="PAS_chr3_0390"
FT                   /product="Subunit of RAVE (Rav1p, Rav2p, Skp1p)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70436"
FT                   /db_xref="InterPro:IPR028241"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4F0"
FT                   /protein_id="CAY70436.1"
FT                   /translation="MSCRVFVPYGITETDPKLISKSNKEKEGPWFIENIILRQIPSIQE
FT                   TLVSCKDMIVDESNEIKLPISSRNSDVIKGVIIRKQCEIVGINLILKGFPVKHLELKAN
FT                   ERVVIPQLNDGVHEIDQALISIDRLFQLYSDGTHFERYLDVLTEFHGHIKLAKDSLKLP
FT                   SPDYLFPRYRNVKALEPELPVSMSLDFYINNGDICLEINKLHQSHAVPWSIIVNKTKRQ
FT                   SFVDVVRTQISKNREDSINEIVDMEYKKLLRWLDSESGTAIEDDNNHHKKSLQGRGVGG
FT                   VLSGLFFNGGSSFRNCNKYLQNYLTYLDNDNQPIVVMVEEKFEVLSSDPILISTSTKLE
FT                   TLERVVEKMIENFQVVNYKDNR"
FT   CDS_pept        757649..761806
FT                   /locus_tag="PAS_chr3_1186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1186"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70437"
FT                   /db_xref="GOA:C4R4F1"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024986"
FT                   /db_xref="InterPro:IPR026003"
FT                   /db_xref="InterPro:IPR033031"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4F1"
FT                   /protein_id="CAY70437.1"
FT                   /translation="MDLPSVLVNYPVPLVALQDMVSLASPYQVDIGGPSVSHFSCECED
FT                   SVLQTTAHRIQDMDPQLEGLRFRKPIVKSRELNCNSGQPHRDNLLIRQVLQTYNRSSSP
FT                   KIVKPKLKVKRLKMNVEPIDVKELYFTKKPLLELKTATEDTIAASSSSLIFQPDQENEK
FT                   YTQEIISTLQEIVLEEHLEHHHLLRIMDLLYQLDTNRAELKLDTQVLRNVQKATLQLIT
FT                   ESLENEQDWDLTFKGFYCLLINLTILNLDNDKLLHLDTCLKSLVTFFCTKYEDIIEPLS
FT                   TLSIGESTVTTDSFSLIFELCKQSIVALSIYCVNHRLDDYLFTRLEYVCITIITHHTDH
FT                   KRKNLLMDYSRFSPLKVAASDLLLSIFRFFPDQREFILTEFCYAIHKLDERNSKVYRVQ
FT                   SVILDVFTVTLIRMIQVETLDFRQLSLSEVTKVHDEIQNILQIVFATLMERVVDHPKLR
FT                   SKLEYLIQDVLQVLSDPHFPGASLLIKRFMKGLSESSDNDISILIAGLIAKSLNEKLNF
FT                   ENREKSFDLSMLPNLLLQLDWSAATTILVNCIVSSPSPEDTLSKLDFSNSTGKAPPDVD
FT                   VNIYSLYDEVLNSQSLLQLYDRFLVMMLNNLDSKKPKTRLKAMKTVSLLLSREVLDYST
FT                   VKKIFIKGLRDSSPIINNWIIQEASKYIDKEPYLTDFYLLILDKLFDESISVRKGALKC
FT                   LKSMYIVTQDVSIQVQIAEGALKLLEDEEESMVMLAGETLLELWFYSLDVMNNEDNPAA
FT                   YRLGVHARVEIMAQLLARSNKNKDSFVEFIRSFLNDEKNNDTNSSRMVLRSIKAIADSS
FT                   LESIVENEGNGKAEHMMCLTSTLVLINGEILNQDQLVFLKPYLDEHSNTVTCYYTLKLF
FT                   KHSLPLMKNLASSFTYECLTLLLEKLTKFNVKELFEAMPTVYYLSKLQNDTRYVNAAIS
FT                   CLRLLRPFVNSNHEGDLNAKLTRLLYLAGSFGRCCYFETYRDLFEKNNITIQPNEPVVS
FT                   VFVRSLLLFTKPPMSRKIRRIAIRNLMELCVTHPKFFLSKPLVTIMDEELQSDYVDTKE
FT                   VIIQGIFEFLSQHEETSINNSDHSNKNSKQISLDVEVFHGKSPSFVNESLGVSLVHKYM
FT                   PYILKMCIFDEGYYSLLPVRFIDFVVRLGMANPKVCISTIVCLESSSNRTIRSLALQIH
FT                   RELHNKHESLIESSYVEGVRMATEYRKAHSKDMWKETFFLPLFLTILGDNKSSRRKFFS
FT                   NLLRSFINDVRILTESDSQAYRDYVCFVVLNLANVSFITLEEVYLIIRGIDGLLSKQGA
FT                   PLSAEIDNQENEHDGEGLSWRGLSFLVTAFLTLEQFKEFLISRYGVLEEKLLEFRPQKV
FT                   DKELRQPIRQFNEKKLFDQNKVLHRFDMDPKELSLQFSRNWS"
FT   CDS_pept        762084..764024
FT                   /locus_tag="PAS_chr3_0391"
FT                   /product="Catalytic epsilon subunit of the translation
FT                   initiation factor eIF2B"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70438"
FT                   /db_xref="GOA:C4R4F2"
FT                   /db_xref="InterPro:IPR003307"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR035543"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4F2"
FT                   /protein_id="CAY70438.1"
FT                   /translation="MPPKNKKQKEIVQDERLQAIILTDSYQTRFEPVSSQSPRCLLPLA
FT                   NVPLIEYTLEFLANSGVDEVYVMCRSHASQIQDYLEKSKWSQRNSPFKVQTVLSLESRS
FT                   VGDAMRDLDNRGLITGDFVLISGDVVTNMSLEPVLKTHRQRRSQDKDHMLTMVLMEASP
FT                   YHRSRSNTEPATFMVDRATGKCLYYEQIGGAKKAVSIDPELLTGIDKFEIRNDLVDCHV
FT                   DICAPQVPLIFQENFDYQELRNDFVRGILASDILQKTVYAHITNQYAARVESWSTYHAI
FT                   SQDIMERWTYPVAPESNVIDGTSYIHVGEHIYKENDVILAQTSRLQRCVVIGGGSFVGA
FT                   ETNIVCSCVGKNVRIGEGVQLKNSYIWDDVVLENGVEATGAVVASGAIIRAGAKLLPGA
FT                   IVGFNEEVPAGAEVAASESKMPQLKFSESAAHDDGLFDLSDTSITSLPGTGSRRKGRTL
FT                   STTSYYSEFDSDADGLRDEDDFDKEAMATVTRSMENNHDLDTALLELNTLRMSMNVSYH
FT                   ELRLATTKALLARIEHFVATQTLSLTEATNKIFRKWGLLFRRQVFETEEQIDLLNVLQQ
FT                   QCLELENRSDAASILMRALYILYDEDIVEEDQIYAWWDAPESNASEELIEVKAPAGKWV
FT                   QWLREAEEESD"
FT   CDS_pept        764283..765320
FT                   /locus_tag="PAS_chr3_0392"
FT                   /product="Putative nucleotide sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70439"
FT                   /db_xref="GOA:C4R4F3"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4F3"
FT                   /protein_id="CAY70439.1"
FT                   /translation="MALTHLFPANSNPIVFSILAWYLFSLSISLYNKWMFGPDLGFEFP
FT                   VIITSLHQMVLFILSGSCLLLTPQFRLAHDSKLSYSMPWQMYVRTILPCALASAADIGA
FT                   GNSSFRFITLSLYTMVKSSSLVFVLLWGVAFKLETLSTRLVLIVAIMTGGVVMMVYGHD
FT                   SKDGDNRPTHIFIGCSLVLISAVMSGLRWALTQLLLKRHSHTQNPILTIFYLSPAMSIA
FT                   LFITGGFLEGFGSFAASKVWDIKGVPVTLCLLVIPGILAFLMTLSEFILLSYASLLTLS
FT                   IAGIFKELLTILLGHLVFGDSLSLINGVGLLITLLDILWYNYYRLTESSTVPTLTDVEL
FT                   EEVNE"
FT   CDS_pept        765681..767492
FT                   /locus_tag="PAS_chr3_0393"
FT                   /product="Transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70440"
FT                   /db_xref="GOA:C4R4F4"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4F4"
FT                   /protein_id="CAY70440.1"
FT                   /translation="MSSIFISFFKLVQLRFRYYWNVLASFFPLLTLLSDGLNHVLPPTR
FT                   KISSDSEESHELDDKKSLFPESQQRITQIKVFKNVHPCSLTFNTKLVPFKNSNGEMEWK
FT                   FVEDNESAEKSPSLMEDGLSESLSPFMADSTQDSDVHLMFGTPFLVKEEQQQHKQEQQQ
FT                   LQEQEQEHQHQQHQQNLPSSSNSKDGSQDHSSLAESSKELNIHKRNRRKRVSSVVTSVT
FT                   NGETYYHCSECPSKFKFRGYLTRHSKKHSQRKAYHCPFYESGHGKCSLGEGFSRRDTYK
FT                   VHLKAMHFKYPKGVKCADRTGMMGWCGSCGQSFQNNEIWVERHIEKGVCRGLPEGYSSR
FT                   IMTRNRKKTGKQSSLLNVANNGVNENPMLKLVMDGEVVSAPKLEDVTHLLGESGSTNTW
FT                   TENSENASRTSSIHDLSDHSSASDSLSGHTSGESLAGSTNDSSSQSLDEAINPIGHPVD
FT                   RSLFAHPNSNGEMFGRSWTARESSLHSVVDPFGGQVQAQVQAQIYMKSQADSQVSQSDS
FT                   QKQVNFQTNFQQIPQNFENSVPLAMPIGDDDFPALDGENAYIALLQQHRQLPDSRPERA
FT                   KPAHLGQDPLFHPNMHVSWLSQPDLTF"
FT   CDS_pept        767712..769460
FT                   /locus_tag="PAS_chr3_0394"
FT                   /product="Putative GPI-anchored aspartic protease"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70441"
FT                   /db_xref="GOA:C4R4F5"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR033121"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4F5"
FT                   /protein_id="CAY70441.1"
FT                   /translation="MYQALLVLSLICFSSANFVKLRSNAGMFYDTMAGVPRSDEEFWLR
FT                   LDINQGLSWTLDSSYYSCNGSNVSSSLCFNSAQNVYDASNSPTADFVDVYANTTVNNTD
FT                   EASAERVNLTNNLFADGVYMEDNFYVTLNNGARMTATDLKFLNAHNSSAAVGSLALGSY
FT                   TSQDVPTFLQRLQSGGLIESNSFSLALNEIDSSYGELYLGTINSTKYVEPLVEFDFIPV
FT                   SDPNGVFGFDWEDTFPTVPISGLSMSSNDKQRTVFFPNEWNNTVLTGTYPLPMMLDSRN
FT                   IFIHLPFSSIIHIAVQLNALYLDTLHKWAVNCSVGQLDATLNFHMGNLTVHAPIKELIY
FT                   PAYQGDKRLSFANGEDVCILAMAPDVYIGYPLLGTPFLRNAVVAVNHDSKKVAVANLNR
FT                   DSIPPASNVSVSESMGVYVPPPVSTSRTSERPSTLDETSTANFDKREESAISSSSVTNS
FT                   SSRNSSTITSSGTQTEQTSGIATIETDSIPGALGNNLTDYSTLTLTIYTNSEVDELNPN
FT                   IATAFISNGSIYSEPYPFSGTAVAESFSASPSQAEGSNSSSSGSSLVLCFFTSLASLLT
FT                   VSCLLL"
FT   CDS_pept        complement(769531..772464)
FT                   /locus_tag="PAS_chr3_0395"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70442"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR013914"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4F6"
FT                   /protein_id="CAY70442.1"
FT                   /translation="MPQTPWLKKTKDPFESPNMSKSFDNSVLKETQVTPVPAARSKTAH
FT                   GIFEQLRKNHAVVQEFEVLDGIVVDGVDMEDQSTSSLKLNDRSLKQNDTFDSTLSHDTP
FT                   RHRIPFDATQKDILPSSDTLAVSEKDIVPILDTQSSTQKDSHSNWESQEKLGPMLKDTQ
FT                   VIDTSNMPTSTQADDGHKYMTKEYLLGGASQLAPTQVIEKSTQNIHGTPNQKFIQVPGT
FT                   AEREIASTNASRFSRRHELTDPENSQIIESSFSNIKSQNGDEEENDEASAFPNNLLFDT
FT                   LERLTPKRNKSGSGSTSFSPGKQNVSTPKEKEFLSSEVTEELTDIEDERALNFKHARHL
FT                   KAQQTPSSFDKMEEQNKHIGSNYLSPRKPNYSQNADFMFSQQSFKGSPTRRNLFDANEV
FT                   EEEIHSDYEKHQTLDTNSRTSSLSDLIENHDVIFDSFQSPQSKDLRVSNKFDIELGQKE
FT                   VIHRKEKHEDYILSQTDIANKAAVWVRIGSKIIPGNIVDFAGTSVDVSDGVDVFRIREM
FT                   NVLGILDIKIGDVIKWKSLKRRTCIVTGLAFKGSIASDNTDIQCARGFNTVYLKEHKKG
FT                   VDLEKDEEKKVNLNEIYLSGTLFRCPTRSKLFNDTDFFKDYLCQVKESLGLTSKYLNND
FT                   HGVFSGCLFAITGTTDKKGKEILDLKAEIDSNGGKILENGFRPFLLDSRTQFIDSEHNL
FT                   QLTPKDSLDSFSFAAIISNGVVRTPKYLEALALGWPVLGHEFIGDCLKDSKTFSRWKAY
FT                   LLPAGKTKLVSGLKSIEISRFINNFEAGKSLVSQLRANNYKMNGMRLLVIQDGDQVKAG
FT                   VVEFLAYCFGVKSLDKPANYEEALSIIEKYHPSNGREDKCECALYDDKTIKEITGALNL
FT                   AYDKIDNQTPNDQTEELASGATTKKRGIDSQDLITTRRRRTVKKINYNEDSDDEPEIKS
FT                   KRSKSVSKLQARNLPESKRTRIQLLNWEWMTEVIVSGEVWPPSGNYN"
FT   CDS_pept        772852..774759
FT                   /locus_tag="PAS_chr3_0396"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70443"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4F7"
FT                   /protein_id="CAY70443.1"
FT                   /translation="MKTQFDVLCRRLDELYNDRCFFEVVWLVTPEMLFEPIPLEQRVQI
FT                   GLALIQLKKYGVGVQQLILACEFSSGMSKQDKWLLLAQQLKKLGYVEKARLCLNEAYLI
FT                   SLDTKILQLVIEVQRTNNVKVEPNEDELQLIQKIRKMEQLHQKEYYQSRITQLEEIEYI
FT                   SNQLILFSISNFLERQKIIDDCLLGRVFKVASKFPPWSFFSLLEEHKPTLQSLIKEEED
FT                   IYFEINLTAPAKPFCKSLKALSRSQHKEKLVKICRLAVLHRFTQSIISFLNDDLERSSS
FT                   IMREVLLLFEMLSMHFDMINKTRNEFIEQFGFNEVFMVCAIYAAQYALQRNHKTSREEI
FT                   EHLQKVLNKCLDDSSVNLITNKQLAGHLFKMLGLIHQRLAVYNLRWIRSSPSMFENHQP
FT                   VEVPDNLIKLNEENLDCMVTNLIWAATMKQNHDPELVRIYDQILWAMLLSGGVHVKCFW
FT                   FFKFVRDYYKLENDISPLTLDCYQPQTCYHKESITERLVEYYCHGQFFSIENEAQKLLD
FT                   HIYNIKDSFSSDEKSQMWDVTQENVFLAPHVFLHQDSFKCLMMDGYFSYAEFQSLQQHH
FT                   LRPILRRLMRYPQEETTEEVSKSIHKSRDWIVLWIQQFKVFNGREIPEVISNFWYENIE
FT                   "
FT   CDS_pept        complement(774803..775774)
FT                   /locus_tag="PAS_chr3_0397"
FT                   /product="Component of the septin ring of the mother-bud
FT                   neck that is required for cytokinesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70444"
FT                   /db_xref="GOA:C4R4F8"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030379"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4F8"
FT                   /protein_id="CAY70444.1"
FT                   /translation="MNTFTSISPEEMRRRKMVKRGLDLSIMVCGVRGTGKSSFINTLCG
FT                   QQVIEPTSETPADNNVSFKTYKAEITEINSTPINLEIVTTPGFGDKINNEESSLEVLKY
FT                   LEAQYDTILDEECRVERNTKAKDKRIHVVFYLIRPTGKPLRELDLEFMKMVGTRANVIP
FT                   LLSKADLLTEEELQLNKQLVMDDIKDHNIPIYDFTLSYDSVADSDYYNEGLEIQKMLPF
FT                   AVIGGNNVEIINGQKFHTRDYPWGTVRVEDPDHCDFLPLRNILFGSYLQDFKDSTHSVL
FT                   YEKYRTERLAGTKSKDLTFKSDALFDSVKRESASQHLDISVT"
FT   CDS_pept        complement(776046..777311)
FT                   /locus_tag="PAS_chr3_1187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1187"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70445"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4F9"
FT                   /protein_id="CAY70445.1"
FT                   /translation="MITPQENFKGKKDSLKRPSDTEVSPAPDSSPSKRSKPASKVDPIS
FT                   STTWPPVVDIVENNWKFTFDELRDRSPSRVKQVPYHVELERRWKGVNFINQLARALNLS
FT                   RSVAITGSTLFHRFYMRRDFNMHHQYPVAAACLFIATKTEEARRPLKNVVIEAVKISSK
FT                   DPQKQVDEQTKDFWQWRDTIIRNEEIVLLYLCFDVSPESPYRKSQQAVREAEFPKQLNA
FT                   GIPLKVSPELIFRESCSFYEECCKLALLVLFGANVVAGVGLVHACIQEDARFSPQFLQK
FT                   SLNTSINDCWRCYKVFVEMMRILKDRIPPSVKERYGQYPKDRFFRVAGEDIPQEKNKTI
FT                   PVDKSAGAVELDAISTKTAPQELNEEVKNNDGDDISKNTNGTTKENPKGNDFDDYPNST
FT                   KETVKEFSDSETNATTPAPNGT"
FT   CDS_pept        complement(777404..779515)
FT                   /locus_tag="PAS_chr3_0398"
FT                   /product="Translation termination factor eRF3"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70446"
FT                   /db_xref="GOA:C4R4G0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR003285"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4G0"
FT                   /protein_id="CAY70446.1"
FT                   /translation="MQSVLISVVFRQLSVNFPSSSSATVNKNFTRTVSFPFSKEMSKQQ
FT                   DNNDLSQGVGNIDLNRKNEQRFNPNSASSFQPSFNPQAQNFVPGQYQESQSYQNYQGYQ
FT                   SYQQNQGFQAQPGYQQPYQQGYQAYQGYNNFYQPPAEPQTKAMSLEDYNKQKEQSKNSL
FT                   NAKPKRTLKLSSSSGIKIGGKKEEPKTETKPETKTEAKTDPKPAQKEEPKVEVPKAKSE
FT                   NKIESNTESKTDSKAGSKTESKSASKVESKASLAADTLPKEDDINEEVINDLFGGKDHI
FT                   SILFMGHVDAGKSTMGGNLLYLTGSVDKRTIDKYEKEAKDAGRQGWYLSWVMDTNKEER
FT                   NDGKTIEVGRAYFETEKRRYTILDAPGHKMYVSEMIGGASQADVGILVISARKGEYETG
FT                   FEKGGQTREHALLAMNQGVSKLAVVVNKMDDTTVNWSKERYDECTAKLAAFLKAIGYKK
FT                   EDVLFMPVSGYTGAGLKEPVNPTECPWYKGPTLLSYLDSIDIQNRKVNGPFMLPIAGKM
FT                   KDLGTVVEGKIESGHIKKGSTLIMMPNRVSVEVLTIYNETEEEADQAISGEQVRLRIKG
FT                   VEEEDVSNGYVLTSPNTPIKTVTRFEAQIAFVELPSIVSTGFSCVMHVHTAIEEVTIVQ
FT                   LKHKLEKGTNRRSKKPPAFAKKGMKVIAVLETPEPVCVETYEDYHQLGRFTLRDQGATI
FT                   AIGKITKLL"
FT   CDS_pept        complement(779590..781059)
FT                   /locus_tag="PAS_chr3_0399"
FT                   /product="Minor sphingoid long-chain base kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70447"
FT                   /db_xref="GOA:C4R4G1"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4G1"
FT                   /protein_id="CAY70447.1"
FT                   /translation="MSDKPLLQTLSRAIITQSGIQLSGNWHESNYHPLFCCSGSSSDSS
FT                   IHRTIPYHDILFAEELDSSASDGDFGTREIELTYVARNNKIDLKKEIVIVTDYEPNLSQ
FT                   TILQKAYGQTDRTHPQRILVLINPHGGKGKALRLFEDKAEPILNAAQCEYEVCTTLKHQ
FT                   HATELIRTRKDILDFDTIVCASGDGIPHEVINGLYQRDDRAECFEHLTVTQIPCGSGNA
FT                   MSLSCLDTNDPAEAALSVLKAPSVRIDLMAITQPSQSVRLSFLSLTYGMIADGDIGTEW
FT                   LRFLGPFRFEVGIVTKLLQNAKYPCDLSVDFCAKDHQLLSQHYCDNIKSDYSKTQHLPI
FT                   TDQSFELKSPSLENPPPTDWERLDSQITDNLSIFYVGKMPIVSADTNFFPAAIPDDGCM
FT                   DLVITDNRSSVLDTANLLLQVDKGTHVLQKDVIHSKVKAFRLTPRIPKGYISVDGESFP
FT                   FETTQVEVLPTLLKTVMKEGTYAETGFPSYS"
FT   CDS_pept        complement(781291..782445)
FT                   /locus_tag="PAS_chr3_1188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1188"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70448"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4G2"
FT                   /protein_id="CAY70448.1"
FT                   /translation="MFRQARFVSTFPLKSDINITKSGKTLLSVGQGGRSSRTGFTATVF
FT                   GGTGFLGRVVVSKLAKHGTNVVVPFRNDRARRQLKVNGDLGVVNFVEFDIRNLKSIEDS
FT                   VKYSDIVINLIGTEHFSKNFSIEDVNIGAAERIAKAAKEAGVSRLIHVSSYNANPSSSS
FT                   DFYATKGIGEQVVRDNFGPDATIVRPAPMYFRNSPFLNELLQIKALGGNVIFKKEVYPV
FT                   HALQVGEAIERIAFDDATAGQTYELFGKERYSKKELREMIKHIIHIGQRGYYPYSAGFY
FT                   LPAPEPFLYAFALIRQYISSQPRFNVDQLKRSHINQEIDQSAKTFTDLGMVPDELSEYL
FT                   YRYVKPHISYTSQTQNRTVYSKEDIEKLRDYVNTPNDSFNLFNV"
FT   CDS_pept        complement(782572..783606)
FT                   /locus_tag="PAS_chr3_0400"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70449"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4G3"
FT                   /protein_id="CAY70449.1"
FT                   /translation="MTNPSLARDKQLFTDLKSTELNDGSLENHRTSTDIITLEFNKGNR
FT                   LAYSRSDKTLCIWKRFKENVWDSLLQINTTSNKPVYCIAWDTVDELIFVTVAKDSTAQI
FT                   WQLNGSNTQCKCLKTIQTPSPKNSNFIAKISPDGKYLVIASFNNTISFYDFQSKHEPVF
FT                   LFQYTFNENVYDLQWDSKSRFLLFTLSNGTAPIYSITKDSGGLRFSLLQTLSGHNASVT
FT                   SVAITGDRIILGTNEGIVSIWDLSTLVCISVDSSIDVPVTSVQASYDGDYLLITYEHHN
FT                   ARIIRLSPFSKDSETILELENSSRGIYSAKFSSTRLALAYTGMNNNCVVLGRKEHSKRR
FT                   YRGS"
FT   CDS_pept        783718..783906
FT                   /locus_tag="PAS_chr3_0401"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70450"
FT                   /db_xref="GOA:C4R4G4"
FT                   /db_xref="InterPro:IPR010580"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4G4"
FT                   /protein_id="CAY70450.1"
FT                   /translation="MAPQTPRQRIANEKFVKRAEAQQGKVKKARSKREFPVSTKWVIIL
FT                   LFLLIGGGVLEILRLFF"
FT   CDS_pept        784321..786237
FT                   /locus_tag="PAS_chr3_0402"
FT                   /product="Mitochondrial matrix ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70451"
FT                   /db_xref="GOA:C4R4G5"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4G5"
FT                   /protein_id="CAY70451.1"
FT                   /translation="MLSSRWCSCKKQSPSRQVGQLLRYMSSKVIGIDLGTTNSAVAVFE
FT                   GKEPKILENEEGKRTTPSIVAFTPETVLVGEPAKRQSILNYQNTFYATKRLIGRKYSDP
FT                   EVQRDISNVPYSIIEHENGDAWLQNMHSGQKYSPSQIGSLILGKMKEIAELNLSQSISQ
FT                   AVVTVPAYFNDSQRQATKIAGDLVGLKVLRVINEPTAASLAYGLNRKNDGIIAVYDLGG
FT                   GTFDISILDIEAGVFEVIATNGDTHLGGEDFDHLLVDYILQQFQSQTGQDLSTDRLALQ
FT                   RIRQAAEKAKIDLSTVKTTTIELPFITKTQHINLELTEDQLDEMSLHLINRTVQPVKKC
FT                   LRDADLTNSDIDEVILVGGMTRMPKIRKVVEETFGKKPNTSVNPDEAVALGAAIQGAVL
FT                   SGEIKDVLLLDVTPLTLGIETFGGIFSPLIPRNTKVPCKVQQMYSTAVDGQNSIEVNVY
FT                   QGERSLVRDNKMIGQFKLSDLEPQPKGVPQIKVSFEIDADGIIKVNAKETTTNQDASIT
FT                   VSGSTGLTSEEVERIVAESKSNSETDRIRKEIYTKANNLELLLFDCDNALSQWGGYMDD
FT                   SDRQELTKRISDLREVIRQARDEKLEDISVLESSQQLLQTETLKAVGKAAQKMRTLSKN
FT                   KND"
FT   CDS_pept        complement(786329..788347)
FT                   /locus_tag="PAS_chr3_0403"
FT                   /product="Acetyl-coA synthetase isoform"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70452"
FT                   /db_xref="GOA:C4R4G6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4G6"
FT                   /protein_id="CAY70452.1"
FT                   /translation="MTFPEPREHKVVHEANGVRAIKTPQSFYDKQPVKSLEALEHYQEL
FT                   YQKSIEDPEEFFGQMAKQFLDWDKDFGKVSSGSLKEGDAAWFLGGELNASYNCVDRHAF
FT                   SHPDRPAVIFEADEESESRTITYAELLREVSRVAGVLQSWGVRKGDTVAIYLPMTTEAI
FT                   VAMLAVARLGAVHSVIFSGFSSGSIRDRVNDAGSKAIITCDEGRRGGRIVNNKKIVDAA
FT                   VDSCPTVEKILVYKRTGNPEIKMVEGRDFWWQEEVEKFPGYIAPVPVNSEDPLFLLYTS
FT                   GSTGSPKGVVHSTGGYLLGAALTTRYVFDVQDEDIIFTAGDVGWITGHTYSLYGPLVLG
FT                   VPTIVFEGTPVYPDYGRLWKICAKHKATHFYIAPTALRLLKKAGEEEIKKYDLSRLRTL
FT                   GSVGEPIAPELWEWYNEKIGNGNCHIADTYWQTESGSHLIAPLAGAVPQKPGAATVPFF
FT                   GIDACIIDPVSGKELEGNDVEGVLAVKSTWPSMARTVWRNHAKYLDTYMRPYPGYYFTG
FT                   DGAGRDHDGYYWIRGRVDDVVNVSGHRLSTSEIESALLENGKVAEAAVIGISDELTGQA
FT                   VIAFVALKDATDSENLDALRRALVLHVRGEIGPFAAPKSVIVVDDLPKTRSGKIMRRVL
FT                   RKISCHEADQLGDMSTLANPESVDSIIGAVDNQFFKK"
FT   CDS_pept        complement(789468..790007)
FT                   /locus_tag="PAS_chr3_0404"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70453"
FT                   /db_xref="InterPro:IPR000614"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4G7"
FT                   /protein_id="CAY70453.1"
FT                   /translation="MGEIHHAEYANFSSSDKREALEQVLQSYDALVEGQTNWVCNLSNA
FT                   SSLIWHAYQSLNVPVNWAGFYVLNPEVPGELILGPFQGKVACQTIKIGHGVCGTAVSQS
FT                   ETQVVPDVNKFPGHIACDGETQSEIVVPIISSNSSGEKTVQGVLDIDCLALQGFDSIDQ
FT                   EILEKIVNRIAQTCKW"
FT   CDS_pept        complement(790186..791286)
FT                   /locus_tag="PAS_chr3_0405"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70454"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4G8"
FT                   /protein_id="CAY70454.1"
FT                   /translation="MDKEDSISLTPVKKFATLNLSSAQKGRKPLYPSLEGFPDTHESPN
FT                   QIQHHLSLSMGFDTDKSLESLFPRRLNKSVLEELNDRTEKIKGSLSYRQKLQGSSLKSS
FT                   SLKEKSRFSLAHSSIFDKMESIKDHCAAQRLERRVVEQSDQGDGRPSLLQTATKRRRTL
FT                   RGPQEIREPLKETNTLRTSTKSYNLNEILHKPSDGIPKSRSRLQLKNGSSREVASGTKE
FT                   ASAPGLKKIPPSIVRAKTGDFGYPRLDPNSGNPSRHTRLQERKPKTIAKPTNNTPILQR
FT                   HQKTLLKANSSRKLEQEPAVPARTDSIKSIPRSVSSKGFDRFSRTAMQTLGSIPRSRTM
FT                   HNELNISSSLEKSTSTSSRKTRPAWR"
FT   CDS_pept        join(791729..791757,791806..792811)
FT                   /locus_tag="PAS_chr3_0406"
FT                   /product="D-aspartate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70455"
FT                   /db_xref="GOA:C4R4G9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006181"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4G9"
FT                   /protein_id="CAY70455.1"
FT                   /translation="MTDSKYVIIGAGISGLYTAWSLIDKGTGPSDIKVVAEFLPGDQST
FT                   LYTSPWAGGNFSLITSTDERSMKFDKFTYTNLHRIQELLGGPECGLDMLPSTEMFEQEL
FT                   DHAKLDSISQYLKEYRPMTKEEMPEGVVSGVKFLTWNFNCPLFLANFQKHLAAIGVTFE
FT                   RSKIDHISSVFSPSVDAVFNCTGIGAASLGGVKDENVFPTRGQVVVVRAPHIRENRFRW
FT                   RPDSDTYVIPRPFSDGSIVMGGFFQEGNWSGNTYGYETEDILKRGLELYPEIGKRNELK
FT                   IIREAAGLRPSRKGGVRIEVEHFDQVNGKDRYIVHNYGASGYGYQSGLGMANEATDMYF
FT                   EAAK"
FT   CDS_pept        complement(792918..795731)
FT                   /locus_tag="PAS_chr3_0407"
FT                   /product="Putative transcription factor containing a zinc
FT                   finger"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70456"
FT                   /db_xref="GOA:C4R4H0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4H0"
FT                   /protein_id="CAY70456.1"
FT                   /translation="MPNGKREKRAEAKRQRVAKACDYCRSKKVRCDGEQPCNNCISCKT
FT                   SCTYNHVKKRRTTDKKSSPKRSKEVDDRLERLELMIESLVTQLGSSNSVVPVSRIQHNE
FT                   ETTDDDESDSTQAENDAHLQPSTNKKTDQKELNGLSREVTPFSSNGKTSCSDATLQFAH
FT                   RKTECFDSFFAEYCSFSLFSKEGQEWLVSKMKSEHLEIINKNLRHMFANYVSYSFTLWI
FT                   EPIQPSDLQPLFPKNISLGLLKFLFSYVSQSLYPIDTNEQLALLEVYCESQGRGKGKSH
FT                   HLSYANLMMLNMFLAFSLALYRDSVLKTSVRIEGLDISPEKSREYESGFLRNTIFYYQR
FT                   LFLVGDGLNSILAILLLYKYCEGTLAFHAAYMLLSTGVRLAQEMGLHRAESYAGLSQKE
FT                   QDSRAIIWWDCYTEDKLYSIKSGKPSIINDLDVSAPLPSYWRKLVVLPHKVDEFRRAID
FT                   EEYGPGLAIPEYIRINALNTSYNKGKAAVLHYFLSLSFLVSYIYQTVFSVSTTNHRSLE
FT                   EQMIQFEVINEKLEQWRLSLPEQCRPKSRKELNNEDIYKNLTVEGVERVLHEQNKYSTS
FT                   SVINPFEIDGPTESVHFRLLLKDLHLAYYTILSSVCKVFIDKSSKLVSANHSHSRVVGE
FT                   YVAMRVNSCREVLFMSKEVGEGTTFFANIFSFYLLAAFIPLFCNILRNPDSETTAFDFA
FT                   LLYYSEKHYFERLEGPHTAEPTLSRHPLSLLTAFFLLVAHNLTKRSSNFASISTKFDEF
FT                   ERKNFDIFKTIGLTSYSQSKSNKLSSKSDPSLTVSASEDFHQDLTSRLDFKQDNKITSD
FT                   SVTFEASRDNYLPTYTKDSLINGHSLYREPNFASQIVPPIMPPDTLLQHEESNLADANF
FT                   QSIHPMVNSTESAYIPIEYQNQPGISENSKLVNDLNHESFLQDDSADERACLFQTVFDV
FT                   PGFYLDS"
FT   CDS_pept        796803..797891
FT                   /locus_tag="PAS_chr3_0408"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70457"
FT                   /db_xref="GOA:C4R4H1"
FT                   /db_xref="InterPro:IPR002680"
FT                   /db_xref="InterPro:IPR038659"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4H1"
FT                   /protein_id="CAY70457.1"
FT                   /translation="MLKLYAIRPIRPIKPCLVASTFRHYSVKVDTSNKADVIKDSQTDT
FT                   TSKPGAEHGHTLGQYITKKLMVRQRLPTEKRDDSFLTPPAMPHHGYRQDLMEKIHYEHR
FT                   EPTLIRDKLAFGLMRSLRVCFDFFSGYKHPKTKEGLEKLTPATYQMTPEKWLTRFIILE
FT                   SIAGVPGSVASFLRHLQSLRLLKRDKAFIQTLQDEAYNERMHLLTFLEIGKPGPFMKVL
FT                   LYASQGVFCNLFFFTYMLAPNACHRFVGYLEEEAVYTYTTCLEDIERGLLPDIEHFKVP
FT                   KIAKDYWHLSEDAKMRDLISYIRADEAKHREVNHTFANLKLDGTDRNPFALQVDSVPES
FT                   AQPNNRLSTHKAVGWERDELVL"
FT   CDS_pept        798138..800768
FT                   /locus_tag="PAS_chr3_0409"
FT                   /product="Na+/H+ antiporter involved in sodium and
FT                   potassium efflux through the plasma membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70458"
FT                   /db_xref="GOA:C4R4H2"
FT                   /db_xref="InterPro:IPR004712"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR013928"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4H2"
FT                   /protein_id="CAY70458.1"
FT                   /translation="MAIWEHLAPSKTHIAYACIGVFSTIFSLCSLFIKEKLYIGEASVA
FT                   VIFGLIVGPHCLNWFAPEDWGNLDLITLEISRMVLIIQIFAVAVELPTKYMKKHWVSVF
FT                   IFLVPIMTFGWLIVGLFLWIIIPGFNFSEALLVSGCVTATDPVLASAIVGKGKFAERVP
FT                   GHLRNILSAESGCNDGMAFPFIYLALNLIIHEGNGGLIVQDWICVTLLYECLLGCVLGW
FT                   AIGLSGRYAIKFAENKGLIDRESFLAFYIVLSFVCAGFGAILGVDDLLTSFAAGTTFAW
FT                   DGWFSEKTEESQVSTVIDLLLNLAYFVYFGSIIPWEDYNNASIGTPIWRLILIALVIIF
FT                   LRRIPGMLMLKPVTPDVKTWREALFCGHFGPIGVGAIFASILAKSELESHYTGSTGPLA
FT                   ELPDSSTPHFQLLVSIWPIVTFIIITSIVVHGSSVAVLTLGKHLHTMQFTMTFTHTEGN
FT                   KNSSNWLNRLPKIDAKGRDISLERIDTLNPSMLSSAATLENSGSNINISGMTAKPAGGM
FT                   KRRKKTKRSRIRNRFHEETGIGKEQNARRVPEVEDLDLGTMHRRSKEETSTETPSGENT
FT                   PKVDDTDQDQEAISKVPTTGYTEGNRLIVEDEHGEVIDEYELKDHTPKSQTDQTSVHSY
FT                   GSFKRALNKISTELEPEVPQKLQRILSTSSQSIKNAKKVLVGCGTKTEGGDRRKLYAFV
FT                   VGDQVVIENKDGEILRRYKINPHKGESELSDSQLRAGLNNSDIRGLRDNSNAEQPDLEK
FT                   QENDIVPEEEEVNNPTLTRKMSQKLDNTVQSLIAPFRRTKTASFSVRKKPSELELTESV
FT                   NTSSNAPLNQQSSSETLSISSEPAENEVKESKVERARRLAALHTSVRDDKDEEGPPVKA
FT                   TKPMK"
FT   CDS_pept        complement(800865..802169)
FT                   /locus_tag="PAS_chr3_0410"
FT                   /product="L-ornithine transaminase (OTAse)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70459"
FT                   /db_xref="GOA:C4R4H3"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR010164"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR034758"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4H3"
FT                   /protein_id="CAY70459.1"
FT                   /translation="MSPNYNISSETAVQYENEYSAHNYHPLPVVFHKAKGAHVWDPEGK
FT                   EYLDFLSAYSAVNQGHCHPKIIEALVDQASKLTLCSRAFSSDVFGVYAKYITEYFGFES
FT                   VLPMNTGAEAVETAIKIARRWGYVKKGIPQDEAIVLAAQNNFHGRTIGIISMSTDPEAT
FT                   QDFGPYLKNVGPQIPGEAEGTPLRYGVIEDVERAFSNAGDKIAAILLEPIQGEAGIVVP
FT                   PADYLPKVQELCKKHNVLLICDEIQTGIGRTGKLLCYEHSKGVRPDMILLGKAISGGVL
FT                   PVSAVLSSKDIMSVIQPGSHGSTYGGNPLACRVAIAALDVVKDERLVDRASELGDFLFH
FT                   ELSKLQRESNGVISEIRGKGLLTAIVIDDSKANGRTAWDLCLLMKNHGVLAKPTHDHII
FT                   RLAPPLVISKEDLLKGVDAIRTSLAELPNAPHVEH"
FT   CDS_pept        802520..802927
FT                   /locus_tag="PAS_chr3_0411"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70460"
FT                   /db_xref="InterPro:IPR013900"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4H4"
FT                   /protein_id="CAY70460.1"
FT                   /translation="MSDPSRYKKQNMYSELPKRQDESTEALQTVGMRIRKAVADGYQVP
FT                   PPEPVTTPFGPRRTALPDHLQEPPSLLYGGSTASSLSEWQNDVTLTNKRKFEDYDDSKD
FT                   FQGPDSDFLTKNRDLQGFQQVYGTLRFDEDF"
FT   CDS_pept        803200..806157
FT                   /locus_tag="PAS_chr3_0412"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70461"
FT                   /db_xref="InterPro:IPR026705"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4H5"
FT                   /protein_id="CAY70461.1"
FT                   /translation="MASLEEKLRFKSEVFRLTKQTSSISVDDPYWGIFWNCPTCASDIF
FT                   DLLSATDIRNIRETNKSNFITLIRVIALQLVHQSNTVTSLDENTALLNCIRVLTKFLPS
FT                   LYEDPSLEEVEKSLFWSLDTLYNRDATSGSQCSDVATVATEISSSSVLSNQLHDSSSTS
FT                   AQVEFQSSQNHIEQASIKANVGSPDYSTVPLGAKLVFTLVQLLFTQNFCIKSQSSVRSK
FT                   GAKPIVDFSIWEPGIGFNGPFKPPNTFIDSNRYETMKLLITLCSRCLYIPSSELVAQGS
FT                   RFLTVLVTAIPRLQILTLLSSLLNLTARAARDPKESGLEMNNSQLNNLRTLNVTAAIHL
FT                   LTLMFVYPLPKNNLLFLQELRIYDSTPINLVRYYMGRLHKESELAFLKVSLFGILKAPL
FT                   IEMSKLENSTSLTAMIKAKTYTIQPSLWCTEIVILVWELYQSNKKFSQLISAKHSVELS
FT                   LILLFYINYYRKDEHHRNQVRICSYFFLYLTNDEQITFNLLKPFNSAIYSSLPQSFKTP
FT                   TTPITYRDFFIVRICTMLLDDEPGILTSILIEMLYNLIPITRADYLSSHTDEVTVFRKR
FT                   PFNNSVTVCEQNGQISHSASANLMHVIVKLSRPQYLASNSLHSDLLGLVLRAIAHYLGK
FT                   NFHGVDSSDLGDVAAMAYTLTKNYRIFNEVKKVIESVGHISELDTKKTLSVHSTESNVY
FT                   DLESIDPSEDESEDEEAKYNLMNLKMPVGMSTKVKGKQPLDAPLKKTWTGTKALKSILN
FT                   FTNYLNKEHTELLHITDFNTVVVSIANTSIKQKSWEKLIHREFLPSYRPWSCLKFVWNN
FT                   ASLGWYESILWGLIYNSNEIIHRNKVLLDLNNSISAITKATSDWSFGMWKSPRAESTYP
FT                   SIEKQVERASSSMVDTGTWNGTYVKTFRIKGSGQHSKLLNHRGAINTMTDSLVKKISDF
FT                   RISSPSANGPASQQHQNPHPESHHNLAETVQLKVTPRNYIHRKDSTLSTLSTLST"
FT   CDS_pept        complement(806205..806837)
FT                   /locus_tag="PAS_chr3_0413"
FT                   /product="Protein with a potential role in pre-rRNA
FT                   processing"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70462"
FT                   /db_xref="GOA:C4R4H6"
FT                   /db_xref="InterPro:IPR019398"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4H6"
FT                   /protein_id="CAY70462.1"
FT                   /translation="MSLQIDETDFVEASEGADSLKFLNEKSHALFELGVSMLVHKWDAL
FT                   SVAVVNQWGGPNSKDKRDWISAVVVDLFLQNSVVDVAMIEETLLYAMQDEFDVMVEDDS
FT                   ALPLAAQVLDCYRNVAIGEVDKIKESYAKWQAKQSSNSDVKYQVTVGEDPSNPDVSENE
FT                   VDDYDSDIDAHAPGTQQDEDSEMTEATESVPQAIVDDDGFTIVQRKR"
FT   CDS_pept        807077..808816
FT                   /locus_tag="PAS_chr3_0414"
FT                   /product="Calcineurin A"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70463"
FT                   /db_xref="GOA:C4R4H7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4H7"
FT                   /protein_id="CAY70463.1"
FT                   /translation="MNIMLGKKLAQKRLANENTAKLDNALKVLKNKDEEGLVKRDYSIH
FT                   ITKDGQSLKTTERQVSSVPPPIATKPSDSELFLENGLPDHEFLRTHFIGQGRLHEYQAI
FT                   RIIEMATSQFIKEPNLLEVPAPVTVCGDIHGQYYDLMKLFEVSGHPKDTSFLFLGDYVD
FT                   RGCFSIECLIYLYSLKLNYSDTFWMLRGNHECRHLTEYFTFKAECLHKYSEDLYEVCVR
FT                   SFQGLPLAAIMNKQFFCVHGGISPHLKSIDDVNRIDRFREPPTKGLMCDLLWADPIEEY
FT                   DEDDATEDHFVPNTLRGCSYAFSYEASSAFLKKTGLLSIVRAHEAQDAGFRMYKRTKTM
FT                   GFPSLLTMFSAPNYLDSYNNKAAVLKYQDNVMNIRQFSSSPHPYYLPKFMDVFTWSLPF
FT                   AGDKMVDMLVSILNVCSQKELDEETPLAKVPASALENVDKLIKQKKANASKTTQESQID
FT                   PMDLEAKKVVLRNKILAIGRVSRMYQVLRQESENVQKLKSLSVDGQLPPGSLLNGPEGI
FT                   RQKIHSFDEARKMDLKNEALPPLPTDFAYQQKLEDERIRRDIEQQVKQDRKFNTLAQRL
FT                   SDF"
FT   CDS_pept        complement(809206..810387)
FT                   /locus_tag="PAS_chr3_0415"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70464"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4H8"
FT                   /protein_id="CAY70464.1"
FT                   /translation="MSIEPLQTIQSPKFTGFTGPSRHIFSDEQKLKFAEIFVHLTKENG
FT                   NNCNFPVTQSIRQFIRQEMNKSILHCTPVTDRNVVSLKDMLKKVMKGYCQLSNDPSFVY
FT                   NSTTCFIEYPDYKWKLSEERYGRSVICQIRNKNCLYLEQLKPFFKESLAVGNAEKKGFF
FT                   TVNMRKLASDYTSEPQNTPREAQAERRYVHLSPNQQPQTQHTSLPLKIAHQQSEPDAQR
FT                   MVEFLPHYANSSSMQQLNISQLPVSPSPLSDYRTISPTIAHQSHQQQHENLDDSVVPRK
FT                   RHRQSQTFPQIMPEISSVFMTPQSSLPRARPSDPSNRNDEYSNEESRFEVDIRKKIAKK
FT                   LGELCKRDSLSYEIFSWILKQKLSFLISNVAPLLDNVDDTLLVRFLNDLYIEK"
FT   CDS_pept        810648..811406
FT                   /locus_tag="PAS_chr3_0416"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70465"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR039924"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4H9"
FT                   /protein_id="CAY70465.1"
FT                   /translation="MFIVRCIHERPTIENSVPSKAFQSSFPEGALPSDSEDKQVIYGGG
FT                   FFRLAFISKDFEIQGVQNTECSECFVYVLNTCLVLWFESGRFGLSIPYQLVLLAALQSD
FT                   PEGIYLQIEPRGDLTASPESTLGSNTALVELKVTYDGVRSDALLDQFPNSINQTYEAIA
FT                   QCSSFHEDPSSDTEDDREDNSLQQKDAFTTDLTNGEADDLAPLSHSPTLGKSASMAVNI
FT                   LGQIVGIRTRDDDESDQDGVHYINKKTHTH"
FT   CDS_pept        complement(811467..812867)
FT                   /locus_tag="PAS_chr3_0417"
FT                   /product="Ornithine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70466"
FT                   /db_xref="GOA:C4R4I0"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002433"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4I0"
FT                   /protein_id="CAY70466.1"
FT                   /translation="MTVPSIVNSFSDVANDKFRTSLLNSECNDHNHTYAVDGLNNVITK
FT                   RVSKPNTAEALAKSRKMVGQALYDHISAIDLDTCLPEEEESFFVCDLGEVLRLYKNWCE
FT                   KLPRIKPYYAVKCNNDPKLLEVLATLGTGFDCASTGEINTILNLGVSPDRIAYANPCKS
FT                   ISSVRNAKKVNVNLTTFDNSDELYKIAKYHPESRLLLRISTDDESAQCRLSTKFGASMS
FT                   ESFDLLRLAKKLQLNVAGVAFHVGSGASDFSAITQATKDSSILFEEGTRLGFKMNILDV
FT                   GGGFVLQTFDESSRYLREACDQYFPEKLFPELKIIAEPGRYFAASAFTLACNVIARRMT
FT                   TQSSDTTTPTAHAMLYVNDGLYNNLNCVLYDHQLPKGKALTINGRFVYDLQFSLPESEK
FT                   KIPVSIWGPTCDGLDCISEMTYVSSLMEVGDWIFFDEIGAYTSAAATAFNGFQKESHTI
FT                   YTCSESLI"
FT   CDS_pept        complement(813667..815250)
FT                   /locus_tag="PAS_chr3_0418"
FT                   /product="Zinc-finger inhibitor of HO transcription"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70467"
FT                   /db_xref="GOA:C4R4I1"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR039355"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4I1"
FT                   /protein_id="CAY70467.1"
FT                   /translation="MSVLMSNNNHFKNHPDLSNIFHVRSRSDPATSLTSPSQPRCIKQA
FT                   KHEPNSSKHVKSTSSCPASVANFSIPSCAIDQRALPKKEKRRFSEVHHTESPLSSKRRL
FT                   EPSEVNQSRKRVSLPPATPLFKSKVENESVSSVPAVARILANLKPTPASSHSIRNSSLL
FT                   YPDTAYSYINYTTSSCHNFEVIQNTSNNEWRANMVSNLKSGNLQGFKRYKDYCLENYKV
FT                   TDDKAGANLRTDYEKSRNIPRTRNKMVRFIEAQLRDKESASEAGIYNTANIINYPFVSN
FT                   YTYQKDGYLDDVSMLCNNVELYKNLDTSHDDKKSEVQHEKHPDGGRLQLYQTIDTPVNQ
FT                   PLSIPASHMVTPPLSSKSSALTTSEDAKSTQPKMSTFKYVSPNSSPMKSNSCSDQITVF
FT                   RAAKSPQSPKKSPKSPSTRLATISHPNRVCISCHSNHSPCWRPSWSALEGQLCNSCGLR
FT                   YKKTGARCTNRSCLRIPAKGEWTLMKNKGKLAIPVYGNNEHGEFTLLGEELKYKCLHCE
FT                   GTVEVGESER"
FT   CDS_pept        complement(815861..817465)
FT                   /locus_tag="PAS_chr3_0419"
FT                   /product="Putative metalloprotease with similarity to the
FT                   zinc carboxypeptidase family"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70468"
FT                   /db_xref="GOA:C4R4I2"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4I2"
FT                   /protein_id="CAY70468.1"
FT                   /translation="MLYKTTLSIAHTSVILLSLITAISCFELHLPQKVSHIVDSLQYTC
FT                   GQFLQKQQIFALYNKQNFTEIVNQNIKGIEERVLSELLEERLENESQNDYYTANSQNWP
