(data stored in SCRATCH zone)

EMBL: FN434114

ID   FN434114; SV 1; circular; genomic DNA; STD; PRO; 28259 BP.
XX
AC   FN434114;
XX
PR   Project:PRJNA46805;
XX
DT   25-MAR-2010 (Rel. 104, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   Erwinia amylovora CFBP1430 plasmid pEA29
XX
KW   complete genome.
XX
OS   Erwinia amylovora CFBP1430
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Erwiniaceae; Erwinia.
OG   Plasmid pEA29
XX
RN   [1]
RP   1-28259
RA   Blom J.;
RT   ;
RL   Submitted (24-JUL-2009) to the INSDC.
RL   Blom J., Cebitec, Bielefeld University, Universitaetsstr. 25, 33615,
RL   GERMANY.
XX
RN   [2]
RX   DOI; 10.1094/MPMI-23-4-0384.
RX   PUBMED; 20192826.
RA   Smits T.H., Rezzonico F., Kamber T., Blom J., Goesmann A., Frey J.E.,
RA   Duffy B.;
RT   "Complete genome sequence of the fire blight pathogen Erwinia amylovora
RT   CFBP 1430 and comparison to other Erwinia spp";
RL   Mol. Plant Microbe Interact. 23(4):384-393(2010).
XX
DR   MD5; 844d8b2f46685379f66eef6ddd563d97.
DR   BioSample; SAMEA3138297.
DR   RFAM; RF00059; TPP.
DR   StrainInfo; 761795; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..28259
FT                   /organism="Erwinia amylovora CFBP1430"
FT                   /plasmid="pEA29"
FT                   /strain="CFBP1430"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:665029"
FT   gene            13..990
FT                   /gene="repA"
FT                   /locus_tag="EAMY_3712"
FT   CDS_pept        13..990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="EAMY_3712"
FT                   /product="plasmid replication protein"
FT                   /function="Protein involved in initiation of plasmid
FT                   replication"
FT                   /db_xref="EnsemblGenomes-Gn:EAMY_3712"
FT                   /db_xref="EnsemblGenomes-Tr:CBA18913"
FT                   /db_xref="GOA:D4I4M6"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4I4M6"
FT                   /protein_id="CBA18913.1"
FT                   /translation="MELNKLTVVQGNDLLEGAYSVTLDEMRLLNLALAQIDSRKPQPDA
FT                   LYRLFPHDYQRIYGLNPTSCHRQLREAAESLMKKPVTIYQPDRKSGKTRTVQLSWFSRL
FT                   EYVSSDEQSAVILRFGQDVAPYLYELKESFTKLNFTNIAKLDTPFSVRLYGWLIKAKNL
FT                   YGRKGSKAIEVTLALDWMREKAGLQGKYEDYRDFRQKLLEPTLARINANTDISVIWHPV
FT                   KKGRTVVSIRFSYVDESTPEASKPLRPKFPRRPRAAAGSELEGAWARRCIAIMEQYRDC
FT                   LITYDRTEKVPLTDVRKLAGWYKIIGDKIACKRVMSEVNARAKK"
FT   gene            complement(1368..1694)
FT                   /locus_tag="EAMY_3713"
FT   CDS_pept        complement(1368..1694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EAMY_3713"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /db_xref="EnsemblGenomes-Gn:EAMY_3713"
FT                   /db_xref="EnsemblGenomes-Tr:CBA18914"
FT                   /db_xref="UniProtKB/TrEMBL:D4I4M7"
FT                   /protein_id="CBA18914.1"
FT                   /translation="MNSVNPTWPGLALPAVHSNIGGGYLPVVKENLFLTRPETNNAPLH
FT                   QASTQICGYHQAVKQMAVVDSYPCISAVLRGFGGKRAYGDRGPANRYGELQKRSFAAIT
FT                   PGGR"
FT   gene            complement(1691..1825)
FT                   /locus_tag="EAMY_3714"
FT   CDS_pept        complement(1691..1825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EAMY_3714"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /db_xref="EnsemblGenomes-Gn:EAMY_3714"
FT                   /db_xref="EnsemblGenomes-Tr:CBA18915"
FT                   /db_xref="UniProtKB/TrEMBL:D4I4M8"
FT                   /protein_id="CBA18915.1"
FT                   /translation="MTAPASGLNPNNADTGDVKLTLRPGVAEKVFHITAEMNAGSTLR"
FT   gene            complement(2725..3129)
FT                   /gene="hns"
FT                   /locus_tag="EAMY_3715"
FT   CDS_pept        complement(2725..3129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hns"
FT                   /locus_tag="EAMY_3715"
FT                   /product="histone-like nucleoid structuring protein"
FT                   /function="DNA-binding protein H-NS"
FT                   /note="Histone-like nucleoid-structuring protein H-NS, H-NS
FT                   histone family"
FT                   /db_xref="EnsemblGenomes-Gn:EAMY_3715"
FT                   /db_xref="EnsemblGenomes-Tr:CBA18916"
FT                   /db_xref="GOA:D4I4M9"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR027454"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:D4I4M9"
FT                   /protein_id="CBA18916.1"
FT                   /translation="MSETLKVLNNIRTLRAQAREVSLSELEEMLEKLEAVVNERRDAEA
FT                   AIASEIKEKEEKLAKYRQMLLEDGIDLSELTSAENTSGKPRAKRAPRPAKYEYTDENGE
FT                   HKSWTGQGRTPAVIKQALDAGKKLEDFLIK"
FT   gene            complement(3890..4144)
FT                   /gene="pgtE"
FT                   /locus_tag="EAMY_3716"
FT   CDS_pept        complement(3890..4144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgtE"
FT                   /locus_tag="EAMY_3716"
FT                   /product="outer membrane protease E"
FT                   /function="Outer membrane protease"
FT                   /EC_number="3.4.23.49"
FT                   /note="Outer membrane protease E precursor (E protein),
FT                   Peptidase A26, omptin"
FT                   /db_xref="EnsemblGenomes-Gn:EAMY_3716"
FT                   /db_xref="EnsemblGenomes-Tr:CBA18917"
FT                   /db_xref="GOA:D4I4N0"
FT                   /db_xref="InterPro:IPR000036"
FT                   /db_xref="InterPro:IPR020080"
FT                   /db_xref="UniProtKB/TrEMBL:D4I4N0"
FT                   /protein_id="CBA18917.1"
FT                   /translation="MRSLKFRAKTSDSGYHGTSVDAGYYVTLAANVFAEFSYNKYEEGK
FT                   GGIQIIDTSSADSASLRPDAAGISNRNHTVTVSLQYRLV"
FT   gene            complement(4410..4535)
FT                   /locus_tag="EAMY_3717"
FT   CDS_pept        complement(4410..4535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EAMY_3717"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /db_xref="EnsemblGenomes-Gn:EAMY_3717"
FT                   /db_xref="EnsemblGenomes-Tr:CBA18918"
FT                   /db_xref="UniProtKB/TrEMBL:D4I4N1"
FT                   /protein_id="CBA18918.1"
FT                   /translation="MRVFFGTDHVAAAHAAPEFATGSISVADPPGMPGGKSKTSR"
FT   gene            complement(4770..5627)
FT                   /gene="yneJ"
FT                   /locus_tag="EAMY_3718"
FT   CDS_pept        complement(4770..5627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yneJ"
FT                   /locus_tag="EAMY_3718"
FT                   /product="Uncharacterized HTH-type transcriptional
FT                   regulator yusT"
FT                   /function="Transcriptional regulator"
FT                   /note="LysR, substrate-binding, LysR substrate binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:EAMY_3718"
FT                   /db_xref="EnsemblGenomes-Tr:CBA18919"
FT                   /db_xref="GOA:D4I4N2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4I4N2"
FT                   /protein_id="CBA18919.1"
FT                   /translation="MELAQLEIFRAIAEEGSVTAAAEKLHRVPSNISTRLKQLEKELGC
FT                   ELFRREKLRLYITDNGRTFLAYSQRILALSEEAKQSVSGQRPDGIFTLGAIESTAAVRL
FT                   PPLIARYHQSWPQVGLDLSTGPSGDMVDGVLAGRYSAAFVDGPPKHPRLEGIPVFAEEL
FT                   VLITALNHPPVSAASAVSGSTIYTFRENCSYRRLFENWFARTHAVPGKIFEMESYHGIL
FT                   ACVSAGAGLALIPASMLESMPGRDSVKAWPLSEAMGQIAIWLVWHKGTRSANLQAMKTL
FT                   LTED"
FT   gene            5674..7158
FT                   /gene="aldD"
FT                   /locus_tag="EAMY_3719"
FT   CDS_pept        5674..7158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aldD"
FT                   /locus_tag="EAMY_3719"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /function="NAD-dependent aldehyde dehydrogenases"
FT                   /EC_number="1.2.1.-"
FT                   /note="Aldehyde dehydrogenase, Aldehyde dehydrogenase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:EAMY_3719"
FT                   /db_xref="EnsemblGenomes-Tr:CBA18920"
FT                   /db_xref="GOA:D4I4N3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D4I4N3"
FT                   /protein_id="CBA18920.1"
FT                   /translation="MNQSQDYDERYAKSWRNRRWLSHPFWFSDKAVMMKNVSSAVAVSR
FT                   NPATGEVFARYPFATIDEVDRALALTHGAFQDWRHSVMSDRVRLLRNVAGALRQQAREL
FT                   AEMMTSEMGKPVDQGLAEVEKSARLCEWYAEHGPAFLQREPTLVEGNKAFVDYLPLGPV