FT                   IDLDQYSESFVIRITSEDEFIKYLIFKEAKALHISIWEQSVGLIDLKVDRDQMHRLLYN
FT                   VESRILERRTRSVDSPVSEYKVQLMIGDLPQRIYETYPSTKVTSLQALGEFPSFQNLSN
FT                   AFFEDFRTLETIYDWFEEIQKEFPKLVSINWIGQTYEGRDLKALHVRGKHSGNKTVVVT
FT                   GGMHAREWISVTSACYAVHKLLQNYADGHHKEAKYLDKLDFLFVPVLNPDGYEYSFNED
FT                   RLWRKNRQETYMPRCFGIDIDHSFDYHFVKSEDLPCGEEYSGESPFESIESEVWNNFLN
FT                   RTKEEHKIYGYIDLHSYSQTVLYPYAYSCEILPRDEENLIELGYGIARAIRKSTGKKYQ
FT                   VLKACEDRDADLLPDLGGGTALDYMYHNRAYWAFQIKLRDSGNHGFLLPKKFIYPVGTE
FT                   VYASIQYFCSFVLNLEG"
FT   CDS_pept        817643..819919
FT                   /locus_tag="PAS_chr3_0420"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70469"
FT                   /db_xref="InterPro:IPR021861"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4I3"
FT                   /protein_id="CAY70469.1"
FT                   /translation="MLSGYDEYSSSIIPALETDLVVLRERFSSDQIFSSSINNHPDLTA
FT                   IYTKHFEDKFTEEDQTSTISFKSAVIENVVLNVLFNVIEKNESTEVLVTEILILLDLAI
FT                   HGYNKQVYKSLPLIIVLQAFAKLDIDIICDKLGPILLGPHSNERKRILQQNGSLIGKKS
FT                   PGLVLLSYSQKILNRLFKHIESHELFGGYFRTFIRTSFALDDSLLPTRKWETNVNTKTF
FT                   LTGLQKQLRQTRGVSSAENKLNRKMQEDFKRFVDLMIFLNDPVPLIEADKRGRTFRHLS
FT                   DMENSLNFVFEFLKTLIDMDKKQKHGIRLQNQSFFLPETQRSDREIAQVVEHYTRKLLQ
FT                   LEIPVTAELFQKQLNDYTFRQLILLQVVVGATYILSLKKKEVDDRIARLRKATKDPKLA
FT                   QQLHNKMPAVIYDRDLSDACSNLRNTILKHYKEFDSNFYETLQSIAASEESWIDWKLLQ
FT                   YSLAIIETGKFDSHVTLFNEQLPSLYEYAPQYSHKLGTPQLSRIWKIETSLPHLKNHSF
FT                   DKEEFVEDIRMELYPLDSQLQQPDLDSKHKEEIQGQKDYLNWKSMRFLRSNNEWLKLKQ
FT                   TNEKVGLEGMFDDGLLMDEDFEEEIPSEVKEMMEKIQQEENEKIEKQKKEEADELEQEQ
FT                   TKNEADKLETQESQVAPEEKRDEETTNDAAEKGLPEKLEPSQIDESPVENKSPAIQSPR
FT                   TASPASETPKLSYEDTKLQSDDESSTKQPSSTSQADLSNDLEGVQKKRKLSTDSELPTA
FT                   KKLKP"
FT   CDS_pept        complement(819979..822840)
FT                   /locus_tag="PAS_chr3_0421"
FT                   /product="Member of an oxysterol-binding protein family
FT                   with seven members in S. cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70470"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR036598"
FT                   /db_xref="InterPro:IPR037239"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4I4"
FT                   /protein_id="CAY70470.1"
FT                   /translation="MEALDIRSKSYFIKWVEAPAKSVLHWEIKPLKKSIDFGIYSCKKG
FT                   ESSHETKNNSASSFNTESPSFRASIPPIIDEGDQFNLSSGSAVLPLERNPSLKESSNAT
FT                   GTGRRRSDSNISAISSTNSLSLEQRLKQSNLKKEQWVGKCQGNELIQGTFQVQDSCLLA
FT                   FVFDNTFSKTTAKKVFFNQYVEDPSMPKKDLDSTIYRNNNKTNSTLSLKKIDTSSSTGV
FT                   RFDLPNDHDKKIDNSTVLHVKGGRYLQGFLLKKSRKGRQKSFHKRFFVLNFKYGILNYF
FT                   ANDNSKQVRGNMLIRSAAIFADEKTKVIILDSGLELWVLKSSNENDWSTWIQAFNFLKG
FT                   SSSLNEEAKPQITRVNTLDSTLPSFVDRDIFLKIHDNISALRSKSSNLVSVLDDQQTTQ
FT                   DSIRSSNRKSSFWKKFKREKDDVNGDQLSMSSFTSDPLSLAKDIKSRIDTLMSFMDNAK
FT                   NLQSSQQISRSNTVTTGGASIFSQEFYDAQEYLQEITGEVVFLNEQNDTTISTNGHGHG
FT                   ALPLKNIEEIATDSSDYSSLEETEESLSSESSTERELVKSIMSQQDNLEINDLYPLGET
FT                   ENVTRRTDIPESASTPPSILSFIRKNVGKDLSNVAMPVTANEPLSMLQKYSEFVEYCDL
FT                   INDALDSDKASGSRLMKIAAFATSYFSSLRVKERNSRKPFNPMLGETFELVREDLGIRL
FT                   ISEKVVHRPVILAINVDSKRWNLNYSPSPSQKIWGKNAEVTVEGVARLTDRTTGDVYHW
FT                   SLPNCLLKNLIAGEKYMEPTGSMTVKCSDGHKAVVAFKSGGVFSGRSEQLSITLTDSKN
FT                   NIVGPKATGTWTESISWNGVNIWKVGPLVPSPNLKFGFTQFAACLNEITSLEEGKIPPT
FT                   DSRYRPDLRMYENGDVDGAEDKKIELEEFQRARRKANEIANEEHQPSFFHKGKDDCWIP
FT                   IQGENNYWERRKRSDWDDVLKLW"
FT   CDS_pept        823588..824601
FT                   /locus_tag="PAS_chr3_0422"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70471"
FT                   /db_xref="GOA:C4R4I5"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4I5"
FT                   /protein_id="CAY70471.1"
FT                   /translation="MENPLQIIDISNIDIPTAREVVSAAGSQGFLMLEGHGFSQEEVAE
FT                   LFKVSKGFFEEPLEEKKKYTIPANDNHGYTTFGGENLDESNPDKPQGDPKEGYNFSNLN
FT                   LLEGTWNGSTPEYFQNSEHAKVVQSVIKKHSLLVHKLLTLFAIGLEIDKEAGGADWFVQ
FT                   RHKLTDPSGTTFRLLHYPSPKSLNPEETIRAGAHTDYGGVTLLFQQDGQAGLEIHSPLT
FT                   KKWTPVPFVDASAQFKEKGAAAPIIVNIGDQLSYWTNGLLKSTVHRVKFPEESVREGKS
FT                   RYSIVFFSHPADDTLLEPVPSPFIRAVNGRGAGAQSKAITAKEHLLKRLAATYGWY"
FT   CDS_pept        824773..826155
FT                   /locus_tag="PAS_chr3_0423"
FT                   /product="Putative membrane protein of unknown function
FT                   involved in Mn2+ homeostasis"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70472"
FT                   /db_xref="GOA:C4R4I6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR033308"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4I6"
FT                   /protein_id="CAY70472.1"
FT                   /translation="MGLRTRASSTLRNVDVMLLLLAWCAVFWFHQTYIPRKVIEQCSFH
FT                   QSNSTTFTVLMIADPQLIDNHTYPGRNKILLGLSKHTVDTYLTRNFRHLISTLHPDSVM
FT                   FVGDLMDNGRSSEDNYYEREYSRFKNIFPDSDSYEMLTNVPGNHDVGWANGVKKHAVGR
FT                   FNMHFGESNTVITRGNHEFIFLDSLSLSNTNDESIYGPSSRFMQEFKNRRKDKPRILLT
FT                   HVPLFRNPDIDCGPMREGGKFPLTQGYQYQTVLDNELSEEILASFKPDLILTGDDHDYC
FT                   EYNHEYHVNETSYIAKEITVKSISMAMGIQRPAVELLTLQNEKLYFSICHLERPYREVI
FT                   TYVLLAALTVVIIFFWNNTHIRGRRYQPLANRSIRNKLANYVKGIEVDNFGPATTILVG
FT                   QADQETPASNNFATSWWNLKHHTRAPIGSSLFTKLNFGVFIKKCAIMSLCVAILYINMV
FT                   GI"
FT   CDS_pept        complement(826169..826657)
FT                   /locus_tag="PAS_chr3_0424"
FT                   /product="Membrane anchor subunit of succinate
FT                   dehydrogenase (Sdh1p, Sdh2p, Sdh3p, Sdh4p)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70473"
FT                   /db_xref="GOA:C4R4I7"
FT                   /db_xref="InterPro:IPR007992"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4I7"
FT                   /protein_id="CAY70473.1"
FT                   /translation="MLRLNPILTRRSLFRPQVFSRCISLKPDFSKLKLKEQPPGYVVGT
FT                   VNDAYVPPEPDHFHGGYHWTYEKIITIAMIPLFITPFAAGAEYPLVDSIFSVLLVFHCR
FT                   AGFESCIIDYIPKRVYGVWHKMALYLLDAATGLSLYGVYVLETENNGIFDLIQKLWGA"
FT   CDS_pept        complement(826863..828722)
FT                   /locus_tag="PAS_chr3_1189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1189"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70474"
FT                   /db_xref="GOA:C4R4I8"
FT                   /db_xref="InterPro:IPR031403"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4I8"
FT                   /protein_id="CAY70474.1"
FT                   /translation="MSTIGSTRNFSSVSLQSLPEEGFNELSLEDDKVFMEDKRGAKHTK
FT                   HPSPSSLLNGRSKSYTSVRRLGSNTQINSGLGIKVRRPDVTGTLKRSTSGVESEDSECS
FT                   RSNTSIDTASLTMTTLASNDPPPLANRPFYSRVAHSTPVLVTMKSKPKPKPVSRRKSQM
FT                   EAEKIPVSFSDDEIPDDQLMYNVPVTNGCALSFYGSNNMPAKIVKLALQSVDDLQSMPP
FT                   SPLPGRLEQFSDGSEPSTPTIENYERKFHALSPEAKNLTKFYENSSTNFVQNELLKRKE
FT                   YNKLKLPSGSETVEDAGLEKLDLISKEKLDTLCKTRPLWLPPKSFKEAKRHEKQASAML
FT                   DSAARKQKRMVSIRRQSERDLLIWKERLPYILSHETWKSSYKNEVVKNTWKFPIQDELK
FT                   SQVWIKFLTDMKGDKVVPEKYQEYDDLIKMDHLILKKLPKDISEESMKRLNQILTARSK
FT                   SNQDLKNGDETIIATIFLLPGFSNNDVFEIMRLLNANLRSGAFVSKFDRKVSKIVSFIK
FT                   HRVAKDQYTTFKTQSSEVLNFQFIFNELLLNHFSKDDMIRILELFILTEDYRLLYALFI
FT                   TVYLHYHYGFSQISDLLSKENQNFTIEVDSKFWERLYYYYSKV"
FT   CDS_pept        829742..830800
FT                   /locus_tag="PAS_chr3_0425"
FT                   /product="Sphinganine C4-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70475"
FT                   /db_xref="GOA:C4R4I9"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4I9"
FT                   /protein_id="CAY70475.1"
FT                   /translation="MDKFSQYIPKNTTGFLNQPYPPTSVVIRRPDLIQGVPDGILSLCV
FT                   PIVLYWSYSTFFHIVDTYELAEKYRIHPSEEVLQRNKVTLRVVIQDVIVQHIIQTLVGL
FT                   VFYKLDPVPTTGYEQREMWYLKQRLPPFFKWNDTIANLFVYYGYWYGLSATKIIIAFVI
FT                   IDTWQFFLHRLMHVNKTLYRKFHSRHHKLYVPYAFGALFNDPFEGFLLDTVGAGLAAIF
FT                   TGLTPRESMVLYGFSTLKTVDDHCGYSLPFDIFQIIFPNDSIYHDIHHQHFGIKSNFSQ
FT                   PFFTFWDKFFGTTFHGVDQYKQSQQKITLERYKEFLASRQKSRIQKQQQQHSKVERYSD
FT                   SEDEPDHQKKEQ"
FT   CDS_pept        complement(830888..831502)
FT                   /locus_tag="PAS_chr3_0426"
FT                   /product="Protein involved in homologous recombination in
FT                   mitochondria and in transcription regulation in nucl"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70476"
FT                   /db_xref="InterPro:IPR024629"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4J0"
FT                   /protein_id="CAY70476.1"
FT                   /translation="MSTKLRSAKWIQKNGFAPQVFLFRNIETNQVLYSQLPHISNYQIK
FT                   QQFWRPNWQDRKPQKRRDIWRCMAVADFHNYDNALKAYHALVELRYLRQVTKKEEAMAM
FT                   RRRNKDGNIWFSAQFRPVHSQEAVADLSTVIDEFNMPSKIYWESLWRRGDEKYWNKDLT
FT                   THEEMDLRDPRFRTVVLNDIKEKSKAEIGLNQARAATSKLQ"
FT   CDS_pept        complement(831663..833261)
FT                   /locus_tag="PAS_chr3_0427"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70477"
FT                   /db_xref="GOA:C4R4J1"
FT                   /db_xref="InterPro:IPR015672"
FT                   /db_xref="InterPro:IPR022535"
FT                   /db_xref="InterPro:IPR025969"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4J1"
FT                   /protein_id="CAY70477.1"
FT                   /translation="METEPNDLQQFGQEPGSTGVSFFGIIPLLGLATFYFFWSSKVLYP
FT                   LVPKLFGLTHVDMSKLKTITTISLEGYYDKKTVLPNEYTPMVYIAKLVFSIVVSASLMV
FT                   ISLVLFEIQGFFDLDSKIVIWKFSLPLLVFFLIFVVPMLFVYHLINNWELRREFKFNSN
FT                   IKAVLLMAITVIWLLALQFLKKAFFWIDDSGEGYLVRFLNQLALLGIMSLGALSGIISV
FT                   STPYNAYRKDQQYISVLDLKNKARQLESIQDQLNTKLSRLETKPKASRFRLFSFSSNDS
FT                   NYSRIEVESLTSMRDSLKQELHQLYEKYQVQKNKDSFLGKIGIMWTKVFSIYCVYKFTS
FT                   VLLYKIPVSYYKTYSRPSDEEPNVASDALSATLSKLIVSLNISSFQPDEKELTNQITFL
FT                   LSLGLFASSISSLHSTFHSIKKALPSHLSVSVSSPDSTNNKSVFRSLFISETLGIYTIS
FT                   TLVLLKTNIPESLSKSFVSFLGKSSYFNGARVDFLFDKVFATSCTVSLVILLLSSFFGN
FT                   EDEIYDEEILLEKEL"
FT   CDS_pept        complement(834712..835011)
FT                   /locus_tag="PAS_chr3_0428"
FT                   /product="Protein required for cytochrome c oxidase
FT                   assembly"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70478"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4J2"
FT                   /protein_id="CAY70478.1"
FT                   /translation="MSANPGNKLSSWNPTPPQRGAFPLDHFGDCTEPMKKYMECLKLVK
FT                   NDNAPNCRQLAKKYLDCRMNNELMDRVPWEDLGFNDEPKRKDAPVKQDAGTKEN"
FT   CDS_pept        join(835261..835293,835354..835488)
FT                   /locus_tag="PAS_chr3_1190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1190"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70479"
FT                   /db_xref="GOA:C4R4J3"
FT                   /db_xref="InterPro:IPR012621"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4J3"
FT                   /protein_id="CAY70479.1"
FT                   /translation="MSGLALSEESKERIVKILDTTTTVVHYGWIPFVLYVGWISTPNRP
FT                   SLIKYVYFPV"
FT   CDS_pept        835801..836718
FT                   /locus_tag="PAS_chr3_0429"
FT                   /product="Protein required for transport of flavin adenine
FT                   dinucleotide (FAD)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70480"
FT                   /db_xref="GOA:C4R4J4"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="InterPro:IPR040062"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4J4"
FT                   /protein_id="CAY70480.1"
FT                   /translation="MFDQPIFGIKSVEIISGLNAGLCSTLVNHPLDLIKLRLQLNSHQT
FT                   SLSGGISSVVKDIVHLSTKNGKLDPKVLVKEFYRGITPNLVGNMASWALYFMCYNEYKT
FT                   FFRNPTSSTYLMSGFLAGWSTSILTNPVWVLKTRMVATHHSTPEGYNSLWEGASQILKK
FT                   EGISGFWKGLTPALLNVSQGALQFTLYDTLKDSLYPENQKVLSTYQYIYVSGISKIIAT
FT                   VAFYPLQVLRSRMQGFELLKNRQSMSHLVIEIITKEGVPGLYKGLVPNMMRVLPATCIT
FT                   LTVYENTKNLLNGTSNRKNNIDNN"
FT   CDS_pept        complement(838189..839649)
FT                   /locus_tag="PAS_chr3_0431"
FT                   /product="Subunit of the Nsp1p-Nup57p-Nup49p-Nic96p
FT                   subcomplex of the nuclear pore complex (NPC)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70481"
FT                   /db_xref="GOA:C4R4J5"
FT                   /db_xref="InterPro:IPR025574"
FT                   /db_xref="InterPro:IPR037665"
FT                   /db_xref="InterPro:IPR039079"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4J5"
FT                   /protein_id="CAY70481.1"
FT                   /translation="MFGNSNKNPANSGGMFGNASGSNVGAFGGSSSGNTGGLFGAKPAT
FT                   NTNNTGGLFGNNASTNSGGNSGGLFGSTNASGSTNTGGMFGNNSGNTNTNQSGSLFGAN
FT                   TNTGNTQSQGLFGGNTASNSNQSGGLFGGNASNTQSKGLFGGNTNTNSNTQQGGLFGGN
FT                   SGNTQSGGLFGTNSNNTQSGGLFGGSNTANSNAQTGGGLFGNANKPAQSGFSGSNNPSG
FT                   NTGGLFGSNNTNANTTTGSLFGNNTNSNAGGLFNSSNNNNSLLGNNAAPNNPNNASQPQ
FT                   ITSLTRVTDLPDAYQKEIEQLDQYIQQQMDIAESLKDDQANHKELIESVPRDINFLENK
FT                   YSSVSQAIHNDLNFVMSFKCKVLESFNDWVEKVIKLYLQLTNPVLLKEITNNDKTLNIK
FT                   EAEPPNSAILHTFYVHKVKEIQQNIQKYHSVLQEIENAVDELDKVSSNGIDNSWDLIIQ
FT                   TLKEEFRLYLELANNLADVHHEIKRISV"
FT   CDS_pept        839909..844264
FT                   /locus_tag="PAS_chr3_0432"
FT                   /product="Evolutionarily-conserved 5'-3' exonuclease
FT                   component of cytoplasmic processing (P) bodies"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70482"
FT                   /db_xref="GOA:C4R4J6"
FT                   /db_xref="InterPro:IPR004859"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR016494"
FT                   /db_xref="InterPro:IPR027073"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4J6"
FT                   /protein_id="CAY70482.1"
FT                   /translation="MGIPKFFRYISERWPMISEPIEDSQIAEFDNLYLDMNSILHNCTH
FT                   SNDGSVDLMKEEEMFSAIFAYIEHLFTLIKPGKTFFMAIDGVAPRAKMNQQRSRRFRTA
FT                   IEAEKSVEIAQKNGLITSKDENFDSNCITPGTEFMAKVTTNLKFFIHQKISSDAKWQKV
FT                   QVILSGHEVPGEGEHKIMDYIRFLKAQEGYDPNTRHCIYGLDADLIMLGLVIHDPHFAI
FT                   LREEVVFGRGSKASSTDVSEQQFYLLHLSLLREYLALEFKDLEDQIKFDYDLERILDDF
FT                   IFIMYVIGNDFLPNLPDLHINKGAFPRLLATIKETMIDSDGYLQEGGVINMERFGLWLD
FT                   HLSQFELQNFEQVDVDVEWFNKQLENISLDGERKRERAGRKLLLRRQQELISKLRPWIL
FT                   EFYSSRDNIYSAHDDDSLIPTLQLDTELMEEEIKLPFIKQFALDVGFFIVHSKSQNTYH
FT                   AKIDIDGINVNESDEEFEARVLYIRKKIKEYENSIFVEDENTLEEQKNIYDTKFVNWKN
FT                   KYYKEKFGFTLSDTEDILKLTESYIQGLQWVLFYYYRGVPSWQWYYPYYYAPRISDIKL
FT                   GIKACLEFDKGTPFKPFEQLMAVLPARSKQLVPACYRPLMTDPNSPIIEFYPDEVEIDK
FT                   NGKTASWEAVVKINFVDEKRLLEALEPYNSKLNAEERQRNSLGTNIEFSYHPQVNQVHS
FT                   SPIPTIFPDITEDHCYEIVVEFDKLHSSTYAKPMKGAKQGINLLAGFPTLKTIPFTSQL
FT                   MLAECHIFNQPTKSESMILSTQNPFEGLTVEQFAAQNLGQTIYVNWPYLKEAKVVAVSD
FT                   GLNVFEPGNKSIRTTRMESSEVSEFASDVRYISETLFKRKGVLLVNYTEEELQGTPEPR
FT                   RSPHNDDAIQGIVFVKKVNGVIRTRSGAYVKTYSDKIEKYPINLLVDDVVNKDRRLLEK
FT                   PPVPLEEEFPKGTTLISLGAFAYGTPATVVDHQNDLMTVRFVNQPIKHEFNYGEIQAQR
FT                   EAHTNVYYPSFKVAKIVGITALALSRITSSYRIVNGAKKTVNIGLDLKFEGRKLKVLGY
FT                   TKRNEKHWSYSALAVNLLQQYQKRFPSVFKIISLRNDSSIPEAKELFPQVPASQVDEKV
FT                   NELVAWVKEQKKSFVVATLESESLTKVSIGKIEQEVIKFVSKPHEHIPQKGLKGVPREA
FT                   TLDISNSSQFLSKQTFNLGDRVIYVEDSGKVPNFSKGTVIGVRSVGTKVTLNVLFDLPL
FT                   LSGNTFDGRLATPRGVTVDSSLVLNLTKRQLIYHDRKPAKKEGKPGVKKTSQDSKKQTV
FT                   KLQNGSGKAKQAQDAELSVTTTPVPVPAANTAPVTASVQATSVVTATVPTSKPSNNSED
FT                   EHELLRLLKGNKDSSESQGSQEPLARTSIQQIYGTVFNQVLSAQPQLQPVRGFSNPVPE
FT                   TPVNGVQANEQHSDSTPQNHSRDENQGRGRGRGRGNRRGRGRGRGKGGQ"
FT   CDS_pept        complement(844334..844885)
FT                   /locus_tag="PAS_chr3_0433"
FT                   /product="Subunit of the RES complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70483"
FT                   /db_xref="InterPro:IPR018609"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4J7"
FT                   /protein_id="CAY70483.1"
FT                   /translation="MSLQDYLDSKYGKSKSKKRDKSLKPKPKSSIQKPTKPAKPENATI
FT                   YRDLSGNVLSHEEMLEQQRQKSQQEKQKAKEASEKLRNMNLPEVTQTATKRVAPPSYVD
FT                   DPLLAFSPDKVKSLQKDRYISQTGRKLYKSSFPDNRFSIMPGYRWDGIDRSNGWEQKVF
FT                   KTTALRQEKKVLSYTMQDDY"
FT   CDS_pept        join(845551..845681,845956..847927)
FT                   /locus_tag="PAS_chr3_0434"
FT                   /product="Mitochondrial amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70484"
FT                   /db_xref="GOA:C4R4J8"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="InterPro:IPR040062"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4J8"
FT                   /protein_id="CAY70484.1"
FT                   /translation="MLNEHCKHSANDGFNECLDFSGFYWPSLVDRCLISISSSGSVGFF
FT                   HSALSSIEERMPELTQSLTEIFDSYSKEGKLDYNGFIDILSNESYASQYFNNFLRIPNS
FT                   SLGLLYLLVDKDANGQISLDNWLAFSEKLLNEEESSITYKLFQNLDSSFKDKSEDEFKS
FT                   LVSTNLNDQFKSQFDRVVSDDGKILPEDFRNIVSSIYSSRLPTAAIDQIGRLCTESLTF
FT                   NEAASLFDFVQAIPKLNYYTFRASNNFKDTLCKEDFIAALKETINTEDNVSDSFLDYYY
FT                   QLTTFIVNSTNQNHLLKGDLLAILTDDMVTTEETVDGGFSLYPILNSAYSFLLGSIAGS
FT                   IGATIVYPIDLVKTRMQNQKGNAKYSSYFDCFKKTFRSEGLRGFYSGLLPQLVGVAPEK
FT                   AIKLTVNDIVRSIGVKQSANGEITMPWEILAGCSAGAAQVVFTNPLEITKIRLQVQGEA
FT                   LKQSLAEGTNVVEKTAVDIVRELGIRGLYKGASACLLRDVPFSAIYFPCYANLKKHLFD
FT                   FDPKDPTKNSSLESWQLLVSGALAGMPAAYFTTPCDVIKTRLQVEHKAGDMHYTGISNA
FT                   FKTILKEEGFSALFKGGLARVFRSSPQFGFTLASYELFQTYIPLSAFYPDPNQTKTLGK
FT                   VAGAITDGKGNSLNSLTPVDISKLDNARDVHYSISEHARKVVNTSFDLNPKLNSFNYFN
FT                   YVNEKK"
FT   CDS_pept        complement(847996..849114)
FT                   /locus_tag="PAS_chr3_0435"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70485"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4J9"
FT                   /protein_id="CAY70485.1"
FT                   /translation="MSRRVLLSQRCLPRLQRLPQLFTQASIGPMSDTIRLAKEIDETSR
FT                   KQSLLLGQLLDRLDEKEANEQRLLAKIRVLESNHSLLLSKISECPSCSGFNDQRFYSSQ
FT                   TQVSMTQESQLQRVPSSKRPKYQPRSPLKEITNLEPTLNMNVNTNSFDSSSSGSIEYVA
FT                   VASPELITSDIEEIISDSQPDVTHDDILTHNTPKINPYITPITDSKIKIDLSTNPKFNR
FT                   EWFLEDFKRNPASKSSHTDNCMCNDCSKLFQLAPVSNLKNGIKWDSNSAESGETPSKRS
FT                   IPAGFKRRHGNGGDNTIWDDPCTPPGFNRSEFPTTQELKEDRKESSKRVKSIALYRLKE
FT                   ALKVDEHGKQIGKFIFKNNEFNVIVNNGNFLT"
FT   CDS_pept        complement(849187..851832)
FT                   /locus_tag="PAS_chr3_0436"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70486"
FT                   /db_xref="GOA:C4R4K0"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4K0"
FT                   /protein_id="CAY70486.1"
FT                   /translation="MIGGPQVISESESKLRYFCQHPKCDKNFTRKEHLSRHELNHNPKV
FT                   LYKCQLPECGKSFVRNDLLKRHIRRHELRRDKFQRRNNKAAVHFNNTPIVLSGPGLKTS
FT                   HENSSSSEIDAFTRSSIDTSAPLEARPSISEQGNMKHDDSTPNGSSQPTQAHVTSIPQR
FT                   STLVTPKNDGLRGVQKSTSSGNLLSWLFDDLSSNDNNIEPAMRTRNDFSDFMLSEDMLF
FT                   QEAPGVSGGFAHINGVDMAWSARLPPITSPLAAGLGNETTNDSTALDNRRINAPIENSP
FT                   ASPSDHISSLVLNDLLNVIPSLSQHPDFTGPKIDFFLFNYWSLYHPAFPILHKPSFSSA
FT                   RCESLLLLCMLMIGAHVIAASPSGTAGCHFLDICDPRSLADCIAEPVRWALFTSPDFHP
FT                   PAKLYVIQSLLLLEWYEKNCSTRRIHERGHLHHGTTINLLRRTPSLGGNPLKSSQELEP
FT                   NEPETVYSQWLEMESMKRATLMCFYMDAVDAISFGHQLVLHCHQIQLTMPCDDALWEAP
FT                   LPVRRIPKSMPFLLAMKSTLNRTSFNATPFGRRMVLAGLCAILFQMQQLDLQSAIGLEE
FT                   GMHPIKNWREVIMRAFTFWRNELGESKGLDSKGRPSRIIAGSLANSSSTCTSPYGSLCT
FT                   SSILEQLEADTSCKHPVFHMAYVFMSISHFDLTTFAGAPWRMNVRPSDSDHAAVNRRVK
FT                   DWARSLHGRIAVIHCYLMLFELFLSPEDAPYEYNHPFDPNSDLFCRSNILALLTVVIWN
FT                   YNYAVDGTESNILFGSSDKKLSDITPVENGYAYLRRIRKELSQLSGVMIHTKVKHISGD
FT                   EFFKLTCRYADLLPKVRNKQNMSGLCVMVSSMLMQSSFALPKELAKLLNLCAERSLGSP
FT                   RNTELHMYDQ"
FT   CDS_pept        853612..855378
FT                   /locus_tag="PAS_chr3_0438"
FT                   /product="Member of the PUF protein family, which is
FT                   defined by the presence of Pumilio homology domains"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70487"
FT                   /db_xref="GOA:C4R4K1"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033133"
FT                   /db_xref="InterPro:IPR033712"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4K1"
FT                   /protein_id="CAY70487.1"
FT                   /translation="MTKNLLSVGGSSPQGQNSLANALSPGIPPIGAGSTANTVSFQSQF
FT                   RHQPSLSVNSINSINSLNSLNSFNSNTSTSIHDSAYQFGGEPLTPPEIANNSTKHFSPW
FT                   NTNNNGALKSNSTTQFPAQVFPFSNTAGNPGVGAAPSVTNTNPRSRLLSLPQLQPAVTF
FT                   NIDKSLASLSLQNNNNLDTFNPTSSSTTPIYPKKSHEKELVTRLNSTPFEALTDEIVSL
FT                   SKDQYGCRFLQRKLDENSTMYFPTIFGQICAHASELMVDPFGNYLVQKLLNYCTNHEKD
FT                   LLLEQSAPDLFSVALNQHGTRALQKIIDCLGTNYQFSLVRDSLKNHVVELIQDLNGNHV
FT                   VQKCINKFSHKDFQFIIDAICLHIVRISTHKHGCCVLQKCLNKCNQQQLVQLGDEIIAN
FT                   AIVLMKDQFGNYVVQYLLSMNNLPINEKLVYQILPSISMLSVQKFSSNVMEKCLKNAPN
FT                   RSSQNAMLEEILRPQNLNALIKDQYGNYVVQTAIDVADDEYKFRLIQTVKPMLPFIKST
FT                   PYSRRIQSKISVVLNQNANLNAMLTTYQQYFASTAAPDQYLSFYKQQQQQQQQQQHQYQ
FT                   NQQFQGLHNNQN"
FT   CDS_pept        856281..857939
FT                   /locus_tag="PAS_chr3_0440"
FT                   /product="Lactate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70488"
FT                   /db_xref="GOA:C4R4K2"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4K2"
FT                   /protein_id="CAY70488.1"
FT                   /translation="MSHSIHSAAHKSVMTDIEKQHDRIHPHDHPVTPLEKPDLSAKSIK
FT                   HYFATRLSTLVPKAEDFKDKRYIFNPFMVLRELTPKNWNFFMCGFAAWTWDAVDFFSVS
FT                   LNVTNIAKDLNVTTKDVTWGLTLVLMLRSVGAISFGLWADRKGRKWPFIFNMILLIVLQ
FT                   IGLGFVNTYKQFLGVRAVFGIAMGAVFGNASSLALDDCPPRAKGIVSGIFQQGYAFGYL
FT                   LVVVFQRAITDNASKSWRALFWFSAGPPVLIILWRLVLPETDAFIAQQNLRMETSDGQT
FT                   ASQQFVKQGKDALRVYWLMLIYMIIMMAAFNFSSHSSQDLYPTLLTVQYEFGKDRSTVT
FT                   NVVANLGAIVGGIFWGHMSNFIGRRLAVLLCCIVGGAFIYPWAFINGSGINAGAFFLQF
FT                   AVQGGWGVCPVHLAEMSPPHFRAFVTGTTYQLGNLASSGSSTILADIGERFPIYDENGV
FT                   RKEGVYDYAKVMAIFMGAVFAFLFIVMLLGPERRGASNLDDLQDYIDDWEQKDLDNKKG
FT                   IETEFIEDVQLMEAVSNEDLSEKGNEKVEAFEGNK"
FT   CDS_pept        859462..859935
FT                   /locus_tag="PAS_chr3_0442"
FT                   /product="Lsm (Like Sm) protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70489"
FT                   /db_xref="GOA:C4R4K3"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR034104"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4K3"
FT                   /protein_id="CAY70489.1"
FT                   /translation="MTQNQNRSQTAGLSDVFQNDSEKDLYLESYMYTTAAALVGSIDKI
FT                   VTVTLREGRVFIGILRTFDQFANLVLQDTVERIYIGDDKYAEAPQGVFLIRGENVSLVG
FT                   EIDLDQQDKDLEKRSQIPFPEAQRIRKELVAAKQAKTTKERELMLSKGFEPQS"
FT   CDS_pept        860100..861197
FT                   /locus_tag="PAS_chr3_0443"
FT                   /product="Subunit of tRNA (1-methyladenosine)
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70490"
FT                   /db_xref="GOA:C4R4K4"
FT                   /db_xref="InterPro:IPR014816"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4K4"
FT                   /protein_id="CAY70490.1"
FT                   /translation="MSFLYYKDVIEEEDLVMAFISRNDIKPMIVKSGETLNTRYGVFPH
FT                   DLMIGARYGEQIASAKGYGFIHLLQPTPELWTLSLPHRTQIVYTFDSSYVVQRLRVLPG
FT                   SRVIEAGTGSGSFSHAFARTIHSNGRLFSYEFHKPRYEEAKGEFECHKLPNITLTHRDV
FT                   CTDGFKVDGVNVDGDAVFLDLPAPWEAIEHLDEVVAKDRRVSICCFSPCIEQVVKTIEA
FT                   LTAKNWNGIEMVEVSGRKWEAHREMVRDVDEAVARLKDIKKRAVAGLERKRKLNQTSDE
FT                   FENEDIDIQTTEENDISHKEPAGKGETDLKPKSDQNTKDRGYNPFGKGMRIREGDPAYN
FT                   WINVTRSEPEVKSHTSYLTFAYRNQ"
FT   CDS_pept        complement(861204..862121)
FT                   /locus_tag="PAS_chr3_0444"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70491"
FT                   /db_xref="InterPro:IPR013744"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4K5"
FT                   /protein_id="CAY70491.1"
FT                   /translation="MVEFTLQKSEPVTGIVHSIHTQIPPKAFEFVDSSFKDIVLFVGGL
FT                   TNGILGVGYLPLLAKALAPLGFGLVQALLSSSDRGWGTSSLKKDAAELAQLVKYLRTKA
FT                   GKRNIILMGHSTGCQDTIHYLLHQNPTEPTLRVNGAIFQAPVSDREAFSNELPVEELDA
FT                   LNEEARAILESKGPNELLPQKFRELAFNTPITAYRWLSLMAQRGDDDYFSSYLTDEEFS
FT                   NTLGAINVPFLLLYSGSDEFVPQTVDSNKLVDRWKAIVQRNGLSDWSQYSGIIDGATHD
FT                   LGPQSDAGVDRVVNFIKNLSWDKN"
FT   CDS_pept        862254..863105
FT                   /locus_tag="PAS_chr3_0445"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70492"
FT                   /db_xref="GOA:C4R4K6"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4K6"
FT                   /protein_id="CAY70492.1"
FT                   /translation="MLPLLIPRRLAIHSKGVIFNKRVPINLSFKRALFHFNSPLITYPV
FT                   VRAIITRSYSQHRGNNPWSSRSTKKLNQLVPDPLKVLIGLVGTASLLFVVAAPLLFVIL
FT                   PPILLGGYFTTRLRLRRIESQMQQRWQRALSSSLKFTPRDDLTVSQIELSRAVLDRLVL
FT                   AVDDNEQHLKDLLGLKVDQDGVLPRLALGEAERIEYDSRYSSPGVEEILMVLFFPLTDG
FT                   KHRLANVVVSLAGNSLSPSESRKMVLEIQVGNFVRPVFITNDRQFEDDLVIDVKGKTTT
FT                   RD"
FT   CDS_pept        complement(863723..864787)
FT                   /locus_tag="PAS_chr3_0446"
FT                   /product="Putative dihydrokaempferol 4-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70493"
FT                   /db_xref="GOA:C4R4K7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4K7"
FT                   /protein_id="CAY70493.1"
FT                   /translation="MVSKVLLTGASGYIAQHITNELLSHGFHVIGTVRRQEQADQLHKQ
FT                   FTEENPALQRDPSLLTYVLVPDIGAPDAFDEVLKSTSDITYVLHTASPVALNDDRALED
FT                   VYLKPAVEGTKNILSAIKKFANVSVKNVVVTASLACIMNLDKAEDKSFIHTEKVWNNNT
FT                   WDQTKGGDKIVAYIVSKKEAEKAAWDFVEKEKPNFKLTTVNPPYVFGPQKFDASAKKES
FT                   LNTSAEIVGSLLRTKYPSDDKLFDDPVSISVDVRDVALYHVLPLLDADLASKRLFVVQS
FT                   KFSAQRILNIINENFPDLKGKIAVGKPEETARLEALKAPEYNNSVTVGLTGVDPIPLEK
FT                   TIVDSVKQILRANK"
FT   CDS_pept        complement(866032..867096)
FT                   /locus_tag="PAS_chr3_0447"
FT                   /product="Putative dihydrokaempferol 4-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70494"
FT                   /db_xref="GOA:C4R4K8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4K8"
FT                   /protein_id="CAY70494.1"
FT                   /translation="MVSNVLLTGASGYIAQHVTSELLSHGFRVIGTVRRQEQADQLHKQ
FT                   FSEENPALQKDPSLLTYVLVPDIGAPDAFDEVLKSTPDITYVLHTASPLIFNDDRALED
FT                   VYLRPAVEGTKNILSAIKKFANDSVKNVVVTSSFAALMNPDKFEDKSFIHTEKVWNNKT
FT                   WDDTKPRDEFLGYVVSKKEAEKAAWDFVKKETPNFKLTTVNPSYVFGPQKFDVAARKES
FT                   LNASAEIVNLLLRTKYPSDEKLFDDLVSISVDVRDVALYHVLPLLDADLASKRLFVVQS
FT                   KFSAQRILNIINENFPELKGKIAVGKPEETARLEAIKGPEYNNSLSIALTGVDPIPLEK
FT                   TIVDSVKQILRANK"
FT   CDS_pept        complement(867597..868661)
FT                   /locus_tag="PAS_chr3_0448"
FT                   /product="Putative dihydrokaempferol 4-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70495"
FT                   /db_xref="GOA:C4R4K9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4K9"
FT                   /protein_id="CAY70495.1"
FT                   /translation="MASKVLLTGASGYIAQHITSELLSHGFKVIGTVRRQEQADQLHKQ
FT                   FSDDVPALQKDPSLLTYVLVPDMGAPDAFDEVLKSTPDITYVLHTACPVGPNDDRALED
FT                   VFFKPVVEGTKNIFNAIRNLANDSVKNVVLTSSFVTLMNADKAEDKSFIYTEKSWNNNT
FT                   WDQIKNRDELLAYTVSKTEAEKGAWDFVDREKPNFKLTTVHPPLVFGPQKFDVAAKKES
FT                   LNFSAEIVGSLLRTKYPSDDKLFDDVVTLSVDVRDVALYHVLPLLNADLASKRLAVVQG
FT                   KFSAQRILNIINENFPELKGKIAVGKPEETARLEALKAPEYNNSVTVGLTGVDPIPLEK
FT                   TVVDSVKQILRARK"
FT   CDS_pept        complement(869184..870248)
FT                   /locus_tag="PAS_chr3_0449"
FT                   /product="Putative dihydrokaempferol 4-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70496"
FT                   /db_xref="GOA:C4R4L0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4L0"
FT                   /protein_id="CAY70496.1"
FT                   /translation="MVSKVLLTGASGYIAQHITNELLSHGFKVIGTVRRQEQADQLHKQ
FT                   FSEESSVLQKDPSLLTYVLVPDIGASDAFDEVLKSTPDITYVLHTASPFIFNDDRALED
FT                   VYLKPAVEGTRNILSAIKKFANDSVKNVVVTSSFAAILNADKFEDKSFIHTEKVWNNNT
FT                   WDQTKSGDRGVAYIVSKKEAEKAAWDFVEKEKPNFKLTTVNPPYVFGPQKFDASAKKES
FT                   LNTSAEIVGSLLHTKYPSDDKLFDDPLNLSVDVRDVALYHVLPLLNADLASRRLLVVQS
FT                   KFSAQRILNIINENFPELKGKIAVGKPEETARVEAIKGPEYNNSVTVGLTGVDPIPLEK
FT                   TVVDSVKQILRANK"
FT   CDS_pept        complement(join(870572..871298,871348..871382))
FT                   /locus_tag="PAS_chr3_0450"
FT                   /product="Alpha 4 subunit of the 20S proteasome"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70497"
FT                   /db_xref="GOA:C4R4L1"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR037560"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4L1"
FT                   /protein_id="CAY70497.1"
FT                   /translation="MSGYDSALSIFSPDGHVFQVEYALEAVKRGTCAIGVKGKDVVVLG
FT                   AERRTTLKLQDPRVTPSKINNVDKHVLLAFAGLNADARILIDKARVEAQSHRLNLEDPV
FT                   SIEYLTKYVAGVQQRYTQSGGVRPFGISTLIAGFDGNDNVPRLYQTEPSGIYSAWKAVA
FT                   IGRSSKTVNEFLEKNYLQLEESDVTLDRDRTIKLTIKALLEIVQTGAKNIEISVMAPNE
FT                   TIQLSNDEIAAVVEQVEAEKAAEAEKKQKKK"
FT   CDS_pept        complement(872015..872434)
FT                   /locus_tag="PAS_chr3_0451"
FT                   /product="Mitochondrial outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70498"
FT                   /db_xref="GOA:C4R4L2"
FT                   /db_xref="InterPro:IPR013262"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4L2"
FT                   /protein_id="CAY70498.1"
FT                   /translation="MADIEIEIDLPVEPVVEDFPSNAESPLSQEELFESSDSQQTEAEL
FT                   EDSEITTKINLSNVWSAVSSVAINLVLPFINGMMLGFGEILAHEVAFRYKWRGAKIQPP
FT                   SRMLRAASNSSAAVQSEKSYKEESPAISQRRSLVL"
FT   CDS_pept        872702..874414
FT                   /locus_tag="PAS_chr3_0452"
FT                   /product="Sensor of mitochondrial dysfunction"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70499"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4L3"
FT                   /protein_id="CAY70499.1"
FT                   /translation="MSTVELQANEAEIVARSLVAIVDIGSNGIRFSVSSTASHHARIMP
FT                   CVFKDRLGISLFDAQLDKGSASSISTRKPIPQEAITEICLAMKRFQLICEDFGVSNDNV
FT                   KIVATEATREAPNSKEFRDAIAKTTGWEVELLSKEDEGRCGAFGVASSFHNISGIFMDV
FT                   GGGSTQLSWVSTVNGDVRLAEYPISLPYGAAALTQRLLYEDEREVYEEVRQAYELALEK
FT                   IKIPTELIEEAEKNGGFNLYTCGGGFRGVGHLLLHEDPNYPIQTIINGYTTGFKKVELL
FT                   ANYLLLKKEVPNFSEGSPKIFRVSERRKQQLPAVGLLMSAAFQVLPKIRTVSFSEGGVR
FT                   EGVLYSRISPSIRSEDPLLTATRPYAPLLSEQYRKLLLGALPEEVPSEITQTIVPALCN
FT                   IAFVHCSYPKELQPTAALHMATSGIIAGTHGLSHKVRALIGLACCERWGFDLPESEEVF
FT                   YGKLEKLVIQSDPNDGERLLYWTKYCGKIMFVICGVHPGGNIRPGVIDFNVIPRAEANK
FT                   TNTAVQVGMSANDVKSSYTVKNRIASLQRKIKKLNKSYKGKDRVVVEVEYRMS"
FT   CDS_pept        874605..876773
FT                   /locus_tag="PAS_chr3_0453"
FT                   /product="Subunit (90 kDa) of TFIID and SAGA complexes"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70500"
FT                   /db_xref="GOA:C4R4L4"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR007582"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037264"
FT                   /db_xref="InterPro:IPR037783"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4L4"
FT                   /protein_id="CAY70500.1"
FT                   /translation="MKQEPGDSSDKSAPSGSITPQPKPPQQANVSNQQPQKPQQFSAAD
FT                   LNRIVLEYLNKKGYHKTESMLRMESSHIPAPPTNIPTPQTTNISRPTAPGRAPEYSDDP
FT                   ATIKRGYSILKSWCESSLDFYRPELEKFLYPVFVHCYLDLIARGYPSHAREFYDKFSKD
FT                   HSVLHEYEISKLGGISLKEHLQENDVAKIFRSHKFKVLIGRTTFNLLLYFLNENDAVGG
FT                   GVVLRLINQYIEPVITTEAIAVEREGELNLSEGIVELHTLNNTSIGGEQREISSVDAFN
FT                   KKPVKLGKLQVDPEYSKELEAELKLKDEHEQAAQKKVSTTLLEEYRENFKVDPSDENNP
FT                   SKDTLPLPLKSAQDLRNDIAMIQDSRAKIKLSAAQASLPSVCMYTFHNTNNDLTCLKFN
FT                   DDSTMVASGFQDSFIKLWSIDGSPLRSLLKNDPYNQQNNDGVAVKGSRRLVGHSGAVYG
FT                   VDFSPDNRYLISCSEDKTVRLWSLDTYTCLVSYKGHSSSVWDVKFSPMGHYFATASHDQ
FT                   TARLWSCDHIYPLRIFAGHLNDVDCVEFHPNSTYLFTGSSDKTARMWDIARGECVRVFM
FT                   GHSGAINCLAVSPDGRWLASAGEDSVVCLWDISTGRRIKAMRGHGRSSIYSLAFSREGT
FT                   VLVSTGADNSVRVWDVKKNTNSPSAQPEPINDVTAQGIQKKTEDLRRRKEIVATNDHMS
FT                   VYFTKKTPVYTVHFTRRNLCLAGGVFGG"
FT   CDS_pept        complement(876797..877660)
FT                   /locus_tag="PAS_chr3_0454"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70501"
FT                   /db_xref="GOA:C4R4L5"
FT                   /db_xref="InterPro:IPR009450"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4L5"
FT                   /protein_id="CAY70501.1"
FT                   /translation="MARHPWKKLLWLKQDYADNYTDSSFLSQLKKNTTVANYSYFKLVN
FT                   DFALIVLHSSTIVLVSIVFYGVYHENWNPVIPTLVSTSITFIFWVVYMVISYINHLEVA
FT                   SVVGTLKSSLLILFILLTLSPVLKSLTDSTSSDSIWALSCWICVVNVLFNDYVIEFSGA
FT                   THTSNLSKNLALSNAILLASRLYSNLAAFSFILFCIQVQGLFPMFNNFTRRCQMLAFHR
FT                   FQLIAIVGGVNYLVYSILGMSALSCWAALQGIILFVGPSYFIRLQKYKEELQGPWDPVK
FT                   PRISVA"
FT   CDS_pept        877889..878200
FT                   /locus_tag="PAS_chr3_0455"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70502"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4L6"
FT                   /protein_id="CAY70502.1"
FT                   /translation="MADNIETIRPGINYQDKLLTEIDILDDVKQLSTQMEQEGKGFVFP
FT                   KDHYSKIKSLKGLQVKLLKEMQELAEIQQSRHQDETAYRQKLQDLEDTTSELRNVALT"
FT   CDS_pept        878576..880258
FT                   /locus_tag="PAS_chr3_0456"
FT                   /product="Glycolytic enzyme phosphoglucose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70503"
FT                   /db_xref="GOA:C4R4L7"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4L7"
FT                   /protein_id="CAY70503.1"
FT                   /translation="MPSLLQEDNATFKLASELPAFEELKELYKSKGKNFSAKQAFQKDP
FT                   ARSSKFSHTFKNFDGTEVFFDFSKNLIDDEILAKLFDLARQANVEKLRNEMFAGEHINV
FT                   TEDRAVFHVALRNRANRPMYVDGKNVAPEVDSVLQHMKEFSTQVRDGTWKGYTGKQITD
FT                   VVNIGIGGSDLGPVMVTEALKPYAQEGLHVHFVSNVDGTHIAETLKYLDPESTLFLIAS
FT                   KTFTTAETIRNANTAKDWFLSKTGNKSEAIAKHFAALSTNAEEVAKFGIDTKNMFGFEN
FT                   WVGGRYSVWSAIGLSVAIYIGFDNFEDFLKGAEAVDRHFLETPLEQNIPVIGGLLSVWY
FT                   TNFFGSQTHLVTPFDQYMHRFPAYLQQLSMESNGKSVTKGNVFANYSTGPVVFGEPTTN