FT                   LSVMPWNFPVWQVLRGAVPILLAGNSYLLKPAPNVMGCALLLQQILSRAGVPQGLFAVV
FT                   NADNDGVAQAINDRRIAAVTVTGSVRAGAAIAALSGAAIKKCVLELGGSDAFIVLAEAD
FT                   IDAAVKGAIAGRFMNNGQLCISAKRIIVEAAVFETFRDKFVCAVREMKIGDPRESGTWI
FT                   GPMARYDLRDELDAQVQATLKEGATLLLGGHVLPGEGNYYAPTVLSDVKPGMTSFVQEL
FT                   FGPVASLIMADDAGHAVAMANDSEFGLGGSLWSRDLAVAQKLASRIETGSVFINSPSFS
FT                   DPRVPIGGVKKSGFGRELSHFGLREFTNAQTVWMEG"
FT   gene            complement(7164..7322)
FT                   /locus_tag="EAMY_3720"
FT   CDS_pept        complement(7164..7322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EAMY_3720"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /db_xref="EnsemblGenomes-Gn:EAMY_3720"
FT                   /db_xref="EnsemblGenomes-Tr:CBA18921"
FT                   /db_xref="UniProtKB/TrEMBL:D4I4N4"
FT                   /protein_id="CBA18921.1"
FT                   /translation="MVIWQPLGMQEALSRMRNVGNLKSMPQRYLVMRAQLTLTPLQPTA
FT                   EEGEAKP"
FT   gene            complement(7441..8997)
FT                   /locus_tag="EAMY_3721"
FT   CDS_pept        complement(7441..8997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EAMY_3721"
FT                   /product="Methyl-accepting chemotaxis serine transducer"
FT                   /function="Methyl-accepting chemotaxis protein"
FT                   /note="Bacterial chemotaxis sensory transducer,
FT                   Methyl-accepting chemotaxis protein (MCP) signaling domain"
FT                   /db_xref="EnsemblGenomes-Gn:EAMY_3721"
FT                   /db_xref="EnsemblGenomes-Tr:CBA18922"
FT                   /db_xref="GOA:D4I4N5"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:D4I4N5"
FT                   /protein_id="CBA18922.1"
FT                   /translation="MNRWTVKVKLSMSIAMIIISFLILTSFLLSRLTATTSELQNLYER
FT                   DYQSASIIGQVDGLLTRVDINILRMIAIGDPASIAGWKKQNTENFDEVNALLNKLKPTI
FT                   DTTMTSSFNGLISSYELMRKGMEHQVQAVESGDIKKASEINRNEVKAYADKTFGALSTL
FT                   KKHQDAVAENKVVAQKRKDFRTLIISLLAAGAVTLISVALGTLILRSLLRQLGGEPLAA
FT                   AQEVRLMAGGDLSHPILVEQHDRVSLLAQLKDMQSSLSALVTNVRSNAESLATASTQIS
FT                   QGNQDLSQRTEEQASSLQQTSATMEQLGSTVSNNAENAHQASQLASGASTLAAEGELMV
FT                   GRVISTMRVINDSSKKISEIINVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAAEV
FT                   RSLAQRSANAAKEISTLITNSVGQVEQGCLLVDETGVTMTRIMEAIKQVKYIVSEISAA
FT                   SLEQSSGVKQVGQAITQIDMVTQQNAALVEESAAATENLKEQAEQLVQAVAVFQVTATA
FT                   V"
FT   gene            complement(9346..9693)
FT                   /locus_tag="EAMY_3722"
FT   CDS_pept        complement(9346..9693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EAMY_3722"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EAMY_3722"
FT                   /db_xref="EnsemblGenomes-Tr:CBA18923"
FT                   /db_xref="GOA:D4I4N6"
FT                   /db_xref="InterPro:IPR018668"
FT                   /db_xref="InterPro:IPR036361"
FT                   /db_xref="UniProtKB/TrEMBL:D4I4N6"
FT                   /protein_id="CBA18923.1"
FT                   /translation="MHKPQTLSKVCAIHTDLPDTTMTTHSSKDPLHGVTLEALLTMLVA
FT                   RFGWQQLAERININCFKSDPSIKSSLKFLRRTPWARKEVEDLYIASLKDNHSAKPEMPT
FT                   DNPWNSRQRKD"
FT   gene            10136..11419
FT                   /locus_tag="EAMY_3723"
FT   CDS_pept        10136..11419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EAMY_3723"
FT                   /product="Protein hipA"
FT                   /function="Uncharacterized protein related to capsule
FT                   biosynthesis enzymes"
FT                   /note="HipA-like, N-terminal, HipA-like C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:EAMY_3723"
FT                   /db_xref="EnsemblGenomes-Tr:CBA18924"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:D4I4N7"
FT                   /protein_id="CBA18924.1"
FT                   /translation="MKMRGLKHTESLVVLKSGVKVGELFKPEGKGIYFVYDQHWIATGF
FT                   NLSPLTMKFDNKPQLAQDAKLFEGLHGPFADSLPDGWGMLLMDRFFNSTFGDGTAYTVT
FT                   ALDRLAYMGDRCMGAFEYQPKADKSALTGTVSLAELFEQSVGVQEGETSTVLSKLRLAG
FT                   GSPGGARPKAIVALSPDGKHATSAFDKIPEGYSHWIVKFRDLNEPVETGGIEFAYAEMA
FT                   RDAGIDMAESSILNITLPTGRVENFFATRRFDRCGDKKIHMITVAALMYASFREPSMDY
FT                   ASLLKLTQHLTRNSREVEKMARLMIFNALSHNHDDHTKNFAFLCHDPEHTGGESIWTLA
FT                   PAYDLTFSRAMGEHTTGFGGKNPGKPTRKRINEICQDYKYLKADEYIEQTLDALSRWKD
FT                   VFERLKIPQKSGTGIFNILNKLHRDFES"
FT   gene            complement(11613..12578)
FT                   /gene="thiF"
FT                   /locus_tag="EAMY_3724"
FT   CDS_pept        complement(11613..12578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiF"
FT                   /locus_tag="EAMY_3724"
FT                   /product="thiazole biosynthesis adenylyltransferase"
FT                   /function="Dinucleotide-utilizing enzymes involved in
FT                   molybdopterin and thiamine biosynthesis family 2"
FT                   /EC_number="2.7.7.-"
FT                   /note="thiazole biosynthesis adenylyltransferase ThiF"
FT                   /db_xref="EnsemblGenomes-Gn:EAMY_3724"
FT                   /db_xref="EnsemblGenomes-Tr:CBA18925"
FT                   /db_xref="GOA:D4I4N8"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D4I4N8"
FT                   /protein_id="CBA18925.1"
FT                   /translation="MSRYQRQSMLPEIGESGQQRLAQARVLVIGAGGLGSALLPLLAAA
FT                   GAGYLRLYDGDRVEEHNLHRQTLYGMQDIGEEKVFCARRALATRNPACVVDARPHALTA
FT                   SATAAALDGIDLAIDAADNFALTYQLSDACLAHRIPLVSASVLGRRGYVGGFCGGAPSY
FT                   RALFPQLPGSAANCNTAGVMGPAVATLGAMQAQMALSILLNFSPSPLGCLVNCDFVQWH
FT                   FRPFRFDSAAEPDRPPVPFIDRHLLTAEDCIVELRSVDEAPESIADAVQRVLPQQLSDW
FT                   QPPADRRIVLVCASGIRAAKAAMALELRGFSHLAMIAAGR"
FT   gene            complement(12594..13352)
FT                   /gene="thiG"
FT                   /locus_tag="EAMY_3725"
FT   CDS_pept        complement(12594..13352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="EAMY_3725"
FT                   /product="Thiazole biosynthesis protein thiG"
FT                   /function="Uncharacterized enzyme of thiazole biosynthesis"
FT                   /EC_number="1.5.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:EAMY_3725"
FT                   /db_xref="EnsemblGenomes-Tr:CBA18926"
FT                   /db_xref="GOA:D4I4N9"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:D4I4N9"
FT                   /protein_id="CBA18926.1"
FT                   /translation="MFYDFVPQSRFLLGTAGYPSPQILQQAIEASGSEIITVSLRREGS
FT                   QGGAFRALLTQLNKRVLPNTAGCHTVKEAVTTAYMARELFNTRWIKLEVIGHADTLQPD
FT                   PFALVEAARILCADGFQVFPYTTEDLILGEKLLEAGCKLLMPWGAPIGSGQGLRNIEGL
FT                   RSMRSWFKDIPLIIDAGIGAPSQAAQAMEMGFDGILLNTAVARAQDPLGMAQAFASAIR
FT                   AGYDARSAGLIERRDMATASTPIFGMAQFS"
FT   gene            complement(13356..13553)
FT                   /gene="thiS"
FT                   /locus_tag="EAMY_3726"
FT   CDS_pept        complement(13356..13553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="EAMY_3726"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:EAMY_3726"
FT                   /db_xref="EnsemblGenomes-Tr:CBA18927"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D4I4P0"
FT                   /protein_id="CBA18927.1"
FT                   /translation="MKIQLNGSSIDTHARTLAELLHERQIDAGCIASAVNGQFVPRSQY
FT                   DSQPLTEGCALEVLAPMQGG"
FT   gene            complement(13550..14632)
FT                   /gene="thiO"
FT                   /locus_tag="EAMY_3727"
FT   CDS_pept        complement(13550..14632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiO"
FT                   /locus_tag="EAMY_3727"
FT                   /product="glycine oxidase ThiO"
FT                   /function="Glycine/D-amino acid oxidases (deaminating)"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:EAMY_3727"
FT                   /db_xref="EnsemblGenomes-Tr:CBA18928"
FT                   /db_xref="GOA:D4I4P1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4I4P1"
FT                   /protein_id="CBA18928.1"
FT                   /translation="MITAEDTCREGMPDTAPPFSPFLYHGSPHVLRGLRDNIHSFYPVA
FT                   GKPHIMSRWSVIGDGVTGLCVATLLAERGESLEVITDEHRQPASHWAGGMLAPWCEGES