FT                   AQHSFFQLVHQGTHLIPADFILAAKSHNPVANNAHQILLASNFLAQAESLLLGKTEEEV
FT                   AAAGATGGLIPHKVFSGNRPTTSILTQKITPATLGSLIAYYEHVTFTEGAIWNINSFDQ
FT                   WGVELGKVLAKAVQKDLQDDSANVEESHDSSTAQLIKKFKAWA"
FT   CDS_pept        880411..881640
FT                   /locus_tag="PAS_chr3_1191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1191"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70504"
FT                   /db_xref="GOA:C4R4L8"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR022052"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4L8"
FT                   /protein_id="CAY70504.1"
FT                   /translation="MAEEVDPVSLGDQTILRYKIWKKNSPYLYDYFQSKSLLWPSLSVE
FT                   FLPDIERNDEDEFDYQRLIFGTFTSGASNEFLNFGMFSRHNEVSLRESLRNSLDNFDSV
FT                   KGEISPLVLPSSKDSKNSNRSCEKLSIIQRIAHNGEVNKCKYLPQNPDIIATINNYGSV
FT                   SIFDRTKHPSQPLSGTIKPDIYCTYHKDEGSCLSWNPSVEGELLSGSMDGTVVLWDIKK
FT                   YTRDKDSLDPYKIFIAHDNGCNDLKFIPRHTSIFGSVGEDGFFKLWDTRQGLDPVKSTR
FT                   LHQTGINSLSFSDQVPFTLATGDAEGQIKLLDLRNLENTIQDIKAHEESISTLEWNPHN
FT                   SLLGSCSMDKTVKIWDFGDNEQPLKFTHGGHMFGVNDISWNPWDETMISSVGEDNSLHI
FT                   WKPSKSIIGV"
FT   CDS_pept        complement(881649..882854)
FT                   /locus_tag="PAS_chr3_0457"
FT                   /product="Essential, non-ATPase regulatory subunit of the
FT                   26S proteasome"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70505"
FT                   /db_xref="GOA:C4R4L9"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019585"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR035268"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4L9"
FT                   /protein_id="CAY70505.1"
FT                   /translation="MATYASGIPKIPDFDVSKLSFLAQIADGDGDAALVDKVIQGVETN
FT                   EMAPYYHYLYHQIALPGLEWDQGLYDKLVLQNEKKVEELTNKIKVVDEDDEGEVENAEC
FT                   WAELGNYYAQIGDKNKAIETLGKATDLAPSIGAKIDIKLTLSRIGFFYDDKQFTKKYLD
FT                   EANALIEKGGDWERKNRYKVYTGIHDLSMRKFKEASDLLIGALPTFTSTELLTYEDLAL
FT                   YALIAGVISLDRKNLKKQLIDSPEILSIESHSSLFKPIFSLLKALYDCKYDSFFKHLLE
FT                   TNDQILTKNVNLAPHANYYLRELRVKAYSQLLESYKSLSLKSMSEEFGVSIEFLDHDLC
FT                   QFIPNKQLNCVIDRVNGIVETNRPDNKNNQYNLLIKSGDALLTKLQKYGATVRLSGTEK
FT                   AN"
FT   CDS_pept        join(883230..883268,883335..884762)
FT                   /locus_tag="PAS_chr3_1192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1192"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70506"
FT                   /db_xref="GOA:C4R4M0"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="InterPro:IPR019807"
FT                   /db_xref="InterPro:IPR022672"
FT                   /db_xref="InterPro:IPR022673"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4M0"
FT                   /protein_id="CAY70506.1"
FT                   /translation="MVHLGAKKPQHRKLSPELRKAYKEVEAQFVVSTPRLKQIVDQFVA
FT                   ELKEGLKSSSSNIPMLPTWVMDFPTGEETGDYLAIDLGGTNIRVILVRLLGNRKFDTIQ
FT                   SKYVLPKWIRTSTSNELWLFIAQCVKTFIDEEFDYRESPEDPIPLGFTFSYPAFQSRIN
FT                   SGVLQRWTKGFDIPDVEGHDVVPMLQDALESLGLSVVVVALINDTTGTLVASTYTDPET
FT                   KMGLIFGTGVNGAYYDTISSVSKISNALPPDIQEDASMAINCEYGAFDNNISVLPRTKY
FT                   DDTIDLESPRPGQQSYEKMISGYYLGELLRLVLVDLHHQGHIFKGQTIGKLNEPFIMDT
FT                   SFPARIEEDPFENLCETGELFNSLGIETTVPERELIRRICELIGTRAARLSVCSIAAIC
FT                   KKRGYKKAHCAADGSVFTRYPYFPDRAARALRDIFQWGHSTPDLVTVVPAEDGSGVGAA
FT                   IIAALTKQRMANGESVGLDEYHPQDGKDSN"
FT   CDS_pept        join(884875..884890,885048..886195)
FT                   /locus_tag="PAS_chr3_0458"
FT                   /product="Essential component of the Arp2/3 complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70507"
FT                   /db_xref="GOA:C4R4M1"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="InterPro:IPR027306"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4M1"
FT                   /protein_id="CAY70507.1"
FT                   /translation="MEQPIVLDQGTGFVKIGRGGTNFPDHTFPSIVGRPILRAEERTGT
FT                   VEIKDIMCGDEASSVRSALQISYPMENGIIKNWEDMEHLWDYAFYERMKIDTTDRKVLL
FT                   TEPPMNPLKNREKMCDVMFEKYHFGHVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVP
FT                   VYESVVLSHLTKRLDVAGRDVTRNLINLLLRRGYAFNRTADFETVRQIKEKLCYVSYDL
FT                   DFDTKLANDTTTLVESYELPDGRVIKCSSERFEAPECLFQPNLVDVEQPGVGESLFNVI
FT                   QSADVDIRSTLFKSIVLSGGSSMYPGLPSRLEKELKQQWFHKVLRGDPTRLEKFKVRIE
FT                   DPPRRKQMVFIGGAVLANIMADKDHMWISRQEWEEQGPRVLEKLGSR"
FT   CDS_pept        complement(886269..887993)
FT                   /locus_tag="PAS_chr3_0459"
FT                   /product="Dual-specificity kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70508"
FT                   /db_xref="GOA:C4R4M2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR027084"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4M2"
FT                   /protein_id="CAY70508.1"
FT                   /translation="MKSLSGLGLSPDSNRSEEILPPELNVVTMSMLDDVSFKPTLKPRR
FT                   ERTSVYKDPSIFDKYSNEYFTPHTQTRAPITPPSQQCMESLGRGSSRLSKKYNRIGLGA
FT                   PKRLSQKLTDEFSLENIMQRGTKTQQRRQQLDQKLQDKDLDPDNLQEIQKDLESHRSKY
FT                   LNELKRQNHSPPLTTTKAQLPDVAPYFDRNTPAQKTPSREPLRPISSNVRCQELNTATT
FT                   TNKTSVQPQAPQDNIQRSKPIVQINNKHYEKLELIGRGGSSKVYKVKSFANNKAYAIKR
FT                   VTLDQFDSNAIKGFKGEIQLLQKLSNSDRVVKLIDYNFSDTTIHLVMELGEIDLAHVLT
FT                   SQNSLDLNAVRFYASELFKCVQAVHQSGIVHSDLKPANFLFVRGVMKIIDFGIANALDD
FT                   VTCNIYRDSQIGTPNYMAPEALIECSSKGVASLGPESSTWKIGKGSDIWSCGCILYQMV
FT                   YGRPPYAHFNGNQRLMAIMNPQVQIEYSEKGLDDVRVPSALKSLMQGCLERDLTKRITC
FT                   EEALNSNFLNPKTVSREFICDLVDHALKYGARNQNVTPDVMSSLCEEVWSKVCQSNN"
FT   CDS_pept        888430..889128
FT                   /locus_tag="PAS_chr3_0460"
FT                   /product="Subunit b of the stator stalk of mitochondrial
FT                   F1F0 ATP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70509"
FT                   /db_xref="GOA:C4R4M3"
FT                   /db_xref="InterPro:IPR008688"
FT                   /db_xref="InterPro:IPR013837"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4M3"
FT                   /protein_id="CAY70509.1"
FT                   /translation="MSLARVSFRAARQSTIGLRAFQPCAVRLQSSQVEPKAKANSIIDA
FT                   LPGNNILSKTGIVATSVAGAVYAISNELYVVNEESILLLTFAGTVGVVAKVLGPLYNEW
FT                   ASSTIQNITDILNSSRTKHVEAVKGRIDQVGNLKDIVSTTKALFELSKETAQLEAEAFA
FT                   LKQQVDIAAEAKSVLDSWVRYESQVRQLEQQQLASSVISKVQEQLKDPKFQQKVLLQSL
FT                   EQVEQVFAKK"
FT   CDS_pept        complement(889189..889497)
FT                   /locus_tag="PAS_chr3_0461"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70510"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4M4"
FT                   /protein_id="CAY70510.1"
FT                   /translation="MSSPPDDPNALGRRSIFYEPQWNPSGKAPKGFKNVPYPLKNPKDY
FT                   PSDPRAEKIPLPEGPPPKYYKRKTTAIEAPEERRDLYKETLQFVPRTIASTQKPKTP"
FT   CDS_pept        889696..892641
FT                   /locus_tag="PAS_chr3_0462"
FT                   /product="Cytoplasmic alanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70511"
FT                   /db_xref="GOA:C4R4M5"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4M5"
FT                   /protein_id="CAY70511.1"
FT                   /translation="MLKFPHKGISSIKSKPRIGIIAMSTLASKEWTANKVRSTFFDFFK
FT                   SKDHTYVPSSSVIPYDDPTLLFTNAGMNQYKPIFLGTVDPSSDFATLKRATNSQKCIRA
FT                   GGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIGYGWELLTKVYGLEKERLYVSY
FT                   FGGDAGLGLEPDLEAKEYWKALGVAEDHILPGSVEDNFWEMGDQGPCGPCSEIHYDRIG
FT                   GRNAASLVNQDDPDVLEIWNIVFIQFNREADGSLKPLPSKHIDTGMGFERLVSILQNVR
FT                   SNYDTDVFDPLFTKIQEITGVRPYSGHFGKEDMDGIDTAYRVLADHVRTLTFSLADGGV
FT                   PNNEGRGYVLRRILRRGARYARKYMNYPIGKFFSQLAPALIEQVKETFPEVDKNFDTIA
FT                   EILDEEEASFSRTLDRGERLFEQYAIIASKTPEQTLAGRDVWRLYDTYGFPVDLTRLMA
FT                   EETGLKIDDEGFEIAKEASREASKGNGKTQGKELVKLDVHVLGELEKNSEVPKTDDSYK
FT                   YGTKNIEASIVAIYNGKELIQSTSEVADDQQLGILLDKTPFYAEQGGQIYDTGKIVIDG
FT                   VAEFNVENVQSYAGYVLHTGYVEEGVLSVSDKIIAGYDELRRWPIKNNHTGTHILNFAL
FT                   RDVLGDDVEQKGSLVAPEKLRFDFSHKKALTLSELQKVEDISNEVIKKNVPVFASDVTL
FT                   AVGKEINGLRAVFGETYPDPVRVVSIGVPVEELVKNPSNAEWHNASIEFCGGTHVAKTG
FT                   DIKDFVIIEESGIAKGIRRIVAVTSTEAHTVQRIAREKNDQLDAIAKMSFGEAKEKKLK
FT                   EFNVALGKLQISVLAKNDLKTKFTNIEKVVKDELKVRQKAESKKTLDTVKDYFNEHEDS
FT                   PFFVAHVPVSSNAKLLTEAFSYIKKEIPDKSLYLIVGNESEPKIAQGCYVSDNALSKGV
FT                   VASEVTNVASEFIGGKAGGKGNICQGVGTNPEGINKAIEAVTKILKEKLSI"
FT   CDS_pept        892906..893973
FT                   /locus_tag="PAS_chr3_0463"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70512"
FT                   /db_xref="InterPro:IPR018865"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4M6"
FT                   /protein_id="CAY70512.1"
FT                   /translation="MAPNTMKLTASKSSKLSHRSLIESQLKKTKLQNQGYIDKKQPEYY
FT                   LPSEQAIVNEINQEKLLKKEEFDKQQKLQVLNYDCRIFDNLDLELEADGGVDDYLAEYY
FT                   GSKREDPLITAIDQIQLSQFDNNYPPIAKGGLTKKSKLEIETKREAYPRLVLVNQLYSV
FT                   FPSNPTFVDQAIQKLVDTGKIKQLRINHKDFHDNVVIKNEDYMTIVETFSDDGNVSNFS
FT                   KFLTENRSANNVTLKDSEKYGFRIDDLISKGFLNISTGKSTINTENYYLSVPNIGGFLK
FT                   LIQESKKFVFKVIGTTKWKEALESKLEERWNYKNRKWYYFKGLNLKWVLSYCAGAGTLE
FT                   VFNTPVGKGWKITGK"
FT   CDS_pept        complement(893999..895111)
FT                   /locus_tag="PAS_chr3_0464"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70513"
FT                   /db_xref="InterPro:IPR012879"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4M7"
FT                   /protein_id="CAY70513.1"
FT                   /translation="MLAILSLLAVASAQQVSQPYYEHTYEELKEMGLLQRLITYNWKLE
FT                   LVTVSFTLAYLLTHFLGASYNARLVGKWVSSAEEVLDKQFASLGCSVKEKVVKDDNEHY
FT                   TYFATGRKNIESLTVRFTLKPRHNLLLLVTETILSFFISSIEKSIDSVNIIVKYNDEAE
FT                   SNIDDFIWAIVNKDGMNQARIENYFLSLTKTSESSKLPTEYVFMSETADITEEVYNDAE
FT                   NSGLTSSPTLLKYVAFTDQSIVKPTTLEEAASSKKAILFTNFPSTASELKANQDLLTSF
FT                   LSLVDNVVENVKFRPETLKRVKKTREAEIQKIKKALDEVQKEELESKRVEEQRKERERI
FT                   SKLSPEEQRKIEKKRQEKKQRKQMKQQRVR"
FT   CDS_pept        complement(895426..895968)
FT                   /locus_tag="PAS_chr3_0465"
FT                   /product="Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70514"
FT                   /db_xref="GOA:C4R4M8"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4M8"
FT                   /protein_id="CAY70514.1"
FT                   /translation="MLLQSFKALRATRSSLISTPIIQTAGYKTQYLGQKVVKVYQPLPK
FT                   LREGTPLMKYVKENQYKKLDPNGVKKSLLDKSNPSLLRSGDIVRITYNNKQPPLVGMVI
FT                   AVKRNGCDSNILLRNSYAKLGVEIRVPIFNPVIERVDILKRPTKYRSRNKLYYIRGTKL
FT                   DVTDIESSLKKQQRRSN"
FT   CDS_pept        complement(896113..896922)
FT                   /locus_tag="PAS_chr3_0466"
FT                   /product="Protein involved in bud-site selection"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70515"
FT                   /db_xref="GOA:C4R4M9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR022238"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR039769"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4M9"
FT                   /protein_id="CAY70515.1"
FT                   /translation="MSRPEQLAPAEVFYNETESRKYTNNTRIQHIQAKMTLRALELLNL
FT                   PKDTANFILDIGCGSGLSGEILTEEGDMWIGMDISPDMLATALDREVEGDLLLADIGNG
FT                   IPFRAGTFDAVISISAIQWLCNADTSNADPKRRLLRFFNTLYASLKRGGKVAAQFYPMN
FT                   DNQLDQIQSAAKVAGFQGGVVIDDPESKKNKKYYLVLSAGTPDVQINLEGVVMDAPTKE
FT                   RKLNKKQMKLMETRKDYIQRKKEVMKRRGKSVANDSKFTARKRRPRF"
FT   CDS_pept        897081..898661
FT                   /locus_tag="PAS_chr3_0467"
FT                   /product="Acyl-CoA:sterol acyltransferase, isozyme of
FT                   Are1p"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70516"
FT                   /db_xref="GOA:C4R4N0"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR014371"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4N0"
FT                   /protein_id="CAY70516.1"
FT                   /translation="MMPIPVARVDSDTQMQAIKRNAKKERSKIHNFPLKGQEIGSSMTG
FT                   FEEDLKEYDIMEDLKSHDLVLIKKNAQISTRYDKKGELRSRFGDISFNQSRSIFDSSIM
FT                   ETPFRGFFILAWMAVGMLALKTLVEYERNNTRIYTSNIIRIMQKDLIKVGFADLLMYLS
FT                   MYATFFLQKLIKNGYLDWDNTGMYLQHVYQCGFLFFWLLTAKRMEFPWIGKIFLLLHSL
FT                   VMLMKMHSYAFYNGYLFKIQKELDFSQRHLNNKKQKLDKETTAALQKSVEFCKFELTSQ
FT                   STTSPFPSNVNLKNWFWYTMYPTVVYEIDYPLTNEIRWKYVGTKMLGIFGVIFLMILVA
FT                   ESWLYPLALEAIQLRKLPVSQRVSPYVFILLEMAPPFLLMYMLVFYLIWELILNAVAEL
FT                   TGFADRSFYSEWWNSVSWDEFARDWNLPVHRFLLRHVYHSSISAFQLSRYNATLFTFLL
FT                   SSFVHELTMYVIFGKFRGYLLYFQMAQIPLTYLSRTKFMADRKILGNSIFWLGISTGPS
FT                   LLCSLYLVF"
FT   CDS_pept        complement(898697..899365)
FT                   /locus_tag="PAS_chr3_0468"
FT                   /product="Putative metalloprotease of the mitochondrial
FT                   inner membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70517"
FT                   /db_xref="GOA:C4R4N1"
FT                   /db_xref="InterPro:IPR019165"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4N1"
FT                   /protein_id="CAY70517.1"
FT                   /translation="MPEPNDEPPSGFNWWRRTLSYKTGLGLTQEEKVKYENDLKLKKSK
FT                   DDCAKCYEYRDWMLRYSPTVKFLMDQISQAGGQISAKDIVCDECDDLKGGGFHPEIGIL
FT                   ICQNRLIDKWHLEDIVSHELIHAYDNTKFKVDWFNLRHHACSEIRASSLSGECRIMQQF
FT                   WRSSISRFNSGHQDCVRRRAVLSLQANPNCKDKEQAESIVDEVFESCFNDTRPFEMIYR
FT                   "
FT   CDS_pept        join(900140..900209,900259..902333)
FT                   /locus_tag="PAS_chr3_0469"
FT                   /product="Signal transducing MEK kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70518"
FT                   /db_xref="GOA:C4R4N2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR029458"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4N2"
FT                   /protein_id="CAY70518.1"
FT                   /translation="MEQLNLSSWLNELQCSAYLDRFEENGITTDLLCDLDKGALIDLGI
FT                   DKVGPRIRLENEIQRLRLKRLRTILPLERLSEIILPDYASETSLSEKDALGNQVSPLSP
FT                   TKQLVQKSPRNQLRRSHSSLKSTTDEKSSKSLATFINLDGSKKQIDIRGCFNAMSIKRK
FT                   ALKGLDLKMDPDLCAAYFVNDDEELHLMYDIELVTVCHSADRVERNRIILCKKTESPTL
FT                   AAIETSTAAMKLARNSDKGLAQENDNSVIKESTEGKPSLNNFFGQRPPSELISTNLAEY
FT                   FPDTKVNKLQETVRNSVRNSMRISRLMSSQFSNASIFSDHSGNHSRLSSSLSRYAMSNI
FT                   AGDRASIISSSTRKTIGKVLADRITKEDGDTVEPEYNEHTVRSNHEANSSNELSDSVHE
FT                   RHNEFNEGDSSIIELFEECDDDDTGDDEYMLKQLSIEEERGPQSWLKGARIGAGSFGTV
FT                   FLGINSFTGELMAVKQVELPTARSVNDAHGQNMLESLKQEISLLRELDHENVVRCIGSS
FT                   IDDEFLNVFLEYIPGGSVSSMLNNYGPFEEPLIRNFVKQVLSGLAYLHEKQIIHRDIKG
FT                   ANVLIDTKGTVKISDFGISKRMSDLKPSSKRASLQGSVYWMAPEVVKQTVYTNKADIWS
FT                   VGCLIIEMFTGKHPFPDFSQMQAIFKIGMQTRPEIPPTASDLARSFLESCLESDYTKRS
FT                   SATDLSHHEFVKTALLDRHN"
FT   CDS_pept        complement(902330..903103)
FT                   /locus_tag="PAS_chr3_0470"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70519"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4N3"
FT                   /protein_id="CAY70519.1"
FT                   /translation="MSLSDFTLIGKDDVYDHVYLLYSDSKLNNDLGYYPSKADKFVIPI
FT                   GDLDIEVEQSKSGVYSRHGTGTTGFYLWNVSPLFAEWMLYHKHPLSDMFNGCGVVVELG
FT                   SGVVGVLASTLSTRCELFVATDQKHVLKLLAKNIENNRQPKANTKIVEFDWENIEFGVS
FT                   NLESTLERRQVDFVLAFDTIYNSFLLDHFIAATKTICNSETIVVVGIQLRDEDVLSEFL
FT                   EKMLDKSFQCYHVDQEWLSSDLKNGYSIYCFKLCS"
FT   CDS_pept        903300..904370
FT                   /locus_tag="PAS_chr3_0471"
FT                   /product="Aspartic beta semi-aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70520"
FT                   /db_xref="GOA:C4R4N4"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005676"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4N4"
FT                   /protein_id="CAY70520.1"
FT                   /translation="MKKAGVLGATGSVGQRFILLLSDHPEFELSVLGASSRSAGKRYED
FT                   AVVWKQTDLLPESARNIIVQECKAEAFKDCDIIFSGLDADYAGEIEKEFVSSGLAVVSN
FT                   AKNYRREADVPLIVPIVNPEHLEIVEQKVKSGQKGFQICISNCSTAGLVAPLKPLVEKF
FT                   GPIDLLTTTTLQAISGAGFSPGVPGIDILDNIVPFISGEEEKMEWETRKILGGLSEDKM
FT                   ECRLVSEDAMKVSAQCNRVPVIDGHTECISLRFERRPPPSVEAVKQCLRDYVCEASKLG
FT                   CPSAPKNTIHVLEQNDRPQPRLDRVRDNGFGVSVGRIREDPVLDFKMVVLSHNTIIGAA
FT                   GSGVLIGEILLKKGLI"
FT   CDS_pept        complement(904425..905099)
FT                   /locus_tag="PAS_chr3_0472"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70521"
FT                   /db_xref="InterPro:IPR013239"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4N5"
FT                   /protein_id="CAY70521.1"
FT                   /translation="MSLQSIGRNMAVSHPVSINVTGQQPLETENVQELLDEFIAKADEE
FT                   TAQELNFMALNDGTTATATNNNAAKISQLKRLQRELRGLPPLLDAPTFGEKPRKAGFEG
FT                   ATADTGKIEAGVKLNKKIKFDDEPVTVEPVINTVTNSQKHVIEEEEEEVLKEVETDEQP
FT                   KPEASDSESEEQERKRRKKEKKEKKDKKEKKEKKEKKDKKEKKEKKDKKEKRKEKKQES
FT                   KV"
FT   CDS_pept        905336..905698
FT                   /locus_tag="PAS_chr3_0473"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70522"
FT                   /db_xref="GOA:C4R4N6"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4N6"
FT                   /protein_id="CAY70522.1"
FT                   /translation="MLRVVNQKMASNVASGMYRANGNMFRTLGQIMQRPQLANPTNIQS
FT                   QSLVQEVSPLSFINNFVGSFSQRRWGTRGGNRGNTYQPSTLKRKRRLGFLARMRSISGR
FT                   KVIRRRQLKGRWYLSH"
FT   CDS_pept        905867..906688
FT                   /locus_tag="PAS_chr3_0474"
FT                   /product="Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70523"
FT                   /db_xref="GOA:C4R4N7"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4N7"
FT                   /protein_id="CAY70523.1"
FT                   /translation="MSLARSIPGRGFVAVSSYCRLFSTTGLAYAPKKQASQDNSKKKEA
FT                   KRMALLRLQAKQPANKSPLYMTIPEALRYLRAAEVGFPINEAVISICSVIVNDKGAPPI
FT                   NGSVKLPRPLKETKLAVFSDDPALQEEATKFGASLVGGSELIEDIKNGKVQLDFDKAFA
FT                   TPDIVPSLNQIARILGPRGLMPNAKRGTVITDVQKAVVESHGSLPFRQRNNLLSLPVAR
FT                   TNFTDEETLENIIEANAAIKESISRIRTKKPILFGETTITSTHGPGIVIDF"
FT   CDS_pept        906864..908342
FT                   /locus_tag="PAS_chr3_0475"
FT                   /product="Transmembrane protein subunit of the
FT                   glycosylphosphatidylinositol transamidase complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70524"
FT                   /db_xref="GOA:C4R4N8"
FT                   /db_xref="InterPro:IPR019540"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4N8"
FT                   /protein_id="CAY70524.1"
FT                   /translation="MSESKSEILPPEPEEERSLRTLIFISVFSVIVLLGVPLWFLTTSL
FT                   YRAELPVEEINNLSSTLKSQIHYDIPFYIELPKPMRYLVLETQELLDSKLAQLSSEHPF
FT                   DVDYHVSLISGPKKSDLDYQIELVNSEDPNGEGLFISPYERRIVIRNSENVVVNKLVPD
FT                   FISRVILDEVLKYEISVHQGLLTTNSGFEIPFKDKLKLTFNLFKGDGLPIDWDTSSLER
FT                   YLDGALENFRTYLDLRVETQVIYFASLNINKDNLIIEDGQYLLTERNLSSFINYSDWGL
FT                   EDSTTTDPTLNFIIYIPSEDTRPLKVQNSEHNSFLIAQYGGVLILNDIVDNQLSETDLM
FT                   PILDIFTSQLYKLIGVPEHIESLTPKSPQIRVDIMMRLKIIENLQLAVDNLKSLITLSK
FT                   RLSTINIPDFTIEHVNSAIENINQSIDKLNSREFVDSLKLSNEAIEESDRAFFSENMVQ
FT                   QAYFPDEHKMAVYLPLIGPIVMITCLMFLRVMKK"
FT   CDS_pept        complement(908374..910074)
FT                   /locus_tag="PAS_chr3_0476"
FT                   /product="Protein of unknown function that associates with
FT                   ribosomes"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70525"
FT                   /db_xref="GOA:C4R4N9"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="InterPro:IPR036885"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR039757"
FT                   /db_xref="InterPro:IPR039759"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4N9"
FT                   /protein_id="CAY70525.1"
FT                   /translation="MFKKDPDLKPLSNLKNSDRKKLFAKVVEDYKVSNVPIDYLFPSDS
FT                   KQGNFKSPLKISGTIYTDAESTPTWFKTKDSNVLPSIMTLWRYPSLIPIVLTNDMVIGK
FT                   LINGADLMLPGCIPPFDSRCVKGSIVGVASYKQPNVVYAVGECLLGLSDVEETVGKSGV
FT                   AVRVYHHFEDHLCQLAKITLKPPKEEEALETILQFQDVTSEQPVEEDGLHNNAEALNSE
FT                   VQDETIEHEASDSNELAEVLTELTVEDVDMFFERALLQTITQDKISLPISASNFMNHIL
FT                   KNMPPIDSSLVTMKKTSWKKTSKYLKAMQKLKLLDLKGKGEDLTIISVASSDNEKVRKF
FT                   VPYTVKSVNSSKQSQNKPSKDKLTILFYYKPNSCTRSFFNDNDKVTNVLYSQQELKNIL
FT                   NEYIRSKDLVREKNKIFLNPPLQEIVKLKEGRTIARDKIFSEFLKGFTINHKIIPINTP
FT                   DEEVESIKIKKGNVPKVEIVTEMRIGRKVVTRISNFEVYHIKAQELANELRVKCSGSTT
FT                   IGENIQSKSTEVTVQGPHEKIVQELLAAKGLSPAWFNVTNKLKAKKKRT"
FT   CDS_pept        910242..912089
FT                   /locus_tag="PAS_chr3_0477"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70526"
FT                   /db_xref="GOA:C4R4P0"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR024789"
FT                   /db_xref="InterPro:IPR024790"
FT                   /db_xref="InterPro:IPR024977"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4P0"
FT                   /protein_id="CAY70526.1"
FT                   /translation="MEEIYQKPLPLSAPEENYQWCPTIYLISGISANRLQLSVFRVNSQ
FT                   KVWSVSLKSEIICQCWRPDGKIIAVSLKDGSIRLYDGNMGTLMYVIESANNTGGPTASF
FT                   LSWPNVKQIKSQSSEDSEPTLQEKLEKFFDFNLAKGLPKLTPLNNTDTVFMNKSLQDED
FT                   KYLTQDNTLNYLLTNYNNVISLSLLGFFQIASLVKFDSNDVILHHFESDDLSTLYFLYN
FT                   RDGSTLLKQISLNFLKQRDIVNLGLSYSKINSLIEYVNQVLKQLHHETKPYLDFNHKLL
FT                   DLLKEEIISSEGDETGISLLYGLLLTGIMHPCLKTWITDYLGDKNIRRWIKLAVNCYEG
FT                   NKKSLFSHLLPCLERIIVMLDELKGSTTPLTKQQLQKLLSGCTDLLQKTYLFIWKINHE
FT                   QRLFKYFIEWLDYVLLEYTTDDTPDMEIKTKEVTEFLTNHLTSSVMHAFLDDLSSLQNT
FT                   IRIDMNTITASFVEELKVKTDSKDFPLSITLPSSTLYSTNDSETHNNLKTIVLTNTPDA
FT                   LELISINLITADVQHRHFSFPMSVISYMHYSENSTFILASDGQATEFLKLTSIESSPIQ
FT                   LSRFSGDEFIPTSFKMTHKNEAGFLIDSNRKKYLYFKLK"
FT   CDS_pept        complement(912099..913067)
FT                   /locus_tag="PAS_chr3_0478"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70527"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4P1"
FT                   /protein_id="CAY70527.1"
FT                   /translation="MKEQLEKLASNFQKSCLDARTIEYSCQFFHKKFKKCQNPEKTARR
FT                   EYLQKALTYYNAQLSQMNETKHIPQELFNDIYSIAYFQNRPIAERCPRWWRQFMYATDE
FT                   PLQRLYINSLFKIEHRIYKDFKDIDDKETLREYDAYFDKQHNSPPVSILESFKDLYNSS
FT                   DQESTNCKNLLDGSLLQAFYKENGIEDLQVAFDEETNQNVRKLSLFTQSPLFKDKLYYK
FT                   RTNPPSMKIEFPGTVFGLPIALKRQNVKKRKKLQELRRFMLNVEPVAIDDLDYLDKSID
FT                   MDIDAKIKRKIQVWVRNKYALDEEGQFIRSRFCNRPADNVI"
FT   CDS_pept        913094..913837
FT                   /locus_tag="PAS_chr3_0479"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70528"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4P2"
FT                   /protein_id="CAY70528.1"
FT                   /translation="MYEMRSGKNAHYINTKTRKGKMRLSRVCVPVCKQDGILYSPQSLS
FT                   MPLTTTVYQDKENKLDNAKQSLTSRQSLGKQVKPDSQARPRTILGSTNVNSKQILDKRN
FT                   LIHPKQLTVLNENNLESQDEIEIVPTLDEPNLSDREADSETESEGITYSEPTTFRIEKF
FT                   QDLKPYTDSLYSQDYKHIPKLDSRELKKEEEDFLLQLDEQIEEDHQKNKEKLLPFPLHS
FT                   QNDSDLNIYGDLNVSNQELERMIFL"
FT   CDS_pept        complement(join(913879..914740,914802..915109))
FT                   /locus_tag="PAS_chr3_0480"
FT                   /product="Putative chaperone, homolog of E. coli DnaJ,
FT                   closely related to Ydj1p"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70529"
FT                   /db_xref="GOA:C4R4P3"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4P3"
FT                   /protein_id="CAY70529.1"
FT                   /translation="MSSLYEILGVDPSATQEDIKRAYRKLALKHHPDKVEESVRVESEA
FT                   LFKEISTAYEILSDEVKRSQYDIYGDTDGVPNRNGPGSGGVPGFGFDFDDANPYGADEK
FT                   TPDAVMEMEISLHDLYKGKVIKVSSTRSTICSKCSGSRLRKNADSNSMMKCMFCHGSGM
FT                   KRAMRPVQNGWAIEEYIDCSHCDGSGLRIQSKFKCKKCSGSGCVEESKILEFNIPRGAA
FT                   SEGEIILEGESDEKPNYKPGNVILKYTTKAHEYLERKGNDLYTTWKLPLCDCLTGFDYK
FT                   PSIKTLDGRFLMVNSPTGKVITPTTVLKVPNEGMPILDQGRNWLFKQNPKGDLYIKIEI
FT                   EFPKDNWFIERNEITKLRLLLSHDSSFPKTEISEGDLNNAIYAANIEFQ"
FT   CDS_pept        915864..917396
FT                   /locus_tag="PAS_chr3_0482"
FT                   /product="Putative alanine transaminase (glutamic pyruvic
FT                   transaminase)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70530"
FT                   /db_xref="GOA:C4R4P4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4P4"
FT                   /protein_id="CAY70530.1"
FT                   /translation="MRVNKFIRPCRHMSSTTVVSLGLKIKPDFQPAPKLTVTDLNPHTV
FT                   NAKYAVRGKIPTKAELLRNQLNDVDHKLPFTKIISANIGNPQQLDQKPLTFYRQILALL
FT                   QYPPLLDDPRVASIFPKDIIERARSLLKQIGSVGAYSQSQGVPSIRQSIADFISRRDGH
FT                   PCARKELIYLTTGASTAVTYLLTLLGQNEKTGFLIPIPQYPLYTATLTLNNRTALPYYL
FT                   NEEDNWSIECDEIESIILDSKAKGIDPRCLIVINPGNPTGAILSYEAIEDILNVCAKYG
FT                   LVVIADEVYQENIFDGKFISVRKVLLDLLQGPKADLYKNIQLASLHSTSKGISGECGQR
FT                   GGYMELIGFDESVLEQITKLSSISLCPVVTGQALVELMINPPKEGDESYKLYYDETRAI
FT                   HDSLAERATKLYDAFNSMEGVVCRKPQGAMYCFPKITIPEKAIKTAKELDFEPDEFYCN
FT                   ELLETTGICAVPGSGFGQKPGTYHIRTTFLAPGSEWINDWVVFHKKFMQKYK"
FT   CDS_pept        917546..918301
FT                   /locus_tag="PAS_chr3_1193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1193"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70531"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4P5"
FT                   /protein_id="CAY70531.1"
FT                   /translation="MSGLVSKWATEDSLAEKARVDDTLRRTKSKNVKQSGKLSKDQGLQ
FT                   SASDTPKKAKTFTKNEPLVSRWANVKDPALEEKSSKKVAQHESSGDFSKVSHAHNKDSK
FT                   RQPKREHHRSEAKKEPPSAPPVDLKTNSLAQRLGQVSLEPDNHKKEYVHAPRENNGSKS
FT                   SEGLKSNELAQRLGLVTAPKKKSPKKKTGGYKPPHKRDNKLEKQSESKAQEQEQDFALD
FT                   ETKRQELLELMEQYTSTQIDWADDFDDEL"
FT   CDS_pept        complement(918357..919766)
FT                   /locus_tag="PAS_chr3_0483"
FT                   /product="Conserved phosphoesterase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70532"
FT                   /db_xref="GOA:C4R4P6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR033307"
FT                   /db_xref="InterPro:IPR033308"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4P6"
FT                   /protein_id="CAY70532.1"
FT                   /translation="MLSNRRFIKQLANWVTAITILINIYLYTYPSFNSERCSWSTTEVR
FT                   TGSLTNWEGLVLQIPYFGDIFQQYFLDESKLEDNSDDIKILALGDPQINGNWPNTPYIK
FT                   RLDNFGNDYYLGHIYRTMKRRLLPSHVAVMGDLFSSQWISDSEYYNRTRRYMTRLFPQP
FT                   EQHTLDAMNFVDKHEDVDWRSFYGWMNGNLNDGSFLREEEYAYYDIYDWTEPRIKGEPL
FT                   FINITGNHDVGYGDTTYQHLARYRKLFGKDNYFIEYDNDTDHPWRIVVLNSLALDGPLL
FT                   QPEFQKYTWQFVEMLSKQNYPGQTILMTHIPFYKREGLCIDGPFVEYFTEENALEDYRI
FT                   GLLKSENHLQYETSQKVLNAVFQSGKPGIVLTGHDHEGCENFYSKDENNVWVADKTVKN
FT                   KNFYIKEATVRAMMGDFDGHAGIMTGHLNKSTGLWEWDYSTCPFSVQHVWWVGQVGIAL
FT                   SILLQSIGFLI"
FT   CDS_pept        complement(919911..922289)
FT                   /locus_tag="PAS_chr3_0484"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70533"
FT                   /db_xref="GOA:C4R4P7"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4P7"
FT                   /protein_id="CAY70533.1"
FT                   /translation="MSSTHVFNPNEDVNTAKQKKRKRATGHFECTYPNCSKTFTRSDHL
FT                   SRHRLNHNPTRRYVCSWEGCDKSFARSDVRDKHFQRHQQRNVLPSPTTPVSEKDGSSRT
FT                   MVKDGSNKDIFRWLLNTDYAVQDFLPGKVIEPLDSFFYFDVDRSPDSDIQDLLIGSKGT
FT                   DIVRQPVVMEQPDAAGKSQEKGLHSSYVPESGQKVSSDGKNNFNNSNGDPTLIDQTYFD
FT                   DVLRDKLIQLVPGLQYHADFEPVVIRYCLNVFWTVFHPQYPFIHRPTFKSAEAHPLLLL
FT                   SIIMVGLGFVNKNPDHRIDSISITDSYSLGNIIAHPLRWLICSSHEFTTPPELWIIQSL
FT                   ILLEIYEINFSNRKLHERAYLHHGLKTQLLRRSPLLGGDPLKNKQDDDESNTTNAQKWL
FT                   KRESMKRAAFMCFHLDTTHGAIFGHEMILNSHQIKFSLPCNENLWNQTLSGSEKIKPAM
FT                   NFLDVLKLLLKQQDPPSTLVETFDFSSNHLNENLKLSGLISVLFQLEEKDMELKLLEWE
FT                   SMKASWRDTLTLALDWWKDHLLSQKLSTFSNLSGNYCTGTSLLCEFPVYFILQTFMKMK
FT                   QYDFIIFTGAPTRMNVRVGMSDYTIVEKRIRSWSKSSAGSFSVVFLYLFLIDLLLVSDA
FT                   EKQDLEFTYDPNTDPILYRPNLVALSLMILWSYNFIQEGPESTVMANLKEGMDDLPMND
FT                   KDIPYQECGRDYLKRIRNELMVDENQLKLSSDLNTIKLYSKIITGMTHKNRMVGLLKFF
FT                   KKGFLNCTSTICREYGRLLENCISRSLGRRRILCNNMNQ"
FT   CDS_pept        922552..923895
FT                   /locus_tag="PAS_chr3_0485"
FT                   /product="Cytoplasmic protein required for cytoplasm to
FT                   vacuole targeting of proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70534"
FT                   /db_xref="GOA:C4R4P8"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4P8"
FT                   /protein_id="CAY70534.1"
FT                   /translation="MRKRSSSKSTSNYQPIRRDPPELTTKLHVVKLVPLNKSFELVKVL
FT                   VVPDYPKELELGRQAGSRAGTSLTNAYFASRTLSRSHASLFVKEGKLYVRDLKSSNGTF
FT                   INDVRLEHKKEYLLNVGDELTLGSTLESQPLHKKIQVKVEKFLTMNLQEYEDLVQGLVI
FT                   DNDERKAELFNDTLDALLFSDALDSEDKILDALVAGDPNLDSLEVEPTVPTPGVSPSPN
FT                   LKGITRLEDVTRRLIISINNENIQHQKLLAMGHFLDEYLNHEFSNGKSSSKETKQSGVS
FT                   QEDHDRLFKEMEKLALENELLKSQITSKDEEEDYDISSEEEMDDRRRLEKEIVESINSI
FT                   TNSKQNGKVATALTNLLEDVKGENVKDDAVVLAANESASERIHDEVEDSRHSQHEPYKD
FT                   CSIQTDSFNTVTPKDTVKNGNRNYLTIPILIAVIILLLAYNLRNNSSL"
FT   CDS_pept        complement(923950..925356)
FT                   /locus_tag="PAS_chr3_0486"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70535"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4P9"
FT                   /protein_id="CAY70535.1"
FT                   /translation="MFSIKNIAVALSTLAAVQAVALPSYEVALEHAARGLVPRAFAEAL
FT                   NPALEKRADFMCHAACGLAIYGAWECGPEEGPFDEECLCAADSSFSTQIDACLECGWCI
FT                   YQSYFGNLAGALDACGLPITPTGSTCIETATGLTPTLGPFTDYTPTHPNNVPTSSEEET
FT                   SEEPTEEPTTEETSEEPTEEPTTEETTEEPTEEPTEDETTEETTEEPTEEPTEEPTEDS
FT                   TEEPTEDSTEEPTIAPTGEPTEEPTEDETTEETTEEPTEEPTTEETSEEPTEEPTTEET
FT                   TEEPTEEPTGDDDTTEEPTIAPTGVPTEDPSSQYYGNTTTVHSTIRETSIIEYTTCVTD
FT                   VHGQTTTVTVPCHGKCTASPSVHSTDLTKTYTTTKAIVSGKTVTVTVECETTTPKVSTT
FT                   HSTTPVPGTTTHSTTPVPGTTTHATTPVVSSVSSTHAISSVTIQTHSGAANKLSIAGAA
FT                   IVGYAGLMLL"
FT   CDS_pept        926526..930008
FT                   /locus_tag="PAS_chr3_0488"
FT                   /product="Bud-specific protein with a potential role in
FT                   membrane trafficking"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70536"
FT                   /db_xref="GOA:C4R4Q0"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR017147"
FT                   /db_xref="InterPro:IPR031468"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR037756"
FT                   /db_xref="InterPro:IPR037761"
FT                   /db_xref="InterPro:IPR037762"
FT                   /db_xref="InterPro:IPR037765"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4Q0"
FT                   /protein_id="CAY70536.1"
FT                   /translation="MKKRQQKREVHNTSFTGWREVAGWEPKDTLTADDELMDLLTKQTF
FT                   LENSLPEIAYGDWYHNFAALVLGATLCWIVGRFKLSLALVFFIVLPLALYYRTSIRKFR
FT                   GFLRRELQREFVVRNMENDYETMNWLNVFLDKYWIFLEPGVSKMVCEQVNPILANSPAP
FT                   AFIKQLWLGAFTAGTKPPRIDMCKTLAGTNDDVSVMDWGVSFTPNTLADATVKQMRNRI
FT                   NQKVIVKLKLYGLTLPIVVSDISFRVLLRVRLRMMTQFPHVRTVNLSLVNPPEFDFSCR
FT                   IFGGDSILSFEILSIPGLKFLIDDMIKKYIGRMLFDPLSFQLNVPMLLAGEAFGSPSGI
FT                   IEINVKKATHIKAVDTSGGNTVDPYVIFSFGGKEIARTSTIEDTREPIWNETIRFLVSD
FT                   FSEPLHLDMYDFNDFRKDQLVGNILYDLGAFMDEDELSDLELPILRNNKRVGTLHLDMK
FT                   YMPIIHGSTLPDGSFDPPPELNSGITSLTVVGARGFNESDKVISVTAEVYLNKELINKT
FT                   GAQKSNDPKWNSLVHHMIDNRADSYIDILLRDGKKNVIGALHRRLIDVVDSSIVGYSWF
FT                   PLNEGGEVELKASWGPVELPGGEKADSYVEPIGVARIFVDSCTGLPNLERIGVIDPYVR
FT                   ILVNNFQRCRTLVQNSTVNPVFKEVLYVTVASPNQKITIEAMDVEKNGRDRTLGAVALN
FT                   LAEFVGKNDEGKYIESRSDETKEARLISSKGVKGTIKYSIDFFPTIPVVSQNELNKKAA
FT                   REKEKEEQKKKLEEESEGKAEELKKAEKEKAKTLALLEELEKEQEEHKLNLSFDELIKY
FT                   QQGVFVYDIISGDFGHESGYLQVYFDQNGYSQFTTRKIRKGGKHRLGVNGDYLVKELEY
FT                   SQTVIRYVKDFSANRLKNSMAEISLPTIQLLQRSYDKPYLLKLPGQSGTISIYLQCSWI
FT                   PVLMSQLPSQDSIGNSGQLSVTVLKGKDLPSADRNGKSDPFCELYLNDNQVYKTKKIKR
FT                   TLNPEWNESFEVEIGNRCGSILNIDCIDWDVASHNDKLGSGHVSLADIDPMSPTELTVP
FT                   LKDDDGLEAGEVYLRFVFRPKFVILLRPETTAFSLEAGERVLEAGVGAGGKVIGAGVGA
FT                   GGKVLGAGVGAGGKVLGAGVGAGGKVLGAGVGTGGKVVGRGASLLRGLRGSEK"
FT   CDS_pept        930166..931545
FT                   /locus_tag="PAS_chr3_1194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1194"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70537"
FT                   /db_xref="GOA:C4R4Q1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010111"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4Q1"
FT                   /protein_id="CAY70537.1"
FT                   /translation="MSYSAKDIEVLDKRFPSLKDEFHIPTFKSLGITPPESKSENDDSI
FT                   YLCGNSLGLMPKATESAIFEELAVWKGKGVEGHFQHPKTPWLDIDLPVVPLIAPIVGAK
FT                   ENEVAVMGTLTMNLNSLLCSFYQPKGRKRKILFEKHAFPSDFYAFLNQAYLKDLSEDDL
FT                   LQLEPRTGEYTLRTEDIIKVIEDQHEEIALMCFPGIQYYTGQYFKMKEITKAAHEKEII
FT                   VGWDLAHAVGNVDVRLHDWDVDFACWCSYKYLNSGPGGIAGVFINERWTDQKFHSKSSP
FT                   LNYFPRLAGWWGNNASARFSMKEVFDPIPSALGFRQSNPSVVDVVALHSSLKIIHKFGG
FT                   IKAIREKSIEMTKLMEVLLKRSPHYVKPTELLSRGFTIITPHTSLERGSQISLLFADGW
FT                   MPIVFEQLHSLGVICDERKPDVIRLAPVALYNSFQDVISAMEKLKASLDVASNAVMTVI
FT                   T"
FT   CDS_pept        931826..934387
FT                   /locus_tag="PAS_chr3_0489"
FT                   /product="High affinity sulfate permease"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70538"
FT                   /db_xref="GOA:C4R4Q2"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR018045"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4Q2"
FT                   /protein_id="CAY70538.1"
FT                   /translation="MSDSIYERGGELPLEPQHFKFANDESVKIAGYEDKQVGPLDVLHE
FT                   IVDSPWTRFKDYLISLFPILRWILHYNLKWFYSDLIAGVTVGCVMVPQSMSYAQLAGLT
FT                   PEFGLYSSFVGVLIYCFFATSKDVSIGPVAVMSLQVGKVVAHVQEKHGDLYPAHVIATA
FT                   VAFICGVVALGIGLLRLGFLLEFISMPAVVGFMTGSALNIVAGQVPGLMGFNKLVNTRD
FT                   STYKVIIETLKHLPDSTIDAAFGIIPLFILYLWKYVCDFGPKRYPSKQKWFFYTSVMRN
FT                   GVVIIFATLVSWGAYYDWTHNKYPGGAKKVPWSILGTVPSGLKHTGVMEMPNGIFSAFA
FT                   SQIPVSVIILLLEHISISKSFGRVNDYKIVPDQEVIAIGVTNLLGTFFSAYPATGSFSR
FT                   SALKAKCGVRTPLAGVYTGVVVLLALYALTEAFYFIPKASLSAVIIHAVGDLMAHWRVT
FT                   WDFYLIAPLDAAIFLICVLVSVFSTIENGIYFAMAASAVTLLWRNLRTHGQFLGRIKVA
FT                   EVIDPIVVSRSGRSEYSESSSSINEDTGSIEKKKIHIKFFSKDGQNSDIELQTKEYSKE
FT                   YPSDQEFDPSNFDLSKLPKRTRFATRWVPIPKSKFPLSSSHTYANYINEEIEILPPPTG