FT                   APPEVVELGQRSAPWWCAHVDGVEHRGTLVVAPPRDAPELTRFARMTHAHQWVEPGTLE
FT                   PDLAGRFARGLFFAGEAHLDPRSAMQQLRKKLRRAGVNFHGGQPAGRAIDCRGIHAAAQ
FT                   MPGLRAVRGEMLILHSDDLRFSRPVRLLHPRFPCYLVPRAEGHFMLGATMVESHDSSPI
FT                   SARAMMELLSAAYGIHPALAEARIVESGTGLRPALPDNIPDIRHRNGTWYLNGMYRHGF
FT                   LLAPVMAEKLMQQLTQENLI"
FT   gene            14982..15227
FT                   /locus_tag="EAMY_3728"
FT   CDS_pept        14982..15227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EAMY_3728"
FT                   /product="prevent-host-death protein"
FT                   /function="Antitoxin of toxin-antitoxin stability system"
FT                   /note="Prevent-host-death protein"
FT                   /db_xref="EnsemblGenomes-Gn:EAMY_3728"
FT                   /db_xref="EnsemblGenomes-Tr:CBA18929"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:D4I4P2"
FT                   /protein_id="CBA18929.1"
FT                   /translation="MEKVNIYDAKTNLSRIVQEVARTGETVLIARNGHALVKVIAYKEE
FT                   KPKRKLGFLKGKGSVPADFDNLNSNEIQDMFEGKYS"
FT   gene            15255..15647
FT                   /locus_tag="EAMY_3729"
FT   CDS_pept        15255..15647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EAMY_3729"
FT                   /product="hypothetical protein"
FT                   /note="PilT protein, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:EAMY_3729"
FT                   /db_xref="EnsemblGenomes-Tr:CBA18930"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041705"
FT                   /db_xref="UniProtKB/TrEMBL:D4I4P3"
FT                   /protein_id="CBA18930.1"
FT                   /translation="MFMAYEPERLAENVVALLEDADLTLCFSAASIWEVVIKSGLNKPD
FT                   FDVGPEEFRNGLFNAGLLEIPVKSEHTLIVADLPEKRHKDPFDRLIVAQAKHNKVPLIT
FT                   SDSKLIEFVSDYITIIPNKYGLPPPR"
FT   gene            15799..15972
FT                   /gene="yi91"
FT                   /locus_tag="EAMY_3730"
FT   CDS_pept        15799..15972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yi91"
FT                   /locus_tag="EAMY_3730"
FT                   /product="IS911 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:EAMY_3730"
FT                   /db_xref="EnsemblGenomes-Tr:CBA18931"
FT                   /db_xref="UniProtKB/TrEMBL:D4I4P4"
FT                   /protein_id="CBA18931.1"
FT                   /translation="MICSPQNIAGTPMKRRNFSSELKRESAQLVVDQSYTEAEAASVMD
FT                   VGLSSMVTSGPA"
FT   gene            complement(16311..16577)
FT                   /gene="parB"
FT                   /locus_tag="EAMY_3731"
FT   CDS_pept        complement(16311..16577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="EAMY_3731"
FT                   /product="partitioning protein ParB"
FT                   /note="Ribbon-helix-helix"
FT                   /db_xref="EnsemblGenomes-Gn:EAMY_3731"
FT                   /db_xref="EnsemblGenomes-Tr:CBA18932"
FT                   /db_xref="GOA:D4I4P5"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR015354"
FT                   /db_xref="UniProtKB/TrEMBL:D4I4P5"
FT                   /protein_id="CBA18932.1"
FT                   /translation="MHHQCNYFGSDIMALEKNHTSSKKMTFGEHRDLDKVVDSPLPSGK
FT                   SKRVNVNFNEEKHTRFKAACVKNGTSITDVINQLVDNWLTEHE"
FT   gene            complement(16649..17299)
FT                   /gene="parA"
FT                   /locus_tag="EAMY_3732"
FT   CDS_pept        complement(16649..17299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="EAMY_3732"
FT                   /product="partitioning protein ParA"
FT                   /function="ATPases involved in chromosome partitioning"
FT                   /note="ParA nucleotide binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:EAMY_3732"
FT                   /db_xref="EnsemblGenomes-Tr:CBA18933"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4I4P6"
FT                   /protein_id="CBA18933.1"
FT                   /translation="MSIYSIEVLSMKVISFLNPKGGSGKTTAVINVSAAMARAGYNIAV
FT                   VDTDPQMSLTNWSKTGNAAFDVFTAASEKDVYGIRKDLAEYDFTIVDGAGSLSVITSAA
FT                   VMVSDLVIIPVTPSPLDFSAAGSVVTVLEAQAYSRKVEARFLITRKIEQATMLKVLKES
FT                   IKDTGVNPFRTAITQRQIYVKSILDGESVFESNDGAAKGEIEMLTKEIVSHIE"
FT   gene            complement(17642..17773)
FT                   /locus_tag="EAMY_3733"
FT   CDS_pept        complement(17642..17773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EAMY_3733"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /db_xref="EnsemblGenomes-Gn:EAMY_3733"
FT                   /db_xref="EnsemblGenomes-Tr:CBA18934"
FT                   /db_xref="UniProtKB/TrEMBL:D4I4P7"
FT                   /protein_id="CBA18934.1"
FT                   /translation="MQATDPWQKPETPLMQHLAFILVRFDAGTQHGMNACLVTTGMR"
FT   gene            17975..18172
FT                   /locus_tag="EAMY_3734"
FT   CDS_pept        17975..18172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EAMY_3734"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /db_xref="EnsemblGenomes-Gn:EAMY_3734"
FT                   /db_xref="EnsemblGenomes-Tr:CBA18935"
FT                   /db_xref="UniProtKB/TrEMBL:D4I4P8"
FT                   /protein_id="CBA18935.1"
FT                   /translation="MFNKNSHKADIYAPVILWKGNNVPQKVVKEFGGASVLEVVRDDRG
FT                   INKLPAIDVSPDIYVRKWSV"
FT   gene            18266..18850
FT                   /gene="tnpR"
FT                   /locus_tag="EAMY_3735"
FT   CDS_pept        18266..18850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpR"
FT                   /locus_tag="EAMY_3735"
FT                   /product="putative DNA-invertase from lambdoid prophage
FT                   Rac"
FT                   /function="Site-specific recombinases, DNA invertase Pin
FT                   homologs"
FT                   /note="Resolvase, N-terminal, Resolvase, N terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:EAMY_3735"
FT                   /db_xref="EnsemblGenomes-Tr:CBA18936"
FT                   /db_xref="GOA:D4I4P9"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D4I4P9"
FT                   /protein_id="CBA18936.1"
FT                   /translation="MSRVFAYCRVSTLEQNTDNQRREIEAAGFSVKAQRLIEEHISGSV
FT                   AASERPGFIKLLDRMEEGDVLIVTKLDRLGRNAIDIRKTVELLADSDIRVHCLALGGVD
FT                   LTSPAGKMTMQVISAVAEFERDLLLERTHSGIARAKASGKRFGRPPTLNDDQKQSVLAR
FT                   LSTGMSVSAVAREFKTTRQTILRVRAASLMS"
FT   gene            19180..19839
FT                   /gene="ybcY"
FT                   /locus_tag="EAMY_3736"
FT   CDS_pept        19180..19839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcY"
FT                   /locus_tag="EAMY_3736"
FT                   /product="Uncharacterized protein ybcY"
FT                   /function="SAM-dependent methyltransferases"
FT                   /note="Methyltransferase type 12, Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:EAMY_3736"
FT                   /db_xref="EnsemblGenomes-Tr:CBA18937"
FT                   /db_xref="GOA:D4I4Q0"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR016584"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4I4Q0"
FT                   /protein_id="CBA18937.1"
FT                   /translation="MDIKSEKGASIYSPLVLKLYDTWVLNISNNYAWRCNTDNILLPHF
FT                   KQNMAKRHLDIGVGTGYYLAKAKQSSDAITLLDLNPNSLAAAKKRIGAHRIKHVLQHNI
FT                   FTPLPESEKNKYDSVSMYYLLHCLQGNIKEKASAIENASQALTEEGTLHGATILGSGVE
FT                   HNAFGRYLMNVYNKKGIFSNKFDSLDDLKSVLEHYFDQVKIQQHGVVAVFTATGKK"
FT   gene            complement(20129..22183)
FT                   /gene="betT"
FT                   /locus_tag="EAMY_3737"
FT   CDS_pept        complement(20129..22183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betT"
FT                   /locus_tag="EAMY_3737"
FT                   /product="High-affinity choline transport protein"
FT                   /function="Choline-glycine betaine transporter"
FT                   /note="betaine/carnitine/choline transporter (BCCT) family,
FT                   TC 2.A.15.3.1 High-affinity choline transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:EAMY_3737"
FT                   /db_xref="EnsemblGenomes-Tr:CBA18938"
FT                   /db_xref="GOA:D4I4Q1"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:D4I4Q1"
FT                   /protein_id="CBA18938.1"
FT                   /translation="MIIFSDDIMPATEIPEKPQKDRINPVVFYTSAVLILLFSLTTILF
FT                   TEFSDRWINRTLNWVSNTFGWYYLLAATLYIVFVIFMACSRFGSIKLGPEQSKPEFSLM
FT                   SWAAMLFAAGIGIDLMFFSVAEPVTQYMMPPEGQGQTLEAARQAMVWTLFHYGLTGWSM
FT                   YALMGIALGYFSYRYGLPLTIRSALYPIFGKRVNGPIGHTVDIAAVLGTIFGIATTLGI
FT                   GVVQLNYGLKVLFDVPEGLTAQAGLIVLSVIMATISVTSGVNKGIRLLSELNVLLAFGL
FT                   ILFVLFVGDTSFLLNALVLNVGDYINRFMGMTLDSFAFDRPAEWMNNWTLFFWAWWVAW
FT                   SPFVGLFLARISRGRTIRQFVLGTLTIPFIFTLLWLSIFGNSALNEIIHGNLALAQETL
FT                   AHPERGFYSLLAQYPGFTFSASVATITGLLFYVTSADSGSLVLGNFTSRLADINNDAPN
FT                   WLRIFWSVTIGVLTMGMLMVNGVTALQKTTVIMGLPFSFVIFFVMAGLYKSLRVEDHRR
FT                   ASATVNTPPVTVDRLNWKQRISRVMNYPGTTHTRKMLDNVCRPAMEEVGRELEHRGAKV
FT                   QVNELPAVDDERLNHLELLVDLADEQSFLYQIWPQRYSVPAFTYRARSGKSDYFRLETF
FT                   LLEGTQGNDLMDYTKEQIINDILDQYERHLTFLHIHREAPGNSMPFPEV"
FT   gene            22571..23569
FT                   /gene="ytl2"
FT                   /locus_tag="EAMY_3738"
FT   CDS_pept        22571..23569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ytl2"
FT                   /locus_tag="EAMY_3738"
FT                   /product="Uncharacterized protein pSLT051"
FT                   /function="Uncharacterized conserved protein"
FT                   /note="Conserved hypothetical protein CHP01784, putative
FT                   transposase, YhgA-like, T_den_put_tspse: conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EAMY_3738"
FT                   /db_xref="EnsemblGenomes-Tr:CBA18939"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:D4I4Q2"
FT                   /protein_id="CBA18939.1"
FT                   /translation="MPERKSKGGKNATSTPHDLAFKQFLTHPDTARDFMRLHLPPHLQT
FT                   VCDLNTLKLESGSFVEESLRPYFSDVLYSLQSTTGDAYIHVLIEHQSTPDKHMAFRLIR
FT                   YAVAAMQRHLDAGHQKLPLVIPVLFYTGRRSPYPYSTCWLDEFDDPALAEKLYGGDFPL
FT                   VDVTIIPDDEIMGHRSMAALTLLQKHIHRRDLADMLDNLTTLLVTEHITGQQLVSLINY
FT                   LLQAGETSDAETFVRKLAQKVPQYEDKLMTIAQQLEQKGIEKGRAEARAEALTEGEHNG
FT                   EHKAALRIAQTMLQQGFDRNIVMELTGLSEDDMAQIEKDRVARAGRALSRR"
FT   gene            complement(24025..24408)
FT                   /locus_tag="EAMY_3739"
FT   CDS_pept        complement(24025..24408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EAMY_3739"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /db_xref="EnsemblGenomes-Gn:EAMY_3739"
FT                   /db_xref="EnsemblGenomes-Tr:CBA18940"
FT                   /db_xref="UniProtKB/TrEMBL:D4I4Q3"
FT                   /protein_id="CBA18940.1"
FT                   /translation="MSEDFNAAAVSLTALRAAPVSLVDKRYGAAHLPAPAVSGLVVAFR
FT                   RLHVPDLCALSQPGVRFFRRRVKTRALIFLSGKDGILVTGHPFILAFNVPGDSCPHDPV
FT                   RRTLAGFCQMRNTVFQNVTEFNG"
FT   gene            25131..25667
FT                   /gene="msrA"
FT                   /locus_tag="EAMY_3740"
FT   CDS_pept        25131..25667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="EAMY_3740"
FT                   /product="Peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="Peptide methionine sulfoxide reductase msrA
FT                   (Protein-methionine-S-oxide reductase) (Peptide-methionine
FT                   (S)-S-oxide reductase) (Peptide Met(O) reductase)"
FT                   /db_xref="EnsemblGenomes-Gn:EAMY_3740"
FT                   /db_xref="EnsemblGenomes-Tr:CBA18941"
FT                   /db_xref="GOA:D4I4Q4"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:D4I4Q4"
FT                   /protein_id="CBA18941.1"
FT                   /translation="MATEYAMIAGGCFWCTEAVFKQINGVESVESGYIGGHTENPTYKQ
FT                   VCNGDTGHAEAIRIGFDPEKVSFGDLLDISFATHDPTQLNRQGNDIGTQYRSAIFPTSA
FT                   QQAEEAIAAIARARSEYSDPIVTSIEAGAAWYPAEDCHQDYWAGEGQENRYCLAVIPPK
FT                   LQKLRKRFAAYAVSE"
XX
SQ   Sequence 28259 BP; 7096 A; 6990 C; 7206 G; 6967 T; 0 other;
     ggatcctgct gcatggagct gaacaaactg acagtagtgc aaggtaatga cctcctcgag        60
     ggggcttaca gcgtgacgct ggatgaaatg cgtttgctga accttgctct ggcacagata       120
     gacagcagga aaccgcagcc ggacgcgctc taccgccttt ttcctcatga ttatcagcga       180
     atatacggtt tgaatcctac cagttgccac cgccagctgc gtgaagctgc cgaaagcctc       240
     atgaaaaaac cggtaaccat ctaccaaccc gatcgtaaga gtggcaagac acgtaccgtg       300
     caactgtcgt ggttttctcg tcttgagtac gtcagcagtg atgagcagag cgccgttata       360
     ctgcgctttg gacaggacgt tgcaccctat ctttatgagt taaaagagtc ttttaccaag       420
     ctcaatttca ccaatattgc caagctcgat acgccgttct ccgtgcgact gtatggctgg       480
     ttgatcaaag ctaaaaatct ctatggacgt aaaggcagta aagcaattga ggtgacactg       540
     gcacttgact ggatgcggga gaaagcagga ttacagggaa aatatgagga ttatcgtgat       600
     ttcaggcaga aattactgga acctacactc gcgcgaatta atgccaatac cgatatctca       660
     gtgatatggc accccgtcaa aaaaggccgt accgttgtgt cgatcaggtt ctcttatgtc       720
     gatgaatcca cgccggaagc cagtaaacca ctgcgcccca aattcccgcg ccgaccacgt       780
     gctgcggccg gctcagagct ggaaggtgca tgggctcgcc gttgcatagc cattatggag       840
     caatatcggg actgtctgat cacttacgat cgtacagaga aggttccgct gacggatgtc       900
     agaaagcttg cgggctggta taagattatc ggcgataaaa tagcctgtaa gcgcgtgatg       960
     agtgaagtta acgcgagagc taaaaaatag actattcagc cagagcctgt tcaggctgct      1020
     cagaatgtta atcaggggcc ttgcgtataa cggttatttt tcctttttgt tgactattgg      1080
     ttaacgtttt actgccgatg gtttgctctt cagccggtgg ataatatcca gtctcctgag      1140
     gagggttagg taatatagcg aaaccattgc aaccagataa caccggggtc aatatcagaa      1200
     acaataaatg gtttttccca cagagatggc cttttcacaa agtgaggcac gatcatcagg      1260
     aagtaccata ttttgatcgg cattgggtaa ttagtcgaac attaccccag cctgctgtgc      1320
     tgccccgggc attatccgca aagccacttt tgaccagtca tttttcacta tcgaccaccc      1380
     ggtgttattg ctgcgaaact acgcttctgt agctcaccat agcgattcgc aggccccctg      1440
     tctccataag cccgttttcc gccgaaaccc cgcagaacgg cggaaataca gggatatgag      1500
     tccactacgg ccatctgttt cacggcctga tgatagccac agatttgagt acttgcctga      1560
     tgcagtggtg cgttattggt ttccggtcga gtcaggaaca aattttcctt caccacaggc      1620
     aggtaaccgc caccgatgtt ggagtgtacg gcgggcagtg ccagtcccgg ccatgtgggg      1680
     ttaacgctat tcaacgcaga gttgaaccgg cattcatttc agcggtgata tggaagactt      1740
     tctctgccac accagggcgc agggtaagct tcacatcacc ggtgtccgca ttattcgggt      1800
     tcagaccact tgccggtgcc gtcaaaaaag acgccaggcg tcagcgttat ttctcgtttt      1860
     tctttctgtc tggcctgttt atgctgaggt tccggcgcag catttttgga ccgtctgctc      1920
     gtgctgtgcc agctcgctac cggtcgggat ggctgatatg cctgttttgg gaacgtcttc      1980
     ctggtaaaga ccgtgtcaga ccccttcaac aggagcgggc gcagctgttg atgttcagac      2040
     ggcgttaagt tccgctgtga taacggagaa aagctgcgcg tgacgtttgc gcaggacgac      2100
     ttcgactggg cgagcgggca gcgataaaga gacggggctg gattaggtac cgtcgggcga      2160
     aaattcgtgc gcgttacaga aatcctttat tgtcagaaag ttttagagta ctgacgataa      2220
     atatcaagcc tgacaggggg taaggtgaac caggaaattc atctggctat ttgcatttac      2280
     tgcataagat gtcggtgttt tcatcattag gttgaagttg aaaaacgatt gtttatccct      2340
     tttttcaggc atgaagtgct gtctgtttct tctccctcat cgtgcaaaag tcatgacgaa      2400
     ggggcgactg gcttcgggtt attgcacagg gggatggggt gatcagacag atcttaacct      2460
     ttatattttc tccaggatgg aaagagtgcg gctgtgtaac agggtcgaat tcgactttct      2520
     ggcgataaaa ataaaaaatg aatgcgataa atacatctga taatcaacga attaattttt      2580
     tctgttttgg aaaattctta gaaaaaaccg gatgtgtgga taaacacagg tttagatgga      2640
     acttgctttc tggcatacag tgtcggggta aagaggataa tgaaataaca tatggccacg      2700
     ttggacgacg tggccagctg ccatttactt gatcaagaaa tcttcaagct ttttgccggc      2760
     atccagagcc tgcttaatga ctgcaggagt tcggccctga ccggtccatg atttatgttc      2820
     accattttca tcagtgtatt catatttggc agggcgagga gcacgtttgg cacgaggctt      2880
     acccgatgtg ttttctgctg aagtcagttc gcttaaatcg ataccgtctt ccagtaacat      2940
     ctgacgatat ttagccagtt tctcttcttt ctctttaatc tcagaagcga tagcggcttc      3000
     tgcatcacgt ctttcgttca ctactgcttc cagtttttcg agcatctctt ccagttcaga      3060
     caaagacact tcacgcgcct gggcgcgaag ggtgcgaatg ttatttaata ctttcagcgt      3120
     ttcgctcata acggaatccg taaccttgag ttgatttaaa attgataact attacaacga      3180
     gcaccagtct acagacaaat gaatcgcgaa aaaacactaa atcgaaaaaa tgtctcgtta      3240
     aaggttttcc ggcatacatt ttagtatggt caagaacacc acgaatgaga gccatattta      3300
     tgacttatgg gataaatctt aacaaaaaag taaaaaaaaa gattgaataa ggtattaagt      3360