FT                   VIVYRPGEAFTYLNCSRHLDTLLDYMKSNTRRGETVVYKVKSDRPWNDPGELTWNFNSV
FT                   KNIFKRKKNIDSNEDEIEVVEDNRPILKLIHFDFASVTGVDVTSIQALVDLRKAVSRYT
FT                   GRDIEFHFSGIINPWIKKSLINAGFGKPFQPLKGSTIDNAVSSEHRYYDIGTSYDEYDS
FT                   TFSAETYDDAELQIGRHRYYAVNSTETPFIHLDIPSYDYLE"
FT   CDS_pept        complement(934468..937152)
FT                   /locus_tag="PAS_chr3_0490"
FT                   /product="Zinc-finger transcription factor of the
FT                   Zn(2)-Cys(6) binuclear cluster domain type"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70539"
FT                   /db_xref="GOA:C4R4Q3"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4Q3"
FT                   /protein_id="CAY70539.1"
FT                   /translation="MQVLATLHKTLLFSIVINESIDMVPTKKKRSFYGCWTCRSRKVKC
FT                   DNGRPSCQRCQKSNLNCLGYNIKLSWSTPYTVGKHGTLVPLSNYVLDKEDDSIQRRNIS
FT                   LVRFTSDSTYKNDKDLDLVLDELEQLPVYGNSPNKRGPFMVFQASTDHKVKTETNTSIP
FT                   NDSSKDLFSIRSLSSTNLVPYMTMDVVDVINQNRDFVLEAFDSNFVHQDAFTHALNTTL
FT                   EDELELHHSAPASTFPERDRIVIHEQLKPSALVTFKGIKGDINSNPRDEQEVLDCLFPN
FT                   YYNSEANHSILEMSLSRNQELNNLDKTYKLFENLSHSHISSIREYSFPWLLSTQMFQKL
FT                   ITNFQSEKHFMMLLTFRGNVMDSVILPVLYRAIGQMSILTADIEHEFGRIISSEMFHKR
FT                   MMRIMVLSALNISAFLLYRKSLFEQNFYGSDYLEIAIVLRRFIILELSNLIKCLLVPSG
FT                   VPFKDAKRKLQIKNGKLVNYLITNDLIKELIVVLVFFIKIDELFGIIDNFTTLFDILDQ
FT                   LVDYLNNYKPSFYENADMLEKNINLKLIIMYYKFMQIFFFSTTNIDLFNYEVKDKNFED
FT                   MLDENYNKISAATLNDSFNPDAFFNIDFLQEEVSVSEKQNKSFLSKSFPARFNFAKGYS
FT                   DSEEESNHNQTGSENRYYTKDNENSRVANSPTIKESLIHIPYPYNESVYKYRDESIVST
FT                   LELTYGMPETLFQLFKKTVTLTNHHSFFKRRNLKHPRNFSKVASDLETELKSWTLPWIL
FT                   YESSDTISISFLSTFHRILFHMSMSYYNSILIYFYIFVQDFKASDLSSLVQESLTHLEA
FT                   LVSLSVSSNVVKDFTVHVPFWPFFVCACGATLEADQARAVALMKNFKTNERWIGKQLIH
FT                   AVWEKHRQKFTDTNWVTMTKVGT"
FT   CDS_pept        join(938969..939053,939097..939356)
FT                   /locus_tag="PAS_chr3_0492"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70540"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4Q4"
FT                   /protein_id="CAY70540.1"
FT                   /translation="MLLRSTQKTLVSFLTSHDAVNDTKAGMQRCLRKFKPRSFDAKLTT
FT                   GVCLALKQITQSRKKRPACGMLRLLSVHTSGLVLEGYPRVECAPPQLAKRAVRHTKEEN
FT                   SGQVTCLKKV"
FT   CDS_pept        940342..942600
FT                   /locus_tag="PAS_chr3_0493"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70541"
FT                   /db_xref="GOA:C4R4Q5"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4Q5"
FT                   /protein_id="CAY70541.1"
FT                   /translation="MAHEKAGKEEKHSSTQKNTDLNLYEQSQQPSQPQQPFIRHQSIPN
FT                   FSQLQYPQQWQYQTYQPSPAFNPGHGQPTHMYESSSSHQSSQLENLPGGAIGGRPQITP
FT                   LPPHSLPLQQQHPQPIVPGQAFGVPMYQQFPQNYVTQDTLQPKSSLSLMVNPPAATKSK
FT                   QDPRAKVACIRCKKRKTKCTGGNPCKLCSISKVKCVYQTPGKRISILESHFRSLQDRIK
FT                   FLENELHIAKDQRSDPSRFKAIDRALDSFTNERLYSMIGSLHFMFKEFVLSTDISTLFE
FT                   AVDNNVNAFQPNEGTEEKKDNELFFKSVLLCIVAISLIRDAKLSQHVSNSTIINLSHEV
FT                   VYENPEKLPGFVYIRDALSIVPLMCISSEQSQVVELLTLISYYFLCSGHNEIAYKYSAL
FT                   GDKICTVAKLYINKDANQYRRKVFWNCYSFTRLLTITHLYELKPNLTQSFRFSEIDIPQ
FT                   PMLSNSNSLEVSSSTISTMFRHRADLANISEQLINLFSRNPPQLSTSSKEWMLNGYVRE
FT                   FIFEALLEQVPFLLDWTQDFQITSFPAFATTGQHYCVMILVHFFGPLLIFGVGSLIKKS
FT                   VWPNIESILILSLRLYPVLQDDSSSMLRCHDFFKFMIVIIVRTLQLHQYGYINLQKQLH
FT                   LENYLLINLNQLREYDASSFAKTLDQLNLFSSRQKLSFVDRLPKPKNKKYPLRMDYMDP
FT                   SSMENSIESLFVGDKDQCLYKLRQSKPEFLSCYTNEWFDTDRIWAHLVTEEQLTPHQS"
FT   CDS_pept        complement(942872..943639)
FT                   /locus_tag="PAS_chr3_0494"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70542"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4Q6"
FT                   /protein_id="CAY70542.1"
FT                   /translation="MALTKKPVIKPIFISNLDQIEKVEKVEKTREQALNDIREKLKSNK
FT                   LKQEEKAREEKEKQATVMSWSPSPIVAKKSSSWGSQSSGSSGSGTESPAIRDFRRKQSR
FT                   ELFGDFKLNIPLKQSKSAQSIMVLNSDNSSNSSKRPSFNKGRSESVLQFTASNNKLDSI
FT                   WLHKMTTISRQHSVVSSLDGQDPNEEDDIMEDVEQFHVVSGTTTPLDIPSSCHHSPGDS
FT                   EYLDDADFVAVSPKSQPPSMSDLADYYNQNQFL"
FT   CDS_pept        944090..946534
FT                   /locus_tag="PAS_chr3_0495"
FT                   /product="Low-affinity phosphate transporter of the
FT                   vacuolar membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70543"
FT                   /db_xref="GOA:C4R4Q7"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4Q7"
FT                   /protein_id="CAY70543.1"
FT                   /translation="MKFSHSLQFNAVPEWSTKYISYSTLKKLIYSLQRDYVNSGALSKT
FT                   TTPYDSEQEPLRSRFKDSDPVDVFFKALDKELRKIDTFYKQKEKHIYKDFDEIIREIEE
FT                   FESSYKNSTMQDEPVRKRLRDLIGTIKSNDFATDETGAVSSSRFSINSANDSNCHSYDN
FT                   LKSLVQRRTSRPELFDDDDFNLDFSTQVTITTKKSLTGIYVALSELKSFIELNQIGFSK
FT                   ALKKFDKSLETEVKAEYLAKLPEVSYIFKPSTLDTLNKKIASVISIYSLLVTDSDFNLA
FT                   KSELRSHLREHIVWERNTVWRDMLGMERKTQAANLEEVKGTPDGIPIASSINVSLGAGR
FT                   YLRIPIILVSQTVLKGSAIAFLSILLLFLSPFEDTQQKNCFAILVCASLLWATETIPLY
FT                   ITALLIPLSIVVLGVLKDPYDDHVLTGEEASKYIFSQMWSSVIMLLLGGFTLAAALSKY
FT                   HVDKSISTWILSKAGNSPPIVLLTIMGVSLFASMWVSNVAAPVLMLSIIQPLLRTLPTG
FT                   SVFAKQLILGIALASNIGGTASPIASPQNIVALESMDPQPSWGEWFIIALPVAVVALVL
FT                   VWILLLLTFQNQKHLNLVSIKPIDAPFSFAQWYIVFVTMITIILWCLQSKLSYIFGEMG
FT                   IIAIIPIIAFYSAGLLVTEDINNYPWNIVLLAMGGIALGKAVSSSGLLAHIAKAIQAQV
FT                   MDLDIFSISLVFGLLVLVVATFVSHTVAALIIVPLAAEIGNALPEPHPRILIMITALMC
FT                   SMAMGLPTSGFPNVAAVCQLDEIGVPYLTVGTFITRGVPASVICYGIVILIGFFIMKII
FT                   NF"
FT   CDS_pept        946671..949340
FT                   /locus_tag="PAS_chr3_0496"
FT                   /product="RNA-dependent ATPase in the DEAH-box family"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0496"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70544"
FT                   /db_xref="GOA:C4R4Q8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4Q8"
FT                   /protein_id="CAY70544.1"
FT                   /translation="MSEGTGGVSIRRQHINWSDDSDDEQKKDTKLESVDDLDDDEKQRD
FT                   EFSKRLKDQDKTANKAPKPRADDTTDMKELRRLAREQYLTKREKDKFLLLKREVNELEE
FT                   DVAKYGWENLTEKERSEISFKKEILEIFEKRSELLKDGENYQLPDDSTADRKRKADVLY
FT                   SKEKYEATKQTRDQAWESQQIRMATTGKELNLEEFSLPDSKNYDFVFDEKFHVNFTGNS
FT                   EEPAIKQAEQMEIQDLKNQEIRNIQQTRESLPVCRYREQLLEAIKDHQVLIIVGETGSG
FT                   KTTQLPQFLHEAGYTKNGKKVGCTQPRRVAAMSVASRVSKEVGCPVGTTVGYSIRFDDR
FT                   STDQTVIKYMTDGMLLREFLNDPELSSYSAMMIDEAHERTLHTDILLGLMKDICKYRKD
FT                   LRLLISSATMNAEKFSKFFDDAPIFNVPGRRFPVDIHYTIQPEANYLQAAITTIFQIHT
FT                   NQKETPGDILVFLTGQDEIEYMQENITDICRKLGSKIQEMIICPIYANLPPEMQQKIFE
FT                   KTPPNARKVVLATNIAETSITIDGIKYVIDPGFVKENVYNPATGMESLVVTPCSQASAD
FT                   QRAGRAGRVGPGKCFRLYTKWSYDNELPKNPTPEILRTNLTSVVLLLLTLGINDLLHFD
FT                   FMDAPSPEALMKSLELLYSLGGLNEKGRLTKTGRQMAEFPTDPMLARTLLASDQYNCVQ
FT                   EVLTIVSMLGESSALFFRPKKNKAMADKAKQAFVVENGGDHMVLLTIFNQWVDTGYSYQ
FT                   WCKDNFLQFKSLSRARNVRDQLERVCDRVEILNHKEKSEHGISNPGQDSKNSKLLPIQR
FT                   AFIAGFFPNTAKLSKSGTYKSLKENQLVYIHPSSTLFKAVPPPRYVIYHELVLTSQQFM
FT                   RNCIPVEERLLTPYLNRM"
FT   CDS_pept        949500..951038
FT                   /locus_tag="PAS_chr3_0497"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70545"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4Q9"
FT                   /protein_id="CAY70545.1"
FT                   /translation="MKDDCDKLSSEMAHTRETEAERNEKRRKVDRQFNIGTANTYFNEV
FT                   DDYMISSFTESSDRIVSQRNSMPSSPPRIDELDSLSSSSPIDVVAPESQPIPMQLTFSQ
FT                   LARKNLSSEDTLELDIDNYGRVSGVRNCELYSTSPTKDHDMGHREFLYKDSAEAQREAV
FT                   KVLRMVFDEDNENKIDLERFGLTSIPDEFEDFKDSIMVNDSGHLSSPQLHVFLGHNHLS
FT                   SLSHSLFQVPFIDVLSLRFNHLTRIPGNIKKLTQLRYLALGNNNIVHLPHSILKLDKLQ
FT                   VFSLRPNPLKEPSEGDIELNLKPGPRYASRIRWSNKRKSSKIMPRLNKAYSSFGGDLSL
FT                   LEKSTSSPKSVLEQERGPYLSPNRTPNLLNEQTTISEAFADERDFDSQEQELIKNSTSY
FT                   VPRLTELALRCISNYRISISEAKQWKKSTSKYILKMASKALIQGTNGESCGSCENIIIE
FT                   PVAAVYEWWDIADAKNVPIRRHFCSKMCAIKWESAIQEMTEGTHKKGSSQINST"
FT   CDS_pept        complement(951020..952141)
FT                   /locus_tag="PAS_chr3_0498"
FT                   /product="Actin-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70546"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4R0"
FT                   /protein_id="CAY70546.1"
FT                   /translation="MKVDWNDVKENVIRAPQIFLQRTNLASTNPSLIDDEIIGLQTNFK
FT                   NLVTNCKHLQVSLKRYEESAKFMVECGLQTGQSLKSLVADTSKTRSEIDSLFLNKINQY
FT                   NMVFQDCKPIVIEVLTSLNDRVGSRLKQLESHNKEVASLLRQREYALLDLNKEMLCLER
FT                   LKAKGNLMTCKEQQKIFTTERKLTVCERNFTKLNRVIKQELPVYLVISKSIIENILQVI
FT                   YFGTLTVFYELQNKLKSLERDINLHDADQSHYSTTTKNMELVSVFKAKHAPVALQVDSL
FT                   KICHFYEKNLRNVASNIPSASTIVTNYSGLKIVQEDKDLVCVAGYNFEKINDQDLSFKR
FT                   GDHIKVLKQEGSWWKGELNGKVGNFPSNYVELI"
FT   CDS_pept        complement(952246..954486)
FT                   /locus_tag="PAS_chr3_0499"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70547"
FT                   /db_xref="GOA:C4R4R1"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4R1"
FT                   /protein_id="CAY70547.1"
FT                   /translation="MSDKDIPSSLTISPWSIKPAAKKKKISQDKTNSSTAPNTHLYGKV
FT                   IRHDKEKRNKACNSCRKSKIKCESSLEQDNAPCKRCLNHGLQCVYEYKIPSYKVIGGSS
FT                   VNEVLDNSKNNFRPTEKADISKILNPQSSQVLTTSTNQASETPIQNSNNQGWKSSVENR
FT                   LQNFDSTLTDILSLLRDRQNGKSQEPSISATIDSILTLEDAHILFDYFDTNITPQLFGF
FT                   DLSSYSVNELRATSPILFITICCISSIHHIDFKHIHESLKGLLEKLSQDVLQNPPNNEV
FT                   EAFNTIIALCISGFWFQKNQIFTGLALQLAKNMNLNVPVRKNKRKRRNSNSRSISDKDR
FT                   LKLWYLLFILDGHQSLAFNRQPLLSSNDPALTHSRQLLSSESVRDKYCEALRENPSTEL
FT                   ILNGSPPGSSSDTDSPSKVTNGSSTSDQSHELKYSDLRLVSQVEYNQAISEVFRGNAWD
FT                   LLTPASFGIPFKSNVELDKWMVQWTVLLSPMHSNNIWSSKSTLIYYNFAKMHINSLSVR
FT                   KLHTDGSSFPEWKDDEDEDDESLSNTEYENKRAQVSICKENSHSSDSDDSDSDDEFITH
FT                   SPVVSQRESLKVSSQIAVSAAETVLNLVLSDNDIISALRFVPVHVHVMLYYAAMLVINS
FT                   PTLLRTHFTGSKNHKGKKEDPNLTAVKIVKKLRNLIYHHKPIDRKFAEIVILGLDKLLA
FT                   DKHSTLKNESSVDPSTLQKVFNVLHEDEINFREESKLAEKIFAWPGTNHGHP"
FT   CDS_pept        955489..955899
FT                   /locus_tag="PAS_chr3_0500"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70548"
FT                   /db_xref="GOA:C4R4R2"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4R2"
FT                   /protein_id="CAY70548.1"
FT                   /translation="MAFFGNRTYLVVGASKNPEKYGYKVLKWYLDRNLNVVPINPTTPE
FT                   VLGAKTKSSILEALANGHEYSLSVITPPDVSYNSLKEVLESVKGDLVKSIWFQPNSYDE
FT                   KLISYLNKKGFYKNKGNLIYNDCILVSGDSKI"
FT   CDS_pept        complement(955906..956580)
FT                   /locus_tag="PAS_chr3_0501"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70549"
FT                   /db_xref="GOA:C4R4R3"
FT                   /db_xref="InterPro:IPR012445"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4R3"
FT                   /protein_id="CAY70549.1"
FT                   /translation="MDFNLNIHTSLDIVSDHIEALLWTILFQRLFGTISPSQSTFLGIT
FT                   YPKVELPILQTLIDSKISQFKRDIMESKTLSQNDHDDDNDNQSLEDETELGSFRLSFFE
FT                   KFSKRDSKNTLLKFWTNETKESSEDITGIVNDDIQRGSFQDCWETWNLTLYISSGKDYA
FT                   NSFLESMFQILDITDINKSHIPTIRSVAIAPFPFKIAYLVKKDSSIGSSMEYITEKDAQ
FT                   EE"
FT   CDS_pept        complement(959753..962482)
FT                   /locus_tag="PAS_chr3_0503"
FT                   /product="Zinc finger transcriptional activator of the
FT                   Zn2Cys6 family"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70550"
FT                   /db_xref="GOA:C4R4R4"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4R4"
FT                   /protein_id="CAY70550.1"
FT                   /translation="MPGTYKFRRSYKACLNCKIRKVKCDLGPLDNQNEPPCAKCRREKK
FT                   ECVFPESRNRKRRSVVENQDQEYNQELYPHEKSRRTSQEASESHKYTSSNLGHPGPVFP
FT                   PPSNINNLLNNSERNHYENHPPPMSQRLTVPSVTHNRKLKDDSNSSSTSELNNLDFKTS
FT                   QGTMVFLASAAGEIARADERDHIDALKRHQQLETSFSQTQNLQQDMHGTRGESTSNQSA
FT                   DERHTMPPLESSSSVRPKPSSTLADIDYIGPTKVLTETQARRLISLFFNTMHPFFPHIP
FT                   SEMHSADCLAGYPILLCAILTISARYHKLDENDDASSSNNIQVHEQLWVYCQRLISQTV
FT                   WAEASTRSIGTVFAFLLFTEWNPRAIHWRWSDYANSDTGELAPLKEVVLAAEEGGSVTG
FT                   LDAMRRSDRMAWMLIGSSVRLAQDMGFVEHDSGVFLATHIAEINTAMNINRRSMLTSSL
FT                   HEIDILDHDSQDPSFENEPLDLVVIKEKQKRNMVNPDDDRPNSQPVTNHLKFTKMQMAK
FT                   LELLQITSICYESLYGKDPKFSGLDKHQNLALLDILSPLLESWYRRYHRLLVPSSPSYL
FT                   AHNNPRKQFLNQSPEFYAELAILLDRESLIFDYYYAKLYIFSLALSPEISKSSISSRKQ
FT                   KQMKLDDIAKSSKYVEMAFNAAKEMLSVTHRTHKLRILRFMPVRWLTRIVRAVAFVVKC
FT                   YLTLTSPVPIAPREFNPSNILHDAVNSFNGSKTDDTSSNYQSAMFSVIPLDEIIAVIQR
FT                   AAISLREASPDELHLCTRYSTILMYLCTQMKARNKNNGKVIDYEAEIQNAYKDAEKVRQ
FT                   SGLDSPANGLSPYASERSSKQKDHHYNLTEPINSPSQENTYDDNFSQMMNPSETVFNWF
FT                   SNNDFGVGLEFVDAWTQELEQDYLQKISENPGNSAGNS"
FT   CDS_pept        complement(962741..964078)
FT                   /locus_tag="PAS_chr3_1195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1195"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70551"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4R5"
FT                   /protein_id="CAY70551.1"
FT                   /translation="MIRSSITHSKIGPISKMFLRRFSTNGSVWNAYSPIFKEDENLKDL
FT                   RTSKFEYKSLYQPLKIDSFTSEIENSSEKVDYYSHCLREEMKHYGNSEFQDEDRLNNTS
FT                   SLPELRMIKTKNQAFETYLIENPNVDPKSTVTKMKQYVKFAVMFMKFFKLGVMNVWKNY
FT                   RLNRKEFYGSYYMVDPKNENAKLKVKNLNSVIDELHTVINCERNVRNASEQRRVLNKGG
FT                   TQDLFPKIELSRSTLQRVLRTRADFIKLPLFAVLFLLLEELTIGLCYIFPEIVPSTCEL
FT                   PQLNHRFFYQQSKSQKELLELRQNAPKSELFKKTPYNISCKELFVLSSVLKTKSSLIPT
FT                   VLYPESYLRQALLRKLKSLNVDNYLIVRDGGVWKMTNLEILRSCIDRGLVDFSKELNPN
FT                   NDPQSEEQKSHYELIDFSTLRFRLHSFICEMNRSNNHASVGLLGMY"
FT   CDS_pept        964689..966506
FT                   /locus_tag="PAS_chr3_0504"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70552"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4R6"
FT                   /protein_id="CAY70552.1"
FT                   /translation="MYNQYGNIEYLEPMHGNSNGVLGHQSSFQHGAGLYQDLPLDQNLV
FT                   RMSPYGTVPQDPLLSVSHDPVATIEGPPIGTFQNNTGKSSMQQSPLGNQSGLASDQPHQ
FT                   SLSQQDPNARQKTAFNESPENFKASQIQNPVGTRELTEHPHIEQSSQVQPMQQVSYMQS
FT                   MQPLQGYQHVQPTQLADQSQHVQIHSQLQNVQPSYPYSVFPSPQTNLIGVTEFPPNAMH
FT                   SPNSAVPYTSSISQQHSYTDTLNLMDMNDNATPLVPFPEDLEDIFADGPLVDVPTSNEE
FT                   GSSRSLLDQSFIFDFDTSNLHDEPLSNNGLGITTSREKQSSLQPLAYNKKRVVGPMTLK
FT                   PNVSNRSMKIKQRILSDSSVLEQHGIQKFDKPPMPYSMDVSSAESSPREKSSTSPILEL
FT                   GGGIRKNSIKPLRKSASQGTLTQSKRSKMKPIGERLSFSEYSSTLELSGMNPNLSNQAS
FT                   RRQFSFVIEQPNRTKEKRKINHSRNSSAGNKSLPNWSDAGSATTSPKFDPSTIKHRTTS
FT                   TESSPVTPLSATVSKFQSLKTHDEVELESLPEDLPYHSDRKKSLSEQESMGISHQPVIS
FT                   SFKRMDSHPKTYNTIQEGMNQFQVIINKR"
FT   CDS_pept        complement(966731..967804)
FT                   /locus_tag="PAS_chr3_0505"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70553"
FT                   /db_xref="GOA:C4R4R7"
FT                   /db_xref="InterPro:IPR007526"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4R7"
FT                   /protein_id="CAY70553.1"
FT                   /translation="MDSILTNRCLTPVSNHETFNLVGGSKSLTSAETRKNSDERSSISI
FT                   PSPPLSPYQRSLDVERDHKIFDVVGRSNDQIVGDFEEPATKTQTEQLEEGKPDDAPKIS
FT                   SSVLLSNQTFPIKDLTNAKLTVNAWASINSGDSSFKENQLVFLDSYYNIIDTRKKRAPR
FT                   RKYPTAQPRRRVFFSASESETPNERVRTRRVIRDNVKYSDYESEVEISRPSTPKRSTKR
FT                   VSKPSTPQPQFYSDYESIPDYSPPLSTLPPNNTKALKAEWKGQPMNLSDDPLVGKLHPA
FT                   EVTLASVLRLPCNVYLDSKRRLFSEKVSRFRLGLPFRRTDAQKACKIDVNKASRLFAAF
FT                   EKVGWLDDYHFRKFLDM"
FT   CDS_pept        complement(968316..972953)
FT                   /locus_tag="PAS_chr3_0506"
FT                   /product="Pentafunctional arom protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70554"
FT                   /db_xref="GOA:C4R4R8"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR008289"
FT                   /db_xref="InterPro:IPR010110"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR018508"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4R4R8"
FT                   /protein_id="CAY70554.1"
FT                   /translation="MSGLIEKVSILRNDSIHVGYNMSSHIVDEILTKKASSTYVLITDS
FT                   NIVKMGHLQTFVDEFNRLIPSKRPGSRILTYVVPPGEANKNRATKAAIEDYLLEKGCTR
FT                   DTFILAIGGGVIGDMIGYVAATFMRGVRFVQIPTSLLAMVDSSIGGKTAIDTPLGKNFI
FT                   GAFWQPDYVFVDVAFLETLPEREFINGMAEVVKTAAIWNEQEFSRLETYSKRFLKVIRD
FT                   RRVDDSVDLTSLKEHIIKLVLESIKVKAEVVTLDEREGGLRNLLNFGHSIGHAIEAILT
FT                   PQALHGECVSIGAVLEAELSRYLGILSPVAVSRLYKCFAAYGLPVSIADKLVQKRTNGK
FT                   KCPVDVLLQKMAIDKKNDGSKKKVVLLSKIGKCYEPKASYVNDEDLRFVLTDEVLVKDF
FT                   NSAPSTAVVVPPGSKSISNRALILAALGKGECKIKNLLHSDDTEHMLNAVAALKGADIS
FT                   FDDNGETVVVTGNGGNFTATDAEIYLGNAGTASRFLTSVASIVKPDSNTTHVILTGNAR
FT                   MQERPIGPLVDALRTNGSDIEYLNREGSLPLKIKSGNGLKGGRIELAATISSQYVSSVL
FT                   MCAPYASEPVTLSLVGGKPISLLYVDMTIAMMKSFGIEVTKSTTEPYTYHVPQGHYVNP
FT                   AEYVIESDASSATYPLAFAAMNGTQVTIPNIGSSSLQGDARFAVDVLKPMGCKVEQTAT
FT                   STTVQGPTKGTLKPLPLVDMEPMTDAFLTASVVAAIANDTNQSTSIVGISNQRVKECNR
FT                   IEAMITQLAKFGVRAKELEDGIEVFGIDYHHLKTPSDGVYTYDDHRVAMSLSLLAGLAE
FT                   SPVLIQERHCTGKTWPGWWDILHTTFNVELDGHEAVVETTTAKANEDKSIIVIGMRAAG
FT                   KSTLSHVIAQTLKGFKVVDLDDVFVEKYGDIREFIKENSWELFREKEAMIAKEAFKNYS
FT                   KNTVISTGGGIVETEASRKLLKQQMKDGHIVLHLHRDIEETVVFLSQDKTRPAYVDEIN
FT                   QVWERRKNLYKECSNYFFFSPHCQTEREFFTLKKTFSKFINRITGGAVPSIPNGRSAFV
FT                   CLTYEDLAPVSSKLTRVTNGCDAVELRVDLLKQHDSHFISNQIGILRNQTSVPILFTIR
FT                   TKSQGGRFPDDSYEDIERLLNLAIKLGVEYVDLELSLPESLLDSVASKRQFTKIIGSHH
FT                   DFSGTVKWNNVEWENKYLLALKLNVDIIKFVGTATSLNDNWELEHFRSLHTDKPFIGIN
FT                   MGPLGKVSRVFNTILTPVTHKDLPSSAAPGQLTLKEINEYFGQFGGSSRKKFYIVGKPI
FT                   SHSKSPELHKTFYDEFGLSHTFDKFETDDAAKVFNDLVKGNDELGGCAVTIPLKIDMLK
FT                   YVNELTDSAKSIGALNTIIPIGDGRFIGDNTDWIGIRDSLHQAGCEIAPESSVGLVVGG
FT                   GGTSRAAVYALHQMGCSKIYMLNRTPSKLSEIKNHFPSNYNIHIVDSLDAIDEDDKLDA
FT                   AVSTVPGDKPLDDQLISLLKKLLEKKRGHAVLLEAAYKPRETPIMALAFSRGWKVVPGS
FT                   KMLVNQGIEQFYKWTGYQFSSHIDL"
FT   CDS_pept        973556..975142
FT                   /locus_tag="PAS_chr3_0507"
FT                   /product="C-22 sterol desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70555"
FT                   /db_xref="GOA:C4R4R9"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4R9"
FT                   /protein_id="CAY70555.1"
FT                   /translation="MSQVISSYSGSNSSTIAGTISHYAQSVINDFTWWQAALAIIVGVL
FT                   SYDQIMYQIRKGNIAGPKFKIWPVIGPFLESLDPKFEEYKAKWDSGPLSCVSIFHKFVV
FT                   IASTRDLARKILQSPAYVKPCVVDVAVKILRPSNWVFLDGKEHVDYRKGLNGLFTKKAL
FT                   EVYIPAQEKIMDDYLNRFAEMSKEKPMIFFHEFREIMCALSLKTFCGDYITDEQIKLIA
FT                   DNYYKVTAALELVNFPIIIPFTKTWYGKVTADDTMKIFESCAAMAKKHINEENGKPTCV
FT                   MDAWIDSMKQARESKSKDPDAKLLIREFSNREISEAIFTFLFASQDASSSACCWMFQLI
FT                   ADRPDVMAKIREEQIRLRDGDINKPLTGELIDSMKYTFMVVKETLRYRPPVLMVPYVVK
FT                   KSYPVSDNYTVPKGAMVIPTLYPALHDPEVYENPDDFIPERWVEGSPANQAKKNWLVFG
FT                   NGPHVCLGQNYVMMAFTALIGKAAMLYDIDHTVTPLSEEIKVFATIFPKDDLILQFKHR
FT                   DEQEILNDISA"
FT   CDS_pept        975322..976050
FT                   /locus_tag="PAS_chr3_1196"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1196"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70556"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4S0"
FT                   /protein_id="CAY70556.1"
FT                   /translation="MEKSGKMMPIPELNIRKDNYSQLYSLVDVLLAKLDTNRQLKRSLF
FT                   RKLEALSNFQKVATQQAESSEPTIDLAKSKRQPETIPQALKTSLDSLHIDEKPKNTAGD
FT                   EESELAALRQENLRLREKITQTQIHNSRMVQLLDDYEDNILMIVDRLRDYIIQSRQSSV
FT                   DKLREQNGKLYEKTQEVNHLIGELLSYQESAAEQLPPMLDPLKQASGSDSSESELRDSF
FT                   EAFYLDKYAREALAVLYSGK"
FT   CDS_pept        976303..977859
FT                   /locus_tag="PAS_chr3_0508"
FT                   /product="Specificity factor required for Rsp5p-dependent
FT                   ubiquitination and sorting of cargo proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70557"
FT                   /db_xref="GOA:C4R4S1"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR027713"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4S1"
FT                   /protein_id="CAY70557.1"
FT                   /translation="MYSFDDVNVGNPELDLNIPFVIGLSAILSLLLLLLIIIAVYYTFF
FT                   CGSSTFGYDLGDNFSIRLPQNFQVDDDKIKLWEKTYFPLLTDEEKDQYLLGKHFFHFNK
FT                   PNVVPQGTGFGIDAQLSLRDRGINIFYFESYTNHTDLVLDQINHPEKYKRSINEDSASF
FT                   DEEEIIEQSQKSSLVAKSFPDYGAVTDEGTSTSRNIPVPFYIEDRTDIIFTTDKPHSTT
FT                   LNFPLPTKNRRKDTVYFEAKLYEFNPANTLISVGLCCKPYPDFRLPGYNPYSIGIESSG
FT                   HMRLNRPFINDSDTPVLLPQLIQGDVIGIGYKYYPGSVYVTHNGKKIMEVLHDIKLDLY
FT                   PCIGSTGGRSQVSVNLGQLGFVFIEANVKKLGFCEGDNEGSLGAPPLYLSTKEDVEDTI
FT                   LQTGEALPPEYPENETTFFGPKAYLQGRVAISKPSSLPLMSPRQVRSILSDDYLTHTDD
FT                   EISSRPPSYISNSSDQDSTEHNAPNTTILANDQSDLTISTTNKASRKKGKRRRKNKSRR
FT                   R"
FT   CDS_pept        complement(977912..978367)
FT                   /locus_tag="PAS_chr3_0509"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70558"
FT                   /db_xref="GOA:C4R4S2"
FT                   /db_xref="InterPro:IPR039432"
FT                   /db_xref="InterPro:IPR039914"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4S2"
FT                   /protein_id="CAY70558.1"
FT                   /translation="MPPVKSLDIFFNRTEKLLEANPTTTKVSIKLGVNFNDHENPQSKH
FT                   NVITVRVSDPVSGSNFKFKVTNKTDMLKIFSFLGPHGIELPISGQQSQIKSNDQTQSDN
FT                   TEVPTTFHRGATSILANKAFEKKPLIIKDSSTAKKGGKGGKKKGKKF"
FT   CDS_pept        complement(978520..980196)
FT                   /locus_tag="PAS_chr3_0510"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70559"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4S3"
FT                   /protein_id="CAY70559.1"
FT                   /translation="MFDSLPLDQYRANYQAIKEHKPIPYGDAKGLILMSDDIDLDLVLR
FT                   KHIPTKILEEYFHKPREGDASTDGKTRYASDTEELLRFSNVFKDDSIEIGRSRSMYGSP
FT                   KYSSFEKENILRPSTKANQKGTKYDIDIAGDLLASSHKFISNLPTTNKYEKLLSSSIEK
FT                   TIREFKRLKEENEQLRSKSSSPRNTGARQSEELVYLKDVNKTLMERLQKEKDSKEQLTK
FT                   METELKVKDDSLRDLESQLVERNQLIDSLRVQLADREKLLEKSKSELAEKDHIIETRNV
FT                   QLTEKDQLVEKIKSELDTRKIINEKENTSKTRNSFGTHDSEVHEKQSTPTQGDSSVKQS
FT                   EAEAAVSSIARELHQIKESITYLGKDPKKTKLFEEINEIRDQIKYLDLKRFEKEEEIAN
FT                   LNEKELYIQQLSGRSGYYFQGPNLAKEQWDSMRNQPTASPKHDANMQDSPTFRRAQRVK
FT                   QPCPTCFQSNISPTQSTRDSRANQYAHNNDIYVNDLENIDPNDFLSKLTGPEENRKKEE
FT                   ALNYLDSTRCARKHAQGHTQGSNHLGDMEEIHEEIANSEYY"
FT   CDS_pept        981002..982627
FT                   /locus_tag="PAS_chr3_0511"
FT                   /product="Choline/ethanolamine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70560"
FT                   /db_xref="GOA:C4R4S4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4S4"
FT                   /protein_id="CAY70560.1"
FT                   /translation="MSSSVEKSDVNDVSLTRRFTKDSTLDKDDLILAQLGYEPELNRNF
FT                   SVWSVLGVGFGLTNSWFGISASLVTGISSGGPMMIVYGIMIIAAVSTCIGITLSELASA
FT                   YPSSGGQYVWAKVLAPKYPVLAFLCGSFSYAGSIFSSTSTTVATVQIAVAFYELTHADY
FT                   EFHRWHVFVAFQILNFFIFFFNCYAKFLPSIAKSSLYISLGSFIVITITVLACSSGHFQ
FT                   NAKFVFSDFDNQTGWESAGIAFIIGLINPNWSFSCLDCATHMAEEVAQPERVIPIAIMG
FT                   TVAIGFFTSFVYCISMFFSIRDLDALLNTATGAPIISIYYQALQNQGGAIFLGFLLFLT
FT                   ACGCLISGHTWQMRLCWSFARDNGLPFSPFLSKVDKRMGIPFNAHLFSVCLCSLVSCLY
FT                   LASDLAYNSLVTGCITFLLLSYAIPVSCLIYNGRDSITHGPFWIGKFGYFTSSMTVAWA
FT                   LFALVFYSFPFVKPVTKSNMNYAAAAIVGWLVVSLVYWFSYGKKIFIMRNEDDEDAVLK
FT                   KIFAKTESHREKDATIPVEVTKEL"
FT   CDS_pept        complement(982679..985006)
FT                   /locus_tag="PAS_chr3_0512"
FT                   /product="Mg<sup>2+</sup>-dependent phosphatidate
FT                   (PA) phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70561"
FT                   /db_xref="GOA:C4R4S5"
FT                   /db_xref="InterPro:IPR007651"
FT                   /db_xref="InterPro:IPR013209"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR031315"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4S5"
FT                   /protein_id="CAY70561.1"
FT                   /translation="MQYVGRAIGSVSKTWSSINPATLSGAIDIIVVEQENGDLACSPFH
FT                   VRFGKFQLLRPSQKKVDFIVNGEKTDLPMKLGDGGEAFFVFETDAAIPSELQTSPVISP
FT                   VSSPEPASPLSTPSRPNSEPDYLELGDGESTTSELENFKLNRYPYLSTEVSHSDPGVGS
FT                   VSSSPENTKIIQKISRKLNTKNIPSKVDNNGNLVLDIQGYKSDDLDDNSKSLKQLLLAE
FT                   LGEDVDLDKVIEKDHEGNIMINGAISLLSGEDDLESFPQTDDQAESLKLDLESDKSDIE
FT                   SDTNHELSRYFKTLRLTSDQLKCLTLKKGINELKFSVNKGKSVVTANLYFWDYYDPIVI
FT                   SDIDGTITKSDALGHVFTMIGRDWTHKGVAKLFSDIKSNGYNIMYLTARSVGQADSTRY
FT                   YLNNIEQEGLRLPQGPVILSPDRTMAALRREVILKKPEVFKMACLNDIKKLYLTNTKDL
FT                   NPNTDSADFTDINTNTLRSSSLTEDVQTPFYAGFGNRITDALSYRSVGIPSSRIFTINP
FT                   DGDVHMELLELAGYRSSYVHISELVDHFFPPVNTELFKSMPSDTYRNTAKFSDVNYWKE
FT                   PLYNFEELSDEDSSEDELRRRKEEERLQSAPRSPILAAGASFFKGSSSLLGSPERMTLS
FT                   DPKPTEVAPSTIKPPKSVGSVSSDEEKLKDHDDFIDVDHEDETLDDDDDPFDYDYEYED
FT                   EEEENDDVDEVDDGEEYSDDYYDEEDDYDEELDHTLEPDQKKELDQTAEANQLPPSGPD
FT                   EMESKSFKKASDLISKMRIDDS"
FT   CDS_pept        complement(985144..986013)
FT                   /locus_tag="PAS_chr3_0513"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70562"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4S6"
FT                   /protein_id="CAY70562.1"
FT                   /translation="MSVIVHPLALLTIIDEFQRRGRNNDSIIFGGLLGKHDESTNQISV
FT                   VNSFVIPLIDNQFLNKEYLQDMLLKFSIINSNFRFVGYYHVQSLNGTETQQYDLNAINL
FT                   VCQDDNRPSSFVHWIVTDPKEFKSFSMYYLDDSMVQLVNSNIQHYISKPLPYEFKNLLS
FT                   EKIAIDTILKQSRLEKDLSTKNSLKKLNNSYIDIHSSLNVLYKSVNRLIRYLKKCSKSE
FT                   VSIDYDTVQEMNTVILKIERLKLIPQVKEEFDLVTLSLLVDNLDQMDHLLYLRKQVEQY
FT                   KISESMYS"
FT   CDS_pept        986189..987733
FT                   /locus_tag="PAS_chr3_0514"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70563"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4S7"
FT                   /protein_id="CAY70563.1"
FT                   /translation="MGRKVANNDPNVDSFLRKVQELDAKKKKEDNERVLKLEEEVESKR
FT                   SKVGDLDELRRSKSKSNGPPQRPQKPDSLRSGSEEEYNDIQLIHPIARDEEKQKMDSEE
FT                   EAAPQLPKRPKNSILEFPEKNSFVDSLPNFNNSKAPKVIRSEDVLRKPKRDFVINKGNR
FT                   IGREEVTHDDGKDENPPALPLRRSNVTINEGTKEKPNAALKLGTQKDIKTKENAETERK
FT                   PLIPSKPTSLKVLKPETTVSLKISTPPPPAPKPRNQKKEPVIEENNDDSVVESLKKLSP
FT                   KPKTPAKPSSLQVPSKPITTKPAPLKPTKPKDLAKGLDSNPPEAVVKAKEIKSKPLILP
FT                   KKASKSNFNQPQEDILQSQLQKLRESKSSGKNHNFNAAQETIFNAQLNGLRSRKPDQNQ
FT                   SKGLLPKRSETFSSKPVPIPFMVDPSSSKVLEKSLTKSRTIDGSDVGLSQEHHQSLSHP
FT                   NMTRAKGPKRRLPKTLSNPEAIKQPQPTSSTTSLGKKVPPPKPSKKRIVSNSELFL"
FT   CDS_pept        987936..989324
FT                   /locus_tag="PAS_chr3_0515"
FT                   /product="Subunit of the alpha-1,6 mannosyltransferase
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70564"
FT                   /db_xref="GOA:C4R4S8"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4S8"
FT                   /protein_id="CAY70564.1"
FT                   /translation="MSKDSIIAQPMGTLNFKVLRRYNSTLLRSSKHFATNPKTILVVLV
FT                   ALFLMLFNMIRPFNNSLYEPDFENTKNTHYYDLDNYKGSEDGWQRGERVVFLVPLRDAA
FT                   AHLPMFFRHMRNMTYPHHLVDMAFLVSDSSDNTMGVLKDNLLELQHDPDPKIHFGEIII
FT                   FEKDFGQAIGQGFSDRHGFAAQGPRRKLMARARNWLSSVAVKPYHSWVYWRDVDVETVP
FT                   TTIIEDLMHHNKDVIVPNVWRPLPDWLGNQQPYDLNSWQESDGGLQLASTLDEDAVIVE
FT                   GYVEYATWRPHLAYLRDPYGDPEAEMPLDGIGGVSILSKAKVFKSGSNFPAFSFEKHAE
FT                   TEGFGKLSRRMGYDVVGLPHYVVWHIYEPSSDDLKHMEWMAKEEERQRQEKEIQAVYKK
FT                   YWDQGFEDVSDAWAKERHYMMKNTDFRKQRKIEVDWSGEDDYEPAVKANAVKDQDRAAN
FT                   FYPQ"
FT   CDS_pept        complement(989382..990959)
FT                   /locus_tag="PAS_chr3_0516"
FT                   /product="High-affinity zinc transporter of the plasma
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70565"
FT                   /db_xref="GOA:C4R4S9"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4S9"
FT                   /protein_id="CAY70565.1"
FT                   /translation="MNLKTWITVFIAVAQSATVTVTSTGDFRIGGLVTTAPAGTTAAAT
FT                   VATTTTYAGGVYEVDIASEDGHDDHDHDEHDDHDHDEHDGHDHGSASTTATGQTTAVTD
FT                   CHFHEETQYCVNGDKAEGYIVPAPTETSNAPEEYTGCHSHGAETYCLREDGDEVQFVSL
FT                   GAEASSDEQEDAAEFGGAVGVTCHFHAGVEHCVDANGNTVNRSGASACSAPDHDYNIPL
FT                   RIGCLFAILATSAIGVYLPILTNKFLNFSLTGVIFTGFRQFGTGVIISTAFVHLITHAE
FT                   MMWSNECMAPLDYEATGTSITMAGIFLCFAIEYFIKRIALARLKKADAENAQEEIEVTD
FT                   ENPKENELSDSSSSLERGGTVPVPPLSRKISVIMLEAGIIFHSILLGVTLVVAGDSFFI
FT                   TLFIVIIFHQMFEGFALGTKIAELNMVSLWYKLLMALAFALITPIGMAIGIGVLSRFNG
FT                   NSSSTLIALGTLDSFSAGILIWTGLVEMWAGDWIYGALVNANWLNTTVGFLSLIAGMIL
FT                   MSVLGKWA"
FT   CDS_pept        991518..992378
FT                   /locus_tag="PAS_chr3_0517"
FT                   /product="Putative GPI-anchored protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70566"
FT                   /db_xref="GOA:C4R4T0"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR029482"
FT                   /db_xref="InterPro:IPR039124"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4T0"
FT                   /protein_id="CAY70566.1"
FT                   /translation="MRFINLTITSLLALASRTTAEDVTVTQLVSSPTSASEAGDWSANW
FT                   VKGFPIHSSCNQTKFNQLSLGLEEAQIMAAHARDHTLRYGNESEFFTQYFGNASTAEVI
FT                   GWFSVVVDADKSNLLFRCDDIDGNCKFDGWAGHWRGENGSDETVICDLSFQTRKFLAQM
FT                   CSNGYNVANYPNNLYWASDLLHRLYHTTTIGQLTVDHYADTYEECLELAIESPDEAVRN
FT                   TASLRFYALDVYAYDIAVPGEGCSGEIGEDDEESTSSGSATVTTTSTSAGTECHTHSDG
FT                   EVHCA"
FT   CDS_pept        complement(992433..995300)
FT                   /locus_tag="PAS_chr3_0518"
FT                   /product="Predicted cytoskeleton protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70567"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4T1"
FT                   /protein_id="CAY70567.1"
FT                   /translation="MWTSYVILILSIIWLLTRALKLINLPIDKGIRSLNVFVPKVPILS
FT                   TDRITQNSIIIHWENKHSTSSSCSKVGDGDEIEHREGGPRLIVNTSPKAVSFYQLYVNG
FT                   ELVTTLESAVNMCKLSNLKPGTRYQLDLIAFSILNFRSRSSPVFVKTIETPYQKIDDAD
FT                   DLLHFLAPKKDAESLKVHSTFRQNRTNIYSGMPISEAKVRDDVDQITDIEELRYLLEAG
FT                   QEDLRSLLFQQTQCAKDFEEKEIILLSSREDLRKRKKMEDLNRNSVRAELNALEESKKD
FT                   IVTKIMNNQYLFDEKTKSMQKMKDEIENWKNNLKTSQSRCEELKSNEKKILRELDQKID
FT                   GKKADIKAAKLEIEVLDSELQGNIDYKMERESLKAEITSILSSLNRDADSQNGLLKKDG
FT                   ISLLTRLKQIKAEWGNLLETQQSLDAAADSNWRSSEQMELQKLHSIKVQYQSLLSDNQT
FT                   LQELLAGERNVLTLPRGQTNVGESFPSLESNRPSVSLFPIQMEASNSSFQPAYFEAEDN
FT                   VEDLSPNVEMLLPQSLIESEELILNNLGSNTVDIRNEVFLDTPSTPVLKDPSYETSSFE
FT                   NTAQAGEKSFNSPFEFNSLHERSPSGDGASFFFQKSPPLSHASLVEPQHLDEQLSTFSP
FT                   KRLSNVFNFGKKAAAANNNISMTLNADSDYNANHTATSSKFFGIIKRNSQNTNTINNRT
FT                   RSGSLGSSIWSNNNPNNTGTQTGEFRVGSWSNNNYGGFMTPQQNDTPEYRSPSESLIPI
FT                   SLPQIDIKNLNYENDDLFLSLSHITSDLDGQHSNENSLGESALEKKSKQESGGSPIAFK
FT                   KRMFSLSSSPSKLENDHLDDNHHGNNHGPSKSSKFFSKISRRNSTVTTSSDSKVSQNSQ
FT                   ETTGNGLNTSDASISSSSAVSGTNSSKFSRRLGFLKKDRGKEATDKAKIKKKQKEIGKD
FT                   KDNDLIESTIDEVSDESEKNSPAPE"
FT   CDS_pept        complement(995755..997416)
FT                   /locus_tag="PAS_chr3_0519"
FT                   /product="Permease of basic amino acids in the vacuolar
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70568"
FT                   /db_xref="GOA:C4R4T2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4T2"
FT                   /protein_id="CAY70568.1"
FT                   /translation="MSVKSLETTPLITTTVVQSTSDSEVDKDSQVQFPIQPVDAVDEDI
FT                   SIWDIPNIFKIELALFTNVFVGSFEGTVTSSTYAIISNEFDAVNIGSIITIAYLITSTS
FT                   FQPLYGSLSDVLGRRFMSFFAIGVFSVGSLFCGLARDIYSLFLFRAITGIGGAGIISMS
FT                   TIINSDVIPRKKRGLFQSFQNIMLGVGSIIGASLGGLICDTIGWRWCFIILLPMSLLSL
FT                   VLTYLYVSNPPHHLSGLKLSSVDIKGSVLLVVGLSLQLIALYSRSLRFFLFFLISSSLL
FT                   LFYFIYDLSKNDPSTIKLIPWETVNKLPQLLTLNFGFIVGFANFANIYVLPLLFQLVLN
FT                   DSATKAGLRLAIPSFFTSVGALITGYVMNKNVNHLNWLIKLGFVILILGTFLNSLITPS
FT                   LKKYVNFIIIPNNIGLGIAYPASLFLYIFLFPNSLQASSTTTLLLARGVGQVWGMAGAS
FT                   VVVAHLVKFKLWHVLAEHKKDLDLTDSQIADIIEQSSKSLTYVRHLPENIAVFVHSSYK
FT                   AGLWGAQMVSIAVLVLGLLASIFKDFSSKAGKKFVI"
FT   CDS_pept        join(997770..997820,997887..998201)
FT                   /locus_tag="PAS_chr3_0520"
FT                   /product="Putative mitochondrial ribosomal protein of the
FT                   small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70569"
FT                   /db_xref="GOA:C4R4T3"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4T3"
FT                   /protein_id="CAY70569.1"
FT                   /translation="MVVHILGKGFKGKTLIDIGLSSKFYGVGLQTAQRLCSKLGFYPSM
FT                   RMHQLNEQQVMAITKELSDLTIEGKLRSVVRENIQLKRTIGSYAGLRHAMGLPVRGQRT
FT                   KTNAKTAKKLNKLNRWG"
FT   CDS_pept        998380..999450
FT                   /locus_tag="PAS_chr3_0521"
FT                   /product="Protein involved in ubiquitin ligation"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70570"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4T4"
FT                   /protein_id="CAY70570.1"
FT                   /translation="MPYSNPQASTASLEGEALSLIDSEGNSRRRGSSLGFASGLISNLS
FT                   NLIRPVPISSSQPMDSSPTMVRPISQDEAAVSASEVELLGLLQLNSSSSQQPLPQPEPE
FT                   SKKLHSIRLTPFVDHTTTAPALYFGSVIRKIKPNHQISIGRYTEKSRDAAHAPQGSSAS
FT                   VVFKSKVVSRSHAQFTVDSSGNWYIKDLKSSSGTFLNNQRLAPANTESPLFRLQDGDIL
FT                   QLGIDFRGGTEETFRCVKMRVELNKSWSRRAAKFSKESYRRLQQLSAPGRSTPEDGGVE
FT                   PMECAICLLTLEPCQAIFTSPCSHSWHYKCIRRMIVTSYPQFMCPNCRSVCDLEAEAEE
FT                   AENDSDLPDLDNKDDN"
FT   CDS_pept        complement(999484..1001181)
FT                   /locus_tag="PAS_chr3_0522"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70571"
FT                   /db_xref="GOA:C4R4T5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR019431"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4T5"
FT                   /protein_id="CAY70571.1"
FT                   /translation="MSISTKNSVNSEHDPLQQPTSSSNYQTIPETTPKSLPPDREERRP