     tgaaaaatca caccggattt atgtgaggta aaccactata tatcccggcc aaagctgatt      3420
     tttgtgcgta ttagaggggt gagcgcttct cgctttatcc gcgggtacga tatctgtcat      3480
     tgtgcaggtt acgccgtcac gttttattcc gtcataacgg aataaaaatg agcaaccggc      3540
     ttccgccagt gcagagaaaa cgttttttcc cggataaaga tgattaacag gtttatctgc      3600
     aggcatgcta aaaaccgccg gaagtatatt tttgagattt tcgctgcatg ccgggaaagg      3660
     ctaaataagg atgagacatg ccattatctt caattagtta caacatacac ttattgtttt      3720
     tctctcccac agcgtgagct gcctgggcag gcagcgggct ttcggcgata cccggccata      3780
     cagcttgtat tacggcacct ctggtaagca ttattctctt tcctgctaca ggattattgt      3840
     ggcaggactg tatctcacgc aggcgtattg atccgttttg ccgccggctt caaaccaaac      3900
     gatattgcag actaacagta acagtatggt ttctgttgga aatgcccgcc gcatcagggc      3960
     gcagtgacgc tgagtcagcg ctgctggtat cgataatctg tataccgcct ttgccttctt      4020
     catatttgtt gtagctgaat tcggcaaaca cgttggcagc cagggtcacg taataaccgg      4080
     catcaacgga cgtaccgtga taaccggaat cagaggtctt tgcacggaac ttcaggctac      4140
     gcataccgtg ttcgttgtta tcgtattccc gaactcagtc accggattta agcagtgtat      4200
     tgaatgagaa atcattatta cgatattgag cctttcaagt tcaggtcata tacgttggca      4260
     taattgacat cagcgcccgg attcgaacag taaccggtcc ggtctgaccg gttactgttc      4320
     tgccaatcgt aatcatgcat atggcctgat catgaaacca gtaacgtcca accacgggca      4380
     ttaagcgcac cgggagaaat cagctttcat catcgcgacg tttttgattt tccgcccggc      4440
     atacctggcg ggtcggcaac gctgatgcta ccagtggcaa attcaggagc tgcatgtgcc      4500
     gcggcaacgt gatccgtgcc gaaaaagacg cgcattgtaa ttatcaggac agtccttttt      4560
     tcttatttta tatcctgaag aattccttta aggaggactt atatccagtg gccgattgat      4620
     atctcagtaa ccactttttc aacagtcact ttcagaaaaa agatattttt cttaatactg      4680
     ccgttcaacg gaggtaagtg cttttggcct gaaaacagtt cctttttatt atggtttatg      4740
     ctgaaccggt aacccgctac gatcccgtct caatcttcag tcagcagcgt tttcatcgcc      4800
     tgtaaattgg cagagcgtgt gcccttgtgc cataccagcc atatggcaat ctgccccatt      4860
     gcttcgctga gaggccaggc tttaacactg tcccgcccgg gcatactttc cagcatgctg      4920
     gccggtatca gtgccagtcc ggcaccggca ctgacgcagg cgagaatacc gtgatacgac      4980
     tccatctcga aaattttgcc aggaaccgca tgggtgcgtg cgaaccagtt ttcgaacagg      5040
     cgtcggtaag agcagttttc ccgaaaggta tagatggtcg agccggaaac ggcggaggca      5100
     gcggacaccg gtggatgatt caacgcggta atcaatacca gctcctcggc gaaaaccggt      5160
     atcccttcaa gccggggatg tttgggcggg ccgtcgacaa aggccgcgct gtacctgccg      5220
     gccagcacgc cgtcaaccat atcgcccgaa gggccggtgg acagatccag cccgacctgc      5280
     ggccagctct gatgatagcg cgcgataagc ggtggcagcc tgacggcagc ggtgctttca      5340
     atcgccccca gcgtgaagat gccgtcagga cgctgaccgg aaacgctctg ttttgcttcc      5400
     tctgacagtg ccagaatgcg ctggctgtaa gcgagaaaag ttctgccatt atcggtgata      5460
     tacagacgta acttttcgcg ccggaacagc tcgcagccga gctctttctc cagctgtttc      5520
     aggcgggtgg aaatatttga tggtacacga tgaagttttt ctgctgccgc tgtaacgctc      5580
     ccttcttctg caattgcacg aaatatctcc agctgggcca gctccatatc tttctcattt      5640
     taagatatta attttcatta ttattcattt taaatgaatc agtcgcaaga ttacgatgaa      5700
     cgctatgcta agtcatggcg aaacaggcgc tggctttctc acccattttg gttttctgat      5760
     aaggcggtaa tgatgaaaaa cgtttcttcg gcggtagcgg tttcccgcaa tccggccacg      5820
     ggcgaggtgt ttgcccgtta tccttttgcc accatcgacg aggttgaccg cgcgctggcg      5880
     ttaacccatg gtgcatttca agactggcgt cacagcgtaa tgagcgatcg cgtccggctg      5940
     ctgcgtaacg tggccggcgc cctgcgtcag caggcgcgtg agctggcgga aatgatgacc      6000
     agtgagatgg gcaagcctgt cgatcagggg ctggcagaag tcgagaaaag cgccaggctg      6060
     tgcgaatggt acgctgagca tgggccggct ttcctgcagc gtgaaccaac gctggtcgag      6120
     ggtaacaaag cctttgtcga ttacctgccg ctgggccccg ttctctcggt gatgccgtgg      6180
     aattttcctg tctggcaagt gttgcgcggc gctgtgccca ttctgctggc aggtaacagc      6240
     tacctgttga aaccggcacc gaatgtgatg ggatgtgcgc tgttactgca gcaaatcctg      6300
     agccgcgccg gcgtgccgca agggcttttt gcggtggtga acgccgataa tgacggcgtg      6360
     gcgcaggcga ttaacgaccg gcgtattgcc gccgtgaccg tgaccggcag tgtgcgggcc      6420
     ggtgcggcga tcgctgccct ttccggtgcg gcgataaaaa aatgtgtgct ggagctgggc      6480
     ggttctgatg cctttatcgt gctggcggag gcggatattg atgctgcggt aaaaggtgcc      6540
     atcgcgggcc gctttatgaa taacggtcag ctgtgtattt ccgcgaagcg cattatcgtt      6600
     gaagcggcgg tattcgaaac gttccgggat aaatttgtct gcgcagtcag agagatgaaa      6660
     atcggcgacc cacgcgaatc cggaacatgg ataggcccga tggcgcgtta cgatctgcgc      6720
     gacgaactgg atgctcaggt gcaggccacg ctaaaagagg gggccacctt gctgcttggc      6780
     ggccacgttc tgccgggcga gggaaactac tatgcgccga cggtactcag tgacgtaaag      6840
     ccgggtatga ccagttttgt acaagaactg tttggtccgg tggcttcgct gattatggcc      6900
     gatgatgccg gacatgcggt ggcgatggct aatgactcgg agttcggcct cggcggcagc      6960
     ctgtggagcc gcgatcttgc cgttgcgcag aaactggcgt cacgtatcga aaccggtagt      7020
     gttttcatta actcgccgag cttctccgat ccgcgtgttc cgattggtgg cgtgaagaaa      7080
     agcggctttg gtcgtgagct gtctcatttt ggcctgcgtg agtttaccaa tgctcagacg      7140
     gtgtggatgg aaggataacc gacttacggc tttgcttccc cctcctccgc ggtcggttgg      7200
     aggggcgtta acgttaattg cgcacgcatg accagatatc tttggggcat tgatttcagg      7260
     ttacccacgt tccgcattct tgacagcgct tcctgcatac cgagcggttg ccagatcacc      7320
     actgcacgga tgaccagctc cggcgcaacc cactgaggta acgttttctg agtttacccc      7380
     gctgaccatc gtcctgtggc tgacgcgtta aggtgattac gttccctgcc tgaaatgagg      7440
     ttaaacggcg gtggccgtca cctgaaagac ggccaccgcc tggacaagtt gctcagcctg      7500
     ttctttcagg ttttctgtag cagcggcgct ttcttccacc aaagcagcgt tttgctgcgt      7560
     caccatgtcg atctgggtga tggcctgtcc cacctgtttt acccctgagc tttgttccag      7620
     gctcgcagca ctgatttcag acacaatata tttcacttgt ttgatcgcct ccataatccg      7680
     cgtcatggtt acgcctgttt catccaccaa cagacagccc tgctcgacct gcccgacgct      7740
     gttggtaatt aatgtgctga tttctttggc ggcattggcg ctgcgttgtg ccaggctgcg      7800
     cacttcggcg gcaacaaccg cgaatccacg tccctgttca cctgcacgag cggcttccac      7860
     cgccgcattc agcgccagaa tattcgtctg aaaggcgatg ccatcgatca cattgatgat      7920
     ttcggaaatt ttctttgagc tgtcattgat gactctcatg gttgagataa cacgcccgac      7980
     cattagctcc ccttccgctg ccagcgttga ggcaccggaa gccagctggc tggcctgatg      8040
     tgcgttttca gcgttattgc tgacggtgga acccagttgt tccatggtgg cagaggtctg      8100
     ttgcagcgag ctggcttgtt cttccgttcg ctggctgaga tcctggttgc cctgagatat      8160
     ctgggtactg gcggttgcca ggctttctgc attgctgcgc acgttagtca ccagcgcgga      8220
     aagggatgac tgcatatctt tcagctgggc cagcaggctg acacgatcgt gctgctccac      8280
     caggatggga tgggaaaggt cgcctcctgc catcagcctg acctcctgtg ctgctgccag      8340
     aggctctccg cccagctgcc gaagtaaact gcgcaggatc agcgttccca gtgcaaccga      8400
     tatcagcgta acagccccgg cagcgaggag tgaaatgatg agcgtcctga aatccttacg      8460
     tttctgagca actaccttat tttccgcaac tgcatcctga tgttttttta gagtggataa      8520
     tgcaccaaat gttttatccg catacgcttt tacttcattt ctgttgattt cgctggcttt      8580
     ttttatgtcg ccagactcaa cggcctgtac ctgatgctcc atccccttac gcattaactc      8640
     atacgatgat attaatccgt taaaggacga cgtcattgtg gtatcaattg tgggtttaag      8700
     cttatttaac agcgcgttaa cttcgtcaaa gttttcggtg ttttgttttt tccagccggc      8760
     aatcgatgcc gggtcaccga tggcgatcat ccggagaatg ttgatatcca cacgggtgag      8820
     caggccatcg acctgaccaa ttatcgaggc agactgatag tctctttcat acaaattctg      8880
     taattctgac gtagtggcag ttagacggga tagtaaaaac gaagtcagta tcaagaaaga      8940
     tatgattatc attgcgatcg acattgataa ctttacctta actgtccatc tgttcatggg      9000
     gtgctctcac agcttaacat tctggtgctt taaacacagg ttgcccgccg gcgtaccctg      9060
     taatatgacg aagcgagcct cgtgtctgaa tgatatcggc aaatcagata cgtcctttaa      9120
     tgcagacggt tatcgatgct taaatattct gttttatttg agcatttaca tatcaacatg      9180
     ctgatttcac ggttattttt ttatctgtat tttatatacc gacaaatgcg aaagcctggc      9240
     cataattttt attgtttacg gtgaacgccg ctgaaaacgg cgatcgttat atttagcggc      9300
     gggggatgac gtgttggcct gtagagggat ggtgcagcca ggacgtcaat ctttgcgctg      9360
     ccggctgttc cagggattgt ctgttggcat ctccggtttt gcactgtggt tatccttcag      9420
     cgaggcaata tagagatctt ctacctcttt gcgcgcccac ggcgtacggc gcaggaattt      9480
     caggctggac ttgatactgg ggtcgctctt gaagcagtta atattgatgc gctctgccag      9540
     ctgctgccag ccaaaacgcg caaccagcat agtgagtaat gcttccagcg taacgccatg      9600
     taacgggtct tttgaagagt gagtcgtcat ggtggtatcc ggtaaatcag tgtgaatggc      9660
     gcacacctta ctgagcgtct gcggcttatg caatgtcagt atggggcggt atcacggtct      9720
     cctttttacc gtaacatccg cacagcatct cacccgtgaa taaataaatg gtcataagtg      9780
     accaattaat ggctaagata aactataatg gtttatatgt gaactcttta agattagtgg      9840
     ttatgtcttt tatacattta ctgtactcac ctgcagagtt ggccagagag gtgggtgaaa      9900
     atgctaaaac tcttcgttta tccaggaatc tctcgcgtaa aacgctggca ataaaatcag      9960
     gtgtttctga gtcgacaata aaacgattcg aaatgacggg agtggttacg ctagaggcgc     10020
     taattcttat ggcgacagct ctggatgagc tctcatctgt tgcgaagctt tttaagcctg     10080
     aacatccaaa caattacgaa gaactcaaaa atacgaaacg caaacggggc atgcaatgaa     10140
     gatgagaggg ctaaagcata cagagtcact cgtagttctg aaaagtggag tgaaggtagg     10200
     agagctgttt aagcctgaag ggaaaggcat ttatttcgtc tacgaccaac actggattgc     10260
     tactgggttc aacctgtctc ctctgacgat gaaatttgat aacaaacctc agctggctca     10320
     ggacgcaaaa ctatttgagg ggttacacgg tccattcgca gactctctcc ccgacgggtg     10380
     gggaatgtta ctgatggata gatttttcaa cagcaccttc ggggatggaa cggcttacac     10440
     agtaactgcc ctggatcgct tggcttatat gggagatcga tgcatgggcg cctttgaata     10500
     ccagcccaaa gccgataaat cggcgctaac cggcacggtc agcttagcag aactttttga     10560
     acaatctgtt ggcgtccagg aaggagagac atctaccgtg cttagtaagc tgcgactggc     10620
     aggcggctcg cctggcggag cgcgccctaa agcgattgtc gccttgtctc cagatggtaa     10680
     gcatgcaact tcggcatttg acaaaatccc tgaagggtat tcacattgga tcgtaaaatt     10740
     cagggatcta aacgaacctg tcgagactgg tggaatcgag tttgcatatg ctgagatggc     10800
     gagagatgca ggaatagata tggcagaatc cagtatcctc aacatcacac tcccaaccgg     10860
     tcgtgttgag aacttctttg cgaccaggcg ctttgacaga tgcggggaca agaagatcca     10920
     catgataact gttgcagcac tcatgtatgc aagcttccgt gaaccctcta tggactacgc     10980
     aagccttcta aagctaactc agcacctcac caggaactcc agggaggtcg aaaagatggc     11040
     tcgcttaatg atttttaacg cgttatcgca taaccacgat gatcacacta aaaattttgc     11100
     ttttctgtgt cacgatccag agcacacagg gggagagtcc atttggacac ttgctcctgc     11160
     atatgacctg actttttcac gggccatggg tgaacacact acaggatttg gaggtaaaaa     11220
     tcccggaaaa ccaacgagaa agcgcatcaa tgagatatgc caggattaca agtacctcaa     11280
     agctgatgag tacattgagc agaccctcga tgctctttcc aggtggaaag atgttttcga     11340
     gcgactgaaa atccctcaaa aatcaggaac aggaatcttc aatatcttaa ataaactgca     11400
     cagggatttt gaatcctagc cagttgattt ctgtgctaat gaagcggtca acaaaaactg     11460
     gccacggctt tagagttttt ccagaaccga tttttcggtt cgtttggtgg tgatccaccg     11520
     ttgtagtcgt gcggtctgag cgtactgcaa catcccacgt accggtatcc tgaatctgcg     11580
     cgcatctgcc atccgacgtg tttttcctgc tttcagcggc cagcggcaat catcgccaaa     11640
     tggctgaacc cacgcagttc aagcgccatc gccgcttttg ctgcccggat accgctggca     11700
     caaaccagca cgatgcggcg gtcggcgggc ggctgccagt ctgacagctg ttgaggcagg     11760
     acccgctgta cggcatcagc aatgctttcc ggggcctcat ccacgctgcg taattccaca     11820
     atacagtctt cagccgtcag taaatggcgg tcgataaacg gcaccggggg acgatcgggt     11880
     tcggccgccg aatcaaaacg aaacgggcgg aaatgccatt gcacaaaatc gcagttgacc     11940
     agacaaccca gcggagaagg tgagaagttc agcaggatac tgagcgccat ctgcgcctgc     12000
     atcgcgccca gcgtggcgac ggccgggccc atcaccccgg cggtattgca gttcgcggca     12060
     gagcccggta gctgtggaaa gagggcgcgg tagctgggtg cgccgccgca gaaaccgccc     12120
     acgtaacccc ggcgtcccag aacggaagcg ctgaccagtg ggatacgatg cgccagacag     12180
     gcatccgaga gctgataggt cagggcgaaa ttgtcggcgg catcgatcgc caggtcgatg     12240
     ccatcaagag cggccgccgt agcgctggcc gtcagggcgt ggggccgtgc atccaccacg     12300
     catgcaggat tgcgggtggc cagcgcgcgc cgggcgcaga acactttttc ctcaccgata     12360
     tcctgcatgc cgtacagcgt ctgacgatgc aggttatgct cctcaaccct gtcgccatca     12420
     tacagacgca gatagcctgc gccggcagca gccagcagcg gcagcagcgc tgaacccagg     12480
     ccacccgcgc cgatgaccag cacacgcgcc tgagccaggc gttgctgccc gctttcgccg     12540
     atttccggca gcatcgattg tcgttgataa cggctcatgg ttttcgactc ctgttagcta     12600
     aactgcgcca taccaaagat cggcgttgag gctgtcgcca tatcccgccg ctcaatcaac     12660
     cccgcgctgc gtgcgtcata acccgcgcga atggctgagg caaacgcctg cgccatgcct     12720
     aacgggtcct gtgccctggc cacggcggta ttcagcagga tgccatcaaa acccatctcc     12780
     atcgcctgtg cggcctgact tggcgcaccg atccccgcgt caataatcag cggaatatct     12840
     ttaaaccatg aacgcatgga acgcagcccc tcaatattgc gcagcccctg cccggagcca     12900
     atcggcgcgc cccacggcat cagcagttta cagcccgcct caagcagctt ttcgccgagg     12960
     atcaggtctt cggtggtgta agggaagacc tgaaacccgt cggcgcagag aatgcgtgcc     13020
     gcttccacca gggcaaatgg atcaggttgc agcgtgtcgg catgaccgat cacctccagt     13080
     tttatccagc gggtattaaa cagctcgcgc gccatataag ccgtggtcac cgcctcctta     13140
     accgtgtgac agcccgccgt attgggtaaa acccgcttgt tcagctgcgt caacagcgcg     13200
     cgaaatgccc cgccctgact gccttcgcgg cgcaggctga cggtaataat ttcactgccc     13260
     gaagcctcta tggcctgttg caggatctgc ggtgaggggt aaccggcggt gccgagtaaa     13320
     aaacgggatt gcggcacaaa gtcgtaaaac atcgttcagc ccccctgcat tggtgccagc     13380
     acttccagtg cacaaccttc ggtaagcggt tgtgaatcgt attgcgatcg cggcacaaac     13440
     tggccgttga cggcgctggc aatacagcct gcatcaatct gccgttcatg cagtaattcc     13500
     gccagggtac gggcgtgggt atcgatcgaa ctgccgttga gttgaatttt caaatcaggt     13560
     tttcctgcgt cagttgttgc atcagttttt ccgccatgac cggcgcgaga agaaatccgt     13620
     ggcggtacat gccgttgaga taccaggtgc cgttgcgatg gcgaatatca gggatattgt     13680
     caggcaaggc cggacgcagc ccggtaccgc tctcaactat ccgcgcctct gccagagccg     13740
     ggtggatgcc gtatgccgcg ctcagcagtt ccatcatggc gcgggcgctg attgggctgc     13800
     tgtcatggct ctccaccatg gtggcgccga gcataaaatg cccttccgca cgcggcacca     13860
     ggtagcaagg gaagcgggga tgaagcaggc ggacagggcg tgagaagcgc aggtcatcgc     13920
     tgtgcaggat cagcatttcg ccgcgtacgg cccgcaggcc gggcatctgg gccgccgcgt     13980
     ggatgccgcg acagtcaatc gcccggccgg ccggctgccc gccgtgaaag ttgacgccag     14040
     ctcgccgtaa tttcttgcgc agttgctgca tggcgctgcg tggatcgagg tgagcttctc     14100
     cggcaaagaa caggccacgg gcaaagcgtc ctgccaggtc cggttccagc gtaccaggct     14160
     ctacccactg atgggcatgc gtcatgcggg cgaagcgcgt cagttcgggg gcatcgcgcg     14220
     gcggagccac caccagggtg ccacgatgtt ccacgccgtc aacgtgagcg caccaccacg     14280
     gtgccgagcg ttggccaagt tcaaccacct ctggcggcgc gctttctcct tcacaccagg     14340
     gcgcgagcat gccgcctgcc cagtgtgatg ccggctgacg gtgctcatcg gtgatcactt     14400
     ccagtgattc accccgttcg gcgagtaagg tggcgacaca aagcccggta acgccatcgc     14460
     caatcactga ccagcggctc atgatgtgtg gtttcccggc gaccggataa aagctgtgga     14520
     tgttgtcacg taagcctctc aaaacatgcg gagacccgtg atacaggaaa ggggaaaaag     14580
     gcggggcggt gtcgggcatg ccctcgcggc aggtatcttc agcggttatc aagatacgag     14640
     tcttcctacg ccagtatcag ctgggtcagg ttctaagggt cgctaagccg cgaaaatcgc     14700
     tatcagcctc tcagcctctc agtctctctg gcgagactcc cctgacagga actagttgta     14760
     ttttacccgg tggtctgccg tcaagtcgga ccctgtaaat aattctgtgt aactgccgcc     14820
     gtattgaagg tgatcgcctg ggcggtcact tctgagaaaa ggcatttaca cggaattcgg     14880
     cacaggctca tcctgagtaa gatataacct tgatctaacc aactttacct gaccaacaag     14940
     tgcgcgtgtg attaatatgt gttcaataag aggtgtgctt tatggaaaag gttaacatct     15000
     acgatgccaa aactaacctg tccaggatag ttcaagaggt agcccggacg ggggagacag     15060
     tattgatagc tcgcaacggc catgccttag tgaaagtaat tgcctacaag gaagagaaac     15120
     ctaagcgcaa gttaggcttc ctgaaaggaa aaggtagtgt tccggctgat tttgacaacc     15180
     tgaacagcaa tgaaatacag gatatgtttg aaggaaaata ctcttaatga tttgctgtag     15240
     acaccaacat tctcttgttc atggcctatg agccagaaag acttgctgag aacgttgtag     15300
     cactactgga agacgctgat ctgaccctct gcttcagcgc tgccagcata tgggaagtgg     15360
     tcattaaaag cggtttgaat aagcctgatt ttgatgtagg ccctgaagag ttcaggaacg     15420
     gcttgtttaa cgcaggcttg ctcgaaatac ccgttaaaag cgagcatacg ctgattgtag     15480
     ctgacttacc tgagaaacga cacaaagacc cttttgatcg tctcatagtg gctcaggcga     15540
     agcataacaa ggtgccgttg ataacgagtg acagtaagct gattgagttt gtcagtgatt     15600
     acatcactat cattcccaat aagtatggac tgcccccgcc ccggtagacg atcttgccct     15660
     attgtttgag cagaggagga acgtatgggt acaccacgat ttacacctga atttaaggaa     15720
     gaagctgtcc gtcaaattac ggagcgtggc tattccgttg cttgtagtgg cacactgaat     15780
     gtagccacct gaacagaggt gatatgctca cctcagaaca tcgcaggcac cccaatgaaa     15840