FT                   LLSPDDPSVSPLNVRNVRICRFILGAIINVSLVWLVLLLISDFVSVPGFDNRGRGFIEI
FT                   DLILLSLFANASTLCFFTIPSKLERSLDMAIAGIVTLDLLIMLLYRRFLHDRGGLGFAT
FT                   MLWLVASLSFGAVSDYLVEEAKNHEEIRLTGRVESRKTVYEFFAVATRVTLRLITFVLV
FT                   LLLSLNFWFQAYDFKTKPWGKLIPVGDSQLELHLACFGDVYSNKSFTPEELMFGDVSIS
FT                   SSKDEQPIILVDGGQFVSSEEASEWVEELFHLDKVQRYCVYDHPGTAFSNSFPSPVSLG
FT                   IVADLLYEALSKEKIYGPFVLVGYDIGGLYSRIFASRHASQVHSMVLVEAWSQSLLKPN
FT                   PFANDREKNGKTKLEDLHKTTGIRRMNAKTGLYFWWKGIYAPFSLKRLRRFLVHRHGPE
FT                   DRIFGKDITVNDKFWRFKLQEQISSSLISYHEVTNSLLETNGIPIAVASSDVMIKKSVN
FT                   WGRWQRELTKISSKPIEWVITKGNHRPWDDPNGRKQLQDLLLRVIDEE"
FT   CDS_pept        1001488..1006098
FT                   /locus_tag="PAS_chr3_0523"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70572"
FT                   /db_xref="GOA:C4R4T6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010506"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4T6"
FT                   /protein_id="CAY70572.1"
FT                   /translation="MDFPIPMDVPQHIIAQLSQLRNEYEEGLLTEKGYIKKREKILNGD
FT                   SPFVPVNHNRNSSVVSSTSTPISPIKQFDLATGEDELYTATSPYPSQNGTNYRGDLSST
FT                   QDRTSYAAPSLYSNQNFNRERAGRFFQNGERVELQKPLDPRDLADESNLESFDNLPSIL
FT                   RQRATNYKKEIALLIIDQKGKESSSISWEKLYLKAERIAQQIRNKSGLYRGDRVCLVYH
FT                   QTEVVEFAVALFGCFLSGVVAIPLSSSYPIKELVKIMNDTQAHLCLMSESSIKLFERTG
FT                   PGAQTKTKWPKGMDIWKSTDMGTYQQISKKNDSPALQVPDLAYIEYSKSPTGELRGVVL
FT                   SHRTIMHQMNSITSILSSMPDYDSTSLKRSAVAFNKFRNVILSTLDPRQSSGLIIGILY
FT                   TIYSGNLLVWTAQKSMETPGLYAHIISKYEVNILLADYLGLKQVTYNYQSFPQLTRTYS
FT                   KKIKVNLKSVKWCLINSLTVEGDFHQLLIDRWFTPLGCTNAHRIVAPVLSLSEYGGMII
FT                   SMRDWLGGEERLGYSYHKPLNDDLIDSKTLSSDLSELLIDRASLMTNTVKVVSDKPPAT
FT                   VSDTAEYLRVGAFGYPIPDATLAIVNPETNILSANMEVGEIWVDSPCISGGFWGLSDET
FT                   NTIFHAKCSDYEGVLDLEFLRTGLLGFTYNGKVYILGLYEDRLRQRVTWRDRLEASKAD
FT                   SAKKLKSLDSEYQYHYSSHLVKTLVRNIKEVEDCSFFDIFINQEYLPVAIVETKLAKQR
FT                   AQKNGVVATDKELLEELSSKCIKVLEDVDNVKLYCILVVPPLELPRTGRHGRLEIANML
FT                   CKRKFNEGRLTGRYIKFNVSHAVSNISKGDDITGGIWSQYQSKERQKIFEFAERQYSGL
FT                   DYREESVDDRTNAPLTDFKTIVDILAWRAANQAEELAFSMVDKQSIKELKPLSWKKFDQ
FT                   RVSALCSYIVDKQRFSPGDYVILMYTLSEEFVIALYACFKTGLIPIPVPALDPNRAEED
FT                   VQGFVGIVKDFKVARVFANTEVEALLKMKQISHELRRVALNAKLVIPKIKNTTKYTKVS
FT                   QPVGQLNSKISKFQAGAGYRKPFTTALILTYWTSDQYRICVRFTHANIMGLCKVFKETC
FT                   QVSSIKPLLACVRHHSGIGFVQSSLLGVFVGASTYLVPPMDYSSNPKTLFLALSRYKVT
FT                   NTFGTDSMLNYAVQRMDTKRVDLGDLKNFMLSYSGRPDCQLYRNFLTHFVNTQIPTDAL
FT                   SNVYSHPCNPMITSRSYLSFEPVDLWLDPIALSQGYVSLVNPKTNHHALHLQDSGIVPV
FT                   CTQIAIVNPETLEMCSVGEYGEIWVCSEANAEGFVTGKGRTDSFAMAQFQGKLKGGENG
FT                   VTYFRTGDFGFLHNVSKTTSDNSVVDLQLLFVLGQIAETIEVLGLQYFPCDIEKTVERI
FT                   YDILSTCLFKCDGYAILVVEPRKNFKLSSLVPVIVNTVLNVHHLMLDIVAFVEPGSFPR
FT                   SRLNEKQRARIIDRWNSNTLQLCSSYGTNYGEKSMIELVQRIDQAEFYISNANKKEQHS
FT                   ERKTEDFNENGLRIIN"
FT   CDS_pept        complement(1006081..1008981)
FT                   /locus_tag="PAS_chr3_0524"
FT                   /product="Essential component of the nuclear pore complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70573"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4T7"
FT                   /protein_id="CAY70573.1"
FT                   /translation="MSFILKREGSFDEDDHPSKFKKVTDSFLGFLKKKIGNRSQDEYVQ
FT                   DSFQQDSLLEQQTDILHPDTSSLQEVDSVADQSTRPSNVFSSYYDLLKRQKEQSEHTHL
FT                   HKPLSPAQPKRMNTRSSSQQGEEDVSLLSKRQRNTSSLDLVPPSKKLKSVDSVRTSLVD
FT                   INPMERALLINLKERMEMDKYFKSRVKYMGFHNRHVRNSGGTRSFQNTRSPLFLKSVAT
FT                   QNLRNTISQDRKKHGGYFSGEFEYDLDDSTNNYPENQNLLQYKPAVSSLKFSDKPQDKY
FT                   HPKPANEADVERIINGRVTEPVFKQNKSNLVDNEKDSIGPSIGFKFGDNSSQSENEPNA
FT                   TALENSSQPLVSNNKAADSKPKVSFGNVQEKKDSDSSQKVSSKIDFSFSSKKEISNPSS
FT                   FTTSSASVNGTNAPTEVHAKPSFSFTAPTTAKPAFSFGAPKIDEIKQDDGSQKVSSAAS
FT                   AGDIKSATIPTFSLADSSDAAKKQQKPIGVSFGLDSQSSAQGQPKGQLPSFNGSDSVSS
FT                   DKTEPKPTFSFGPSGSTSQKDDGTKPKFLFGSAGTASSEKATDIQPKFSFGAGTAANDK
FT                   SDSAKPTFSFGSSNGSTATEKKDNAKDSFTFNGNTEQAAEPEPKTSFSSSTPSDQKIES
FT                   KPAFSFTTSSEVKTGESKPAFSFSAPANKETPKPAFSFNDSSEKKEQPTTTKFGSQDNK
FT                   PSSPPKPVFSFGSTNAQNKPNTDSQKSFSFGKESADNSNKRTFGFDETSTSSKNSASAF
FT                   TFNVPSNTTKPAFSLGNEKGESFSAPALSFNNNPNANNFGFGSINSNVASAGSSKEPTP
FT                   SVVNFSSSKGTFGTSTQPSVNNNAFQFGASMANNPSTNRSENNAFPQPQAGFNPSRSAT
FT                   PNFNFTGTSQLDPAAIFGGSGSTPPVPFGQPSVQLNQPQPQTQHNTGFSFGFGNQTAGT
FT                   VRNSNTFNNTWCERQSTCSNEAEKKKLKYVILVYDT"
FT   CDS_pept        join(1009271..1009304,1009373..1009575)
FT                   /locus_tag="PAS_chr3_0525"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70574"
FT                   /db_xref="GOA:C4R4T8"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4T8"
FT                   /protein_id="CAY70574.1"
FT                   /translation="MIASLAGWGLFGVTVRAYQQGIRKVPFSYYPLGYVYSALGWVAFG
FT                   YGFNLWTERNDKLLEKRVEKLKESRNLRLSKDD"
FT   CDS_pept        complement(1009703..1010833)
FT                   /locus_tag="PAS_chr3_0526"
FT                   /product="Protein with a role in regulation of Ty1
FT                   transposition"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70575"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR013719"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4T9"
FT                   /protein_id="CAY70575.1"
FT                   /translation="MENLPSNLSEQIKNLIEKYPETENVFNQLIDLVDEGTLKEAKRVK
FT                   ISNEINFADYTVILQLPSLSVQSPFRSKSNLIFACPKSDTSKPILAIAKTNEKPQLILD
FT                   KLNDENVLYAVILPIPEKKDFKNLAIFYKENMGGVHKNEPLLIQYNESLISESLKLILQ
FT                   KMTFPTYFQRQCSMLGFKLNLFTESKDFYVVAHKGSKEGFLYFLEDQILFGFKKPILLF
FT                   EKSQIESINYSSVTRLTFSITLSYKEADKTAKIEFSMIDQAEFDKIDNYVKAKGFTDKS
FT                   LTEELKAKSNMKNNETSGALREAALQIPGGEKIVGESNIEVQGDSDDEDVDGTYQFNGN
FT                   ESEDDGSPPNTDEETEEKGDDAKEDDLNQEAIKIDN"
FT   CDS_pept        1012015..1013700
FT                   /locus_tag="PAS_chr3_0527"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70576"
FT                   /db_xref="InterPro:IPR025340"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4U0"
FT                   /protein_id="CAY70576.1"
FT                   /translation="MATKTAIEHFPHPLFDNLSGEPNVCFPRVVDDLIVHQLSYTIRSK
FT                   PDWTTKYKNAEIREKWIAEMEGQLKLEDIAPLHPAEKIWKFVFEELAWYDKYAEEKGFT
FT                   AGPNENILFSDRAIGDDFRESLKKFVNEKLEDIPEDAKDWHPGSDNQVLDLVHPSLYPL
FT                   QHGKTLVLTEKGFEVSKPIVPNEVPKYAPYFSNKYISGDLQWLPSIFNVSKKDGDYVVE
FT                   IQSYINNLDPLKYGTLYPLIASVFSKAVPGLNLLLTHLSSLERLRVEYPRFDEMDRDWV
FT                   YTDEFHKKVKALEAARNFGDDWSLLESQRVNYINKSKFLLEFKPPVFEKKVDLADYGDL
FT                   KVITKLANIHLTPEKPSYPGGSWHVEGTVNEDIVATVLYYYDSENIGESKLSFRNATIE
FT                   PHYEQHDHDGIRQIFGLWHEGNLTRYLGSVDCIENRLLIFPNLYQHHVDPFELVDKTKP
FT                   GHRKILCFFLVDPNNKHTIASDKVPPQQQDMLVDDITSFFGKEASSQFSNKILEEIASK
FT                   VQYTMSLDEAKRVRERLMKERAPVEEFDWGDGLVYNTLFNLCEH"
FT   CDS_pept        1014737..1016071
FT                   /locus_tag="PAS_chr3_0528"
FT                   /product="Saccharopine dehydrogenase (NADP+,
FT                   L-glutamate-forming)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70577"
FT                   /db_xref="GOA:C4R4U1"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4U1"
FT                   /protein_id="CAY70577.1"
FT                   /translation="MVKQVLLLGSGFVAKPTVDILSANKDIEVTVACRTLEKAKELAGS
FT                   VAKAISLDVTDEAALDAAVSQVDLVISLIPYIYHATVVKSAIKNKKNVVTTSYINPQLK
FT                   ALEQQIKDAGIVVMNEIGLDPGIDHLYAVKTIDEVHRAGGKIKSFLSYCGGLPSPEDSD
FT                   NPLGYKFSWSSRGVLLALTNQAKYWKDGKIEEVSSEELMASAKPYFIYPGFAFVCYPNR
FT                   DSTTYKELYNIPEAETVIRGTLRFQGFPEFVKVLVDLGFLKEDANEIFSKPIAWKDALA
FT                   QYIGAPSSSEADLVSTIASKATFKNEADQQRIINGLRWLGLFSDNAITPRGNPLDTLCA
FT                   TLEELMQFEEHERDLVCLQHKFGIEWADGSSETRTSTLVEYGDPKGYSAMAKLVGVPCA
FT                   VAVEQVLDGTLSTPGLWAPMTPEINNPLMKTLKEKYGIFLTEKTL"
FT   CDS_pept        1016212..1016790
FT                   /locus_tag="PAS_chr3_0529"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0529"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70578"
FT                   /db_xref="InterPro:IPR028095"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4U2"
FT                   /protein_id="CAY70578.1"
FT                   /translation="MLRVQPSEQSRNLWSKVKQRSKGISSGITSGIASGISNLSLHQES
FT                   DGDKETDTLVHKALVNYYITRDLPFPDWLGAEDHKHPKGSNVFTKASSTITSRILPNQS
FT                   PSSSKSRHSLTGIYQSAEQNTPSSAVKTKLLIRQNTNTRVNDRLKSRENAISTEEHTEV
FT                   QRTVIHHNINPPNTTVSSTSSRRTVWRRN"
FT   CDS_pept        1017446..1018756
FT                   /locus_tag="PAS_chr3_0530"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0530"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70579"
FT                   /db_xref="GOA:C4R4U3"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4U3"
FT                   /protein_id="CAY70579.1"
FT                   /translation="MAQDTSRKRSDSSSESGKQPKKRQRNGSDEKDTKLPPIHSLMGSN
FT                   HDKDNNNQGVVDDDPKTTDKSVDEPPTSSDSNKPLQQLVQSLDSKPDLASDSPRNEHNI
FT                   YPNSHVPQTHMQPVFSGGYPAPLPLQYPSLSPQHYMPNPSGYGSIPPGFYPMEMAPPAT
FT                   EDKESSNKDDPKNFRFVDMNRGNASIPGGLGGTPSTLTAPSKQADQQAYPYTPPSKHEM
FT                   SYQERTTDENNAPTFKREGHKVARIQKWTEEEDSLIIYYKEQMHYSWKSIAQLIGKTHS
FT                   WQAVQMRYLRTHKLRNANWSEKDEIRLINTIKKDWNNRWKRISSDLGPAFTPERCQDKA
FT                   SKLVKAIESSYVSKLFEQSTAADNIPHNKKLMMIYRGIDVISYTDSEDEDQDTPKNNPI
FT                   KEIDNATNDEQPTTKADPVPINSTTLHHLKENSDANS"
FT   CDS_pept        complement(1018895..1020238)
FT                   /locus_tag="PAS_chr3_0531"
FT                   /product="GDP dissociation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0531"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70580"
FT                   /db_xref="GOA:C4R4U4"
FT                   /db_xref="InterPro:IPR000806"
FT                   /db_xref="InterPro:IPR018203"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4U4"
FT                   /protein_id="CAY70580.1"
FT                   /translation="MEENYDVIVLGTGLTECILSGLLSVDGKKVLHIDRQQFYGGESAS
FT                   LTLSQVYNKFKPNKTAAESLGKDRDWCIDLIPKFLMANGELTNILVHTDVTRYIEFKQI
FT                   SGSFVYRDGRIAKVPSNEMEAIKSSLMGFFEKRRMKSFLEFITNYKEEEVGTHKGLDLD
FT                   KNTMDEVYYKYGLEKGTKDFIGHAMALWPNDDYLREPARETYDRIILYLHSVARFGKSP
FT                   YIYPLYGLGELPQGFARLSAIYGGTYMLDTPIEEVFYDDDGKFTGVRTKEGVAKAPIVI
FT                   ADPTYFPEKVKKVGQKVIRAICILNHPVPNTHDTDSAQIIIPQNQIGRKNDIYIAVVSH
FT                   SHNVTAKNQYLAIISTVIETDRPHVELEPAFKLLGPTEDVLMGIAELYEPLEDGSNDHV
FT                   YLSRSYDPSSHFETTTDDVKDLYRRVTGHDLVLKKRKTVEEEESLACE"
FT   CDS_pept        1020626..1023652
FT                   /locus_tag="PAS_chr3_0532"
FT                   /product="Intermediate filament protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70581"
FT                   /db_xref="GOA:C4R4U5"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR003114"
FT                   /db_xref="InterPro:IPR013937"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR036305"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4U5"
FT                   /protein_id="CAY70581.1"
FT                   /translation="MSLLSTGLGILIFTLIFIKLVPILVLCVLSSFVPLLGLVWLSLKV
FT                   RRPSWNSPQHDNLALRFPRFKFITQLNDPKPQDTFRTIQSGDVQAKFDLLFDSIIRDFV
FT                   LSWHKNITQDSSFPEHLKIYMTEVVLELEERLRDTNFTRLVVLKLLPIVVKHYDGFLGT
FT                   NTTVHPASSSREDTTRHLNKLVDRLVWILLPNQESKSRIVRIIVREILTTWVISPITCM
FT                   LSDPDYYNQKIVQFTSVWVEDNDHIQQFRSILNQQVKGSTVKHRKDLKDEKYQLLRQRI
FT                   LECESKDQLDRYKAYLSKSKLESHKVELLKELVDSLMEKYKDTDQLSDVLFNPDSFQKF
FT                   KAFMEQRNNVEVLNFWYDVNQIKDPLESVATFSSLSKSSLVDFGDKKVNEVKSLFNSYL
FT                   NHQILEADSEIFANVQQFVNSRHPTEQVYRNARLSMLQLQDQVYEEMNQTDFELFKQSR
FT                   YFNLVKEHEVEKQEDGFGDPLKNYEEDDDDDERIDSEDDSFVSENVLKAVEDALNEIVH
FT                   DRNPLENSRASPFPPHVQNDDSRSGTRSPMKNSALFGLLGDKFFQEEEKKTEISDTESI
FT                   LSVVPDTNLTMAAPKDLNLSEEITKLSNEIINLENQLDVLLPLLRKAEVTNNSNELRIL
FT                   RKSKEVLEREIQFKSLQKQQYIVQESDNSLYAKSRIRISSFIDAEEEGKSFTLYIIEVQ
FT                   KVDDNNIVTAGWIVARRFSHFFKLNEYLKEQYPQQLAFVHLPKRKVVMKYKLKSLAEER
FT                   MVQLEDYLQKLISISQVCDDRNFKMFLSSDIFEFYQEKKYDKFGRGLLSGKFLMPIPSF
FT                   KGYSKKSVDLHNKEFEEKVREMQQELTTFNESSLRTGDTPFVKPICDLLISLFSTQKSN
FT                   SWIKGRAMLIVLQQLLGSTIERKCDEYLEFYIKNETFVCNALDTLYSNLWPDGGPFRKS
FT                   VERSPEVKSRTKHEAEKLIDKMFVGTFAKVFGETNSSYAGKNVFRLLQNQTLNTSLVLN
FT                   LLDEITLEVFRSDLNNRFE"
FT   CDS_pept        complement(1023714..1024643)
FT                   /locus_tag="PAS_chr3_0533"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70582"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4U6"
FT                   /protein_id="CAY70582.1"
FT                   /translation="MSSSEEEEDTPMTALSEKKLRREGQKLLRYFEDTQAQDLGIHLYS
FT                   AFLLSKQTNGLLPRKRWHAWPLAIDKVSDPKFFDRYVDENEPYHIRRWSGTRHQPIPLT
FT                   VSKSEHPSETIASKPGSTFYKERQVSEFLTDPLQILKEEINAAFQRKLNQKIHISKTKH
FT                   YQPVIGSETNIPEILINKILARLHHILIQLAVGRGQTPVSASEFLSIKRSGLLDWMDVL
FT                   MACREDSPRVHKLFDLDSSDAKKIARRDLFELYRPPVRSRPRNAVVDEENESEQEEINN
FT                   MGDPSCVRRVKIMNLKRELLAQKPDFGY"
FT   CDS_pept        1024813..1025625
FT                   /locus_tag="PAS_chr3_0534"
FT                   /product="Subunit of the signal recognition particle (SRP),
FT                   involved in protein targeting to the ER"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0534"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70583"
FT                   /db_xref="GOA:C4R4U7"
FT                   /db_xref="InterPro:IPR002778"
FT                   /db_xref="InterPro:IPR036521"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4U7"
FT                   /protein_id="CAY70583.1"
FT                   /translation="MPLLEEISDAEDIDNLEMDLAEFDPTLRTPIAEQRPAPQVVRSQD
FT                   AESGQTPLVPNQDQISQYIEQFKEGGTINKDQVIRPDEMMEKEMAELKSFQILYPCYFD
FT                   KNRSVKEGRRCQKEYGVENPLAKTILDACRYLDIPCILEPEKTHPQDFGNPGRVRVAIK
FT                   ESGKYLDEQYKTKRKLIQLVGQFLVEHPTTLQKVQELPGPPELQQGGYIPERVPRVKGL
FT                   KMNEIVPLHSPFTIKHPSTKSVYEREPEPAPPAAVPKAPKQKKIMVRR"
FT   CDS_pept        complement(1025661..1026326)
FT                   /locus_tag="PAS_chr3_1197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1197"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70584"
FT                   /db_xref="GOA:C4R4U8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4U8"
FT                   /protein_id="CAY70584.1"
FT                   /translation="MSLEGYQKRFLDAAVASQALKFGTFTLKSGRQSPYFFNMGLFNKA
FT                   PLVSQLAESYAQAIINSNLEIDVVFGPAYKGIPLAAITVLKLYELGGKKYENVGYAFNR
FT                   KEKKDHGEGGSIVGESLKNKRVLIIDDVMTAGTAINEAFAIIGAEGGRVEGCIIALDRM
FT                   ETTGDDSNTSATQAVSQRYGTPVLSIVTLDHIVAHLGETFTADEKSQMETYRKKYLPK"
FT   CDS_pept        complement(1026475..1027626)
FT                   /locus_tag="PAS_chr3_0535"
FT                   /product="Sphingolipid alpha-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0535"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70585"
FT                   /db_xref="GOA:C4R4U9"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="InterPro:IPR014430"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4U9"
FT                   /protein_id="CAY70585.1"
FT                   /translation="MTSNRPLPLFASADVQKHVSPKDCWVTLYHRKVYNVTEFLEEHPA
FT                   GDDLILEYAGKDITQIMGDQLSHIHSESAYEMLDEDMLVGYLATPEEERELLSNKDHEV
FT                   EVQLDSKGNVVEVDIDLTEFGELPAEGLLSLKTDYEHDLVKHQFLDLNRPLLMQVLRGS
FT                   WTKEFYLDQVHRPRHYGKGSAPLFGNFLEPLSMTAWWIVPMVWLPVNFYFFYIGFTNQN
FT                   KLVAMAFWLLGLFVWTFLEYALHRFLFHLDYYLPENQIAFTIHFLLHGIHHYLPMDKYR
FT                   LVMPPTLFIVLCYPIKTLVFSVLPYYMACSGFAGGFLGYIMYDVTHYVLHHSKLPRYFQ
FT                   ELKKYHLEHHYKNYELGFGVTSKFWDKVFGTYLGPDDVYQKTN"
FT   CDS_pept        complement(1027812..1029632)
FT                   /locus_tag="PAS_chr3_0536"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70586"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4V0"
FT                   /protein_id="CAY70586.1"
FT                   /translation="MSHELFSLNFKQLMTVEIYVKNPRVYLGLDEFDGVSDGDKELEKL
FT                   ASLRERRKLVLPDPNNIVGHEELINWLTEAEFSTIDELNKVSHSENDRYINQILWLRYL
FT                   SVKGKQDQYDVKIVDTFGITFPKANETNYTFELLLQEIARLRLKEDKELYTLLYEYSTK
FT                   TFQSIPILSSLIDILLRGENNTNELIRTFKVYESIITEYEQVHGLNSSPYVVLFLEKLA
FT                   SLTSRLIKEEGSHELILNFIKTLKLKFEDFTEKFQVPFKFYALDSIHIDPIFCDPVFVS
FT                   RISPVISSLIQSCEYLCQNSLDAPDLKKNLEQSVKFHHFFIQLNPKLPVSLGLVKTLVK
FT                   LNQIQSATKIMKKTLQTDATNFKYINFMIVLLVASREYSTATKLINSTLLYIEQDSELS
FT                   KAENDDIINLKILEILVIEKIHSPQVALNYLNDLFETYHKFYGQPGNASPLLDKIWLLA
FT                   SVLYENNKLYDEASNCLNEMAKPDLSRKAWLNIAQNKYQEAHDQIESVLTPIPSSFSPQ
FT                   ARFSAILGLSHLAYNHPETFKSQKDIKSVQARCHTNLQRLRSDYTFSNHHHVYHFLSLS
FT                   YEKLGDQVSLQEVLSYTVNLPDIILDLDEL"
FT   CDS_pept        1029836..1031062
FT                   /locus_tag="PAS_chr3_0537"
FT                   /product="Peripheral mitochondrial membrane protein
FT                   involved in mitochondrial protein import"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0537"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70587"
FT                   /db_xref="GOA:C4R4V1"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR017303"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR039544"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4V1"
FT                   /protein_id="CAY70587.1"
FT                   /translation="MFRIKVITRASRGFHSSGMAFNGPKSPMQVFFETFKNEWKKSDEL
FT                   KSNIKALQDETGRMAESEAFQKAKEAYDKAQKGSSFAGKAVKKTAETVGNAAVKAWDSP
FT                   VGKVTRKTVKTTAEVVDKSFEPVRKTALYKEVSEVIDDGSSTRYGGFETKEQRRLRREK
FT                   ELSNPQRPKVIKANEEASRALVVTNYKPERPKLSDRFTFLKPETPIGKVLGDLRMRWEE
FT                   SENGLISLFRTIFEKIGGFFDETESAKVIRMFKEIDPSFNTENFNKQLREFIIPEVLEA
FT                   YVQGDEAVLKTWLSEAPFNVFHAQQKQFKEQGLFSDGRILDIRGVDVLSAKVIPGNNSP
FT                   ALVIGARVQEVNVYRKAKTGEIAAGSPDNINLSTYVMVLTRIPEDVDHPETEGWKVLEF
FT                   ARGGTRQFT"
FT   CDS_pept        complement(1031185..1034520)
FT                   /locus_tag="PAS_chr3_0538"
FT                   /product="Ubiquitin-protein ligase of the ER/nuclear
FT                   envelope"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70588"
FT                   /db_xref="GOA:C4R4V2"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4V2"
FT                   /protein_id="CAY70588.1"
FT                   /translation="MEEATCRICRTEATEDDPLYHPCACRGSIKYIHQNCLEEWLKYSS
FT                   KNSQCDICHQKFSFRVVYDQDTPAHAPVKLILQQIRTSIDRKLFSFLVIISCIVCAILL
FT                   FSYTTLVLRYSSFLLSFSFVHGIPTTTELLLGQSETPISLQEFFNTDPAGCIRKALVSS
FT                   LLPGFLFLLALLILGPVIKLNHEWIIRETSFLKMLHNRIGPVHSNERHAYVNQVDGMRI
FT                   AGILQQIQEQRDANHGVLRRENVDALANNILGITGNEQLAEAMRLAIENVEQAEPNHEE
FT                   NDINDENEINLLNEQPAHVEEGLPAEDQDDVDFDEPPAVAAQNADLDPDFRPFDVAEEP
FT                   ADQAADEPALPEPRAQAEPELDFNLGVPDEPEANNDLFEIMFSLHPALPPLILTAAIFI
FT                   EPVVLTLLFIIPCLVSFAILDLLRPLGRLINSIPEAEMVTSLFIRQPGAEASGIRIFGH
FT                   LIIGYSFFAFMVYLILRKIEKSCNPRTNPLRKFRQFYNIVFGWSCTFKVFTLLGIEQLL
FT                   FPITCGFLMDFCIAPVMVDPRSTGTLLLSQNFKVLNHSLHYMLYLWSIGSSYMFCFATF
FT                   VGMCRSHILRPGVLFFIRTPDDPNVRLIHEALTRPFFLQLFRIFISLIVYTIFILAGIG
FT                   SVTWFFGLFTPLLPVVIPTILPTGILRFYMSPLWIAPALLQGRKHKDLVILYWKKAYTI
FT                   SAARVRLSSFILNNPIPEERGRIVYRHFYHRLSATPDYSKPMSVRQATQHFKENPSVNA
FT                   IFVPDGNYVRVPDDDAVSRKYLKRLFVAVTKDDNLLEPLKEENTAEDNSQEPSYDSDSE
FT                   TMEITTHCVVYRPPHFKARYISFLFLIGFFAISLFVSCIVLSDLLGRLIVLPISLLWIH
FT                   SESIFSPRINFLYFFIGYQVWLQIFELYQKEDDTFTGLALLLRQITENLRRVLNTISGK
FT                   VLVVVVDTIHLFITLISIGLPLMTQNSAVVENFDMLLKDPNDELNPRGPLSSLYKEVDP
FT                   ALSAFPFGLEVLGPSSLITILSIVGISTCNLVPYKDGTVKQWALLVVYCISNVLTGFLL
FT                   NKARGPKTILEALNIYGWSFFAHYVAFAAYFTTKAVLRYFKTIDEQVKETYYTSRKELK
FT                   NLDP"
FT   CDS_pept        1035243..1038209
FT                   /locus_tag="PAS_chr3_0540"
FT                   /product="Subunit of the cohesin complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0540"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70589"
FT                   /db_xref="InterPro:IPR013721"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR020839"
FT                   /db_xref="InterPro:IPR039662"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4V3"
FT                   /protein_id="CAY70589.1"
FT                   /translation="MLVFGCLYIILPTRLSLSYNHQMVISSRRSIRLRSSQKQSQDLTQ
FT                   DLTDIDDLSSSDAQADSDEEYSVTKKRKKQTIKTVSKKTKGNPKRKNTRVIPSSVDQLE
FT                   NFQENSIFKALSDDDVAVSELSAFWLEQFEESPTDAIKDLLNFTLRCCGCVSQIQEHDV
FT                   ANPDSATETVGEIQQFFQSQKAHEFPLMASGLAKISKWKYFRNRVVEFVEQILFVAHEN
FT                   RMLYENENLMESILVWLSALSTSNLRPLRYASTLFLLTMETTLCRITVKVASLLSKTQN
FT                   QYDSEKRKLTSRTKSSRLNSIQANIDTHKLNKKALDDYLTDITHTTFIHRSRDVDPKIR
FT                   KECMSALGLWIDIYPEFFFENTYLRYFGWILSDADAHVRFEVLKSLGRLYKKDVIATGF
FT                   RQFTERFKKRIIEIAIFDLDFHVKSQAISVLCEITMCGYLENVEELRVIGSIFLSCSHF
FT                   SKSQTHRIHAELSKYIAIVEAGLTKHFLESHTLPDEQSDELSNYIKYGNFARLLQDSYE
FT                   LYLTEEQTDLLDQQKLHLLPFYDVNDFYSSVYHIPRYYSHGNSVPQVLKFLVTDFTSME
FT                   SLSDNLRKALQLDSDGVSILLNYVRDSLSCYNEKGDYDNSRKKSGSEDPSKDVIVSAII
FT                   DKISVLFEKFKSSKHKFQCLLQMFNHIFEGSFFHKLNNQSTCEDLTDSILTFFQGMNVY
FT                   LSKDSPLNADFSTFFKLIIKAAVQSNDTRLRLSIDALCKQLSKTENLNSISLRKLLLVG
FT                   EFTNTSEYLEPIVERLVEVQCTEERLDVWLQFTSRSLETALEFMIEEKSMTEELVQTLF
FT                   GKFPFILRSLKENLDHTRTATTFANILAACKSFALRVEGREHDSIVGPLASFFLQLDLS
FT                   ISPEVERQLLHNFLVLESKLATVLNIQLEREEDDEVSFQETNFEETTVWDAEQDICGYV
FT                   LILKRLFDIGVMSTKSLERIRLNESLLGNVFASVVKEIKLKASELEPIPEITSNDNNV"
FT   CDS_pept        1038333..1038734
FT                   /locus_tag="PAS_chr3_0541"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0541"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70590"
FT                   /db_xref="GOA:C4R4V4"
FT                   /db_xref="InterPro:IPR018937"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4V4"
FT                   /protein_id="CAY70590.1"
FT                   /translation="MSFISRVCYVIGSLLLLNAGYASYTFNQVAKRVLDHNLELPLDIK
FT                   IEALVACVIVALGAILSIEASDQVDIYSGALVKPRDQSGLKNIFMGEATGEHEIIGTTP
FT                   FDHIESNVEFINIIKRREEFAKWEQSIHS"
FT   CDS_pept        complement(1039698..1041011)
FT                   /locus_tag="PAS_chr3_0543"
FT                   /product="Zinc transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0543"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70591"
FT                   /db_xref="GOA:C4R4V5"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4V5"
FT                   /protein_id="CAY70591.1"
FT                   /translation="MKLSTSVLLFFCIGSVFAHSSSKQKSTSRKIEPLFFENGNVNLDT
FT                   LNDRLTECAVVQELQLVLEKQHGDDDEPEGYFQRFFNTLFPFGPSGNALLATTYISGPP
FT                   NLLLALIPSNIDPSSLSILVSFAVGGLLGDVFLHLLPQTFVGEPFDPTKPEFILVDTKR
FT                   NTVLGVFIFVGFAIFWVIDKSLRILEHEQGAEGNSHGHSHSHVQPQIEQEIKDEGFSNS
FT                   VQNNETLSINRKDKSKAKDESTSEITTPSISNPNASVKTSAYLNLISDFTHNITDGLAI
FT                   AASFSISQNVGCTTTLAVFFHEIPHEIGDFALLIQGGFSKWAAMKSQFVTAIGAYLGTF
FT                   IGIAIQNLGSKDLDISRFQDDSLVSNIGILGTSVQWSDVTLPFTAGGFLYIATVGVIPE
FT                   ILELSANSTRLQETGKGFLQVIFMLIGLSLMFFISWLE"
FT   CDS_pept        complement(1041196..1042977)
FT                   /locus_tag="PAS_chr3_0544"
FT                   /product="Component of the RSC chromatin remodeling
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70592"
FT                   /db_xref="GOA:C4R4V6"
FT                   /db_xref="InterPro:IPR000433"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR007526"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="InterPro:IPR032451"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4V6"
FT                   /protein_id="CAY70592.1"
FT                   /translation="MSDHESRPGSADLDVDMKDQTVVAQSEEEHIDDAGSNADAREANS
FT                   RLEEEAKQYLARQTKPVIVPSYAQWFDINTIHDIEKRSLPEFFPPLSDNSKLKSPEIYL
FT                   EFRNFMIHTYRLNPIEYLTVTAARRNLAGDVASISRVHGFLQTWGLINYQIDPRTKSSL
FT                   TGPQYTGHFQISVDTPRGLSPLIPKNATVIKGKDTPSTTPSVTEPKTPQDLEGNEIPYN
FT                   LEIRRNVYDSTQDAITLKGEDKFTSTVIGTKYFFCNSCGNDSTTTRYHNLKAKSNICSK
FT                   CFEQGQFPASFQSCDFVNLEKIATTSDASAWTDQEVLLLLEAIELYDDDWNRICGHVGS
FT                   RTKEQCISKFIQLPIEDRYLNQQLHKKKQFYSEKLIGSSEGTLKGPREPVVETVSNTIA
FT                   HLIKTVDPDLAANTLSKAISGIDKGTEDEDIARAAKLAIGTMAGEAYLKQKETLLQQEG
FT                   LVKQVVELELKKIELKLNKLSIVEKTLDLEKKSLAKQKSDLLIDRISLRKQVLKVQSKL
FT                   KKASELGATDEGLQLCEEALVEASRAPRVVVVGNNVTDNEKLKADANIGNGDVDVIDES
FT                   SQPISLQFPQVYKYWSL"
FT   CDS_pept        1043153..1045570
FT                   /locus_tag="PAS_chr3_0545"
FT                   /product="Putative ATPase containing the DEAD/H
FT                   helicase-related sequence motif"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70593"
FT                   /db_xref="GOA:C4R4V7"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4V7"
FT                   /protein_id="CAY70593.1"
FT                   /translation="MCRALYGTRNPDSGFGPSLRKSLDHMGPTSPLGGEEDDEDYVLEK
FT                   IAPKVERTKEFDQFSELTKDRKLKRLNDLVSHSLKFSELIAENLVKDSTVDKEKPVKMG
FT                   EISTANQPALLENCVLKDYQLDGMRWLVSLYENGLNGILADEMGLGKTLETISLFVFLY
FT                   EQNIKGKFLIVCPLSTVDNWCNELARFAPVLDTMCYIGPPPVRSKLRKKLRQKSVNVVV
FT                   TSFEMSIRDRKYLEKISWEYLVVDEGHRLKNTNCLLIRELKKLKTNNRLLLTGTPLQNN
FT                   LKELWSLLNFILPSIFHDVDMFQQWFDFSSLDELKADNNDQELNEVINEEIQKSLITSL
FT                   HTILKPFLLRRLKKDVIKGLPSKREYIVYSKLTPAQEVLYKAALKNQLKDKLLRIGFRE
FT                   YLKCNKIKGFTTSEVTTFLDKVMNDEVTSLGRAKTGNSNPNQEAELIDLLGSDSEDDIG
FT                   HDNEDKSFYSSLPSNSKRRRLTRSQDAKYNESSRGKQKIAIDEKLNEYWSIVRSQILKK
FT                   KLSNLVMQLRLICDSPFLFFDPWEDDQPLDFKKIVRESSKMQMLAQLLPRLLDSKKSPD
FT                   GKKHKVLIFCQFTKMMDLVEMWCQEENYSTYRIDGTTSQEERAGMVKGFATKDIDIFLL
FT                   STRSGGLGINLTASDTVILFDSDWNPQVDLQAIDRVHRIGQTQPVIIYRLCNINTIEQV
FT                   LLARADSKRRLERLVISMGKFSTLSRLAGSNQSDSADLGKKDSLAHELAQFLLTTSLRN
FT                   SNQEQLVDNNLTALELDEMLDRSEQAYLKADRDSENLHPHISLFETVSGLDR"
FT   CDS_pept        1045920..1047128
FT                   /locus_tag="PAS_chr3_0546"
FT                   /product="Regulatory subunit of the cyclic AMP-dependent
FT                   protein kinase (PKA)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0546"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70594"
FT                   /db_xref="GOA:C4R4V8"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003117"
FT                   /db_xref="InterPro:IPR012198"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4V8"
FT                   /protein_id="CAY70594.1"
FT                   /translation="MTAYTDVVNDLSRELSLKKPKDVIQFCADYFNNKLAEDPARQQPS
FT                   TATAPSSRPAQTASGAPLFKDQFGGDPHEPLSHHPHRGSIFKDSFTHPEDPQSNKIRPL
FT                   DNASPGSGFAAHLAKVKFNPERRISVSAESVNPEIFATSSWQPPVHDLSDEQLQRLNNI
FT                   VRKSFLFSQLEDEALRTVIYALEEKKVPRGTEIIKQGDEGDYFYVLESGEVTFVVNGET
FT                   KGQGKSGSTFGELALMYNSPRAATVISSQDCVLWALDRMTFRRILLEGTAKRRAMYDGF
FT                   LKDVPVLRCLNSYERNKLADALESETYNKGDTIIREGEPGENFYFIEQGEAEVFKEGEG
FT                   HMATLGKGDYFGELALLNDLPRQATVVAKSDVIKVVTLDKNGFQRLLGPAIEVLKLQDP
FT                   TKI"
FT   CDS_pept        complement(1047200..1047628)
FT                   /locus_tag="PAS_chr3_0547"
FT                   /product="Endoplasmic reticulum membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0547"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70595"
FT                   /db_xref="GOA:C4R4V9"
FT                   /db_xref="InterPro:IPR005352"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4V9"
FT                   /protein_id="CAY70595.1"
FT                   /translation="MVSFESLIPTHPGLLPKWLVFISAVSFFNSAQTYFTGPNITRQVY
FT                   AAKPAETTGLSSRTFGTWTLVSAVIRFYGGYYISNPQVYQLTFASYTIALLHFASEWLL
FT                   YGTTSLSAKGSKLAGPFIVATTSLIWMWTQWDYYVSPV"
FT   CDS_pept        complement(1047779..1048624)
FT                   /locus_tag="PAS_chr3_0548"
FT                   /product="Beta subunit of the capping protein (CP)
FT                   heterodimer (Cap1p and Cap2p)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0548"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70596"
FT                   /db_xref="GOA:C4R4W0"
FT                   /db_xref="InterPro:IPR001698"
FT                   /db_xref="InterPro:IPR019771"
FT                   /db_xref="InterPro:IPR037282"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4W0"
FT                   /protein_id="CAY70596.1"
FT                   /translation="MSQEVYEAALDLLRRLDAKNISKHLTNICKLNPDLAEDLLSSVDV
FT                   PLTTKQCAESGKQYLACDYNRDGDSYRSPWSNKYYPALEDEEDAPFPSKTLREAEIFAN
FT                   SSFDVYRDLYFEGGISSVYLWDIDEDGNDVSKDGKIGFAGVVLIKKEVDAGKSGSWDSI
FT                   HVFEVQPNESGPYATYRITSTIILDLSAGKSEDQLLELSGNLTRQTEKDLKYQDLSSHI
FT                   SNVGSMVEDIESKQRNMLQEVYFGKTKDVIGDLRTTKGISSLKEESEKQSELIQGMRNL
FT                   "
FT   CDS_pept        1048880..1049875
FT                   /locus_tag="PAS_chr3_0549"
FT                   /product="Alpha' catalytic subunit of casein kinase 2"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0549"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70597"
FT                   /db_xref="GOA:C4R4W1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4W1"
FT                   /protein_id="CAY70597.1"
FT                   /translation="MPEHSVSKVYADANEKKDKEYWDYDNVTLTWNSPEQYEITSKIGR
FT                   GKYSEVFEGYKIPQGSKVVIKVLKPIRRKKIKREVKILQNLLGGPNIISLLDTVRDSVS
FT                   KTPALIFESVDNIDFRTLYPTFSDLDVRYYMFQLLKALDFCHSMGIMHRDVKPHNVMID
FT                   HKQRKLRLIDWGLAEFYHPETEYNVRVASRYFKGPELLVDFRYYDYSLDLWSFGATLAS
FT                   MVFMKVPFFHGKSNTDQLVQIVRVLGTEDLYKYLEKYKLTLGEEYEALSYFVKRPLARF
FT                   ANDENAKYVCNEAIDLLDKLLRYDHHERLTAKEAMEHSYFDPIREMDPVP"
FT   CDS_pept        complement(1049879..1050571)
FT                   /locus_tag="PAS_chr3_1198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1198"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70598"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4W2"
FT                   /protein_id="CAY70598.1"
FT                   /translation="MNVVPEYFVKNVKFILLIHAFNELCTKSSTLSDVIPVLKRINKVL
FT                   RNTTFVDLKGNCKGNTNCRMFTHYFEALNKTLVAISAHTCANRHQIFQLAINIYLHLVQ
FT                   VMATKLFCTQQTRPIDKLLAHIAQPVVDSVIMDRPLPQSAPTPLPTYLELLKTQKLPST
FT                   KYNLSEVEQKDALYDLAHYFLTVLQLIIENSKDAFTLTDITHRKLLLAAIIHCSEPGLA
FT                   RIYRKIQW"
FT   CDS_pept        complement(1050991..1051767)
FT                   /locus_tag="PAS_chr3_0550"
FT                   /product="Meiosis-specific protein of unknown function,
FT                   required for spore wall formation during sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0550"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70599"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4W3"
FT                   /protein_id="CAY70599.1"
FT                   /translation="MEKRQKVTQDTVIPRLLHADYRAKVEEFKKVRIIQDSSIKDPASL
FT                   EYDMVIENQRGISLFGIPLYGGNSLVHPLDPPNYETESGRPVNDFELFPLPDLSWRWTW
FT                   DKWRVLMIGDLDEQGWSYAYTRFRGHRWRGIYRVNNFIRRRLWVRERIQEDSHLIEEDS
FT                   TDAMITQNSHPLKKTESPVDTEPDFPSDLSDLLENCKIDRERTELLLRSVLEKTKGDET
FT                   ILENYRDSIQKLVDETFVFNNSKKLFWDQLASVHHN"
FT   CDS_pept        1052002..1053717
FT                   /locus_tag="PAS_chr3_0551"
FT                   /product="Vacuolar membrane protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0551"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70600"
FT                   /db_xref="GOA:C4R4W4"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4W4"
FT                   /protein_id="CAY70600.1"
FT                   /translation="MTKPSFKEQMKGFPIWQIFVLGVVRFAEPITFTSMFPYVFFMVRD
FT                   FHIAPDEAHISKYCGYLSASFAFFQFLCSIHLGRLADVIGRKKVLMIGILGTTFSILVF
FT                   GFSTSFWMALFARSFMGAVNGNVAVIRTVLGEVATNPYHAPLAFSTLPLLWQLGCVIGP
FT                   MSGHLVKISAEEYTRSTYSYRLVSLVVQKSFLDSLVKKYPYCLPNLVVSVFLLFSLVFG
FT                   ALFLEETHHTLKDQRDYLLDIGDSIRNFLGFDVPQRPWRMPFKRGGSLMAVPSEADPLL
FT                   GSTSNEEEIEGYHVSEDDLDDDDDDLDDETTTVGKLYRTTSANIMRTFSNHSVDVSAEM
FT                   RRNHESGYPWHVLLEGKTFNAITQNFILCFTAVVFDEFLPVFLAYDVARDEDGNLASKF
FT                   PFLIAGGMGLNTPEIGTLLSTTGVAGVLVVVFIYPWVDITFNRIKALQCCLILTAVSYF
FT                   AVPYLVFTIPPNLPQAISTTLLYSTNILKTLASSLAFPQVILLIHRASPREHSAFVNGT
FT                   TLSLTALARALGPFIWGYVVSISVNHEIVWLSWVLLAAVAFVGFYLSHSLKGLQ"
FT   CDS_pept        complement(1053781..1054773)
FT                   /locus_tag="PAS_chr3_0552"
FT                   /product="UDP-glucose:dolichyl-phosphate
FT                   glucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0552"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70601"
FT                   /db_xref="GOA:C4R4W5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR035518"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4W5"
FT                   /protein_id="CAY70601.1"
FT                   /translation="MVRTLILVALGLVVVALLVLYLLVLLFSHSPRNPFESELYFITTE
FT                   KDGSKSAPLPLPVANSPSDGTIELSVVIPCYNETSRLKLMFDDSINYLKETLPDRFEIL
FT                   IVDDGSKDSTDSYALDLAHNTYNLKPGQLRVIKFEENRGKGGAVIHGLQHIRGEYGIFA
FT                   DADGASSFKDMSKLLAQVKNVENKNNDKIPAIAIGSRAHMVNTDAVVKRSFIRNFLMYG
FT                   LHMLVYVFGIRQIKDTQCGFKLFNKSSIALIFPFMHTEGWIFDVEILIIALRKGISVSE
FT                   VPISWHEVDGSKMDLARDSMNMAIDLVVTRMAYILGIYKDSVVTKTKVE"
FT   CDS_pept        complement(1054973..1055521)
FT                   /locus_tag="PAS_chr3_1199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1199"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70602"
FT                   /db_xref="InterPro:IPR016813"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4W6"
FT                   /protein_id="CAY70602.1"
FT                   /translation="MSGGPVPVFKKYTTGSKGIWEKIRQLLTLVPNRSTGNPLVKNYRV
FT                   PPPGSQTLKYKDPVTIPAGDIVKNQYYDRDHRRNYPRLVAFDQTKVSGLLTLGSAQNPR
FT                   ISVGEKGQKELAVFDQSVSLSSTLATIDPKVVKSELLAEGGSPVVAPSLNKKMKFRLTE
FT                   ESEHGMYPEDYPIRIFAQN"
FT   CDS_pept        1055726..1056490
FT                   /locus_tag="PAS_chr3_0553"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70603"
FT                   /db_xref="GOA:C4R4W7"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4W7"
FT                   /protein_id="CAY70603.1"
FT                   /translation="MVRWSVFRRRRNGNETDAIQEEHIDRSESVGSLNSASDDRVIEEY
FT                   DPYDNDSLREMIRLIAERRREIGVSASEPEEDRRDGVEEATTRAYRPANTFPVDQRPVT
FT                   MRFWDAIGATVFPILLVRIIKELFSVTVFSSDIIRDTEEFFNLTGNEVITKFSTASPVD
FT                   TTSNKSQRVTTSLILKFYRIFISEMSFLNADSGFLRLLTISTFYTYTALASMFMVTAVV
FT                   FLLACSSFTIGRRLHLLQTLAKNLFTHETGVF"