     agaagaaatt tcagctcaga gctgaaacgc gaatccgcgc agctggttgt tgatcaaagt     15900
     tacactgagg ctgaagcggc cagcgttatg gatgttggcc tctcctccat ggtcacaagt     15960
     gggccagcct aaccttttca ttcatgagat gagtcacgta tggcaacgtg aacggcgaaa     16020
     attcggcttc agcaggcagt atatccggtg cactcttttg tgatcgcgag cgtggtagct     16080
     gaaatgcctg cttcacggca gacatcctcc accgttctgc cagcttcgac ggacttcaga     16140
     acggcgatga tctggtgttt ggtggtcggg ctgtaggcag ggtgttctcc tcaggggata     16200
     taatcagtat gccggaagat ctctaaaagt gaatagtact attatgcggg atggtgacac     16260
     ggctacagcg tgtgtttcgt ctgtataaaa tatcaatgac gacataataa ttattcatgc     16320
     tctgtaagcc agttatcaac aagttggtta attacatcag tgatggatgt accatttttt     16380
     acacaagccg ctttaaagcg agtgtgtttt tcttcgttaa agttgacgtt tacacgctta     16440
     ctttttccag aaggaagcgg actatcgaca actttgtcca gatctcgatg ttccccgaag     16500
     gtcatttttt tactgctggt atggtttttt tcaagtgcca taatatcact cccaaaataa     16560
     ttacactggt gatgcaatga gtatatgagc ttttgtgtat atacacttat gagcgtatga     16620
     gcttatgtgt ataagagtat atgagtcatt actcaatatg actaactatc tctttagtaa     16680
     gcatttctat ctcaccctta gctgcaccat catttgactc aaacacactt tccccgtcca     16740
     gtatggattt cacatatatc tgacgctggg taattgctgt tcgaaaaggg ttaacgcctg     16800
     tgtctttgat actttccttc aagactttga gcatggtggc ttgttcaatc ttacgggtga     16860
     taaggaatct cgcctcgact tttcggctat atgcctgagc ctcaagaacc gttacaacac     16920
     tccctgcggc cgagaaatct aacggacttg gtgttacagg aataatcaca agatcgctga     16980
     ccataactgc tgctgatgtg atcactgaca gagagccagc accgtcaact atagtgaaat     17040
     catattctgc taaatccttc ctgatcccgt aaacatcctt ttccgaagct gcggtgaaaa     17100
     cgtcaaatgc tgcgttaccc gttttgctcc agttggtcag gctcatctgt ggatcggtat     17160
     caacaaccgc aatgttgtac cctgcgcgcg ccattgcagc actaacgtta ataacagcag     17220
     ttgttttacc tgaaccgccc ttgggattta gaaaagaaat cactttcatg ctcaaaacct     17280
     caattgagta tatactcatt tactcttatg tgtatatatg attgcatatt gttcggggtg     17340
     agtaaagatg aatacacaca aaaactcaaa tgagattata ctcacatact catttgagtt     17400
     tttgtgtgaa tgagcatgag cgaaaaaaaa ccgtcaggca aactgttgat ctgcaccagc     17460
     cgcccgtcgt gaccgacgag cagaaaacac gactggctgc tctgaaagca atgcctgatg     17520
     accggacaga ctacggcgac gccccccccc ctggctgata ccatccgggc gacatcagac     17580
     aggcttcccg aaccttagca gcaggtcaca tcgcgtattg atgccgacgt gctggcattc     17640
     ttcagcgcat accggtcgtt accagacacg cattcatgcc gtgctgcgtt cctgcgtcga     17700
     agcgcacaag gatgaatgcc agatgctgca ttagcggcgt ctccggtttt tgccatggat     17760
     ctgtggcttg caccgaacag aaaggtaccg gggataacga gcgaagcggg gccgtctgga     17820
     cgaaacctca cagctctgaa gatgccgtac gcttccctct ggccgcgacc tcatgcaccc     17880
     acttgtattt acccgtcggg tttttgcgga tttcagtcgt caacttcttg tcgatggcct     17940
     gtgatggcca caagggtctc cagctcttca accgatgttt aacaaaaata gccataaggc     18000
     ggatatttat gccccggtaa tcctgtggaa aggaaataac gtgccgcaga aggtggtgaa     18060
     ggaatttggc ggtgccagcg ttctggaagt ggtcagggac gataggggca taaataaatt     18120
     accagcgatc gatgtatcgc cagatattta tgtacgaaaa tggtcggttt agtacatcgc     18180
     tgtggtggcg tgtctgaaag tcagtgtatt tcatttcgga catgcattat aattcatacc     18240
     cctattccgt acagaaaatg tcaccatgtc acgagtcttc gcctattgtc gtgtatccac     18300
     gctggaacag aatacggata atcagcgccg tgagattgaa gcggccggtt tttccgttaa     18360
     agctcagcgt ctgattgagg aacacatcag cggttcggtt gccgccagtg agcgtcccgg     18420
     ttttatcaag ctgcttgatc gcatggaaga gggcgatgtg ctgattgtca ccaaactcga     18480
     ccgcctggga cgcaatgcga tagatatcag gaaaacagtt gaactgctgg ctgattcaga     18540
     cattcgggtt cactgtctgg cacttggcgg tgtggatctc accagccctg ccggaaaaat     18600
     gaccatgcag gtgatttccg ctgtggcgga atttgagcgc gatctgctgc ttgagcgcac     18660
     gcattccggc atcgctcgtg ctaaagcgtc aggaaaacgc ttcggccggc ctcctaccct     18720
     gaatgatgat caaaagcaat ctgttctggc tcgtctgagt acagggatga gcgtcagcgc     18780
     agtggcgcgt gagttcaaga caacacggca gaccattctc agagtgagag ctgccagcct     18840
     gatgagctaa agcgacaaag tcccttttca tcactgacag cgacgggtaa atacatttca     18900
     gaacagattg ccgtgtatct gccggtatgc aaaagagtga caatagccgt ttactgtgcc     18960
     tgcctccaat ggttgcaaac tggaatgttg caacaaaagc aggatgttgt aactaaatag     19020
     cggtgcgcat aataatcagg tacgctatca gggacagcca tcccgaaagg atacattaag     19080
     ataaaatcac aaaataatca ggtgaaacag aactttatct gctcatgatt atcgtttaaa     19140
     gtagaatgat atattcaatt aattacagga agaataccaa tggacatcaa aagtgagaaa     19200
     ggagcaagca tatacagccc tctcgtactc aaactatacg acacatgggt acttaacata     19260
     tccaacaact acgcgtggcg ttgcaatact gataatatac ttcttcctca ctttaagcag     19320
     aatatggcaa aacgccattt agatattggc gttggcaccg gttactatct ggcaaaggcc     19380
     aaacaaagct ctgacgcgat aaccctcctg gatctcaacc caaatagcct tgctgccgca     19440
     aaaaaacgaa ttggtgctca cagaataaaa catgtgttac agcacaacat atttacgcca     19500
     ttacccgaaa gcgaaaagaa taaatatgac agcgtttcaa tgtattattt actgcattgt     19560
     ttacagggga atataaagga aaaagcatca gcgatagaaa atgcatcaca agccttaact     19620
     gaagagggaa cgctccatgg agcaactatc ttaggaagcg gggttgaaca caatgccttt     19680
     ggccgatatt taatgaatgt ttataataag aaaggtattt tcagcaataa atttgattct     19740
     ctggatgatt taaaaagcgt gttagaacac tattttgatc aagttaaaat ccaacagcat     19800
     ggtgttgttg ccgtatttac agcgacagga aaaaaataga gtctcaaatg tctgccttgc     19860
     ctgtctcagg caaacggcag tggagtgggt cgggtttatt ttaaataaaa catctcttta     19920
     tcctgtgcga tcccttcccg ttacctgaat caggttaatg ggaaggggat aaaatgatga     19980
     acggttgtcg acacaaccgt tattctgtcc gatcgcttgc cgtaatgttt accaaccaca     20040
     gggacacgca ctttttcaat gcgtcatctc tttaacgacc aattcaagct ggaagagtcg     20100
     tttctcgccc cgaagggcga gaagaatgtt atacctcggg gaaaggcata gaattacccg     20160
     gcgcttcccg gtggatatgc aggaaggtca gatggcgttc atactggtcg agaatgtcat     20220
     tgatgatctg ctccttcgtg tagtccatca aatcgttgcc ctgcgtacct tccagcagga     20280
     aagtttccag gcggaagtag tcagacttac cgctgcgtgc gcggtaggta aacgccggca     20340
     cagaatagcg ctgtggccat atctggtaga ggaagctctg ctcatcggct aaatcgacca     20400
     acagctcaag atggttcaga cgttcgtcgt ccacggcagg cagttcatta acctgcactt     20460
     tcgcaccacg gtgctccagt tcgcgcccca cttcttccat agccggacga cacacgttat     20520
     ccagcatttt acgggtgtga gtggtacccg ggtagttcat cacgcgtgaa atacgctgct     20580
     tccagttcag gcggtccacc gttacaggcg gcgtattgac cgtcgcactg gcgcggcgat     20640
     gatcttctac ccgcagcgat ttatacaaac cggccatgac gaagaagatg acaaagctga     20700
     agggcagccc catgatcacc gtggttttct gcagcgccgt tacgccgttc accatcagca     20760
     tccccatcgt cagtacgcca atggtcaccg accagaaaat acgcagccag tttggcgcat     20820
     cattattgat gtcggcaaga cgtgaagtaa agttgcccag caccagcgaa cctgaatcgg     20880
     cggatgtgac atagaacagc agaccggtga tggtggcaac cgaagcactg aacgtgaagc     20940
     cgggatattg cgccagcaga ctgtagaaac cgcgctccgg gtgcgccagc gtttcctgag     21000
     ccagcgccag attaccgtgg atgatttcgt tcagcgcgct gttaccgaag atcgacaacc     21060
     acaacagggt gaagataaac ggaatggtca gcgtacccag tacaaactgg cgaatggtac     21120
     gtccgcgcga gatacgcgcc agaaacaaac cgacaaacgg tgaccaggct acccaccagg     21180
     cccagaagaa cagcgtccag ttgttcatcc attctgctgg gcgatcgaaa gcaaagctgt     21240
     ccagcgtcat gcccataaaa cggttgatat agtcacccac gttaagcacc agtgcgttga     21300
     gcaggaagct ggtgtcacca acaaacagca caaacaggat cagtccaaag gccagcagaa     21360
     cattcagctc tgacagtaag cggatacctt tattgacccc ggaagtgact gatatcgtgg     21420
     ccataatcac cgaaagcacg atcagcccgg cttgcgccgt caggccttca ggcacgtcaa     21480
     acagcacctt aagcccgtag ttaagttgca ctacgccgat accgagagtg gtggcaatgc     21540
     caaagatggt acccagcacc gcggcaatat ccaccgtatg cccaattgga ccgttaacac     21600
     gtttaccgaa aatcggatac agcgccgaac gaatagtcag cggcaggcca taacgatagc     21660
     tgaagtagcc cagcgcgatg cccatcagag cgtacatcga ccatccggtc agcccgtagt     21720
     ggaaaagggt ccacaccatt gcctggcggg ccgcttccag cgtctgcccc tgaccttccg     21780
     gcggcatcat atactgggtt accggctcgg ccactgagaa gaacatcagg tcgataccaa     21840
     tccccgcagc gaacagcatc gcagcccagc tcatgagact gaattcgggc ttcgactgtt     21900
     ccggcccgag cttgatcgag ccaaagcgtg aacaggccat gaaaataacg aatacaatgt     21960
     acaatgtggc agccagcaga taataccagc caaacgtgtt tgaaacccag ttaagggtac     22020
     ggttaatcca gcgatcggaa aattcggtaa acaggatagt cgtcagggaa aatagcagaa     22080
     taagtactgc tgaggtatag aaaaccacgg ggttaatacg atctttctgt ggcttttctg     22140
     gtatttcagt cgctggcatg atgtcatccg aaaaaatgat caagaagaaa aaactgaagt     22200
     ccgctctgcg aagcgcgcat tagcgcatac tgggtaaaat ccgccgcata tccgctaatt     22260
     acactgggag aaccatcagg atgtcagtag tgtagtctgt tgatttcttt tttttatttt     22320
     ttattcaaac gtcctcctga aagccgtcgt tccgtaagca agaagataaa tgatagtttt     22380
     tattgattgc gcattcaatt aaaaaaaggg aggctgttgt ttgtcgcgta atatttatcc     22440
     gataacgcct gctgtcgcca tatgcctgat cgcgacagaa ggacaagata tttccagcca     22500
     gaacagcaga tattccgcgc agcggtccgc tataattttg cagaaaaaat gaccatcacc     22560
     ggagaaggac atgcctgaaa ggaaatcaaa gggcgggaaa aatgccacct caacgccgca     22620
     cgacctggca tttaaacagt ttctgaccca tcccgatacc gcgcgggatt ttatgcggct     22680
     gcacctgccg ccgcatctgc agaccgtctg cgatctcaac acgctgaaac tggagtcagg     22740
     cagctttgtt gaagagagcc tgcgcccgta cttcagcgac gtgctgtaca gcctgcaaag     22800
     caccaccggc gatgcctaca ttcacgttct gattgaacac cagtcgacgc cggataaaca     22860
     tatggccttc cggcttatcc gctacgcggt ggcggcgatg cagcgccatc tcgatgccgg     22920
     gcatcaaaag ctgccgctgg ttatcccggt gctgttctat accggcaggc gcagccctta     22980
     cccctactcc acctgctggc tggatgagtt tgacgacccg gcgctggcgg aaaagctcta     23040
     cggcggtgat tttccgctgg ttgacgtgac gattatccct gatgatgaaa tcatgggcca     23100
     ccgcagcatg gcggcgctga cgctgttgca gaagcacatt caccgtcgcg atctggccga     23160
     tatgctggac aacctgacca ccctgctggt aaccgagcac ataacgggac agcagctggt     23220
     ttcattgata aactatctgc tgcaggcagg cgaaacctct gacgccgaaa cctttgtacg     23280
     caaactggca cagaaggtgc cgcaatacga ggacaaactg atgaccattg cacaacagct     23340
     tgaacagaag ggcatcgaga aggggcgggc cgaagcacga gctgaagcgc taactgaagg     23400
     tgagcataac ggcgagcata aagccgcgct gaggatcgcc caaaccatgc tacagcaagg     23460
     tttcgaccgc aatatcgtga tggaattaac cggcctttcc gaagacgaca tggcacagat     23520
     tgaaaaggat cgcgtcgccc gggctggcag agccttatcg cggcggtgaa tggcttttct     23580
     ccgtaacttt tgacgcaccg ttcgggtttg attcaaaacg atggttaacg aacctgaccc     23640
     ggcagtatgc ccggacggta gcgacattaa caatgtgaag gccatgccgg gtgagctttt     23700
     ttgcttcaaa atttgaagtc cgggacgctg gccttctctc tgttacgatc tgcatggaat     23760
     cctcttcctg accaactccg gtgcatggtt ggctggcgtg aacgccatgc cttgtcatcc     23820
     ctattttgaa aatatctccg gttttaaatt tattaaatgt attttcttta gacaaggcag     23880
     ccagatatcg ccatatcgca gcttctctca cgccgggccg gaataacgcg gaaggtgtga     23940
     agcgggtatt catttggacc tgaagtgttc tgaccttagc aacaccacca cgaatacatt     24000
     tttggtgacg gattcccacg aaaattatcc gttaaactcg gtgacgttct gaaagaccgt     24060
     gttccgcatc tggcagaagc ccgccagcgt tcggcgcact ggatcgtgcg ggcagctatc     24120
     gcccggtacg ttgaacgcga ggataaacgg gtggcctgtc accaggatgc catccttgcc     24180
     tgacaggaat atcaacgcac gggtcttcac cctacgacgg aagaagcgca cacctggctg     24240
     gctcagcgca cagaggtccg gcacgtggag ccgccggaat gccacaacta atccggacac     24300
     cgcaggcgct ggcagatgtg cagccccgta tcgcttgtct accagagata ccggtgcggc     24360
     ccgcaatgcc gtcagggaca ccgcggcagc gttaaaatcc tcgctcatca gcctgactcc     24420
     gaccggccag aagaagaact gcctccgtca taccgggaat ggccggtcag cttcgggagc     24480
     aagggggatg tgacgctgta ccgaatggaa gatgatgcag tggctcccct ggccatcagg     24540
     caacagagag aaaacggcgg gtcataatgt cggcccctga gactgccgca atctggcgcg     24600
     ggacagctct gtcacctcct cacgctcagt ccatgagaaa tcgcatccgg cccgctgtct     24660
     tcgacgctac tgagcagtac aggaaacaaa caggcaaaat aatctgtacc ccgtagcggg     24720
     cattatgccg ttcgcgttca ccaggatgat agtgaaatat cgtgtctgcc agcagtatgt     24780
     tcagtgaatt gttaaaaaaa gcttttttct gataaaaaat aactaataat cagcatgtta     24840
     tattattaat ccattttctt atcacctcgc atgtcagtaa cccacatgta tcgtcaatga     24900
     cgaaacaaac caaggaaagg cgatccgggg atatctcttt caggaacaca atttttcgca     24960
     aaacaggatg gatcttgcgc gtcatcaggg ggacagccac cggatgcact aacgagaaat     25020
     gcgcggcggg tgtaaccgac taaaaacgca ttgacctggc gtggcaaata gctaaggttg     25080
     atcttagttc aacaacgaat aaactcactt tcccgctgaa ggagtaagaa atggcgacag     25140
     aatacgcgat gattgccgga ggctgcttct ggtgtactga agccgtattt aaacagatta     25200
     atggcgtgga gtcggttgag agtggctata ttggtggcca caccgaaaac ccaacctaca     25260
     aacaggtgtg taatggtgac acagggcatg ccgaagccat ccgcattggt tttgatccgg     25320
     aaaaggttag ctttggcgat ctgctggata tcagttttgc cacccacgac ccaacacagc     25380
     tcaatcgcca gggaaatgat atcggcacac agtatcgctc tgccatattc ccgaccagcg     25440
     cacaacaggc ggaagaagcc atagcggcaa ttgcacgggc ccggagtgag tacagcgatc     25500
     cgatagtgac atccattgaa gccggtgctg cctggtatcc ggcggaggac tgtcaccagg     25560
     attactgggc tggagaaggg caggaaaacc gttactgtct ggcagtcatt ccgcccaagt     25620
     tgcaaaagct gcgtaagcgc tttgcggcct atgccgtctc agaataatgc tctgctcgcg     25680
     cccgccttat tccggctggc gctgcggaaa cggcctgatc tgcagggtcc cgtttttgat     25740
     agtcgttatg ataaaagata tcttgtttcg tcactgaatt ttcacttctc ctttatgggc     25800
     aaatactcgg atttttccct gtaaagctaa aaaaaactga tttaaccttg ccactatcct     25860
     taacaggaag aacgacgtat tcacggcttc gcagatccct ttccccccta atccctccag     25920
     aatttattaa cattttccgt cggattgctc atagcagaat tctgacagtg atgattttcg     25980
     cttacttagc cataacgcaa caaatatatg ccagcggata tccctaaaaa cctcagtgcg     26040
     attacagaat tacagaatta cagaattaca gaattacaga attatcaaac aggctgcatt     26100
     taaatacagt taatcttaac acagaatggg acagaacaag aatagatctc acgaaaggaa     26160
     agacatccgg cttctgaaat acgcctgaaa aaatcaagag atactaatca ttaattccgg     26220
     tgaaattatt tactgatact gatgacggta tcttgtcatc ccgtaatccc gggatgaccg     26280
     tttaatcact ccaggggtaa ttacggcaac aaaaatgatc tcttttctga aggggaaagg     26340
     tggggcaggg aaaaccacaa cattcatcaa catcgctacc agcctcgcac gtaaagggca     26400
     caaggttgcg atggtcgata ctgatcctca gggcagcatc agtaactggt ataacgagtc     26460
     aaaatgtcta ttcgaccttg cagagacatc atcggaaaaa agaagtttat agcgtgcgta     26520
     aatatctgaa aaatcatgat gatgtggtca ctgatggtgc cgttgccatt acctccgcag     26580
     ccgtcatggt gagcgatctg gtatgaattc cggtaacacc ttcactgctc gactttgctg     26640
     catatgcgac tatcctggcg gttgtggagg caagaaaaaa tttacagccc gtcattgcac     26700
     gttttgtgat cgcctaaaag tggcctccac gcgcacgctg gaggttctgc aagcttcgat     26760
     cgaggaaaca ggtgtcccag cgttaaaaac cgctgcagtg cagcgacagg ctcatatacg     26820
     cactatgctg gacggggtgc agtgtttgat accacggatg gaagcgaaaa ggagaaattg     26880
     aggttatgac taacgagatc ctggatctac tggaatgaaa atgaaactcg gccaacaccg     26940
     acagttagcg cctgctctgg acgcagtaac taaacccgtt tctggcaaca caaaaaattc     27000
     agatcaacat cgatgaatat taacaccgcc gttttaaaac agcctgtttt tacagggtct     27060
     accgattttt tcgaacactg gttatttgag gatgagccaa gctaacacca ttgacccggt     27120
     ttgtgaaatt aatattcccg atatgtgatg ctgatcattc ctcttttgtg atgttgatcg     27180
     gccaaatatg gcaatagtgt ttgttctttt tttatagttt agatctttta cttttagggg     27240
     ctgatttatt attaataatc attagcttac atgactatat gtggagagat ttcctgctac     27300
     acgtggagta attttatgtt atatgtggag agatttcctg ctacacgtgg agtttttttc     27360
     tgtggataac tttcaaattt atgagaatcc ccctattcag ggttcccctg tggataactc     27420
     tctttacagg ccatcctgaa gttcagcacc ccccttcttt cagcgtaacg ttttcctgta     27480
     attttgaata tgtggagaaa tttcctgttc cttcaaaaca tcatttttgg cctgtcatta     27540
     tacttacttg attaacgaaa ttgattacag acttttcgta cacaaaacca tcatattggg     27600
     cagttaagtt aaatatgcac gttactctta atgtggaaga attttctgat gccatcatta     27660
     cctgttcctc ttaggtggaa taattttatg tactgccagg cgttacatct ccatgttaca     27720
     tgaggaaaaa atctcttttt taactctgtt ttgtgatctg gtcacttccc cgaacgtatg     27780
     tggagagata tgatgccgtg cgccaaaaga tcttggatct gacagtgaaa tgtggaggaa     27840
     ttttctgtgg caggagggag gtattctgga taaatacggt tctgtgggga gcgctgaacc     27900
     agtctggccg ggtgaaatat ggaaaatagc agttttctta tgtggagtga tttcctgtaa     27960
     tcatcgtcat gtatgttgtt gatttatatg aaataagaat gaagttaatt aacaaaaaaa     28020
     tgtaacttat tacgttgaga acgctagtgc ccctgtcgtc agtgggagaa attcctgata     28080
     gcaggaacat cagtcgcctc acatgttcat gagggtggct ggacccatgc ggaggttttt     28140
     taggtgacct ggctgttttg gcgtaattaa gcttttgata ttacaaggtt gtttttaggt     28200
     aatttttgct ttacctgcct gctttttgtg tggaataatt ttcagaacat tccacatcc      28259
//

If you have problems or comments...

PBIL Back to PBIL home page