FT   CDS_pept        complement(join(1056655..1057103,1057212..1059447))
FT                   /locus_tag="PAS_chr3_0554"
FT                   /product="Zinc-finger protein involved in transcriptional
FT                   control of both nuclear and mitochondrial genes"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0554"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70604"
FT                   /db_xref="GOA:C4R4W8"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4W8"
FT                   /protein_id="CAY70604.1"
FT                   /translation="MSSSSSPSAKATQPIPKKSMLIKTDKPRTHVCQTCTRAFARLEHL
FT                   KRHERSHTNEKPFQCGVCGRCFARRDLVLRHQQKLHLEVFNSNKRKYTRRQSSGGVSSN
FT                   SDSNGNETDALNDNINIVHNNTEASLPLPDRDNLSSMKQPLPQTVGTTDSDSSPFSPQN
FT                   LESLPISQSFNFPLSKNYTMQTAKSTTTDNASNNTPTLTNQPMQDYSNISGVPMEYFDQ
FT                   NLNLLQKSEDWLNEFINTPFDTKFPQASSNVGFHETPEQISIPQMSTTASLNTESPINS
FT                   NDLSMLFKSRQLDLFSKMDFNSFGTAPDESGARLTEDLRFHIMSTYNLSNGQFPQLSEL
FT                   NSYLSFYEQEFDRYFPFIHIPSLNILENYEQIPLLLSMAAVGALYSFHARNSTMLFNFA
FT                   RYLIHNYMEKHINSKLSPSNLSPDGRPGMMNANSNGSNFEDVPLFVTQSLLLHMYLGIF
FT                   HNDLDVSHTAIKQLTSLVGLVKTTHLDTPLENFIMPPTALSKDNLTDQTLLKNNYDYFI
FT                   LAQSRIRTVHCLYLLNILFTSLCDLPIALHPSDMKCGSPCDGDLWRVKSPQEWVQCVSL
FT                   ESFNIIHISNGESSFADIWYDLTNHYCDKGVSLRTLLSLLMTLNGLVHIERKNFNDNEC
FT                   DINKRAARWRLNSRLQIESLIKTWESLCIVNGGVLVPRGQRSILNINKRPVLKLILPLL
FT                   SFVKIRKCVEISPFMEKVWQRNWPGMITAIKQLDKDPEALREAANYAMDIIKYVYATEI
FT                   WAKNYLVSTNMKSPSPLSTSDRVIWLRVETLMKKVDFNLTPKGSNQTSYSEFLRIQANG
FT                   ALDVEILDDEIAQLTLEPGDLKPIAQIITAARLSSRSLSLGVRILADAPVWPIAMVFAE
FT                   ALKARATDIHIQHNTYSANPSPV"
FT   CDS_pept        complement(1060927..1062618)
FT                   /locus_tag="PAS_chr3_0557"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0557"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70605"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4W9"
FT                   /protein_id="CAY70605.1"
FT                   /translation="MNKERLSPPLNVSQRSDMLHDNEHVADRMHMDLVMKNHNLIREQE
FT                   RLELLLHQLQEELTIKGSRLNELVLENKKLSNELQHEIEINEKEFNRFNGLKKTYDYKV
FT                   KQLSNLLNNQNNQDHSHSLTEKFNDSAAIEELSKQLHVLEKDYELEKSSKVLIIDQFEL
FT                   MKQDYTELHTKYSRLQQSYEELIEEMSFEDLDSHPEQESSIPETPSNLEQEFFGGVDLS
FT                   SQASKRLSINFLSGNSSLVGDEDPSIDEEEKKVNIQDNNHNKHGHRNPSHNKLNGNNNA
FT                   THILDMDLDVYSMQMRNQSYLHNQELIKLEFELKSLRLQNEKLYSYIGFLLQKTANDSF
FT                   STFKHEFEYEYSDAINIESAKRNLRQIMRSSSAMPIRPELHQTSNNSDEDDYGNETVEN
FT                   IDLDSLTTDINNDKKRGSLNQDSRTDRSFSVDLTIPPLTVKKRQKSTHKLKGTDTNRYE
FT                   IIRDITSLKLQNIRRRKRDKKLKSLHLKRIPSNTLVNSYPILSSSLSSSMMMCHRHHMV
FT                   DCHCQTYFLPINSMFNGLILSLNNLLLGTALIPMTEQKQELFLDVD"
FT   CDS_pept        complement(1062822..1063754)
FT                   /locus_tag="PAS_chr3_0558"
FT                   /product="Putative protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0558"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70606"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4X0"
FT                   /protein_id="CAY70606.1"
FT                   /translation="MSLFDLLRQRVPVRILPLPTRDECTEDFFYQLISTCESIVTSNPF
FT                   YVRKALSRIVDSLEARSIYDDNYFDKLYELYASLSSQPLGDLDTIPQDILEYRINEQKS
FT                   VKIKESPNFISGRGTTGLRTWEASKLLALRFNNDKSYLPYIQNKKVVELGAGTGLIGIS
FT                   LLRLASHVTLTDGDPNLVDQITNNIRLNENDALFDLKTYSSRVLLWGGPESAPKCDTLI
FT                   GADVTYDVSILPELVKSLQSYEYSVALIGATVRNEVTINAWEGQLTDAKLNWEIIEIKQ
FT                   ISSDPGVFDEPIWFDPSGGLSIKVYKICK"
FT   CDS_pept        1064241..1065572
FT                   /locus_tag="PAS_chr3_0559"
FT                   /product="ADP-ribosylation factor GTPase activating protein
FT                   (ARF GAP)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0559"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70607"
FT                   /db_xref="GOA:C4R4X1"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR038508"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4X1"
FT                   /protein_id="CAY70607.1"
FT                   /translation="MSADEFATKAEVEEIFKRLKKRPANQQCNDCQASNPSWTSIPFGI
FT                   FVCLECSGEHRNVGVHISFVKSSVLDANWTYRELRSMKNGGNDLFKEFYNKNGGGSLLT
FT                   TGVKQKYDNPIAVNYKKKLAQKVEKDFAKFPDVLDGTGSDNSTPEPTDHHEDFFSSWSK
FT                   PAVNSSTSSLNAISSRSGTPQLPQNSAPKRTTVKTTTTSGPKKNILGGSSTRSRARLGA
FT                   KKLSAKEANFDFDDFEKQAREEEEAVKKLGYNPADSSIESASTATNSITAPVESSKTQD
FT                   AFVLEPSYSNASTASVKKTTQQFAKLGFGMTASSSNPEPSVEKASRPARHGALNDDTPG
FT                   EISQKFSGQKAISSDQVFGRSTYGEDSNARSKLQTEFNGATAISSSSYFGQPDPKPAPS
FT                   RGLTASNLEEKVYDVFGDDINQLKDVLETGAEKFSSYLRDYLRN"
FT   CDS_pept        complement(join(1065668..1066197,1066467..1069953))
FT                   /locus_tag="PAS_chr3_0560"
FT                   /product="Protein involved in positive regulation of both
FT                   1,3-beta-glucan synthesis and the Pkc1p-MAPK pathway"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0560"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70608"
FT                   /db_xref="InterPro:IPR006031"
FT                   /db_xref="InterPro:IPR012965"
FT                   /db_xref="InterPro:IPR037508"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4X2"
FT                   /protein_id="CAY70608.1"
FT                   /translation="MKDELELPALPPLEDRKRKSKISMDPFVFASEFDEDSYDSYKKQY
FT                   TEHVKETIGLSRDPFDVELQKHELKDLIHAITNEIKLKGTRAPYFFLPFRPQLNDYRLK
FT                   VFLNRVFIEGKPASLKVIEKVVKKTDEFTLTSALKFLWSRLPNGYIVGWKSYAQFAKLE
FT                   QEQNYPQRAFLDIIPQCLLSPSHASIVYDFFDLIVAIAADTKQNKMSARKISKMCGIWA
FT                   FGPIKVSPKGDTSYHRGIANWLPASDAIFHLLLSFVRSMLPESPNDEYKLPRTLQNLVL
FT                   SNSYPPAETVLTSRSNLVDVPLITLKVNNPSRSPIEMLHRVGKTLKFDDTNLFYTREEY
FT                   ILLKSLFKDYQSLPQKLSSEGKRVMDNFCMFDEDLISDGAGSNHIRFKLCSGWSSEMLQ
FT                   PYENWDESKGDYFTANISKTLIDDYFVWTWLASVSSEQTRIKRNIFGKTYILETEISPG
FT                   YKKWVIVEEIDISRNGYDLDIELKEEKLKKLQMNIEKLEKRKSNLLEKEYRNQKKTKPK
FT                   KLNKIEPPPKDTPYVYRGFPKDFPQNLAEKELPPTPPIIKESLPQSMDKSGDYISLNLP
FT                   KDEEQRVTLTSPHKAQQKVAPAVRQISEGVSEESNSLTISDEPDSSSSVNQDYLLIEND
FT                   RIDDPMDDLRDIIERIDIEEIEHQNYSELVSKVSPTVITTRPSMKEEKRGRKEEIRRKE
FT                   PKIINGPKELGGDVYRVPGDIPESDDSFYLQRKPPSDSLPRHLKGVSPPPLSTEHSPRK
FT                   VNSTSSSPSLPVHVSTNFTPKVESKNTLKSNIFNEIENLEAELQDVLNDDVSSKDVRLG
FT                   LTAGTSSVYSSVMSHRIERNEFPARSENSSEPLDHNRIDPVITKSPVDNQGTPQTTPQV
FT                   RDGAELSDTTPQNSRIRQPPTVRQQTSSPLSPLDRRNPLQNSSQDFISPKNKPETYHTP
FT                   SPQEHYPHQVYPNASQGPAPNGNSLQTYPPQNYPPRDYPPRGYSPQANLQEYSPKGYPT
FT                   EGYPSQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPSGFPPQSYPSPSHG
FT                   QGRRIYHPVQGTQGYYPPPNQAQYQQTQFLHPPSPYQGGAGHQSSYSLTRDPRSASNSP
FT                   RSSNSPARSQDAATPETFSQKMVANSFVPAAKVNKLHGHSNKSADKKNLRDALNNDVLI
FT                   PIAYLLPEYIKAMNVITLKVSPEKLEKFGKIDTLEIKQPRPLKKLTVTLSQSNSASTTK
FT                   PSTPLSKRALLGDRSSPIPSDSPSSSAAGNGTRYKSKGAPGGHSLSLSGTLDKTGEPRK
FT                   WFRQAREIKSFSGFIIPFTTWKGEWKKEDDEKDTNTDFKNESNNSTPIGTPIPE"
FT   CDS_pept        1070192..1072057
FT                   /locus_tag="PAS_chr3_0561"
FT                   /product="Gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0561"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70609"
FT                   /db_xref="GOA:C4R4X3"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4X3"
FT                   /protein_id="CAY70609.1"
FT                   /translation="MKPYHHAKSRPIGSYLYFGVFTVALTFLTWLKYDAELFAQQVHSK
FT                   DIYDPQFNITLPIDGPTFTPSKNYSISVQNAAVASDIEQCSKLGVSILQQGGNAADSAV
FT                   TVALCIGTINSYSSGIGGGGFIVSKLIDNPTALSFDCREMAPSKSFKEMFNYHEEKARV
FT                   GGLAVAIPGELKGLYELFQHHGSGNVEWKDLILPVAELAEVGWTVDPLFSSALKSIEHH
FT                   IYEHSYDWAFALNEDGKIKKRGDWINRPMLATTLRRIAESGNVDLFYDPESDIVQSMVN
FT                   ATRKYGGILEASDFAKYRVRIEESLTLHNFTSDGLTVYTSNGASSGLVLLAGLKLMDLF
FT                   EDFKEFHNDFGAVESQRLVETMKWMASVRSNLGDLNIYSTNETEIDDHRKRYDRYKSDE
FT                   WAIETHAKINDSHTLPSWKDYAPAFLPNDPHGTSHFSIVDQYGNAVAMTTTVNLGFGSK
FT                   IHDPISGIILNDEMDDFSVPTSSNAFGLHPSIYNWVEPYKRPLSSCAPTVIVDSLGVPH
FT                   FVIGAAGGSKITTTVLQAIIRVYHYHLDLLDVIAYPRFHHQLLPEEVLLEFPRDNKLIR
FT                   HLKERGHDVRVQAPISTMNGILRKRGGSLIAVSDHWRKLGRPWGF"
FT   CDS_pept        complement(1072143..1073420)
FT                   /locus_tag="PAS_chr3_0562"
FT                   /product="Mitochondrial translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0562"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70610"
FT                   /db_xref="GOA:C4R4X4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4X4"
FT                   /protein_id="CAY70610.1"
FT                   /translation="MLLRRQFTRALNNTFPRVIRPTQLVRTAATFDRSKPHVNIGTIGH
FT                   VDHGKTTLTAAITKVLSSSGAADFKDYSSIDKAPEERARGITISTAHVEYETANRHYSH
FT                   VDCPGHADYIKNMITGAAQMDGAIIVVAAADGQMPQTREHLLLARQVGVQNLVVFVNKV
FT                   DTIDDEETLELVEMEMRDLLTTYGFDGDNTPVIMGSALCALEGKRPEIGEDAIRKLLDA
FT                   VDEYIPTPERDLEKPFLMPVEDIFSISGRGTVVTGRVERGNLKKGEEVEIVGFNDQPIK
FT                   ATVTGIEMFKKELDQAQAGDNAGILLRGIKRDDLKRGMILSKPGTVNAHTKFLASLYIL
FT                   TKDEGGRHSPFGENYRPQMFVRTADVTVVLRFPEDADHSAQVMPGDNVEMECEIVHATP
FT                   LEVGQRFNIREGGHTVGTGMITRIIA"
FT   CDS_pept        1073587..1074219
FT                   /locus_tag="PAS_chr3_0563"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0563"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70611"
FT                   /db_xref="InterPro:IPR024974"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4X5"
FT                   /protein_id="CAY70611.1"
FT                   /translation="MPVIFVKTMPGLADLRIVTDYDTTIEDLNRNLMNMLPLTVQKRGV
FT                   ITKMDGSPLLKLRNVSELKGDFVDLQLRIPLCGGKGGFGSNLKLKARKLKGKRKDELKV
FT                   ETQHEMKTQKVLPLPSLRDKKRLLKARKDKLQRLVDMDVRRLLDDNEHFNVPTLESIFE
FT                   EVENSVASVREAVMKINDNRTMANEANKTTTRNYQAKHDVFGDFFEE"
FT   CDS_pept        1074285..1075424
FT                   /locus_tag="PAS_chr3_0564"
FT                   /product="Beta subunit of the translation initiation factor
FT                   eIF2B"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70612"
FT                   /db_xref="GOA:C4R4X6"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4X6"
FT                   /protein_id="CAY70612.1"
FT                   /translation="MDFLLPRKLTSSTKPISFMSQTQQQIQEQVDGLVYKLKRRQLAGS
FT                   YKVAIETAQLLMRLITMARWKNTDQLIELIRDAGRQLIAAQPREFASGNIVRRVLSLIR
FT                   DESLEMDREKPDIDKNTAMMSSMFSLLSTTDTKNQQQHSTSDAKQRTQDLRSLVIQGIR
FT                   DLMDEISAVHENIELMSIDLIHDNEVLLTPTPNSQTVLNFLLKARQKRKFTVLVTECFP
FT                   NHTEDAHKFVKKLADAKIDTVLIPDSTVFAVMSRVGKVIIGARSVFVNGGCVSTSGVAA
FT                   VTECAKEHRTPVFTVAGLYKLSPTYPFDNDSLIEVGNSGKVIDYSDQDLVGRCEVTNPL
FT                   MDYIDPENIDIYITNVGGFSPNFIYRIVLDNYKSDDVNL"
FT   CDS_pept        1075751..1076647
FT                   /locus_tag="PAS_chr3_0565"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0565"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70613"
FT                   /db_xref="GOA:C4R4X7"
FT                   /db_xref="InterPro:IPR007150"
FT                   /db_xref="InterPro:IPR016580"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4X7"
FT                   /protein_id="CAY70613.1"
FT                   /translation="MKLKLCVSNTDVLLSTLSAIQPLRKLCVLRFTPVHLCIISMALNE
FT                   PQAWCKISQEVFPLYEVESIRDNVLCVETNIDPLINALRNFDKSNSDGLSIRLQRRPVA
FT                   NEGPESSKKNRSMAVLSLIYTEHVSMASSRSYSFKIPVKVLKAEIDQGIVEPQLTHAEV
FT                   LMKLDRDILPLFRRIERYKRSGYICVTGTNRGRLELSIEEDSRKVQLSWKEFLQVQQLE
FT                   GETQQQSQFSTQDQDMPHSVQIKLKDWRLGAKLTELCYKVVMIISENHALVLHCILNED
FT                   ETAEVTYYIGGKIQDQE"
FT   CDS_pept        complement(1076638..1077810)
FT                   /locus_tag="PAS_chr3_0566"
FT                   /product="3-phosphoserine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0566"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70614"
FT                   /db_xref="GOA:C4R4X8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4X8"
FT                   /protein_id="CAY70614.1"
FT                   /translation="MAKTLEREEPHYFGAGPALLPTSVLQEAAYDLVNYQGVGIGIGEI
FT                   SHRSKQASEVIDNTKANLVSLLNIPDTHEVFFLQGGGTTGFSSIASNLTASFVKKTGRK
FT                   GRAAYAITGTWSKKSVEEAQRLGLDVDIVLDSKKVDGKFGSIPPVDKWSIPTDLSNTSY
FT                   VYYCDNETVNGVEFKEFPFESFPGVEVVADMSSNILSKRLDVSKYGLIMAGAQKNIGLA
FT                   GITIYIIKKSLLEQADDATLKALEVPLSPIAVHYPTVVKNNSAYNTIPIFAVHVVNLVL
FT                   RLLVKNGGVDAQQKINEEKASILYGALEKFPQVYELPASTDARSHMNVVFTLNGDLDAE
FT                   FLAQAAERKLNGLKGHRSVGGMRASIYNAVSLHSVQELTKFIIEFAEAHS"
FT   CDS_pept        1078075..1079160
FT                   /locus_tag="PAS_chr3_0567"
FT                   /product="Peptidyl-prolyl cis-trans isomerase
FT                   (cyclophilin)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0567"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70615"
FT                   /db_xref="GOA:C4R4X9"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4X9"
FT                   /protein_id="CAY70615.1"
FT                   /translation="MTPRSHIFFDISINNQPAGRIIFELFNDIVPKTAENFRALSTGEK
FT                   GIGKSGKPLHYKGSTFHRIIKDFMVQGGDFTNGNGTGGESIYGEKFEDENFQLTHDKPF
FT                   LLSMANAGPGTNGSQFFITTVPTPHLDNKHVVFGKVIAGKATVRKIERNSEGEAPIEPV
FT                   VIEDCGELPEDADLTISDETGDKYEEVLKDNENIDIDDFEQVYQAITEIKELGTKYFKN
FT                   GDTKIAFEKYQKAANYLLEYIPSDLSEEQSSKLELLKTSVFSNVALAGLKVSKFKDTIK
FT                   YATLVIEDESADAKAKSKGYYRRGSAYSSLKDEDSAISDFQKALELSPGDPAISQSLQR
FT                   TTKARKDRLAKEKAALSKFFE"
FT   CDS_pept        1079704..1084935
FT                   /locus_tag="PAS_chr3_0568"
FT                   /product="RNA polymerase II largest subunit B220"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0568"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70616"
FT                   /db_xref="GOA:C4R4Y0"
FT                   /db_xref="InterPro:IPR000684"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007073"
FT                   /db_xref="InterPro:IPR007075"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR038593"
FT                   /db_xref="PDB:5X4Z"
FT                   /db_xref="PDB:5X50"
FT                   /db_xref="PDB:5X51"
FT                   /db_xref="PDB:5XOG"
FT                   /db_xref="PDB:5XON"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4Y0"
FT                   /protein_id="CAY70616.1"
FT                   /translation="MSQFPYSSAPLRSVKEVQFGLLSPEEIRAISVVKIEYPEIMDESR
FT                   QRPREGGLNDPKLGSIDRNFKCQTCGEGMAECPGHFGHMELAKPVFHIGFIPKIKKVCE
FT                   CICMNCGKLLLDETNPTMAQAIRIRDPKKRFNAVWQLCKTKMVCEADAPVDEYSEQKVV
FT                   SRGGCGNTQPVVRKDGMKLWGTWKKSGFSDRDAQPERKLLTPGEILNVFKHISPEDCFR
FT                   LGFNEDYARPEWMIITVLPVPPPQVRPSIAMDETTQGQDDLTHKLSDILKANINVQKLE
FT                   MDGSPQHIINEVEQLLQFHVATYMDNDIAGQPQALQKSGRPVKAIRARLKGKEGRLRGN
FT                   LMGKRVDFSARTVISGDPNLELDQVGVPISIAKTLSYPETVTQYNIHRLTEYVRNGPNE
FT                   HPGAKYVIRDNGDRIDLRYHKRAGDIVLQYGWKVERHLMDDDPVLFNRQPSLHKMSMMA
FT                   HRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQS
FT                   NKPVMGIVQDTLCGVRKMTLRDTFIEYEQVMNMLFWVPSWDGVVPQPAILKPKPLWTGK
FT                   QLLSIAIPSGIHLQRTDGGNSLLSPKDNGMLIVDGKVMFGVVDKKTVGSGGGGLIHTVM
FT                   REKGPKICAELFGNIQKVVNYWLLHNGFSIGIGDAIADASTMKEITHAISSAKEQVQEI
FT                   IYKAQHNELELKPGMTLRESFEGEVSRTLNDARDSAGRSAEMNLKDLNNVKQMVSAGSK
FT                   GSFINIAQMSACVGQQMVEGKRIAFGFADRSLPHFTKDDFSPESKGFVENSYLRGLTPQ
FT                   EFFFHAMAGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTTRNSLGDIIQFLYGE
FT                   DGLDGTQVERQTIDTIPGSDKAFHKRYYVDLMDEKNSIKPDVIEYAADILGDVELQKEL
FT                   NSEYEQLVSDRKFLREIVFVNGDHNWPLPVNLRRIIQNAQQIFHLDRAKASDLTIPEII
FT                   HGVRDLCKKLFVLRGENELIKEAQQNATSLFQCLVRARLATRRILEEFRLNRDAFEWVL
FT                   GTIEAQFQRSLVHPGEMVGVIAAQSIGEPATQMTLNTFHYAGVSSKNVTLGVPRLKEIL
FT                   NVAKNIKTPALTVYLDREIALDIEKAKVIQSSIEYTTLKNVTSATEIYYDPDPTSTVIE
FT                   EDFDTVEAYFSIPDEKVEETIDKQSPWLLRLELDRARMLDKQLTMNQVADKISEVFSDD
FT                   LFVMWSEDNADKLIIRCRVIRDPKAMDEELEAEEDQMLKRIEAHMLDLIALRGIPGISK
FT                   VYMVKHKVSVPDESGEYKNEELWALETDGINLAEVMAVPGVDSSRTYSNSFVEILSVLG
FT                   IEATRSSLYKEILNVIAFDGSYVNYRHMALLVDVMTSRGYLMAITRHGINRADTGALMR
FT                   CSFEETVEILFEAGAAAELDDCRGVSENVMLGQLAPMGTGAFDVMIDEKLLTSLPADYA
FT                   PTMPLFKGKATQGSATPYDNNAQYDDEFNHDDVADVMFSPMAETGSGDDRSGGLTEYAG
FT                   IQSPYQPTSPGLSATSPGFAPTSPGFAPTSPRYSPTSPGYSPTSPSYSPTSPSYSPTSP
FT                   SYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPQYSPTSPQYS
FT                   PTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTS
FT                   PQYSPTSPQYSPTSPQYSPTSPQYSPASPQYSPSRHSPNGESKEGE"
FT   CDS_pept        complement(1085043..1087070)
FT                   /locus_tag="PAS_chr3_0569"
FT                   /product="Biotin:apoprotein ligase, covalently modifies
FT                   proteins with the addition of biotin"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0569"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70617"
FT                   /db_xref="GOA:C4R4Y1"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR019197"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4Y1"
FT                   /protein_id="CAY70617.1"
FT                   /translation="MQLRNLVDKMNVLVYTGNGTTTDSIKHTLYSLRTLLSPYYAVIGV
FT                   DSKVLLNEPWQSKTALLVFPGGADLPFCRQFNGEGNQKFSKFVRQGGKYLGLCAGGYYA
FT                   SARCEFEVGNKELEVSGPRELKFFPGIARGTAFGGFQYKSEAGARSTILDVDEEKLPGC
FT                   GRTVYNYYNGGGVFVDADQFSNVEVLATYRDHVCVDFGSGKAAAAVVGCSVGKGYAILT
FT                   GTHPEYTHLLMKKSDSVPDFERVISELRTKENERLAFLRSLLHKFGLKVNDDSLAQPTL
FT                   TPLHLTSLYPEKLQQLVKSMETNIGYTNGLLKCTTDRFRLSLSAENLQKLDQDFQVPEE
FT                   AIKQLVVHINSLPDRKDTPFFNLESYYNHLKRFWTRYNHPMGDFGSTLIYGEVLTSTSS
FT                   LMDKNANLLRLLPHGFTITGTTQVSGKGRGGNVWINPPGVLAVSTVMKLPTSYSERAPI
FT                   VFIQYLATLAYIEAILRYDESGLYSTIPLRIKWPNDIYILKPEFVEDVSKIPHGEAAYV
FT                   KVGGILLNTNIFDEQYHMVAGCGLNVNNAAPTTSVNSVISAINEVRAKKGLTGIPPVEM
FT                   EVVLAGFLYHLERMFNEFKTSGFSPFLDLYYRRWLHTGQIVHIQHQNNIRAKITGITED
FT                   WGMLIAQEVDSENNLTGARFELQPDGNSFDMFNGLISKKN"
FT   CDS_pept        1087231..1088157
FT                   /locus_tag="PAS_chr3_0570"
FT                   /product="Cardiolipin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0570"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70618"
FT                   /db_xref="GOA:C4R4Y2"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4Y2"
FT                   /protein_id="CAY70618.1"
FT                   /translation="MYFGGAVRRVAFVSGGPFHHLTMPTLRALPPLAVVNLLSVRHLTN
FT                   KSPQRKQTMITKTKEIGKKMSIETVETTKKIKENTLAKSKELKESFSSMIPSEYHENIY
FT                   TIPNILTFTRLLSAPIIGYLIVHNHVTSALSLFTYSCITDFIDGYIARKYNMKSVVGTV
FT                   IDPMADKSLMIICTACMAQSHQIPMYVAVIILGRDVLLGLSAIYYRYVSLPRPKTFKRF
FT                   WDFSIPSAEVRPTTISKINTGLQMVYIGSSMIKPVLIPYLTSDSSAMVLQGLFALEITV
FT                   AISTILSGLSYVFSKDAVRILNKENAK"
FT   CDS_pept        complement(1088183..1089766)
FT                   /locus_tag="PAS_chr3_0571"
FT                   /product="Subunit of the cytosolic chaperonin Cct ring
FT                   complex, related to Tcp1p"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0571"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70619"
FT                   /db_xref="GOA:C4R4Y3"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012717"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4Y3"
FT                   /protein_id="CAY70619.1"
FT                   /translation="MTSTHQSNSIFKDKEKPQEVRKANILAARAVADAIRTSLGPKGMD
FT                   KMIKTGDGKIIISNDGHTILKHMAVLHPAAKMLVDLSAAQDTEAGDGTTSVVVITGAIL
FT                   GAAEKLLNKGIHPMIIAESFQRAAARSVEILLGMSHKISLDDREQLIRAATTSLSSKIV
FT                   SQHSHILAPLAVDSVLKVSNEYANNVDLNDIKLFKKVGGTIDDTEVVNGLVITQNVVKS
FT                   ANGPTRMEKAKIGLIQFQLSPPKPDMENNVVVNDYRQMDKILKEERAYLLNICKKIKKA
FT                   KCNVLFVQKSILRDAVNDLALHFLAKLNILLVKDIERDEMEFISKSTGAKPIADIDSFN
FT                   ETKLGSADLVEEIESSGSRIIKVSGISSATKPTVSIVCRGANEMVLDETERSLHDALCV
FT                   IRCLVKEKALIAGGGAPEIEVSRTLLKESNKLSGMEQFCFKEFALALEVIPTTLAENAG
FT                   LNPIEIVTELISKHDAGEKNAGISVRRSGTTNTFDEHVLQPVLVSTSAITLASETVKSI
FT                   LRIDDIAFSR"
FT   CDS_pept        1090117..1091079
FT                   /locus_tag="PAS_chr3_0572"
FT                   /product="Protein involved in nutritional control of the
FT                   cell cycle"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0572"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70620"
FT                   /db_xref="GOA:C4R4Y4"
FT                   /db_xref="InterPro:IPR009772"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4Y4"
FT                   /protein_id="CAY70620.1"
FT                   /translation="MPGKVHIFNELSTTDEDLSACSYSSWYRTFSENVVSPAKIIEVPD
FT                   SFIEYISKDSIHLPGDDNNNVEINDDNDYSDWSDAEETFLDPSENFSEFHSKVKDVITQ
FT                   YSHVAPKLNWSAPRDATWIMMNNTMKCSSVNDVYLLLNSSNYVAHDLKLETSLKYELVL
FT                   RKWVEINPALEFRCFVRDGKLIGISQRDLNYYNYLDSLKDVIESGIKKFLEETVSPKFP
FT                   LKNYVIDVYFPRPFTKMYIVDFNPFNRSCDSLLFTWHELTIATHVDFRLVTEHNPSRFA
FT                   AKEHSENQVPKDIVDASLDSAAMAELAQKWNELMKKEEP"
FT   CDS_pept        complement(1091080..1092813)
FT                   /locus_tag="PAS_chr3_0573"
FT                   /product="Component of the small (ribosomal) subunit (SSU)
FT                   processosome required for pre-18S rRNa processing"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0573"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70621"
FT                   /db_xref="GOA:C4R4Y5"
FT                   /db_xref="InterPro:IPR018972"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4Y5"
FT                   /protein_id="CAY70621.1"
FT                   /translation="MGKRGTRRNRASNIDFSEEQAVTNELDDFAEAREKILLEESGMGA
FT                   RFDANDISDEDEEVAVLGLDEDESSDEEEALARKFRGASAMDDDEDAELYNDLEKTEKN
FT                   EEPEWGESRDDYYGGAELEDEEAIKLMEQEAIKQQKKHLEDLNMEDFLDDDMDQEWKQS
FT                   AEKETLSTETAMEPIKADELSSDEQVKFLKKAYPEFLPLLKEYQKMKPLLLEFKDQDSQ
FT                   ISKVKFTALSAYLGTIAVYVALFVSALESKEQFTMKDHPVMEGILNTREVWRQANELSG
FT                   KLSNSKFSDASKSIPIEGESESESEYQSLIDHGDSEDSGLEVDLEQNSEKQQIPSSNKT
FT                   LQDDSDSDSDAPREYNIKSLDHKRKNVGDDLTQQEKRARKRSLRFYTSVIDQADGKKTV
FT                   KYAGDDDIPYKERLFERQQRLIEEARKRGDNTNTSAPGEALDEGDFEAADEEVAKDVNN
FT                   LDDSYYQNVLNTKKEQKAARKALYEEAVQAAKEGKLDQFEEKIGTDGKRAVNYQILKNK
FT                   GLTAHRKKENRNARVKKRNKYEKAQKKLKSIRAVYTGEQGPYEGEKTGIKKNLTKSVKL
FT                   V"
FT   CDS_pept        1092941..1094023
FT                   /locus_tag="PAS_chr3_0574"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0574"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70622"
FT                   /db_xref="GOA:C4R4Y6"
FT                   /db_xref="InterPro:IPR007811"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4Y6"
FT                   /protein_id="CAY70622.1"
FT                   /translation="MSDDSNLNRLDSISRRTTPVGNESNASKKTGLKFKPKLVARRTKE
FT                   ERDKSAPVVVESQDPMRRKTRGTVTRGRGRGRGAPAGTHMVVAGPLSHGVQGHVGGDSR
FT                   TRSTPLPSSTASTSEALKKLHGKSGSDDEFEVDDTTVIDVNTKFELNQDTELFPVRAPR
FT                   VEHQENGEADVKIETDPNLLPGNTTTSREVSLKPEPMSDDETGAFTATPLEIKEQSATP
FT                   EPISSLDPLQEKEEKSKLTKDYEHIKQLMEQMNVSKDDDGDVSMEPQSLPKPLFFQLPN
FT                   TLPTFEGVGSEMHNLNGIIGSLRVHKSGRTTVKIGNVIMDVAEGGKSPVFQELIAINHD
FT                   KKEIYNLGSVENKLIVTPSI"
FT   CDS_pept        complement(1094053..1095063)
FT                   /locus_tag="PAS_chr3_0575"
FT                   /product="Cyclin associated with protein kinase Kin28p"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0575"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70623"
FT                   /db_xref="GOA:C4R4Y7"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR031658"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4Y7"
FT                   /protein_id="CAY70623.1"
FT                   /translation="MTSSDSTNQEETPQPEKHSKQITNDDLYRRSTQFRFWSFTEQRLK
FT                   DLKRSTNEKGAANLKERISQLDPSIPEVSEIWEKDLVKPLTVEEEVKIVEYYARKAQGL
FT                   ANYFKLPTQSRATAISFFRKFFLVNSCIQFHPQYIMYTCLFLAAKSDNHFIGIKEFSKA
FT                   IPKTTPESILQYEFQILQSLKFALLCHHPYKPLYGFFLDFQVEMKNNIQSDKLAELYDH
FT                   ARDKVSEALFSDVSFLFTPSQIALAAYYELNPELVTSYLSKKFSQLSTINEDEQLKPSP
FT                   NIQTKLVDNLKHCIELSHASFDPEIEEVTQISRKVHYCIDPMKLVKKMQKQKAVS"
FT   CDS_pept        complement(join(1095358..1096780,1097035..1097171,
FT                   1097427..1097507))
FT                   /locus_tag="PAS_chr3_0576"
FT                   /product="Alpha subunit of the F1 sector of mitochondrial
FT                   F1F0 ATP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0576"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70624"
FT                   /db_xref="GOA:C4R4Y8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4Y8"
FT                   /protein_id="CAY70624.1"
FT                   /translation="MLSARPVIRRAARSAVAINVARSVPRVVRPLVSRGYAAAKAAPTE
FT                   VSSILEEKIRGVSAEADLNETGRVLSVGDGIARVFGLNNCQAEELVEFSSGVKGMALNL
FT                   EPGQVGIVLFGSDRGVKEGDTVKRTGKIVDVPVGPELLGRVIDALGNPIDGKGPINSKV
FT                   TSRAQLKAPGILPRTSVFEPMQTGLKSVDALVPVGRGQRELIIGDRQTGKTAVALDTIL
FT                   NQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQNDALKYSIIVAATASEAAPLQ
FT                   YLAPFTACAVGEWFRDNGKHALIIYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLH
FT                   SRLLERAAKMSDKLGGGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGI
FT                   RPAINVGLSVSRVGSAAQVKAMKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLNR
FT                   GERLTQLLKQKQYAPLAAEEQVPVIYAGVNGFLDSVPLERIGQFEEEFLAYLKSNETEV
FT                   LEAIRVKGQLSDELLAKLKSATESFVATF"
FT   CDS_pept        1097957..1099444
FT                   /locus_tag="PAS_chr3_0577"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0577"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70625"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4Y9"
FT                   /protein_id="CAY70625.1"
FT                   /translation="MSLEAALDDERKQIIDILERQKRRESGARGRSVSPNSGGPHSRGV
FT                   SRGRSSRSHSRNPNPKENKWSITVHDPSERLVSKDDDKDESIENDESSSEEEQISDTDS
FT                   EIDEDEGVILPNFASYTEPSSIPADRRVTKETNASKCVNNAKRAEELDQLSAAERGVAN
FT                   ARLIGSEVPQELIDKIEAKAEKYGARLSHDKYYQDDKERKEKLKEYAVYKKKLVSPGGP
FT                   GLSGTDEEFHVPYTADIEERADGELARTLNETVEIDDIDSDASNARAIRSLTRGRFFEL
FT                   VKEEQHPKTFLLCTDFSEESRYALEWCVGTILVDGSVLYMLNVLEDDEYSSMHLNGIPS
FT                   QNYHSGSMLEPLAPSGSKPPEDTTPTTSASKRAELNEQMRIDNIERMTRETLELLKLTK
FT                   LQVHVVFESIHHPIPRHFIVEVIRHLSPSLVIVGSKGTSALKGVLLGSLSNYLVRKSTV
FT                   PVMVVKRKLKKLIKKKGAGKFNNNIKPLHTLAEARID"
FT   CDS_pept        1100167..1101126
FT                   /locus_tag="PAS_chr3_0578"
FT                   /product="Peroxisomal nudix pyrophosphatase with
FT                   specificity for coenzyme A and CoA derivatives, may
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0578"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70626"
FT                   /db_xref="GOA:C4R4Z0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4Z0"
FT                   /protein_id="CAY70626.1"
FT                   /translation="MESKYLTNIAKYSPVYHGSQIQTSIWPQLPLARRASVMVLLFLGK
FT                   MGELRVILTRRSKKLRAFSGHISLPGGKADTLDETEWDVARRETEEEIGISADDDYLKS
FT                   HSGFTIHKINTLPAYLSRTFLGVRPCVGFIDFHHASNKAISSILLNPGESSAIFSVPLK
FT                   DFLQPKPRRYELKECLKQSYIKTKWGGIPWNLRSFIFPIHNPHEVPWLESIQDLSSEED
FT                   ETEQDMEFGEKTRNVWGLTANILRDLAMLTYGGAKHFHELVGEEDLIHSLATVGKQMQG
FT                   RPRSEFEKTMTNNRRGVGFDQVLPDHEVQRLKTLYSVI"
FT   CDS_pept        complement(1101194..1103197)
FT                   /locus_tag="PAS_chr3_0579"
FT                   /product="Mitochondrial glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0579"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70627"
FT                   /db_xref="GOA:C4R4Z1"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4Z1"
FT                   /protein_id="CAY70627.1"
FT                   /translation="MFRQQIRRFSKASFLAGAAVASAYVTYEVAFPKTQLLNENEKYVN
FT                   KFPSFKTTVENMPSREEMLKKLGPEIKKEDKDKVFSAEDVPEKSFDLVIIGGGASGAGS
FT                   AVDASLRGLNVLVVEKEDFAAGTSSKSTKMAHGGVRYLEKAIFQLSKAQLDLVIEALAE
FT                   RASMLENAPHLATILPIAIPIYKWWQLPYMYSGCLMYDLFAGRQALRYSYIQSRAATLA
FT                   TQPQLDSEGLKASLVYHDGSFNDARFNTALALTAIKQGATVLNYTEVEQLLKNSENKVK
FT                   GVRVRDRETGKEYLVKAEAVLNCTGPYSDRLLDMDHDPKGVSPAKALDTPRMVVPSGGV
FT                   HIVLPEYYCSKDVGLLDASTSDGRVMFFLPWQGRVLAGTTDVALKSVPEHPVASEDEIE
FT                   EILKELQHYVTFEVKRDDVLSAWCGVRPLVKDPRKAPKNGATQELVRNHLVHTSDTGLV
FT                   TLSGGKWTTYREMSQDAVDEVLKVHPELKDPTKNVNHVEIKPCQTQHHKLVGAEDFDTS
FT                   LAARLAQAYKVPSDLAAHLASNYGDRAPVILEIYKKDRANRLPVALAAADELAQLPTYE
FT                   EFEFPFTVAELKYSVHNEYARHPLDFLARRSRLAFLDARAAQKAVKGVVKVMGDELNWD
FT                   DEKRSQLEKETTQYIEHMGLTANKTSFLENEV"
FT   CDS_pept        complement(1104102..1105148)
FT                   /locus_tag="PAS_chr3_0581"
FT                   /product="3'-5' exoribonuclease involved in rRNA
FT                   processing"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0581"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70628"
FT                   /db_xref="GOA:C4R4Z2"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR025721"
FT                   /db_xref="InterPro:IPR026699"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4Z2"
FT                   /protein_id="CAY70628.1"
FT                   /translation="MTEIISIRKPLNPNADSDVESSDEEMLEASLAPKNNNQSIVTPGE
FT                   LITEDPIWMRGHGTYYLNEKTYSSVAGTISKVNKLLSVVPLRGRYQPETGDHVVGRITE
FT                   VGPKRWKVDIGARQDAALMLGSVNLPGGVLRRKSESDELQMRNFLKEGDLLNAEVQSIF
FT                   QDGSASLHTRSLKYGKLRNGYFVKVPSSLIIRQKNHLHELPGSITIIIGVNGYIWISKT
FT                   LYQHQKSLPSTTGNNALDSTVSSAAAKSNSYTPGQGSVSITRLEEESSWEIYSDKNEPI
FT                   SVATKDTIARYANCVKALAKCDIGITETRIIAAYEASMVYENAGLLLDEETMKSIGEDV
FT                   LNRERMRG"
FT   CDS_pept        1105282..1105608
FT                   /locus_tag="PAS_chr3_0582"
FT                   /product="Zinc cluster protein involved in pre-mRNA
FT                   splicing and cycloheximide resistance"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0582"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70629"
FT                   /db_xref="InterPro:IPR005345"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4Z3"
FT                   /protein_id="CAY70629.1"
FT                   /translation="MSRHQYDLVQCFKQPGTTIARLCDKCDGRCPSCDSYVNQAELAYI
FT                   CDECSFVSNKGEGKCILCGSKSTTDAYYCSECVMTEKDRDGCPRILNIGTTRSDLFYEK
FT                   RKKN"
FT   CDS_pept        1105831..1108899
FT                   /locus_tag="PAS_chr3_0583"
FT                   /product="Protein that contains a Phox homology (PX) domain
FT                   and binds phosphoinositides"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0583"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70630"
FT                   /db_xref="GOA:C4R4Z4"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR024554"
FT                   /db_xref="InterPro:IPR024555"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4Z4"
FT                   /protein_id="CAY70630.1"
FT                   /translation="MFSPTQEHYLKKELLEKELLREIQAMSPNYGDVTGLRKFGPPFAP
FT                   YDPINAPDSKNLSELLQVHYQNVEIYNEEFPLLRFFFTNFLQKFPFLQYYENHNVAKKS
FT                   TIQEQLWINKVQQFYEIWKSKRISTSNDRGSLSKRKLLIYKIVKMMLMMYNTAILVSGD
FT                   DEYFKNPSESETSDGRLMKNAYKDIEKILPNELINVEEILHNRENYINGLYINVCGVVK
FT                   DKMKSKIKSINPLSYWYSDTAPTMKSIYLFIILVKDETTGETYYVKRRYSDFKNLDSQL
FT                   LRHFPGKQLPSAPSKIKMSSELNEEMDDTNADDVDVTSLESNDPVQNVTKKLSDFKDSV
FT                   SKSAQSGNLFNLNGNTSKQEILQSFPREKLRLALRGYVQNLIRIPEVRSCSILKEFLKK
FT                   DCYHELSNKEEEEIKNRMKLDDLLIIQQVKFQQEIVNSVNNLQVNINQLKEQIFGNGET
FT                   GEQGLLFLFKEIEMNTKVVELSPQLQSFIELFKLEVASTIYDFFVSSDSSIENFTLLTK
FT                   IHQFFPYKIVQTILRFTNPMTIMKKMIDLFLYQPLGSGKSLMQFVFTHILNDDLKRLEK
FT                   ELLFLNKNITSKYTGGDVLVAKIDEYMEEEDNNVIIDIKATCHKYNIDLVLALLLNSNQ
FT                   LKTKIDQKVLVEVLASYKKWSNDDLGSDEAKLYIDLRTLFETKLRRRDKDLSKELWDSP
FT                   YLIQLIKELIAIFFQPLIVIFTKANLHKYIPIFKSFIEDLIDLIKRYHNDYNSMINENG
FT                   SVVLDFVAVLTKYQDYLLEFIHNLYMNDGKGDDEQVFMQLIQWFNSFIKLLTFVKTQRP
FT                   DLKIDLNAELDQFVSLHNSQVEDDSQKINLDKLRLEIDRKIQEINRRKEAYQNILVSKD
FT                   NGENNPANLVEQDLLAQNRNKMLTKNWNEIHGKLFSELDKGDSKNSFVQDVLGIHQGEM
FT                   DELNLEFLEWEEHEREDPSNSIVFARTEEEALSAIDQEYLKHGKETFKNFIEADEFENV
FT                   TSHVKTELNKLFSINRGEFIRRLSWKVLSCYVE"
FT   CDS_pept        complement(1108982..1109494)
FT                   /locus_tag="PAS_chr3_0584"
FT                   /product="Component of the TOM (translocase of outer
FT                   membrane) complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0584"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70631"
FT                   /db_xref="GOA:C4R4Z5"
FT                   /db_xref="InterPro:IPR002056"
FT                   /db_xref="InterPro:IPR023392"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4Z5"
FT                   /protein_id="CAY70631.1"
FT                   /translation="MSKTFTITALAALGATVGYAIYFDYQRRNNVSFRKTLKKNSKSYQ
FT                   KKLQKDKEQSKKQTLVLLRKRLEQALKEEPVLSDVAEKEQYFYKHITLGEQLSSVPNKE
FT                   IDAAIEFYKALSTYPNPTSILNIYQKSVREDIYELVVMLIAIQPPQAVVNILGESSLQS
FT                   SHGDDVE"
FT   CDS_pept        complement(1110187..1110801)
FT                   /locus_tag="PAS_chr3_0585"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0585"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70632"
FT                   /db_xref="GOA:C4R4Z6"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4Z6"
FT                   /protein_id="CAY70632.1"
FT                   /translation="MFVPCRTQISRSLAHSVRYASKQVATSHSYSSDLPTDIPVLSKRP
FT                   HTNLLDYTFTTFDKMKNWARKSSFWPMTFGLACCAVEMMHVSAPRYDQDRLGIIFRASP
FT                   RQSDIMIVAGTVTNKMAPALRQVYDQMPYPRWVISMGSCANGGGYYHYSYSVVRGVDRI
FT                   VPVDIYVPGCPPTSEALMYGVFQLQKKMMDGQTHRMWYRSY"
FT   CDS_pept        1111514..1113430
FT                   /locus_tag="PAS_chr3_0586"
FT                   /product="Rab escort protein, forms a complex with the
FT                   Ras-like small GTPase Ypt1p"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0586"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70633"
FT                   /db_xref="GOA:C4R4Z7"
FT                   /db_xref="InterPro:IPR017230"
FT                   /db_xref="InterPro:IPR018203"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4Z7"
FT                   /protein_id="CAY70633.1"
FT                   /translation="MSASAQSKQKPTVAERRPSVVERRYSQSISDRRRGSIIPELAGLE
FT                   KPLETNIASEFDVVIVGTGLVEGILAAALAWQGSSVLHVDSNAYYGDNCATLTIDQLKV
FT                   WVDQVNDHKIPGFSTASLYIPRPNVIVSRNYGIDLTPKILFAKSDLLDLLIKSRVHRYL
FT                   EFQPLSNFHTYEDDSFGKMQTSKQEIFTDQSLSLISKKRLMKFLKFVFEFDQNEESLSV
FT                   WTSYADKPLTEFTNETFKLESQQISELVFTLGLAPIPNIPTKEGLSRIRRYLTSFNIYG
FT                   KFPVLYSKFGGPGEVSQGFCRSAAVAGTTYKLNTRLRKFDPNTKTATFSDGSQIKVKEK
FT                   LICSPTQAPENAKNIPLKRNYAITRLIAGVTKDCKEWFSEGESAAIVVFPANCLPTNNA
FT                   YPVQAVILGAGAGVCPEGQCLWYLSTLAPEESAGKDLEAALNKMEESILRESEFDVDES
FT                   EFQFDDKGVPVLNSVKLGKSFMGFVPSKKLQYVFKLRFVQFTDVVPFGVVHKEYFDTES
FT                   PSSKYDPDAPDNGIFYSNMPSSELSYDGAVTEATLLYSKIVGADDDFFDVDFEDEDEVA
FT                   AEREAAGNATSTTTSNSLPTSRPEFRGTSVGSEFAIVDEEDDDDEEMGDAGEKFNDEMD
FT                   FVL"
FT   CDS_pept        1113744..1114178
FT                   /locus_tag="PAS_chr3_1200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1200"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70634"
FT                   /db_xref="GOA:C4R4Z8"
FT                   /db_xref="InterPro:IPR000530"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4Z8"
FT                   /protein_id="CAY70634.1"
FT                   /translation="MSDVEQQVVEEVEVAVEETSASISIEDAVKKVLRISLVHDGLARG
FT                   LREASKALSSGAAQLCVLCDSVTDEAIIKLVEALCNEPEEKIPLIKVSDAKQLGEWAGL
FT                   CTLDREGNARKVVGASCVVIKDWGQDSEERHVLLDYFSSN"
FT   CDS_pept        complement(1114235..1115518)
FT                   /locus_tag="PAS_chr3_0587"
FT                   /product="Checkpoint protein, involved in the activation of
FT                   the DNA damage and meiotic pachytene checkpoints"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0587"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70635"
FT                   /db_xref="GOA:C4R4Z9"
FT                   /db_xref="InterPro:IPR003021"
FT                   /db_xref="UniProtKB/TrEMBL:C4R4Z9"
FT                   /protein_id="CAY70635.1"
FT                   /translation="MSSHDLVFLATTNALSHISSVLGCIASIGTTAKVTINSHGVHFTA
FT                   YNDNQTIRVALTLAKSLFTSFILNADHNAQESNTQISVTQDSDQLEESEISLSLDVQLF
FT                   VESVNIHTSHQTTFGGNNASTNTDKNEIECTFSYQGDGHPFAVIFEDNAILERVEFQTY
FT                   ADQEDFEERFSLDETELVLSTLLSGSLLYDVMKDLKDVNTDALIVYVKDNPIPSNRKLV
FT                   FISQSEIGHSKHQYPSQKIYLQDLSVWKPQKMNDNLEFNQTISDSLTCYYRFETWAKIF
FT                   RSFKISNRIKLQKSISGLTSTSLLVRNPHDQSYTGSVIDFRFWENVNDEEIDNLNWEYC
FT                   YNNTHVEQLVEDDQNIKIIQYALSNNLDPNQITLDDYLKRRETRSHARPQATETPFIIL
FT                   DDNSHKEPEPSTTRRTPAPSTIDIPLFL"
FT   CDS_pept        1115729..1116292
FT                   /locus_tag="PAS_chr3_0588"
FT                   /product="Peroxisome assembly protein 22"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0588"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70636"
FT                   /db_xref="InterPro:IPR024359"
FT                   /db_xref="InterPro:IPR038613"
FT                   /db_xref="UniProtKB/TrEMBL:C4R500"
FT                   /protein_id="CAY70636.1"
FT                   /translation="MKSTKRNTFFGLAALGALGLGYSVYKSFITSDKSSSLINLGINQE
FT                   RKSYTRQKVAIIVSESILAIQLPIQEILKNTKDVVFVLAPTIAKDEFLRENEVDSGLSF
FT                   KVIETGTAIGCFHVLKHIKATYNIFNLHDFLPSSTKTSSDNEQLTFDLEEYVNLHLNNF
FT                   LQNVVELPSDSTSIQETVNQYIYN"
FT   CDS_pept        complement(1116289..1116915)
FT                   /locus_tag="PAS_chr3_0589"
FT                   /product="Component of yeast cortical actin cytoskeleton"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0589"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70637"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR003096"
FT                   /db_xref="InterPro:IPR036872"
FT                   /db_xref="UniProtKB/TrEMBL:C4R501"
FT                   /protein_id="CAY70637.1"
FT                   /translation="MSFRQELYSDLPKDVPSLDDDLQSSRLARYNNPKLISDIKKWLFG
FT                   QMLRPSGKSIPDEEFIDKTDLIELLRDGVYLCQLIDVIDPGKIKYKASKMPFVQMENIA
FT                   NFLQYAREVIGVPENELFQTVDLYEGKDPYQVAMTIQALSRQLTIKDKERFPNSIGPEL
FT                   VEKRKPPVPTKPTHLAGWSKHEYGYINKDVENVVFSGKRDITGRR"
FT   CDS_pept        1118492..1119226
FT                   /locus_tag="PAS_chr3_0590"
FT                   /product="Homeodomain-containing transcriptional repressor
FT                   of PTR2"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0590"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70638"
FT                   /db_xref="GOA:C4R502"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR008422"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C4R502"
FT                   /protein_id="CAY70638.1"
FT                   /translation="MEISSLVSRPATKTTYQLPLRPASVEPKGAVSEPSAEANVKLPSI
FT                   HDMLSDVQLGMQPSYFQPRTYTPSPVILPAPSTSSPMVVLQPVGAYSYQQHVFPASPQP
FT                   QSSLCRTSTVNSPLERSVVASLPSPPPSSTSTSISSTATARRPVSPGPRTEKKIAKPGL
FT                   VGSTVSDSKKRRSNLPKRTTTILSDWLVNNLNHPYPNPRQKLELIEQTGLTSQQLSNWF
FT                   INARRRKINILREVQNNTRETV"
FT   CDS_pept        complement(1119485..1120615)
FT                   /locus_tag="PAS_chr3_0591"
FT                   /product="Cytosolic L-asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0591"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70639"
FT                   /db_xref="GOA:C4R503"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="UniProtKB/TrEMBL:C4R503"
FT                   /protein_id="CAY70639.1"
FT                   /translation="MSTDTKEVVCDDCHTVFHIRTARSYSGSSLGGSVSTLKTPRIKVI
FT                   GTGGTIASKGESGSQTAGYHVDLTIEDLLSSIPDLSNVCELEYEQILNVDSKEFGEKEL
FT                   LMLHEAVSRSIRDDSFDGVVITHGTDTMEETAFLLQLTVNTSKPIVMAGSMRPSTAISA
FT                   DGPMNLYQAICVACNKESWNRGVLIALNDQIGSGFYITKSNANSLDTFKSVIQGYLGNI
FT                   VNNEIHYFFPASKPTGIQYFELAPFPKVIVLYAHQGFDPQIVRLCASQLNVRGVVFATM
FT                   GAGSLSKETNIELYKAWKEFGTPIVFSKRSMDGMVPIANLPRELEIEGKTVQFDGCMAS
FT                   GYLNPQKSRILLQLCLGASMKDRQIADIFKTLSFGG"
FT   CDS_pept        complement(1122585..1124303)
FT                   /locus_tag="PAS_chr3_0593"
FT                   /product="tRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0593"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70640"
FT                   /db_xref="GOA:C4R504"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR025795"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:C4R504"
FT                   /protein_id="CAY70640.1"
FT                   /translation="MHLLKRSVSIIYNLRFQSSFLGSFYTMSSASLEPISLPQKRPLGR
FT                   PESTKPPKKIKRKYNKKKNVDPTSPGGVLGFEIEHLCKEHGLSLADISNPMDVILNDSS
FT                   IQQKYHRIVDEVNVLSLTSNGDGIALIDGPAETNTKKQVAIVPFGLPGDVVSIKVFKSH
FT                   PLHVECDLLKILSPSSMRNDSLVDCKYFGVCSGCQYQPIEYAQQLLLKRDTIVNAYKFF
FT                   APILTASGKLPDMGSTVPSPLQYSYRTKLTPHFEIPRRKTQDFQKPSFGFGSKGRPKFR
FT                   PEIVDVNSSIVDIEECLIGTSIINTGLSNERKKFESTYNNYKRGATILLRENTTPVADP
FT                   PVETGEGSRDGTGEISKAEVELPDGSKQLKTCVTEPRQIVTEIINGNKFQFSAGEFFQN
FT                   NNSILPDIIKYVQDNLKLDPNGENYLVDAYCGSGLFSISCASSVKKVIGVEISADSVKF
FT                   ATHNAELNNIENCEFITGKAEKIFADIQLPRDQTSIILDPPRKGCDDVFLTQLSEFKPK
FT                   KIIYISCNVHSQARDLEYFINNTSNGFQYRIDSIRGFDFFPQTHHVEGVAVLSLI"
FT   CDS_pept        1124974..1126833
FT                   /locus_tag="PAS_chr3_0594"
FT                   /product="F-box protein containing five copies of the WD40
FT                   motif, controls cell cycle function"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0594"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70641"
FT                   /db_xref="GOA:C4R505"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:C4R505"
FT                   /protein_id="CAY70641.1"
FT                   /translation="MSVSEDTERCTKKPRLDDKVVFRMANQLEGKAGLEQNTDPKADKK
FT                   KLSSNTDKNNNVTNFLTHHVVDQSMIPRDNFHKYCYRHNPDVTCNKNTDQCKMDEIQDA
FT                   MEKIPPRDREAITHVWSIFSAAPYQHRSLILRGLLSQCCFPQLSMISEEVKSLIRLDFI
FT                   STLPTELSLKILCYLDCASLCNAAQVSRKWKRLADDDRVWHYMCEQHIDRKCPQCGWGL
FT                   PLLAMKRARHIPDEVSKEIPHTTAIDVKDNNTNKASKNTNTNTTVSKEVAPAARKTRPW
FT                   KVVYSERYKVERNWRKGVYKVRTIEGHTDGVTCMQLGYKILMTGSYDSTIKIWNLETGA
FT                   LIRSLGGHTRGVRTLAFDDQKLITGGLDGTIKVFNYHTGECISTYHGHNNHVVSLDFIG
FT                   KTIVSGSADQTVKVWHVETRTCYTLRGHTDWVNSVKIHPKSMTCFSASDDTTIRMWDLK
FT                   TNSCIKVFGGEENKGHVGQVQCVIPLNIKYEIVEDLEKDNFADETREAQDSATPETEEE
FT                   KNYPTHILTSSLDTTIKLWNVKTGKCVRTQFGHIEGVWSIAADTFRIVSGAHDRTIKVW
FT                   DLQSGKCMHTFGSNDSSVSCVSLGDTRFASGLENGKIKVYYFD"
FT   CDS_pept        complement(1126907..1128118)
FT                   /locus_tag="PAS_chr3_0595"
FT                   /product="Translation initiation factor eIF4A, identical to
FT                   Tif1p"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0595"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70642"
FT                   /db_xref="GOA:C4R506"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4R506"
FT                   /protein_id="CAY70642.1"
FT                   /translation="MSEGIIEIDTNLIETNYDQVVSTFDELNLKEQILRAVFAYGYEFP
FT                   SAIQSRAILPIVAGRDVLAQAQSGTGKTATFAISALQRLDEKLKAAQVLILAPTRELAL
FT                   QIKKVVLALGMHLNISVHACIGGVDPALDVKAFNSGVQIVVGTPGRVQDMIERGAFRTE
FT                   NVKMVILDEADEMLSTGFKEQIYTLFTLLPSTTQVVLLSATMPQEVLEVTTKFMNNPIR
FT                   ILVKKDQLTLEGIKQFYVDVGEEQYKFDCLCDLYDSISVTQAVIFCNTRRKVEELTERL
FT                   TAQKFTVSAIHSELSQTERDTIMQEFRTGSSRILISTDLLARGIDVQQVSLVINYDLPS
FT                   NKENYIHRIGRGGRFGRKGVAINFVTSKDVEMMKEIEKFYSTQIDELPSSITDLFETEE
FT                   VNES"
FT   CDS_pept        complement(join(1128441..1128680,1128816..1128839))
FT                   /locus_tag="PAS_chr3_0596"
FT                   /product="Protein component of the small (40S) ribosomal
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0596"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70643"
FT                   /db_xref="GOA:C4R507"
FT                   /db_xref="InterPro:IPR001931"
FT                   /db_xref="InterPro:IPR018279"
FT                   /db_xref="InterPro:IPR038579"
FT                   /db_xref="UniProtKB/TrEMBL:C4R507"
FT                   /protein_id="CAY70643.1"
FT                   /translation="MENDNGELVELYVPRKCSATNRIIKAKDHASVQINIANVDEEGRA
FT                   IRGDNTTFALSGYVRSRGEADDSLNRLAQQAGLLKNVWSYSR"
FT   CDS_pept        complement(1129082..1130320)
FT                   /locus_tag="PAS_chr3_0597"
FT                   /product="Long-chain base-1-phosphate phosphatase with
FT                   specificity for dihydrosphingosine-1-phosphate"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0597"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70644"
FT                   /db_xref="GOA:C4R508"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:C4R508"
FT                   /protein_id="CAY70644.1"
FT                   /translation="MQVRAHNIPQTHLETLPVPAAKDLSHTSSVDAGCRPSEYYRSRLS
FT                   PVRFASRQLILSLVEKETEPLGRWQAKVRTPLLDAYFSLTATLGSHTFYVLMLPIPVWF
FT                   GYFKLARDLVFILGFGIYFSGLLKDYLCLPRPKSPPLHRITRSHYTAQEYGCPSSHSAN
FT                   AISVTLTLATYWYHYSYTYSTLFNTVSIIFGLIYLVSLVLGRLYCGMHGFVDVGSGLVI
FT                   GISCFLIRHLTSDIWDHIVFQTGWFSPVLVLVFYYSLIYFHVKPIDDCPCFEDSVAFVG
FT                   VLTGMELGQWALFQTSNAITIEDFDFRYNVIVPFSWTHLGPFFTLARLVIGVSTIVIWK
FT                   AISKPLLTRLLSPITPHRASHHCKALQSRTHVYIFVRLAVYAGISTLTVWMNVLFTLFG
FT                   LDSSLSGPLDKYT"
FT   CDS_pept        1130549..1131373
FT                   /locus_tag="PAS_chr3_0598"
FT                   /product="Non-essential small GTPase of the Rho/Rac
FT                   subfamily of Ras-like proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0598"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70645"
FT                   /db_xref="GOA:C4R509"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4R509"
FT                   /protein_id="CAY70645.1"
FT                   /translation="MSSDAVEQLENFQLIKFDRFDPSTQSTIRIARSPKPIPVKVVIVG
FT                   DGGCGKTCLLNVFATGTFPEAYVPTIIENVVITLVTPTGQIAAVTLWDTAGQEEYDRLR
FT                   PLSYSDVDVVLLCYSIDNLSTFHNVADKWYPEVAHFCPNTPIILVGTKSDMRRHQKSQP
FT                   HFVSPQDSSQLARQMGAVMNIECSAKEVSNVNIVFDAAVSYCLSNSRPKTRGDNDNNRS
FT                   NRRLSRAKRASMFIRGKDVSSTSGNSREELVEYDQDGLAIIPDRKKRKCSII"
FT   CDS_pept        1131621..1133006
FT                   /locus_tag="PAS_chr3_0599"
FT                   /product="Essential ATP-binding protein required for DNA
FT                   replication, component of the pre-replicative complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0599"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70646"
FT                   /db_xref="GOA:C4R510"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR016314"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4R510"
FT                   /protein_id="CAY70646.1"
FT                   /translation="MNSPPVTPQKKRILTEINGLPTPKRTKVKERHATTVYSQVKTVFQ
FT                   RGSLPDIDTDGYSLHGRSKEANILKSFLEKGLADLESNSLYISGPPGTGKTAQLNAVLA
FT                   YLFPKKSGTFNTYQIEKNGQSISRLLSVSKINCMTINRPDEIYHSIYRQIQSCNIFHDA
FT                   KCSSEQLEKILSDEDVADMHIIVLDELDNLIAKNQRVLFQLFSWASHLTGAGGPRLILI
FT                   GIANALDLTDRFIPRLKTNGISPNLLQFHPYNGDQIKTIITKKIQCLPHRNTNQIIHPA
FT                   ALQLCARKASSSTGDLRKAFDVLYQSIELAEASAKRKMDPIKFANLQLHEIPPITVAEI
FT                   AKAFNASNLGKGKQFLAKLNIQQKTILCALSKCSGNKSITINSLYEFYKTKIDFDPLTG
FT                   SLKKTEFIDILSMLESHGVISMGNNSSRLSNVGNSKVACITAEHEIRSSIQNLPLLEKI
FT                   MNG"
FT   CDS_pept        1133305..1135896
FT                   /locus_tag="PAS_chr3_0600"
FT                   /product="Subunit of the Set3C deacetylase complex that
FT                   interacts directly with the Set3C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0600"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70647"
FT                   /db_xref="GOA:C4R511"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="UniProtKB/TrEMBL:C4R511"
FT                   /protein_id="CAY70647.1"
FT                   /translation="MPPLDSNRGNNNPPRDYRRKYESEPVSSNGPRKHSGSSYVERDSH
FT                   GYHRGSGSNGYYPSKKDFRPTSNGSSQGYSGYNNGYYGSYNNRYREPLPERRSIGESYK
FT                   PRSNDRIPKDSRYRQQPMIRDYRDSRPYWNNRAGSTERISSSVPSSSRYYNEDSGYGAL
FT                   KKPQSSYAERNNRSSDSPSYGAYSGKLNTLTNKNLESPISSEVSTPRLSTRPSFASASE
FT                   LETKEESKVTRKEAIKEEQEKTVIPTTEEETEKPSLEKVRSTEHANEKSPVSKAVEEPV
FT                   KMDEKAEIDNPILEQVKLEVNPDVKPDIPQTDTTKEDQLIKPSEHICQKTLDQIDITQP
FT                   TDTTSAQTETLQPKVDSITSELKIDIKIDNTNINKEPETQPETLYRIPKIEGCIFPMNK
FT                   LEDKFWSLQTRPKAKVLEHQWYLNDKKIENFTEYPFYIDNLLLHINVLSPTIEKFLQIK
FT                   DKSVLKKRARLTEEFFSRARQWRQRRHKMDEQLNKLHSKEAAPPIQREEEPDTSRELKP
FT                   SRRSRHGDFVGTEAEFQEILESLEREKEKDPLYVAQKGAAVIPEMILDPIERETLRFIN
FT                   TNNLITDKDRWAQRIKTDPIDTFTEKEHEMFVEAYIHHPKKFGRISAALGGLRTPEECV
FT                   LHYYRTKKTKTNFKQVLASRKKGRGKPPRRNKVVLEKKAKTFQEDSDVKLTPEPMKRKR
FT                   ISSSASLNGSEVKKPRGNRAQEQTTTSEELQRKKPHLSSYWSVQEVKMFKVLFGEHGEK
FT                   WDTISSIMKSKSSTMVKNFYQKKMREDTKKDDEYQTVTDNLETIENTKTPDQVEITTPK
FT                   VESPENETPTYDLPHISTFYTGNVDQKKQVQEAEETIPHSKVPSIMNLLND"
FT   CDS_pept        complement(1135874..1136887)
FT                   /locus_tag="PAS_chr3_0601"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0601"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70648"
FT                   /db_xref="UniProtKB/TrEMBL:C4R512"
FT                   /protein_id="CAY70648.1"
FT                   /translation="MGVLKHVLFICAVSVSAAFVGAETQDNKTVGLNATGQKPQIEYTA
FT                   SQTHQSIILTEDQKIHIKSLLGDDVFARSVLPLKELTEVNSQSTKLGKIWKWLLNNHNG
FT                   PVVFEKQLMFKDSVVFMPDGSSAPVDLQSIQEVRDFFEDELNKVLRYCMFRRQTEYEIL
FT                   EAKEIVETTISPCTKYQYGRFFHKEQYVVGRLEMYEDAVVPSTYDSTIIQDLIQDEFRL
FT                   SPRLSSSKKIKIKCPITPQTPFGSSTAVIKRVVAIVRKKTVYFNNCDLFPRIEEDWSQP
FT                   RKLFFTFDENDVQLTCQTSEDDSICGKDSNPLSDNILLIDYELKSWQLKFNRLISS"
FT   CDS_pept        1137217..1138221
FT                   /locus_tag="PAS_chr3_0602"
FT                   /product="Fatty acid elongase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0602"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70649"
FT                   /db_xref="GOA:C4R513"
FT                   /db_xref="InterPro:IPR002076"
FT                   /db_xref="InterPro:IPR030457"
FT                   /db_xref="UniProtKB/TrEMBL:C4R513"
FT                   /protein_id="CAY70649.1"
FT                   /translation="MSILSFDKPFGIELWPIFDTFASKATHGAFVPSEFEFVAGKLPLS
FT                   TLEPVLYSIAAYYFIVFGGYYFIKKLELKPLVLNALFSAHNLFLTTASLVLLTLMVEQL
FT                   VPIIYHHGLFYAICNTRAWTQELVTLYYLNYLIKFVEFIDTFFLVVKQKKLTFLHTYHH
FT                   GATALLCYTQLVGVTSISWVPISLNLGVHVVMYWYYFLASRGIRVWWKEWVTRFQIMQF
FT                   ILDLGFVYFASYQKFAYTYFKDVLPYCGDCAGTMVAAVSGCAILSSYLVLFIAFYIEVY
FT                   RKQGKKSRYVKKVRGGVAAKVNEYVLLEDKQLASGASSRSSSPVTRNLRSRKA"
FT   CDS_pept        complement(1138349..1139455)
FT                   /locus_tag="PAS_chr3_0603"
FT                   /product="Protein involved in rRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0603"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70650"
FT                   /db_xref="GOA:C4R514"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR033196"
FT                   /db_xref="UniProtKB/TrEMBL:C4R514"
FT                   /protein_id="CAY70650.1"
FT                   /translation="MEEEQPEFIQFTPNVFSRIAPDIYLERNLKEGIRPNLRKYEEFRS
FT                   VQVNNKGFGRYDESNPTKSSVLGSSVVKVGKTTVICAITGGIVSDDDILDQATTSSNPF
FT                   ATVYPLVEIARGRSGACTDEEMIIAQKLYETLKSSGIIRKSALKIRYGYKHRTSDDKVE
FT                   VIFPRNGPQTDGTNDDNDQVMADGNTAETIPFEDKQYSFVLYANLQVFSRTGPPFDICW
FT                   TALIKALKNTKLPYTFLDEDTTSSRTVKSRSGANATIERSQLICDPVLNYPIKLEEKKI
FT                   GYSSTFGLVTIPDGEKSQEILLADIEGESEESASTSLVHVVVAGDKLTSLTIHGGSKAG
FT                   GNGSRITKDFIKKSIDLAHQRSLHLSSI"
FT   CDS_pept        1139601..1140626
FT                   /locus_tag="PAS_chr3_0604"
FT                   /product="Putative ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0604"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70651"
FT                   /db_xref="GOA:C4R515"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C4R515"
FT                   /protein_id="CAY70651.1"
FT                   /translation="MSNSITIIGSLNYDMVTYTYVLPEAGQTVLSNHFECHYGGKGLNQ
FT                   AISAGKLLAPDSQTIVRMVGKIGNDSFGKELKQYLEDNRVSASHVSTEKDVCTGIATII
FT                   VEQESGENRILCTPGANGKLILTDNELETVFEDEKDRDYPGFVILQNEQPDPVSCISWI
FT                   KSHRPNLIITYNPSPFNEEILLDKRIWSCVNVLVVNEGEALTCVKQLNSFSVSEIKDKI
FT                   NSNLVHGYTILAKELNRVLNPESGYSLVVITLGSQGSVYATDIESQYIPSLQVEPSKIV
FT                   DTTGAGDTFLGALVVKLAQKEPIEEAIRFATAASSLTVQRRGAAESIPQYEDVISLLES
FT                   H"
FT   CDS_pept        complement(join(1140738..1140745,1140796..1144228))
FT                   /locus_tag="PAS_chr3_0605"
FT                   /product="Ubiquitin carboxyl-terminal hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0605"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70652"
FT                   /db_xref="GOA:C4R516"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR006615"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028134"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR035927"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C4R516"
FT                   /protein_id="CAY70652.1"
FT                   /translation="MSTGVSQERNIDETDSDLNSGAQKSQYESIILQRQVVQKMLDTYT
FT                   MKEGDVFCLVPKDWYQRFFTFTYDPTDNEIFLKIGIINIAELLDANGLVKKPDGEDFVE
FT                   YEILPYTVFQQLVSWYGLFSGLQPIQRIVIARKDGELELEVYPCYFRLHLMDNERNSLD
FT                   INNFILSRYSTIRDLKYHATERFNTEFYHSRLWLVDDPNISNLPLTITVSSFEKIKFKK
FT                   LLVEKIEDFDKTLEEAGLNSCHLVVEYKLKKDSEWPSDITCKPAKLSTGLVGLTNLGNT
FT                   CYMNSALQCLMHIPELSNYFLYDFYKEEINVDNPLGNGGRLAIAFGSLIHTTLGPKKQI
FT                   VTYATPKDFKLTLGRFNSMFLGYHQQDSQELLAFLLDGLHEDLNRILKKPYLDKPELKD
FT                   HLVQDKEAVRQLAEDCWSQHKMRNDSIITDLFVGLYKSTLVCPVCQKISITFDPFNDLT
FT                   LPLPVDKKWYHQIIFFPETGYPKALDVELDKSSTFDHLKNYVSSKLQVPINDLIGADIF
FT                   NSQFYKNFEANDPDLNYLPISDLISSGDKTVFYQVKHKPGDLVVPVFNTLSDDGGRYAK
FT                   PFGLPFLITISEDESFSFGSIRDKLERKYDQLSTLNYFDQIKQESKEIHKLADFPTLNK
FT                   KYQNDSPNEDNSLSDVDCTSDISFANPKISGDFAFNIKLFDSSREFKPRYNLGARHIDI
FT                   DENEDDSLWLPQTNNSFGNLPILLDKLCEKKRAFYTYKKFEAEEELADEDDSESVNVNV
FT                   EEVDENDNNLDTQQDESNDESMMGGMFEESKNSAPVSPPCSEVATNTESNAFEPLIKTR
FT                   QALVCEWEQDSFGKFFVGLGDDDDKSGTQTWETPEVIPNEELIQNKKLIEEKLNKNIAL
FT                   QECLDIFSKPELLGENDLWYCPNCKDHRQATKTIEIWKTPDILTIHLKRFENQRSFSDK
FT                   IDAVVDFPIEALDMSEYVVNPETGDEIYDLFAVDNHFGGLGGGHYTSYVKNHIDHKWYY
FT                   FDDARVSAAEPEQAIKGSAYLLFYRRRSSTPLGGEYLRQMMTQVREQEEVHREMENEIL
FT                   RDYVKLKEMQDAITAYEEKCQQVQVSEAVESTLDEQQLECDSDRELENAGNVEADAESS
FT                   QSINQVEKDQNEPSSMVSSANGAKRRKKQQNNLLMSRLC"
FT   CDS_pept        join(1144483..1146445,1146594..1150981)
FT                   /locus_tag="PAS_chr3_0606"
FT                   /product="PProtein homologous to human Chediak-Higashi
FT                   syndrome and murine Beige proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0606"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70653"
FT                   /db_xref="InterPro:IPR000409"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR023362"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR036372"
FT                   /db_xref="UniProtKB/TrEMBL:C4R517"
FT                   /protein_id="CAY70653.1"
FT                   /translation="MSWCDQLADIIDRKRDQDAFHVAQLIIKSAQFEENRLLTLLVLYR
FT                   RSVSQVEELAESLDTLALSDSNVLPNINDDSNSGATCLSREQASLFAVLLHLILIQDWT
FT                   GDDARFPTMILQYTYNLMHNYPINKVLICSESLNRQFRRARRDDIPSHLLDDCLIESTD
FT                   SDIDMKWVSQYHKDVIFSNKDSSLLLKYLKRDQLPQLVLPMESQISVNELSLENPNHGF
FT                   TFQAWISISDGRTNITSILGAESISLFQISTADRELFQIGLVGERLFIKPRNDDDCIFE
FT                   SFVFELNKLYHITIVNQGDNKGRPTKAELYVDGDFAQTIYIPNLFHHPPDSFQLTISNI
FT                   ETFRTISLSSLLLINNVQPYEWIQLSYWLGPKYAGFFQDRQVTKLLSLRNRAFFEIKLR
FT                   KYYNQDRLKVTKLHENGSKKTNNLIHLATKRGLFKLPPNSIILAIHSTTIFKVGDRMFA
FT                   PKTCSTNQLTDGDIPDENWTLSSNGACLLYQPSSIHKLVYAVGGGLMLLRFVESSSTEE
FT                   QLIYNLSILFEILESSWLYNYEFTIKNGYDILATILKTKRNMIGIKTLDSVLHFVGYDH
FT                   QSPFKSILVNVQAYKSLIVDFEIWKSSKNNNESFKFLLFQFTVFGQDSKYHDFNIKQLS
FT                   KMKIIKRFIQALKFGSFESSACVLDALTTVVCDTSTSATSLDPPLFYRRVVKSLSVKWA
FT                   LLILTDEEIKVSINALKILIRLFTMLRVTQYEKFISHAGLDILTSFLQSKSYDNELIST
FT                   IFCGTFGFPQTRDFGSNLRDIVNNLAPKGTKLRISMPEFLFLLANLFKASAIKTIETLS
FT                   RDLSASTSMQSLNFLAFANSFIYMIVTTYGKPSSLESFFLNDKKWLAMLLNILLLFELS
FT                   TEFKAIPEMDEIRISIEKLLSEIFIKKIFDKKATAFSSFMGSVTADSRTFTIVHAFIFP
FT                   HVLEHLEEFCIYLQELTTKPSSTLTNVFRFYESCLNEERFSKWTGPQAITFIESSSNYL
FT                   EIFRLHCDDKGRWKNDLQNIGDSLCSLLIRELLQATVSLMESNNQDSQSNIKRIATNFI
FT                   FHQELYLLKTMLDNEKLATFCVILFKNIFINDPEISNLCINCLKTCFLVRQPDFEHIAE
FT                   LIADDAGVVIHFFTGMLSITDDELRSEASVPSVRTAFLKNFTLKMNILKHLNNSTPDST
FT                   STLLKLVDKSVLQKRSAVESFKSECSYWTKIIVSSELAKYHRHNQDHRDDVLYYINMYN
FT                   KLKIRTSVSLKVGNIKPVMMLDLSEGMDRMRKRILPDYNSLAKKLNTDYAKTSGDDKTE
FT                   LVKEDTPDIKNFDDTDSISSQDGETFEFVEEPGDIEAQQEDKNRKVLRSLNPGDKVNAI
FT                   WNVCQVHGLEATESVMILGASHIYLIENYYHSPKGEIIDIEDADLEDRDPYMQLLTGQK
FT                   RPDNFEKDLKSHSTTNWKLNILASVSKRQFLFRDVGLELFFADGSSFLITCISPSVRDY
FT                   IHFKLKGYTTQLLDQDLSQAFSLAATSTAHLDNNSFTFKLTSAFSGTNLNNLTITKKWR
FT                   RGEISNFYYLMIVNTLAGRTYKDLTQYPVFPWVLSDYTSDTLDLDDPKVYRDLTKPMGA
FT                   QTEKRLNLFKERYEALQSLEDSNAPPFHYGTHYSSSMIVTSFLIRLEPFVQSYLLLQGG
FT                   KFDHADRMFYSINKAWNSSSADNTSDVRELIPEFFYLPEFLMNSNKFDLGTLQSGSKVD
FT                   NVELPPWAKGDPKLFIEKNREALESPYVSAHLHEWIDLVFGFKQRGKPAVEAFNVFHHL
FT                   SYSGAVDLDKIEEEVEKKAMTGIIHNFGQTPLQVFTKPHPPRDLRENIHISRADLEALD
FT                   NGLVSQLKRIKPIKCIVKTNLQNSRKFIGYPTSVCSDRLHYVMPLPRNGSLLINEEIVE
FT                   GLQNDSITCLVMVGDSSIAVGDVSGVIHIWKIVSTDFSKTLEPLELKEVLRGHESAIKD
FT                   LKVSQIFNTLISLDEEGNCFMWDLLKFEYMRSICEELPVSLIDIDNHAGFVGCLSGNEL
FT                   LLYTINGESISSSLIGSGNVGSISFARRNDDLFNLEGQINHEYWIPGCVLAVGFVSEAK
FT                   LYGLFHTENRYDIRLLKTISMDEANKICCIRFGLSSEYKENTRLHTKPKLLCGDDEGRL
FT                   FVVEQI"
FT   CDS_pept        complement(1150989..1151633)
FT                   /locus_tag="PAS_chr3_0607"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0607"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70654"
FT                   /db_xref="InterPro:IPR019008"
FT                   /db_xref="UniProtKB/TrEMBL:C4R518"
FT                   /protein_id="CAY70654.1"
FT                   /translation="MLFLWLLLPAAFAHQLSGRIEIDDVDSSRTKVELYSPNVTITTRI
FT                   LHDGSFSISDPPTGTYKLSLQLQDYALKNDRYRVEVTNENITAHKYVTNQNWTESGSLV
FT                   ELPLFVPFENVVARKYIEISSGGILANNSWIIWAQQNPLMALGVLVTAAIGLFPHVMNY
FT                   FDPGFTKRILEETVQPKPESPEDANRSISSNSNESTTTARGSSQKPIRKRK"
FT   CDS_pept        complement(1152181..1153686)
FT                   /locus_tag="PAS_chr3_0608"
FT                   /product="Protein serine/threonine phosphatase with
FT                   similarity to human phosphatase PP5"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0608"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70655"
FT                   /db_xref="GOA:C4R519"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR011236"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013235"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C4R519"
FT                   /protein_id="CAY70655.1"
FT                   /translation="MTDLKSKADALKDKGNQELKQNHFEKAVEFYTEAISLKPNPIYYS
FT                   NRAQAQIKLENYGLAIADATSAIELDPSYLKAYYRRAVATFAILDYRKAKLDVKMVLSK
FT                   VPNDPNSKKLAAEIDQIIKRIAFEKAIAVDEKESVIQELDFNAIQLENDYDGAPLEIEV
FT                   TGKGQDRNLSVNITQEYLKQMIQRFKNGKKLPKKHAFAIVAAANEVFKNEHSLVEFGFD
FT                   RNNSQEEALPDTVKTITICGDTHGQFYDVLNIFESFGNVGPNHVYLFNGDFVDRGSWSC
FT                   EVAFLLFTLKLLYPKFFYLNRGNHETNSMNKVYGFEDECKYKYGERLFTCFSEAFNSLP
FT                   YATLIGQEYLVMHGGLFSDDKKTLQDIRNIKRVPNRQPPNEGVEMELLWTDPQVMPGRS
FT                   PSKRGVGIQFGPDITYRFCRSNNLKAIIRSHEVRMGGYEEEHDGKLITVFSAPNYCDTQ
FT                   GNLGAVVNLTSDEKKEYRIDFKTFKEVPHPDIKPMAYTNSGGF"
FT   CDS_pept        1153945..1155216
FT                   /locus_tag="PAS_chr3_0609"
FT                   /product="Beta (RNA 5'-triphosphatase) subunit of the mRNA
FT                   capping enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0609"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70656"
FT                   /db_xref="GOA:C4R520"
FT                   /db_xref="InterPro:IPR004206"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR037009"
FT                   /db_xref="UniProtKB/TrEMBL:C4R520"
FT                   /protein_id="CAY70656.1"
FT                   /translation="MNLVDLDNPADGLSEQPRERTESVISTKSRVSVTDLINPTKSSEL
FT                   PALKSRNSVLDLCNPKDVDISSSSTPDLSRRVSETSNGEITVAKPKVTEAIQNANSDTS
FT                   NYTKKSKPRRYKVKPVWARDFVPKVNLKVQNERRTQDNHSKAFSNLVNNGPTTSSSRFS
FT                   TFTGVIPYDDLTRSVTTWLYANLNSLSEKHPNLEDILELEIKVGEVVSKATDKRIQLPV
FT                   ITETTLNNNFFLQECYFNINLEPVDHQSVEDFFKQLLKESKVTALRTDTIDRFFSHTGA
FT                   RGKKTRLRVTQDTTTKRGDIVIEKDKKSSLVIHLPKCRYDLKLTIALELPQNIPKDELI
FT                   PEGSFSRRKHRTSYIHKPSATQVDLTKVYEGTSKQENFEMELEIDSKQLLDAFKGIGGN
FT                   NDYESLIGTFLDNAKILMRELSKK"
FT   CDS_pept        1155301..1155987
FT                   /locus_tag="PAS_chr3_0610"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0610"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70657"
FT                   /db_xref="GOA:C4R521"
FT                   /db_xref="InterPro:IPR019433"
FT                   /db_xref="UniProtKB/TrEMBL:C4R521"
FT                   /protein_id="CAY70657.1"
FT                   /translation="MIFLWWLLGVIHLVNANTETLLVYADPAYEVYDYGDLNSHERTTI
FT                   PCSLNLSQVYGGDVYLHRPGNPCPIELHNSWTLPPIKTIHRLNVEKGSTYFVSLCWSAI
FT                   FPVDFSLSYVVEKSEASNDNDIRQNFTVDTPIEELQGAIPGIYLIVEAKPNFFALRNSN
FT                   FKQYLDEIQYQINVEQCILVPGLTERILKLAGKIMLVAVIALFIATKMSLWLKQLALTP
FT                   AKIKLR"
FT   CDS_pept        complement(1157985..1159631)
FT                   /locus_tag="PAS_chr3_0612"
FT                   /product="Karyopherin alpha homolog, forms a dimer with
FT                   karyopherin beta Kap95p"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0612"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70658"
FT                   /db_xref="GOA:C4R522"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR002652"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024931"
FT                   /db_xref="InterPro:IPR032413"
FT                   /db_xref="InterPro:IPR036975"
FT                   /db_xref="UniProtKB/TrEMBL:C4R522"
FT                   /protein_id="CAY70658.1"
FT                   /translation="MDSDTTSRFVPEYRRTNFKNKGRFQQDELRRRRETQQVELRKAKR
FT                   DETLAKRRFLVNPGEGSVPQEDDSENEDEINVEDNQFYLELQKELPRMMEKINSNDMES
FT                   QVEATMKFRQILSREYNPPIELVIQSGVVPRLVEFMKDQQEILQLEAAWALTNIASGSS
FT                   DQTKVVIEAGAVPLFVQLLKSPSIEVREQAIWALGNVSGDSSAFRDYVLSCNVMGPVLE
FT                   LFNSSKISLIRTATWTLSNLCRGKKPQPDWNVVSAALPTLAKLIYSTDIETLIDACWAI
FT                   SYLSDGSSDAIQAVVDARIPRRLVELLGHESTDVQTPALRAVGNIVTGNDLQTQVVINA
FT                   GVLPALLPLLDSPKETIKKEACWTISNITAGNPDQIQAVIDCNLIPQIIRLLVTADYKT
FT                   KKEACWAISNASSGGLVRPDQIRYLVSQGCIKPLCDLLAVADNKIIEVTLDALENILKM
FT                   GELDKEARGAPYNENAMYIEEAGGMEKIFDCQNNENEKIYKKAYQMIEQYFGEDDGDLE
FT                   DTGLQPEASGDAFTFGVNSADPSQQQSFNFN"
FT   CDS_pept        1160086..1160826
FT                   /locus_tag="PAS_chr3_0613"
FT                   /product="Putative protein of unknown function with
FT                   similarity to phosphoserine phosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0613"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70659"
FT                   /db_xref="GOA:C4R523"
FT                   /db_xref="InterPro:IPR006384"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4R523"
FT                   /protein_id="CAY70659.1"
FT                   /translation="MSSPKAVVFTDWDGTVTLLDSNDYLTDNLGMGKESRVAIGNQILN
FT                   GEVDFRTGFAEELQSVKLPFDECIDFLLKNIELDPGFKDTYEWCYANNVPIYVISSGMK
FT                   PIIETLLVKLVGQDAMDNITIISNDVKINDDGSWDIVYRDDTSFGHDKALSILEVLDKH
FT                   NLDKNADNRSIPLFYCGDGVSDLSAARETDLLFARKGRELITYCEKEKVPYTEFESFDE
FT                   ILKSIQAILSGEKKLADFIQNKLE"
FT   CDS_pept        1161008..1162666
FT                   /locus_tag="PAS_chr3_1201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1201"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70660"
FT                   /db_xref="GOA:C4R524"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4R524"
FT                   /protein_id="CAY70660.1"
FT                   /translation="MAYHEAAAGDGTTREEQFLKGQKLVLCICSLMLILFLVALDQTIV
FT                   STTFTEVGKDFGSFDKISWLVSGYMLASASVVTVYGKLSIVFGRKYSLLLAIFLFELGS
FT                   LLCAVSQNMTMLIVARVIAGIGGGGIQSLTTVVASEVVHMNKRPAIMSLFGIVFAISSV
FT                   LGPLVGGVFTTEVTWRWCYYINLPVGGFATALLLYAFNPPRPKFTWSKIREIDYIGISS
FT                   FMAGIVLILLAMSLGGINYPWNSAAVICCFVLGGLSLIVFSIWNFKFSSNPLIPYFVIK
FT                   VPGVFVCTLVYFFTFCNFMTLVIYGTLYFQTILNRSAFQSGIDTLALIIPLMVATLIST
FT                   GLVQGSKQVKPVIIIGTILGPIGGGLMTLLDVDSPLSKRIGLFIISGVSLGIQMQTVLI
FT                   SAQLAAPKQASGLILTTVVVNFSRSIGGAIGANLANTIYSVTFSKKIRPYTENSIIRIP
FT                   DSVLLNSPEAILSLPENLQELVTEKLMESLRATFYFGLGCASVAFIISLFVSNDKLPKK
FT                   EKKPEVTETPDQSQDDNKSPSLDKSLEFINVHSKN"
FT   CDS_pept        1162845..1165727
FT                   /locus_tag="PAS_chr3_0614"
FT                   /product="Component of the Sec23p-Sec24p heterodimeric
FT                   complex of the COPII vesicle coat"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0614"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70661"
FT                   /db_xref="GOA:C4R525"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="InterPro:IPR036174"
FT                   /db_xref="InterPro:IPR036175"
FT                   /db_xref="InterPro:IPR036180"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C4R525"
FT                   /protein_id="CAY70661.1"
FT                   /translation="MSGKRRAYPSMQYPATEPVATGGSFGYGQQPGAQAYGQQFTPGAG
FT                   IAGQQLPGATQPNLNGQGAPYGAPGGDQLAQGMSSLNIQPNQQPQPVHQFPSQQQGYIN
FT                   PGAGLGVPPTQAAGPYGVPAAVAPQQQSAQLGYAGPPYGNTYDQQQPQQAAFPFNQLYT
FT                   ADLLKELPPPISDLELPPPPIVLPQGASLTGKPESNASPEYFRCTLNVIPNNNSLLKKS
FT                   KLPLAVVVNPYQCLRDEDEPVPVVEDTLISRCRRCRSYINPLITFVDRNTKWRCNLCNL
FT                   TNDVPSGFDFDKDTQQRVDRMARVELNYSVVEFVAPKEYMVRLPQPLVYLFVLDVSTHA
FT                   IQNGYLATVARTILDSLDQIPNKDGRARVGFIGVDSSLHFFTIPQDSEDENDAQETSML
FT                   VVSDLDDVIVPAAENLLAPLQQSRQNIENLLNNFHSYFENNVNPNFALGPALKAGHRLI
FT                   NNIGGKMIVFTSTLPNKGIGALSIRDEEAHSGKAKESSALLSPNDSFYKSFAVECNKSQ
FT                   VTVDMFLASSSYQDVATLSNLPRYTAGQTHFYPAWTAAREEDITKLSKEISNHLSMNIN
FT                   LEAVLRVRGSAGLRMNAFYGNFFNRSSDLCSFPTFPRDQSYLIEISIDEHITKPLAAFQ
FT                   AAVLHTTSFGERRIRVMTLEVPIGKELNQIYASADQLAITNYFTHKAVEKALSSSLIDA
FT                   REYLNRSLLDIFQVFKKELVAGNLGSSSPLQLCNNLKMLPLLLHSLTKYIAFRPGKVPS
FT                   DHRAYALNLLASSPIQRLIKFIYPTIYSLHDMADECGLPEELEETYVNEAGEEVTEPID
FT                   GDIVLPEPINDTSTLLAPYGLYLIDSGTDLFLYVGGESVPQLLLDVFGVDNPGYIKYGK
FT                   SELPELNNEFNERLRNVINRVREGKDRITYQNLQIVIGQSKQRTGVPDRIQEDLTPLRL
FT                   WCFSHLVEDRVGGGTAYREYLNQIREKLSS"
FT   CDS_pept        1166640..1167098
FT                   /locus_tag="PAS_chr3_0615"
FT                   /product="Subunit Va of cytochrome c oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0615"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70662"
FT                   /db_xref="GOA:C4R526"
FT                   /db_xref="InterPro:IPR004203"
FT                   /db_xref="InterPro:IPR036639"
FT                   /db_xref="UniProtKB/TrEMBL:C4R526"
FT                   /protein_id="CAY70662.1"
FT                   /translation="MLRQSFRQLTAKPLSRAVGIRYASALSNATVTNLEKRWEDLPETD
FT                   QKDIISQLSERQKLPWKDLTLSEKKAAWYISFGEWGPRRPVHTKEDKLYIFWGTVIGIV
FT                   ISATIFGAFRYNRNVPKTMNREWQAASDEYLKSKNAEPFTGYSQIQSK"
FT   CDS_pept        1167426..1168502
FT                   /locus_tag="PAS_chr3_0616"
FT                   /product="Putative S-adenosylmethionine-dependent
FT                   methyltransferase of the seven beta-strand family"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0616"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70663"
FT                   /db_xref="GOA:C4R527"
FT                   /db_xref="UniProtKB/TrEMBL:C4R527"
FT                   /protein_id="CAY70663.1"
FT                   /translation="MSFSFNFHDEEADSNISASDQTNALSNYEPAIEPELVDLELLLES
FT                   LVGKRLTYEEVNISGRYKVFRREFSDVKHQLMMEDDSSNEEVQILLGQTNEDLRSNVYE
FT                   GGLKSWECAYDVVDFIKNEDNQLFPSSNGLNVIEIGCGTSLPTCSILEDLLNTSNTETN
FT                   ITLTDYNAPVLRLVTVPNLIINWALKKLEPSRLKELQQAKTEAAPGIIIEEPIRDGEIF
FT                   LSRGIIRNFLEDLTAHHVTLNLISGGWSEKFLRLVKLSLNKSIQNTLIITSETIYQPKM
FT                   LPVISEILIELTTTAPNTKTIVAAKDIYFGVGGSVVDFTSYLDSQIRKRSLDLHYQVQR
FT                   LTDVPRSLIRLSNSKCST"
FT   CDS_pept        1168625..1169752
FT                   /locus_tag="PAS_chr3_1202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1202"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70664"
FT                   /db_xref="GOA:C4R528"
FT                   /db_xref="InterPro:IPR019465"
FT                   /db_xref="UniProtKB/TrEMBL:C4R528"
FT                   /protein_id="CAY70664.1"
FT                   /translation="MSLEDFDGFLSQSFVAEKFANDLLLATNNVDDDNLDILTSPKRLS
FT                   FDIKELQDLLARFVSSNSTRLVTQLSHISELKKTHEGLNVRQINSSFKRLKNDFIIPYD
FT                   DALKLYSALKRIHATSNLLRNASYYVFLLQQLESIFDQNEFDKPPFNDLVKFTQISTNL
FT                   DLHVQDASSLMSLQLVKDYQPVHRKRTVFIVDIASTLLSQITADSSKQSIANICFTLAT
FT                   LADNNFLNCIQSLLDDYTSKSSQAIVKTLTSPKTIVSSMEKVSHLAKAIYHLSKYMQET
FT                   PFPKLSQTYDQYCQEKLNYNSDLFTHFWRQVALFIGPKFRETISRGGPVAKALKKSSQQ
FT                   YKLALTNGIIQSGDDITENSIPVTMMINAIRVLNG"
FT   CDS_pept        complement(1173431..1174261)
FT                   /locus_tag="PAS_chr3_0618"
FT                   /product="Dual-specificity protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0618"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70665"
FT                   /db_xref="GOA:C4R529"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR024950"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C4R529"
FT                   /protein_id="CAY70665.1"
FT                   /translation="MKILQVSKKNRSRNTKNLLLDLSSQHSPPPLKKVTITKSATELEF
FT                   PKRKGLPIIPKGTLRRRRTTLALTIPSIDENTTPKISTTNESPYSPKSSPTNNNTSTSF
FT                   CFGNTVINHNASKKTVSNPYDSGPVCVLEPNLYLYSEPTLDQLDRFDVVINVAKEIPNY
FT                   QREIRNKGKTYYFVPWTHTSNLCPDLPLLTSVIENSLSSGKATLIHCQCGVSRSASLIV
FT                   AYLMKKYGLNLNDAYNRLKVKAPSISPNMNLIFYLAEWGKTLEAISLPASPYST"
FT   CDS_pept        complement(join(1174706..1175176,1175211..1175375))
FT                   /locus_tag="PAS_chr3_0619"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0619"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70666"
FT                   /db_xref="GOA:C4R530"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C4R530"
FT                   /protein_id="CAY70666.1"
FT                   /translation="MFRPLALKPSCRAINRIPVCRFSTGLIAQKPTLALTSGSIQGTQS
FT                   RRIQTPKTKDATKWYLLSEIFRGLYITLEMYFRAPYTIYYPFEKGPVSPRFRGEHALRR
FT                   YPSGEERCIACKLCEAVCPAQAITIEAEERIDGSRRTYKYDIDMTKCIYCGYCQESCPV
FT                   DAIVETPNVEYATETREELLYNKEKLLANGDKWEQEIQYALDADAPYR"
FT   CDS_pept        join(1175663..1176423,1176486..1176855)
FT                   /locus_tag="PAS_chr3_0620"
FT                   /product="Alpha-1,6-mannosyltransferase involved in cell
FT                   wall mannan biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0620"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70667"
FT                   /db_xref="GOA:C4R531"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039367"
FT                   /db_xref="UniProtKB/TrEMBL:C4R531"
FT                   /protein_id="CAY70667.1"
FT                   /translation="MQQQLFRKVIWLTVGLITVILVIIKISSSKSTATDLQKVLKNANI
FT                   LPQDVINYNSRKVTDELASKLDEIQKKYLSKQDDRISKLEAERADLLEQVRFLRNPPAG
FT                   SSLREKLAYLFPYNENGKFPAYIWQTWKYGLNDDRFGEKFKEGETQWASKNPGFVHELF
FT                   NDDTSGVFIHHLYINVPEVIKAYELLPNIILKMDFFRYLVLYAKGGVYADVDTMPLQPV
FT                   PNWIPENVSPKSIGMIIGIQNDANNPDWKKITELIAKITEDTLQRAESNSLELADISEE
FT                   GGLSDKNLSIMQWTGTGIFTDAIFTYFNDYIQSSIYTKVTWKEFSKLRKPKLVSDVLVL
FT                   PIISFSAGAGSGKSTELNDPLAFVQHYFERLHNDNH"
FT   CDS_pept        complement(join(1179154..1180763,1180883..1181711))
FT                   /locus_tag="PAS_chr3_0622"
FT                   /product="tRNA ligase, required for tRNA splicing"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0622"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70668"
FT                   /db_xref="GOA:C4R532"
FT                   /db_xref="InterPro:IPR012387"
FT                   /db_xref="InterPro:IPR015965"
FT                   /db_xref="InterPro:IPR015966"
FT                   /db_xref="InterPro:IPR019039"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4R532"
FT                   /protein_id="CAY70668.1"
FT                   /translation="MNLPIEPLVLSEKERNEDTNELVTQLKLASLRTNKQGKAHHNEFT
FT                   IFDSDITLDGWRFNEFDYAKTKISLPTNARGLFTKTYKDGTSKIITRGYDKFFNVNEVL
FT                   PTRPDWILKNTIGPYEVTLKENGCIIFVSGLQDGTIIVSSKNSTGDRTELSRNHAKVGQ
FT                   EYLLKQLKENGIAAESLAKSLYELNVTAVAEYCDDEFEEHVLEYPKDKAGLFLHGLNVN
FT                   KPVFKSYPMEQVCKFADAFGFNKVEYLMKDNSAELFEFLDGCSTTGTYNGREIEGKSVR
FT                   EMRITKHKKVSLEYLSFIKPLLVGNTKLSEEFLQGHGIIALRKLFLQHCGMKGYEIANE
FT                   EDTEDERMKELELQLSNISLTDAIYKFVIVNVAVIGCGKTTTSIMLSKLLPKCGHVQSD
FT                   NITKPVKDKLTRMALETLRDHDMVIIDRGNHLLRERKQIFDEFEDLYHDYLPINTKFKF
FT                   VCLNYVSNKNSPELWNLTRSRIIERGDNHQTIKAETQGVKFAESIMKGFINRFQPVDVD
FT                   HEPDSKFNVVIDLEVHPNNSSKSNAVKVVNTLIEYYPEVVSPVSDEKIEHAFQDALDHK
FT                   PELTIKVGKAKTKKVKPAYVGIGLSDKDKARLMDAIEQLFARCAAENNQPVDMSTWVTL
FT                   KQLGRIPEKLHVTLAHIASTRDKKLGKIWNRYTNEYFSKFIQEMNKKLPDDLKGSLQTL
FT                   PNTKAHIRLKSLCISEKLACVEVDIEGIINESQSITVESTNKYPHITLGTVDQTIPAVE
FT                   SNILLQELISHRGSSETPETPDDPAKTQISTEEESCNRKYLYTFPPDILFKDLNLFLQF
FT                   "
FT   CDS_pept        1182241..1183269
FT                   /locus_tag="PAS_chr3_0623"
FT                   /product="Ornithine carbamoyltransferase
FT                   (carbamoylphosphate:L-ornithine carbamoyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0623"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70669"
FT                   /db_xref="GOA:C4R533"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:C4R533"
FT                   /protein_id="CAY70669.1"
FT                   /translation="MSMFKIPKLVLSQGFPSLNRKLAQTTKPPRSLISILELSNQELSS
FT                   LVERAAYHKTQYKSGKISSQVSPSLFGKVAALLFTKRSTRTRISSEGAAVYFGAHPMFL
FT                   GKDDIQLGVNESFYDTTKVISSMTSCIFARVDKHSQIQELAQHSTVPIINSLCDRFHPL
FT                   QAITDILTIREAFGFTKGLKLAWVGDSNNVINDLAIAAIRSGINVSIAIPQGIEMDEEI
FT                   ISKGQQIAQETDTVLEVTHDPKKAVKDANVLVTDTFVSMGQEAESKAKLAQFQGFQISS
FT                   DLASGAAPDWKFMHCLPRHKEEVTDEVFYSDRSLVFPEAENRLYAAIAALEGFVINEGR
FT                   LV"
FT   CDS_pept        1183530..1185755
FT                   /locus_tag="PAS_chr3_0624"
FT                   /product="Protein kinase that regulates the G2/M transition
FT                   by inhibition of Cdc28p kinase activity"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0624"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70670"
FT                   /db_xref="GOA:C4R534"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C4R534"
FT                   /protein_id="CAY70670.1"
FT                   /translation="MLDKNRILRIRKKKDGSVNDASNSRKRSLQSPTTSITSFTSTPLP
FT                   SSKSGYFNESNENKKPLLKRSTGSLLLSAHRKSQSEEDEADRNDNLLNTTTFNSVKPLP
FT                   SAFQSTGLLSKKNAGPIQASKTMPETPCKKIRQPLKPLVTNTTPFAQSHVNSTSSSNSS
FT                   GSGRRSKLKKVVNTSDLQSCILRFADEFDDFYNGENNSSIFRERDMDEDHEDEDIDLSN
FT                   LDDEHFTGFQGFDALDNFPPTPTKLHQSSSKKMPLGVTLMKRNNMNSKNSPSVADRTNI
FT                   SMNGDTTPRTPIEPLFNTTIDSFGTYNTTNPTPMVQRNMNPNQYKSEQLPHSYNDFTNE
FT                   FFTQQTQTSVAMDEHLFSRFKNGSVVGSGEFSIVYEVQYQGVKYAVKRNKNKLAGPKSR
FT                   LRRLEEVEILQTLQRNVPDDYEGSEYTLQFIDSWEYQNYLYIMTEYCENGSLDRFLLEN
FT                   GKITRLDEWRVWKILVEILMGLRYIHNSGILHLDLKPANIFITFEGCLKIGDFGMASKL
FT                   PIPPFFEREGDREYIAPEIISNQIYDKPADIFSVGLIMVEIAANIILPDNGLSWHKLRS
FT                   GDLSDAGKLSSTDLNRQLLQFQKDHTTPNTSIMSSVFTHDNNSGSSFLNHPTSAATTSS
FT                   SGTTNTTYSSKVKSKLGVPPWAPEFLVDGEGILDTLVKMMINPNPSMRPDANVILNTFE
FT                   CQLVELRRKSGAVVYEGDFGPYPDEQELKLEQQLSLQSREYPMIKHL"
FT   CDS_pept        complement(1185885..1187711)
FT                   /locus_tag="PAS_chr3_0625"
FT                   /product="Transcriptional repressor involved in response to
FT                   pH and in cell wall construction"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0625"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70671"
FT                   /db_xref="GOA:C4R535"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C4R535"
FT                   /protein_id="CAY70671.1"
FT                   /translation="MFGNTGLPSISSNIARADNEQRTSNTTFNVHPTTYLNPSIANNTA
FT                   LIANKLNGIQHDFNASATSSSSNNESASPNSVASYTDSSVQSPSAAPEKPEFPSLKFHP
FT                   RQTTTTGPLLSSDLLNVQAHNQNQQFNHPTHQNLYPLDGNDLNAPWNSYDSQRPRASSM
FT                   NTTPFTVQTSSLMATGVGKRKPRKQKLDDSNGPFQCKWEECPLVFDDAKVLYQHLCDFH
FT                   VGRKCNKNLSLNCKWDGCDVSTVKRDHITSHLRVHVPLKPFGCNLCNKKFKRPQDLKKH
FT                   VKTHADDNELQEITPPTEYSVHHQKVPMSFPDSRKRAFNDVLSQNFGTFYEEIKRSKIQ
FT                   PMYNSDIATKLNSLGNMIPTNQPFQQQQQHLQPGLPYHGHSAYNHSNHGSLQDQHMSLP
FT                   VPQSFPPTNKVSNIPTQHELFEANSFFNQLSNTMDHTAHHQAHVHPQPLENAHVDAENY
FT                   IEVHDDHHHAAHNQALYPTINVPGGNYSSFYPQISNRYETNSNSKNSSISVNQKSSVNT
FT                   LRNLTGLLDKLDINEANGSESSSDVEDSELSTTSSDEETEDININDFLKHRQLVQLIQE
FT                   YIQDALKQSKAVEQSATTTMKEGSSLYPTIVV"
FT   CDS_pept        complement(1187978..1189177)
FT                   /locus_tag="PAS_chr3_0626"
FT                   /product="ER membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0626"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70672"
FT                   /db_xref="GOA:C4R536"
FT                   /db_xref="InterPro:IPR002889"
FT                   /db_xref="UniProtKB/TrEMBL:C4R536"
FT                   /protein_id="CAY70672.1"
FT                   /translation="MLLKLIWVFTTTVILQATLASADLSFCSTQNTGSDSSYSLYQSNG
FT                   LCRDTCNGQGAYFAVLSGSECFCSNVAPSEQTSLSDCSSSCPGYPIEQCAGNGYYGYIQ
FT                   LRSGASTLASSSSTTVSSETETDGTTSSDPTSSSGTTSSSTSSSSSSSSSSPTSSTSST
FT                   SSTSSTTSSSSSSSTRSSSSVSPSTSSESGTSSSTASTTSPPSISTVYSVTTVSGTDRT
FT                   LIVSTQYISTFPSTPTDTSTDSATDSSSRSANSNSFWDSTGKVAGTFVAVAVVVILLLL
FT                   LIGLLLYRRYSKRHGDEADSASGSNISSLMYLKNGTLEKNNNFHTHTASNGDTLVPINI
FT                   AESDNIVDQRLDPGQMFMNLNNSRGSFSDHRDYTRRVLRVANPENDLDPSDLETPGNNA
FT                   "
FT   CDS_pept        complement(1190011..1190916)
FT                   /locus_tag="PAS_chr3_0627"
FT                   /product="Protein that binds to cruciform DNA structures"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0627"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70673"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032640"
FT                   /db_xref="UniProtKB/TrEMBL:C4R537"
FT                   /protein_id="CAY70673.1"
FT                   /translation="MASFTFTWPAGPNEVIVTGTFDNWQKTLPLVKKADQSFELTVPFP
FT                   KDTPPVSYKYVVDGEWLVLGSAKSDGNDPSIRNNYFTAEDLDDNVSVAGGAIPESGGLK
FT                   TTVMPSEEGIQKTLGEPGIVVPQNPGSIAAFKEVSTVDPKSLNKEEPASAPVANDVVIP
FT                   EDPSAVAAFNEVSDVDPKTLNQEEPVTNGKKVKKVKKLVKKKTSEDLKPDTEPEGKAAT
FT                   EINPDRLVPSDEVAGDKIKDTPAEDVAAVDAKVPEVSEEPASKTAPETTTPSKKAAEKQ
FT                   DDKKQKKKKGFAAKLKKIFS"
FT   CDS_pept        1191678..1192127
FT                   /locus_tag="PAS_chr3_1203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1203"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70674"
FT                   /db_xref="GOA:C4R538"
FT                   /db_xref="InterPro:IPR011107"
FT                   /db_xref="UniProtKB/TrEMBL:C4R538"
FT                   /protein_id="CAY70674.1"
FT                   /translation="MVVHGIGTASTVVTEREESGEIRLVGSPPPETVEEEPTTSTKTRR
FT                   GVKWQEGTVDNEHLNRKKSKICCIFHPQRSFDDEDCSCHSESGSGSDSDSDSDSNIEGN
FT                   PGSNSNGKPKRKQKKNSKESTVRSSSPNAYEKQPKYPHKHSVHKQ"
FT   CDS_pept        1192218..1192979
FT                   /locus_tag="PAS_chr3_0628"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0628"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70675"
FT                   /db_xref="GOA:C4R539"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:C4R539"
FT                   /protein_id="CAY70675.1"
FT                   /translation="MAKKKPSSSSTRVPAKVNGSYTFPSNFNQLAIKKLTYTPSIECPI
FT                   PGQVILISKFLPPQVCQELMVSFESGLDIITTPLIKSKDYAARVNDRALKTDYGASEIL
FT                   WKYLQEYLFYESDYESEDDNETCFIKKEFQRAIGLNPQLRIYRYLKGHYFGKHYDDSVT
FT                   AFMDSKEKVKGLSRWTLLIYLTGDTEFEGGGTVFHYNDPKSRKQVELNVHPSKGMALLH
FT                   KHGDDCLLHEAELVKSGVKWVLRSDVVFPLS"
FT   CDS_pept        complement(1192974..1195736)
FT                   /locus_tag="PAS_chr3_1204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1204"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70676"
FT                   /db_xref="GOA:C4R540"
FT                   /db_xref="InterPro:IPR007231"
FT                   /db_xref="UniProtKB/TrEMBL:C4R540"
FT                   /protein_id="CAY70676.1"
FT                   /translation="MPSVEDKALVGGTKSQLKELLVSSRNLPKTLTDISPIHLGLSAIQ
FT                   RKAHTLRKYKDDNQRYTRAHYLLAGSGISAEEIETDLLEISVPQTLDVAMGQKNYADLS
FT                   NGIDTYIESKKEENILAAIEQSLTMAAKDFDAYVAQNISMDWNQRKKELRESFDIILNG
FT                   TSKEPSNELVEYTQFGNASKKFKSDPNLTWSANKPILANRVEFTDVEVSSTLPTNVLNP
FT                   SVSYALRQKFEEYAQAIYELNAARQNNKPYELTNVFAQITKQANDIKSRQLYETWKILY
FT                   HLVDFNEPAAFQERKFVKGHDSEVLDSFEAIALRKRIIERSRSYLEQQFMDYIDSIYIR
FT                   LSNKEESKLNTPETPIVDNVTKVKLFVEHRYKKEDTWKIQNLLFINGLPIWAIIFYLLR
FT                   AGCLDDALNLTLKNSDSFTKVERSFPTYLKAYVNSSDRGFNQELHGRLINEFNQFFKHM
FT                   NKEADPFRYAVYKLISRCELSRKNLPYITLSVEDWLWVHFTLCREGTNDDDPIYERYSL
FT                   LDLQKTVLKLGPDNFNGSFNNPLYLQTLIFTGLYEHAVQYFYSISEIDSVHLAIALYYC
FT                   GLLRSTTDKSNTTQLLTYRGERNIPEINFARLIGTYTRTFKISDPRVAVEYLILICLGG
FT                   DLPDGRGKEQIELGLSSIRELVLETREFSLLLGKIDREGFRVPGIIEERKNLLHLPDKE
FT                   SFLRKITEQAAIKADDEGRVFDSLLLYQLSENYDTVISLINKLLGDLLASTDLETAIDT
FT                   PAERAAEGSIIALAERLMKQYSSSTEISGKVLLKHRETCSLLLKMVECRDLFVKQEWEK
FT                   ALKQIGQLDMLPIVAGVNVAVARSKVEVFNSYDESVAKNVPDLLVMTLTCIAQLTYQLT
FT                   SSEFNGLVKSDKIKYLKEVARNCMLYAGILQYKMPRETYSMLVSLESML"
FT   CDS_pept        complement(1195870..1198305)
FT                   /locus_tag="PAS_chr3_0629"
FT                   /product="Conserved nuclear protein required to establish
FT                   sister-chromatid pairing during S-phase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0629"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70677"
FT                   /db_xref="GOA:C4R541"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR006554"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR013020"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4R541"
FT                   /protein_id="CAY70677.1"
FT                   /translation="MENFHHPFKPYDIQTQLMTAIYDTIAGGYKVGLFESPTGTGKTLS
FT                   IICSVMSWLREYKTKNPDQGSQQNETEVSDDEPSWVTEAYESTVLPKIKEKQREYEIVL
FT                   EKVKSQKRGKVVHKVKEREFKRVKKNTDQEELDDSQFLLKDYNANEKNDLDSIQDEVNA
FT                   LLKKISQKDSNSDPFQNLERSQTRILFSSRTHSQLNQFTSQLRLTSFPSSLGAVEEHIK
FT                   YLPIGSRKQLCINPKVNHYQSLPLLNEACLEAQKDSNCKYYDQPNNPQTMQRMQEFRDY
FT                   TYSEIHDIEDLNGIGESLDICPYYSIRKSIPLSEIISLPYQMLLERNTRQILNIDLRNS
FT                   IVIVDEAHNLMDTIMALNSTSLSYKELIDMRKSLKYYLQKFSTRMNSGNRINCLKLVKL
FT                   TELLLTYIKRKKETRIKPGEKLDLMDIFPTNVDINIFQLETYLTTSKLAFKVETYMEKC
FT                   SGRHANHASPLLFKLKKFLSSLSHPSDNGCFFFEVAGDDISLKFLLLDPSEIFQDIVDE
FT                   SRCVILAGGTMEPMEDYVNFLFKHTPRNKIKMFSCDHIIPKNNLKVFALSNGMEGNLLN
FT                   FSFSNRESPAIIKDLGTSILKIVQCVPGGTVIFFPSYKYLEKVVEHWKLTSPLMWSTLN
FT                   RLKDIFTEPTDSGKVEDVLSDYSRKISENPKRGAILFSVVGGKMSEGINFQDDLARGII
FT                   MVGLPFPNAFSGELIARRKFIEDSVLKETNSRKASLQASKDFYENICMRSVNQSVGRAI
FT                   RHINDYAVIFLLDNRYNNTNIQQKLSGWIRKRFASFTMSKAISETEDFFRNRKLHQVK"
FT   CDS_pept        1198585..1199445
FT                   /locus_tag="PAS_chr3_0630"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0630"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70678"
FT                   /db_xref="GOA:C4R542"
FT                   /db_xref="InterPro:IPR009286"
FT                   /db_xref="UniProtKB/TrEMBL:C4R542"
FT                   /protein_id="CAY70678.1"
FT                   /translation="MDNPEDWTFLNKGKANAIFKYIGNDMNYKGKVIRLRLADQLVLSK
FT                   EIFEFVNSFRPQLHQLIAMELIPVSSRFLTTLEQESGIAIKKDTHGIIMPLIGLPEQRK
FT                   RVSKHISLYTDPVQNHLTVEIKPKWLYSIPQHTSLCRNCALNFYRDEELFCTLDLLSPN
FT                   LITNWVDKLGLNEQHSESLTQFLSNSDLFHILYDLQHFEDIHETIGTLTNENEVPEELI
FT                   RSMALKDITIYISFANDDTKVTIIDLDKKHPSKYRHWKKQEESLWNLYSQNSIVEKQCY
FT                   RHLPR"
FT   CDS_pept        complement(1199405..1200445)
FT                   /locus_tag="PAS_chr3_0631"
FT                   /product="Mitochondrial 3-hydroxyacyl-thioester dehydratase
FT                   involved in fatty acid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0631"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70679"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C4R543"
FT                   /protein_id="CAY70679.1"
FT                   /translation="MLLSTRYLCRAYSITSTNQVLKVKERLAQSQWSNTDYCISGYPAT
FT                   QLYWLLKSSLSRNTPGRQKLGNVLDPLHSTLKGEGEFKRGNQVPFGYHFLYCNPLSTDK
FT                   ELGLDGYDNYASPAEFTTDGTVAGQLFRRRMWVGGSILNSGIPFSVGEEVTLTERVKRM
FT                   KCLGKDPSSLDFKSMTTTRREFRNGHKALMMVEERKLVFFNDQFRSTIHENTLDLPTPQ
FT                   FRHVFTPSLFSNIKYSSLISNTHKIHYDARYAQDEGYPDVLVSGPFIVNLCLHYFSNVA
FT                   SNLTIKEFKYKNISPMFPGKEYQICLAKDEDRKYQIWIQSPKGGLVVFFHGTLTLEGVD
FT                   NIASQQ"
FT   CDS_pept        1200509..1201945
FT                   /locus_tag="PAS_chr3_0632"
FT                   /product="tRNA(m(1)G37)methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0632"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70680"
FT                   /db_xref="GOA:C4R544"
FT                   /db_xref="InterPro:IPR025792"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="UniProtKB/TrEMBL:C4R544"
FT                   /protein_id="CAY70680.1"
FT                   /translation="MFKRTFSKAKISETVMSINKPISSNLDPPINRNMRVLDRSFFSKT
FT                   FPVVGVYFPDPKKIGLFLSKCRQDALRVPNVPFIVKFNEAKDSQEEKLVLLNESIQSLS
FT                   QINSSLAPSTLEFIEANKGVLKEHLLTLDYDFWKSEEILKAILPDNLEEEIPSGFTRTG
FT                   HIAHVNLKEEYKPYSEIIGQVIMDKNPSITTVVDKVDSIETTFRTFKMKVIAGEPNFMV
FT                   EQRESDCLFTFDFSKVYWNSRLHTEHKRLVDLFKPHTAICDVMAGVGPFAVPSGKKECF
FT                   VFANDLNPESFKYLDINVSRNKVNKFVKVFNTDGRDFITQAQNDLFNYSNTHKFLTLNS
FT                   RKKQRVSKDTTPQIKVPIPNFFSHYIMNLPDSAIEFVDAYVGLFTKAFPQLSIDEVKSL
FT                   PNYLLPTINVHHFEKFSPNEEPTEEELHRRIHEKIKRLLSFNISFEELHFHMVRKVSPT
FT                   KPMFCISFQLPEEVAFSKSN"
FT   CDS_pept        complement(1201949..1204363)
FT                   /locus_tag="PAS_chr3_1205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_1205"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70681"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019183"
FT                   /db_xref="UniProtKB/TrEMBL:C4R545"
FT                   /protein_id="CAY70681.1"
FT                   /translation="MSESDQTIFSSLEVGAFKQALQLVKKKQKKFPNSSYYYALESYVL
FT                   WSSGDITKAIAVAEDLASKIPSDPDTLRLLKEVYKSSGRDFNLLYENALRKYYNENLLE
FT                   SWFHSNIDDFDISGLQKAGMLYGKQNKRESKLLNAFTLLLASDLDRISPAHKRLFPMLG
FT                   VKVMEALFPLGNAQEVFIYAKLAMSCRMYNETANVVSSFLAKESDLELQIILLESLLLA
FT                   ENWQGLFDTTKKHILSGLDDWNVWQKFVDSGLKLGLTETVAETIGGFKVSRNTLLATIY
FT                   LNNTLGNDITDAIIAYSLHFIDKSSFFPDLKTYASSSRLDLTRVFSQVDPDDLKADNAS
FT                   SLIKLVNITKLKLLMGVKPPTFQDNISSFSKFANLLDNKLDTDYFPADEFLLLGVQQLL
FT                   SADTSLSTVIKCIIILENNVQMDKHEFHLRLWLIKLYSAINCYSLAKTHFDSLSTKFVQ
FT                   LDTLGHYLTERVSALNPNKSGADDLEHFCSVYYQAEVQTVHFIKDGFEKGSYNKIQGMI
FT                   EFAARLNNSLSFLLSNIEKAKLARLLEKKNLLEQSLKHLNEKLPLLTRSDKINDVDCTI
FT                   SDNRDFNTLWDFGTQKVNDDIVQNEFIFGKHHSVKYAHIFSLEELILSKNSEEIISQHL
FT                   RQLCLLLDDADYLTELTEDELWSLKFLTSAIDYVLNHNNNSFKEAEKLVQNIPSQSESL
FT                   LNWKFNHHHVVILNTFKAFKNFTLKHKTIKEVTLNCQLLLKTLKQRIDQLREQALSLPT
FT                   RSRAETNALADEAEAWVNDSCKEQSFSTDAKKILNNIYESNSKALACLRTL"
FT   CDS_pept        complement(1204481..1206085)
FT                   /locus_tag="PAS_chr3_0633"
FT                   /product="Putative serine type carboxypeptidase with a role
FT                   in phytochelatin synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0633"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70682"
FT                   /db_xref="GOA:C4R546"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033124"
FT                   /db_xref="UniProtKB/TrEMBL:C4R546"
FT                   /protein_id="CAY70682.1"
FT                   /translation="MKSVIWSLLSLLALSQALTIPLLEELQQQTFFSKKTVPQQVAELV
FT                   GTHYSKDEIISLWKDIELDVPREKIQEAFDKFVKQSTATSPVRNEFPLSQQDWVTVTNT
FT                   KFDNYQLRVKKSHPEKLNIDKVKQSSGYLDIIDQDKHLFYWFFESRNDPSTDPIILWLN
FT                   GGPGCSSITGLLFEKIGPSYITKEIKPEHNPYSWNNNASVIFLEQPVGVGFSYSSKKVG
FT                   DTATAAKDTYVFLELFFQKFPQFLTSNLHIAGESYAGHYLPKIASEIVSHADKTFDLSG
FT                   VMIGNGLTDPLIQYKYYQPMACGKGGYKQVISDEECDELDRVYPRCERLTRACYEFQNS
FT                   VTCVPATLYCDQKLLKPYTDTGLNVYDIRTMCDEGTDLCYKELEYVEKYMNQPEVQEAV
FT                   GSEVSSYKGCDDDVFLRFLYSGDGSKPFHQYITDVLNASIPVLIYAGDKDYICNWLGNQ
FT                   AWVNELEWNLSEEFQATPIRPWFTLDNNDYAGNVQTYGNFSFLRVFDAGHMVPYNQPVN
FT                   ALDMVVRWTHGDFSFGY"
FT   CDS_pept        1206817..1208058
FT                   /locus_tag="PAS_chr3_0634"
FT                   /product="Tryptophan synthase involved in tryptophan
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0634"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70683"
FT                   /db_xref="GOA:C4R547"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C4R547"
FT                   /protein_id="CAY70683.1"
FT                   /translation="MSYNKPYLENYPDENGFFGKFGGSYVPPNIQEQMDIISREYQRIK
FT                   NDPEYLETLDKIRNEYQGRPTPISHAKRLSDYLGGAQIYLKREDLNHMGAHKLNHCLAE
FT                   ALIAKQLGKKKIICETGAGQHGVGLATAAAFFGLDCDVYMGEIDMIKEAPNVSRMRILG
FT                   AQVIPASHGLKSLKEAVDDAFTAYVSTADETMYCIGSVVGPHPFPAMVRDMQSVVGKEA
FT                   KEQFASRPETGDLPDHVVACCGGGSNAAGIFSAFIDDESVKLYAVEPCGTGESTIGKHA
FT                   ASISYGSEGIMHGFNSIMLKDENNEPAPVHSIASGLDYPSVGPEHAFWSSIGRTEKSAG
FT                   ATDNEAVEAFFMLSKLEGIIPALESSHAIAYAIKLARTLPKDQTILVNLSGRGDKDLDY
FT                   VIEKYPEMVDKKFV"
FT   CDS_pept        complement(1208055..1210235)
FT                   /locus_tag="PAS_chr3_0635"
FT                   /product="Calpain-like cysteine protease"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0635"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70684"
FT                   /db_xref="GOA:C4R548"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR036213"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C4R548"
FT                   /protein_id="CAY70684.1"
FT                   /translation="MDHAQRLLELSFYNQSLGKSVIAKKYRIESSRYLNEQLDKSLTRD
FT                   NDLIGLCRIALDNKLTISDKIIWMSSQVEDNFFPPVFQGLKTYIDSDEIYQEKLLSVPA
FT                   DFEPIVEWKSCTELPNEWSNNGVDNLFQDSLDDCSFVASFLSCNNIGIPLMDKVIPHKN
FT                   SFKYAVRLTFNGCERLVFIDSRLPLLRNTSKTLRVSSFSNKDLLWPSIIEKAFLKMCDD
FT                   GYKFSGSNSAIANYALTGWIPEVIKTSSCTIADISRLHEDFRNGNVVLCLGTGNLTERE
FT                   CKQYGLIPNHDYAVTKLSFTNDSEYKFDIRNPWTKGQKAVTITDLSTFEVIYANRNPIM
FT                   FSHMNQLSGICQSQVNEEFIDLILNHSQYTLGNDGNSTIDVILFFERHSLRKKISAESR
FT                   IEIFQSEGERLISRRNKASKECVSNNTNFHFITIELKPLEKVTVVIDIGESSIRSHPFT
FT                   LKAFANDSTITLNKALSRPGCFKQMDLELTPLNSGGNWDNYAYYKNPQLIVTLHGDSTD
FT                   EAPFESAVFSKSDKTLFTYTVFWKSDDPDFPFITDASKNKLVSTDNKYKYRSCTRSRVV
FT                   SCDKSYLFVLSSYEPDAIESFKVFFQCSHDFSIEWAETSLGLFTKEETFSWKDQLVKEF
FT                   IIQVYNPSKLKVHAVNTNNKRRSKLNCSLSFQNTLISSLQDYTDNLYGCFISGNLEIPG
FT                   KYLLQVHKNIISNEECLVEIGSSSSFELWEHH"
FT   CDS_pept        1210399..1211712
FT                   /locus_tag="PAS_chr3_0636"
FT                   /product="Beta subunit of the CAAX farnesyltransferase
FT                   (FTase)"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0636"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70685"
FT                   /db_xref="GOA:C4R549"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR026872"
FT                   /db_xref="UniProtKB/TrEMBL:C4R549"
FT                   /protein_id="CAY70685.1"
FT                   /translation="MSNSKKKVDWYKTVLGSRRIVEEMVVKSETQSNQIDTLEIMLSSK
FT                   GSGSQKVGTLTTEQQVKVEDDIRQIYESILDDGQLPTLETTQHRSFVKYFLETNLPAGF
FT                   IALDASHTWMIFWLVNSFLLLGGKIDEDMSNRISENILSYLNEDGGFGGGAGLISHVVS
FT                   SYAAVMALCLSNDHHVLDKIDRQKTYEWLLSLKLEDGSFCMYKGGEVDTRAVYCALVIA
FT                   SVLGILTPELVAGTAEWLGRCQTFEGGFGGVPGDEAHGGYSFCAVAALSILGPPQEIIT
FT                   RHCDLKNLVKWSVNRQFQLEGGMNGRTNKLVDGCYSHWVGGIFPFLELATQCDLLDRAA
FT                   LKNYILICCQEENGGLRDKPGKRPDFYHTNYVLCGLSLCQHKAKHDPALMTEKLGASAF
FT                   AYRVERIKDPQEDPANFIEPLHPIFGIPMNTVLKNREL"
FT   CDS_pept        complement(1211716..1212969)
FT                   /locus_tag="PAS_chr3_0637"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0637"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70686"
FT                   /db_xref="GOA:C4R550"
FT                   /db_xref="InterPro:IPR018571"
FT                   /db_xref="UniProtKB/TrEMBL:C4R550"
FT                   /protein_id="CAY70686.1"
FT                   /translation="MSLSRVARDANGVLYETLLSAAKRETEDFSSQDNCVTCSDVPTCP
FT                   TCKSNEKCVLTARTCSTCPEMSCVHDENSGSSSSLSSAATGGISAGAVVGALVIFSLMG
FT                   FLYFRYVYKPKKMRQQDEEANNVKDMTDDKSTLSNTQKSGDIDLERRNSSLTLSTMANT
FT                   ILTKTSNIIPIAYIPGVMVSNSGRSNSTYSKSILSDDNFSSFHEDASIHNEKRNDSNTT
FT                   TAIRAVPRLVNIAEEDDSSSIVELQSIRLAPIHRPSMPVARLNMDDELQKTTTGGNSSD
FT                   AQTFGDDESTDLASSDEDLDYEDIQREHEKRQKAKIEKELGSSKSNSGTTSFKTLLDSS
FT                   QPGTLGSAAVTNTLQTGRRVEPKELDGADDNTKADDPLDNSDVEIFLDVDIEPMNKNSF
FT                   EESESGSVSPFDDKYGLN"
FT   CDS_pept        complement(1213159..1213980)
FT                   /locus_tag="PAS_chr3_0638"
FT                   /product="Subunit of the heme-activated, glucose-repressed
FT                   Hap2/3/4/5 CCAAT-binding complex"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0638"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70687"
FT                   /db_xref="GOA:C4R551"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR027170"
FT                   /db_xref="UniProtKB/TrEMBL:C4R551"
FT                   /protein_id="CAY70687.1"
FT                   /translation="MQEQEYYEEYEQNEENAAEDDQSEGQEEEEDEDDEFGAGSAFQNV
FT                   GQGLTGRSKNMMMQYWQETINSIEHDDHDFKNHQLPLARIKKVMKTDEEVKMISAEAPI
FT                   LFAKGCDIFITELTMRAWIHAEENKRRTLQRSDIAAALKKSDMFDFLIDIVPRDEEKGK
FT                   RTKGMQPPPHSTLPGAAQIPPNGPHEIEAMDDSNNYQTFLQDYQNDNGGTVPDQNLLDQ
FT                   QYHIQQQQQQQQQQQQQQQQQQSQQQSQQQSQSQRTQPEDPTQLQRMYNGF"
FT   CDS_pept        join(1214277..1214447,1214498..1214791)
FT                   /locus_tag="PAS_chr3_0639"
FT                   /product="Sorting nexin"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0639"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70688"
FT                   /db_xref="GOA:C4R552"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="InterPro:IPR039358"
FT                   /db_xref="UniProtKB/TrEMBL:C4R552"
FT                   /protein_id="CAY70688.1"
FT                   /translation="MPSPFQSFQSNLSPSKHTQSFQELYGEPENFLEIEVINPITHGSG
FT                   SSMYTDYEIVCRTNIPMFKFKESRVRRKYSDFDSFRKVLESQTNNVVIPKLPEKSFFNY
FT                   HRFNDDFIEERRQGLQQFLKVIAGHPLLQTGSKALTSFVQDEHWNKSKFL"
FT   CDS_pept        1214987..1215787
FT                   /locus_tag="PAS_chr3_0640"
FT                   /product="Carboxypeptidase Y inhibitor, function requires
FT                   acetylation by the NatB N-terminal acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0640"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70689"
FT                   /db_xref="GOA:C4R553"
FT                   /db_xref="InterPro:IPR001858"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR035810"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:C4R553"
FT                   /protein_id="CAY70689.1"
FT                   /translation="MLLGFQRFPKFHTLTRKSPINSIRSLRYKFQRPLLTPLFLSPIIK
FT                   QSMNLVTISDSIRENLIKHEVIPDVIKDKSFVPKGLLIISYGSPDKEVVLGNTLKVEDA
FT                   QSIPKITFTVNLNEEQEIASFFDEKFTLVVTDPDAPSRTDNKWSEFCHYVVSDLSLSTK
FT                   SGTTDAEDQVNFTTDLKVDTIPESDSKTLVPYLGPGPPPKTGLHRYVFLLYKQKPGVSL
FT                   EGPDPKNRPNWGTGIPGSGVSDWAAKNSLSLLAVNFFFAQNKDN"
FT   CDS_pept        1215967..1218171
FT                   /locus_tag="PAS_chr3_0641"
FT                   /product="Subunit of holo-CPF, a multiprotein complex and
FT                   functional homolog of mammalian CPSF"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0641"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70690"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR021850"
FT                   /db_xref="InterPro:IPR032460"
FT                   /db_xref="UniProtKB/TrEMBL:C4R554"
FT                   /protein_id="CAY70690.1"
FT                   /translation="METQISSLISAREVAFQKPQLYTDIFHNLLPFIYNQNTTLQTLVI
FT                   DFLKESFVDEKLDKELQLQLADELLQPLSYLISSKSHLELPRAPSPANFVKIIQLTNHI
FT                   YPIIFKKCLSSPQMQDLESKWDQLQSLRDNLIQKFGTAYPLLPLNPESDASRSTRSNIT
FT                   LVMFITNVLSILSIAPPKDPRAARARKLKNTPEDLSIVSIPSDHKFLNMTRLEVEGRQI
FT                   LDVLFDALNDSRIINSPLFCVITNRLLTLFKKRPGLVSVKLFDFMIAYESMNKEDPLFE
FT                   SNQLKMRLIRRFNDRILKVMIGYCLNKSFVKDTKLLKRFQNKFTYYQGMFEDQRKRGLL
FT                   KPDSHEIKREEKRAEFKKKKITGNESLEEQLQNNPSESPLFYYNSSPITPDLSYSSLYS
FT                   LISPNNKLASFNMSELPQNILIDMIAYSLQNTTTRKLVKGLEIISDRFQNVMKFQQNYT
FT                   ISQDQDIQIANVPDSVKREDDKDLQDDYNPDLVYELPLPNYMTFKDQKKQLLKIISQFM
FT                   ELAQLDYKQPILSDVSNDDSLNGVALSSWKENTWLVFLTRLATRGLCDAQHTNEDGTVE
FT                   NLNDLVRDAIFTYFTADIRGRIDVVIDWLNEEWICEVARNRKEDNEVPDTPVYNAWGSK
FT                   VLDNIIPFMENSDRKIFLRLLSELPSLNEQMVEKIKSICLDPIRYKFGFVSLQFLIMFR
FT                   PPLKDIAINLFRRLYQETDLDDLKAECLSYLKKYCPGEYT"
FT   CDS_pept        complement(1218207..1219736)
FT                   /locus_tag="PAS_chr3_0642"
FT                   /product="Subunit of the SF3a splicing factor complex,
FT                   required for spliceosome assembly"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0642"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70691"
FT                   /db_xref="GOA:C4R555"
FT                   /db_xref="InterPro:IPR000690"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="InterPro:IPR024598"
FT                   /db_xref="InterPro:IPR031590"
FT                   /db_xref="InterPro:IPR031774"
FT                   /db_xref="InterPro:IPR031776"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C4R555"
FT                   /protein_id="CAY70691.1"
FT                   /translation="MPSLLESQRLSLEELDRIELEIAERIRRNPDIYKAYFSHNLLGGV
FT                   KRPLKQTLLQQHEIKHFLDQYSKKSQQINQEVIKDGEKLFQEIQEIKLDLSGSFKLFGQ
FT                   KIEQLKNNHKMHPNQPLDELSQLYSMFSSQFENERYPKKRKIVSAFCSDLRLDSIFSLE
FT                   ENYGQFLDLSKFYTQWQNLPGNKEADINLHGYISNFSNFKKSFSSVNKNSTEYQVYLTS
FT                   LYAYLCDFWIKIQPLNEPEKNILAINAKGVELQNKSDESIQLNQDGSVFCKSCQKSFAK
FT                   ETVYKGHLTGKKHLKNLKGNGKAPETTNQVPILEFKIREISVLLEKQIQETIKNVERRS
FT                   HLSERERLMDIEARQQESEDEYDFEGSDEISHGNSDEEGVETLDNGLKVAMGPDGKPIP
FT                   YWLWKLNGLSLEFNCELCGNVKYHGRKEFESHFQETRHGHGLRCLGIKPQFFSWFKDIS
FT                   GISEATELWQNIQKEHGIVKDSDESNIETEDNEGNVMSVKVYNELKKQGLL"
FT   CDS_pept        complement(1219848..1223330)
FT                   /locus_tag="PAS_chr3_0643"
FT                   /product="Putative ion transporter, similar to mammalian
FT                   electroneutral Na(+)-(K+)-C1-cotransporter family"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0643"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70692"
FT                   /db_xref="GOA:C4R556"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="InterPro:IPR018491"
FT                   /db_xref="UniProtKB/TrEMBL:C4R556"
FT                   /protein_id="CAY70692.1"
FT                   /translation="MSPERTPLLPLTKPKPHQETASVSSKAEDHKLTTFGGVFIPTTLN
FT                   VLSILMFLRFGFILGQMGILGCLLLLVMSYTIDLLTTVSISAIATNGTVRGGGAYYMIS
FT                   RSLGVEFGGAIGFIFFIGQVLNSSLNVAGFIEPLMVNFNTESGLLGSFLPPGKWFEFAY
FT                   CSLFLLICTCVALIGSSSVSKAGTFLCFALLIATISVPVSTLFVQPFEVPSMNSFYSGP
FT                   SLTTAKANMFPHFTKGAAGSQIKGRETFNDLFGIFFPATAGIFAGASMSGDLKRPSYSI
FT                   PRGTLWGLAITFVCYASVIIAMGVSIPRDLLHKDIQVIQTVSMSKPLIILGELSTSLFS
FT                   VIVGIVGAAKVLQAIARDKIFPGISLFAKGHKKTDDPTIGILFTWVLTQLFLFADINRI
FT                   ATFITMAFLMTFIVTNIACLLLKIGSAPNFRPSFKYFNTATAFFGAVACFLAMFIVDGL
FT                   SACLILIFLLFLILFIHYTSPPKQWGDVSQSLIYHQVRKYLLRLRQDNVKYWRPQVLLL
FT                   IDNPRTSWNLIQFCNSLKKGGLYILGHVIITETFQDRYRELKRQKLKWTQFRDFASLKA
FT                   FVQIGIGPNLAWGVRNVFLGSGLGGMKPNITVLGFFDLSTYAQQHPDALRTSSKSYERN
FT                   NYEYNHQLPDHIQSLPTDSCKAEQRVNITEWVRIIEDLIILESNVAVAKGFPRLEIPEK
FT                   NSPEKSSQEKTFIDLYPIQMSAQVTNKQTSKSALTTNFDTYTLILQLGAILNTVPQWKR
FT                   SHKLRVVVFVEYQEDVEDEKHRLTLLLEALRIQAQIKILVLSDGKYKVYEYITKGTITD
FT                   ARIMESISEALSKDDWWSSVLEARKHRSMTRNLVALNKTVTIPFSRMTKRRLTMSNLQT
FT                   MGVSMSMKTNNLPGPEISQLEYSDDDDYYSEDDMSLYSNAILPNASTVPDIPNGAGPKG
FT                   FNESSRNMSSAAALHRMKGPGSESSTAIRNHSKPDGVMLKPKLSKYGSTSSIQSGTITP
FT                   KKPIKSAAFTASRIPAAHVVEDAEGEEPSIMFVPETETNKPKQLAVRAPTTRLKPPSVN
FT                   RSHDDSSGKDTTEVSEEDQESNSAQELEFDEDIHFSFNEITTKAQHLILNEIMKKISLN
FT                   SSVIFSTLPTPEIGCHNSEADSLEYVQSLDVWCDGLPPILLINAQTMTVTTAL"
FT   CDS_pept        1223588..1225942
FT                   /locus_tag="PAS_chr3_0644"
FT                   /product="RNA helicase in the DEAD-box family, necessary
FT                   for prespliceosome formation"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0644"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70693"
FT                   /db_xref="GOA:C4R557"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4R557"
FT                   /protein_id="CAY70693.1"
FT                   /translation="MELSLEEKKRKRLEKLALWKKKKEKEEQEKNVKNSQIEEPPIKKV
FT                   KGFAIKKHNQPARQIKRNAKGLRLFTDQGEESELKKKTPLLVNGIQNSKKGSNHDKEPE
FT                   TDLDSLLDELKSNPHKLVTKNQKTQNVIIEETQEDDASFYDSQDDAQALLETLKNKNKK
FT                   VIKFIEPSTEPFEKQFYTEPESISSLPETDVQAIRAIHNIKIRGKHIQRPITEWCQLAL
FT                   PQQFMSVIEDLKYEAPTPIQSEALPNLMSGKDLIGIAKTGSGKTLAFLLPMFRQIISQP
FT                   DPESGEGPIGVILTPTRELALQIFKECKPFMKSLNLKGICVYGGASISQQISDIKKRVH
FT                   FAVCTPGRLIDLLTANSGRVTNLSRTSYLVLDEADRMFDMGFEPQVMKIIPNTRPDRQT
FT                   LVFSATFPPKMEALAKKVLNNPLEVIVGEKSVVADTITQKVFVIDPQERFSKLLELLGT
FT                   FKSKDPTGKVLVFVERQDSADVLLTNLLKRGYNAQSLHGGKEQMDRDFIIQDFKTGNSD
FT                   ILVATSVAARGLDVKRLNLVINYDSPNHMEDYVHRVGRTGRAGSTGEAVTFLTAKDYRA
FT                   AYDVSRALKVSKQLVPDNVQAVANVFIEQLKTGSAKRGSGYGGKGLEKLQEERELKRQL
FT                   EKTTYGDEVATADPKKENTHGATATPPPLDQPVEEFKVVFGSEPSGNGTTQFHATIEIN
FT                   DLPQQVRWTMTNRVNISDIIEASNASITSKGRFYPTGKAPSEGEDPKLYLLIEADSEAS
FT                   VNKAVSLFKGKMIEALLQETKDKSKGRYTIT"
FT   CDS_pept        complement(1228904..1234018)
FT                   /locus_tag="PAS_chr3_0646"
FT                   /product="Phospholipase D, catalyzes the hydrolysis of
FT                   phosphatidylcholine"
FT                   /db_xref="EnsemblGenomes-Gn:PAS_chr3_0646"
FT                   /db_xref="EnsemblGenomes-Tr:CAY70694"
FT                   /db_xref="GOA:C4R558"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro: