(data stored in ACNUC7421 zone)

EMBL: FN543502

ID   FN543502; SV 1; circular; genomic DNA; STD; PRO; 5346659 BP.
XX
AC   FN543502;
XX
PR   Project:PRJEA34685;
XX
DT   05-JAN-2010 (Rel. 103, Created)
DT   04-FEB-2016 (Rel. 127, Last updated, Version 3)
XX
DE   Citrobacter rodentium ICC168, complete genome
XX
KW   complete genome.
XX
OS   Citrobacter rodentium ICC168
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Citrobacter.
XX
RN   [1]
RP   1-5346659
RA   Petty N.K.;
RT   ;
RL   Submitted (19-AUG-2009) to the INSDC.
RL   Petty N.K., Pathogen Genomics, Sanger Institute, Wellcome Trust Genome
RL   Campus, Cambridge, CB10 1SA, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1128/JB.01144-09.
RX   PUBMED; 19897651.
RA   Petty N.K., Bulgin R., Crepin V.F., Cerdeno-Tarraga A.M., Schroeder G.N.,
RA   Quail M.A., Lennard N., Corton C., Barron A., Clark L., Toribio A.L.,
RA   Parkhill J., Dougan G., Frankel G., Thomson N.R.;
RT   "The Citrobacter rodentium genome sequence reveals convergent evolution
RT   with human pathogenic Escherichia coli";
RL   J. Bacteriol. 192(2):525-538(2010).
XX
DR   MD5; 06f644a0655b51d70f64dfc95f0e3c37.
DR   BioSample; SAMEA2272524.
DR   EnsemblGenomes-Gn; EBG00000016930.
DR   EnsemblGenomes-Gn; EBG00000016931.
DR   EnsemblGenomes-Gn; EBG00000016932.
DR   EnsemblGenomes-Gn; EBG00000016933.
DR   EnsemblGenomes-Gn; EBG00000016934.
DR   EnsemblGenomes-Gn; EBG00000016935.
DR   EnsemblGenomes-Gn; EBG00000016936.
DR   EnsemblGenomes-Gn; EBG00000016937.
DR   EnsemblGenomes-Gn; EBG00000016938.
DR   EnsemblGenomes-Gn; EBG00000016939.
DR   EnsemblGenomes-Gn; EBG00000016940.
DR   EnsemblGenomes-Gn; EBG00000016941.
DR   EnsemblGenomes-Gn; EBG00000016942.
DR   EnsemblGenomes-Gn; EBG00000016943.
DR   EnsemblGenomes-Gn; EBG00000016944.
DR   EnsemblGenomes-Gn; EBG00000016945.
DR   EnsemblGenomes-Gn; EBG00000016946.
DR   EnsemblGenomes-Gn; EBG00000016947.
DR   EnsemblGenomes-Gn; EBG00000016948.
DR   EnsemblGenomes-Gn; EBG00000016949.
DR   EnsemblGenomes-Gn; EBG00000016950.
DR   EnsemblGenomes-Gn; EBG00000016951.
DR   EnsemblGenomes-Gn; EBG00001008103.
DR   EnsemblGenomes-Gn; EBG00001008105.
DR   EnsemblGenomes-Gn; EBG00001008107.
DR   EnsemblGenomes-Gn; EBG00001008108.
DR   EnsemblGenomes-Gn; EBG00001008110.
DR   EnsemblGenomes-Gn; EBG00001008112.
DR   EnsemblGenomes-Gn; EBG00001008114.
DR   EnsemblGenomes-Gn; EBG00001008116.
DR   EnsemblGenomes-Gn; EBG00001008119.
DR   EnsemblGenomes-Gn; EBG00001008121.
DR   EnsemblGenomes-Gn; EBG00001008123.
DR   EnsemblGenomes-Gn; EBG00001008125.
DR   EnsemblGenomes-Gn; EBG00001008127.
DR   EnsemblGenomes-Gn; EBG00001008129.
DR   EnsemblGenomes-Gn; EBG00001008131.
DR   EnsemblGenomes-Gn; EBG00001008133.
DR   EnsemblGenomes-Gn; EBG00001008135.
DR   EnsemblGenomes-Gn; EBG00001008138.
DR   EnsemblGenomes-Gn; EBG00001008140.
DR   EnsemblGenomes-Gn; EBG00001008142.
DR   EnsemblGenomes-Gn; EBG00001008143.
DR   EnsemblGenomes-Gn; EBG00001008145.
DR   EnsemblGenomes-Gn; EBG00001008146.
DR   EnsemblGenomes-Gn; EBG00001008148.
DR   EnsemblGenomes-Gn; EBG00001008152.
DR   EnsemblGenomes-Gn; EBG00001008154.
DR   EnsemblGenomes-Gn; EBG00001008156.
DR   EnsemblGenomes-Gn; EBG00001008158.
DR   EnsemblGenomes-Gn; EBG00001008160.
DR   EnsemblGenomes-Gn; EBG00001008162.
DR   EnsemblGenomes-Gn; EBG00001008164.
DR   EnsemblGenomes-Gn; EBG00001008167.
DR   EnsemblGenomes-Gn; EBG00001008169.
DR   EnsemblGenomes-Gn; EBG00001008171.
DR   EnsemblGenomes-Gn; EBG00001008173.
DR   EnsemblGenomes-Gn; EBG00001008175.
DR   EnsemblGenomes-Gn; EBG00001008177.
DR   EnsemblGenomes-Gn; EBG00001008179.
DR   EnsemblGenomes-Gn; EBG00001008181.
DR   EnsemblGenomes-Gn; EBG00001008183.
DR   EnsemblGenomes-Gn; EBG00001008185.
DR   EnsemblGenomes-Gn; EBG00001008187.
DR   EnsemblGenomes-Gn; EBG00001008189.
DR   EnsemblGenomes-Gn; EBG00001008191.
DR   EnsemblGenomes-Gn; EBG00001008193.
DR   EnsemblGenomes-Gn; EBG00001008194.
DR   EnsemblGenomes-Gn; EBG00001008196.
DR   EnsemblGenomes-Gn; EBG00001008198.
DR   EnsemblGenomes-Gn; EBG00001008200.
DR   EnsemblGenomes-Gn; EBG00001008203.
DR   EnsemblGenomes-Gn; EBG00001008204.
DR   EnsemblGenomes-Gn; EBG00001008207.
DR   EnsemblGenomes-Gn; EBG00001008209.
DR   EnsemblGenomes-Gn; EBG00001008211.
DR   EnsemblGenomes-Gn; EBG00001008213.
DR   EnsemblGenomes-Gn; EBG00001008215.
DR   EnsemblGenomes-Gn; EBG00001008216.
DR   EnsemblGenomes-Gn; EBG00001008218.
DR   EnsemblGenomes-Gn; EBG00001008219.
DR   EnsemblGenomes-Gn; EBG00001008222.
DR   EnsemblGenomes-Gn; EBG00001008224.
DR   EnsemblGenomes-Gn; EBG00001008227.
DR   EnsemblGenomes-Gn; EBG00001008229.
DR   EnsemblGenomes-Gn; EBG00001008231.
DR   EnsemblGenomes-Gn; EBG00001008233.
DR   EnsemblGenomes-Gn; EBG00001008235.
DR   EnsemblGenomes-Gn; EBG00001008237.
DR   EnsemblGenomes-Gn; EBG00001008239.
DR   EnsemblGenomes-Gn; EBG00001008241.
DR   EnsemblGenomes-Gn; EBG00001008243.
DR   EnsemblGenomes-Gn; EBG00001008245.
DR   EnsemblGenomes-Gn; EBG00001008247.
DR   EnsemblGenomes-Gn; EBG00001008249.
DR   EnsemblGenomes-Gn; EBG00001008251.
DR   EnsemblGenomes-Gn; EBG00001008253.
DR   EnsemblGenomes-Gn; EBG00001008256.
DR   EnsemblGenomes-Gn; EBG00001008258.
DR   EnsemblGenomes-Gn; EBG00001008260.
DR   EnsemblGenomes-Gn; EBG00001008262.
DR   EnsemblGenomes-Gn; EBG00001008264.
DR   EnsemblGenomes-Gn; EBG00001008266.
DR   EnsemblGenomes-Gn; EBG00001008268.
DR   EnsemblGenomes-Gn; EBG00001008269.
DR   EnsemblGenomes-Gn; EBG00001008272.
DR   EnsemblGenomes-Gn; EBG00001008273.
DR   EnsemblGenomes-Gn; EBG00001008276.
DR   EnsemblGenomes-Gn; EBG00001008278.
DR   EnsemblGenomes-Gn; EBG00001008281.
DR   EnsemblGenomes-Gn; EBG00001008283.
DR   EnsemblGenomes-Gn; EBG00001008285.
DR   EnsemblGenomes-Gn; EBG00001008287.
DR   EnsemblGenomes-Gn; EBG00001008289.
DR   EnsemblGenomes-Gn; EBG00001008291.
DR   EnsemblGenomes-Gn; EBG00001008293.
DR   EnsemblGenomes-Gn; EBG00001008295.
DR   EnsemblGenomes-Gn; EBG00001008297.
DR   EnsemblGenomes-Gn; EBG00001008298.
DR   EnsemblGenomes-Gn; EBG00001008300.
DR   EnsemblGenomes-Gn; EBG00001008302.
DR   EnsemblGenomes-Gn; EBG00001008304.
DR   EnsemblGenomes-Gn; EBG00001008305.
DR   EnsemblGenomes-Gn; EBG00001008307.
DR   EnsemblGenomes-Gn; EBG00001008309.
DR   EnsemblGenomes-Gn; EBG00001008310.
DR   EnsemblGenomes-Gn; EBG00001008312.
DR   EnsemblGenomes-Gn; EBG00001008314.
DR   EnsemblGenomes-Gn; EBG00001008316.
DR   EnsemblGenomes-Gn; EBG00001008318.
DR   EnsemblGenomes-Gn; EBG00001008321.
DR   EnsemblGenomes-Gn; EBG00001008323.
DR   EnsemblGenomes-Gn; EBG00001008326.
DR   EnsemblGenomes-Gn; EBG00001008329.
DR   EnsemblGenomes-Gn; EBG00001008331.
DR   EnsemblGenomes-Gn; EBG00001008333.
DR   EnsemblGenomes-Gn; EBG00001008336.
DR   EnsemblGenomes-Gn; EBG00001008338.
DR   EnsemblGenomes-Gn; EBG00001008340.
DR   EnsemblGenomes-Gn; EBG00001008342.
DR   EnsemblGenomes-Gn; EBG00001008344.
DR   EnsemblGenomes-Gn; EBG00001008345.
DR   EnsemblGenomes-Gn; EBG00001008347.
DR   EnsemblGenomes-Gn; EBG00001008350.
DR   EnsemblGenomes-Gn; EBG00001008351.
DR   EnsemblGenomes-Gn; EBG00001008353.
DR   EnsemblGenomes-Gn; EBG00001008355.
DR   EnsemblGenomes-Gn; EBG00001008358.
DR   EnsemblGenomes-Gn; EBG00001008360.
DR   EnsemblGenomes-Gn; EBG00001008362.
DR   EnsemblGenomes-Gn; EBG00001008364.
DR   EnsemblGenomes-Gn; EBG00001008366.
DR   EnsemblGenomes-Gn; EBG00001008368.
DR   EnsemblGenomes-Gn; EBG00001008369.
DR   EnsemblGenomes-Gn; EBG00001008370.
DR   EnsemblGenomes-Gn; EBG00001008371.
DR   EnsemblGenomes-Gn; EBG00001008372.
DR   EnsemblGenomes-Gn; EBG00001008373.
DR   EnsemblGenomes-Gn; EBG00001008374.
DR   EnsemblGenomes-Gn; EBG00001008375.
DR   EnsemblGenomes-Gn; EBG00001008376.
DR   EnsemblGenomes-Gn; EBG00001008377.
DR   EnsemblGenomes-Gn; EBG00001008378.
DR   EnsemblGenomes-Gn; EBG00001008379.
DR   EnsemblGenomes-Gn; EBG00001008380.
DR   EnsemblGenomes-Gn; EBG00001008381.
DR   EnsemblGenomes-Gn; EBG00001008382.
DR   EnsemblGenomes-Gn; EBG00001008383.
DR   EnsemblGenomes-Gn; EBG00001008384.
DR   EnsemblGenomes-Gn; EBG00001008385.
DR   EnsemblGenomes-Gn; EBG00001008386.
DR   EnsemblGenomes-Gn; EBG00001008387.
DR   EnsemblGenomes-Gn; EBG00001008388.
DR   EnsemblGenomes-Gn; EBG00001008389.
DR   EnsemblGenomes-Gn; EBG00001008390.
DR   EnsemblGenomes-Gn; EBG00001008391.
DR   EnsemblGenomes-Gn; EBG00001008392.
DR   EnsemblGenomes-Gn; EBG00001008393.
DR   EnsemblGenomes-Gn; EBG00001008394.
DR   EnsemblGenomes-Gn; EBG00001008395.
DR   EnsemblGenomes-Gn; EBG00001008396.
DR   EnsemblGenomes-Gn; EBG00001008397.
DR   EnsemblGenomes-Gn; EBG00001008398.
DR   EnsemblGenomes-Gn; EBG00001008399.
DR   EnsemblGenomes-Gn; EBG00001008400.
DR   EnsemblGenomes-Gn; EBG00001008401.
DR   EnsemblGenomes-Gn; EBG00001008402.
DR   EnsemblGenomes-Gn; EBG00001008403.
DR   EnsemblGenomes-Gn; EBG00001008404.
DR   EnsemblGenomes-Gn; EBG00001008405.
DR   EnsemblGenomes-Gn; EBG00001008406.
DR   EnsemblGenomes-Gn; EBG00001008407.
DR   EnsemblGenomes-Gn; EBG00001008408.
DR   EnsemblGenomes-Gn; EBG00001008409.
DR   EnsemblGenomes-Gn; EBG00001008410.
DR   EnsemblGenomes-Gn; EBG00001008411.
DR   EnsemblGenomes-Gn; EBG00001008412.
DR   EnsemblGenomes-Gn; EBG00001008413.
DR   EnsemblGenomes-Gn; EBG00001008414.
DR   EnsemblGenomes-Gn; EBG00001008415.
DR   EnsemblGenomes-Gn; EBG00001008416.
DR   EnsemblGenomes-Gn; EBG00001008417.
DR   EnsemblGenomes-Gn; EBG00001008418.
DR   EnsemblGenomes-Gn; EBG00001008419.
DR   EnsemblGenomes-Gn; EBG00001008420.
DR   EnsemblGenomes-Gn; EBG00001008421.
DR   EnsemblGenomes-Gn; EBG00001008422.
DR   EnsemblGenomes-Gn; EBG00001008423.
DR   EnsemblGenomes-Gn; EBG00001008424.
DR   EnsemblGenomes-Gn; EBG00001008425.
DR   EnsemblGenomes-Gn; EBG00001008426.
DR   EnsemblGenomes-Gn; EBG00001008427.
DR   EnsemblGenomes-Gn; EBG00001008428.
DR   EnsemblGenomes-Gn; EBG00001008429.
DR   EnsemblGenomes-Gn; EBG00001008430.
DR   EnsemblGenomes-Gn; EBG00001008431.
DR   EnsemblGenomes-Gn; EBG00001008432.
DR   EnsemblGenomes-Gn; EBG00001008433.
DR   EnsemblGenomes-Gn; EBG00001008434.
DR   EnsemblGenomes-Gn; EBG00001008435.
DR   EnsemblGenomes-Gn; EBG00001008436.
DR   EnsemblGenomes-Gn; EBG00001008437.
DR   EnsemblGenomes-Gn; EBG00001008438.
DR   EnsemblGenomes-Gn; EBG00001008439.
DR   EnsemblGenomes-Gn; EBG00001008440.
DR   EnsemblGenomes-Gn; EBG00001008441.
DR   EnsemblGenomes-Gn; EBG00001008442.
DR   EnsemblGenomes-Gn; EBG00001008443.
DR   EnsemblGenomes-Gn; EBG00001008444.
DR   EnsemblGenomes-Gn; ROD_01891.
DR   EnsemblGenomes-Gn; ROD_02031.
DR   EnsemblGenomes-Gn; ROD_02381.
DR   EnsemblGenomes-Gn; ROD_02721.
DR   EnsemblGenomes-Gn; ROD_02841.
DR   EnsemblGenomes-Gn; ROD_02951.
DR   EnsemblGenomes-Gn; ROD_03001.
DR   EnsemblGenomes-Gn; ROD_03091.
DR   EnsemblGenomes-Gn; ROD_03411.
DR   EnsemblGenomes-Gn; ROD_03432.
DR   EnsemblGenomes-Gn; ROD_05231.
DR   EnsemblGenomes-Gn; ROD_05661.
DR   EnsemblGenomes-Gn; ROD_05781.
DR   EnsemblGenomes-Gn; ROD_05861.
DR   EnsemblGenomes-Gn; ROD_05881.
DR   EnsemblGenomes-Gn; ROD_06421.
DR   EnsemblGenomes-Gn; ROD_06641.
DR   EnsemblGenomes-Gn; ROD_07161.
DR   EnsemblGenomes-Gn; ROD_07162.
DR   EnsemblGenomes-Gn; ROD_08491.
DR   EnsemblGenomes-Gn; ROD_08971.
DR   EnsemblGenomes-Gn; ROD_08982.
DR   EnsemblGenomes-Gn; ROD_10341.
DR   EnsemblGenomes-Gn; ROD_10431.
DR   EnsemblGenomes-Gn; ROD_10521.
DR   EnsemblGenomes-Gn; ROD_10522.
DR   EnsemblGenomes-Gn; ROD_10751.
DR   EnsemblGenomes-Gn; ROD_10762.
DR   EnsemblGenomes-Gn; ROD_10771.
DR   EnsemblGenomes-Gn; ROD_10791.
DR   EnsemblGenomes-Gn; ROD_10801.
DR   EnsemblGenomes-Gn; ROD_10811.
DR   EnsemblGenomes-Gn; ROD_10821.
DR   EnsemblGenomes-Gn; ROD_10851.
DR   EnsemblGenomes-Gn; ROD_10891.
DR   EnsemblGenomes-Gn; ROD_11261.
DR   EnsemblGenomes-Gn; ROD_11301.
DR   EnsemblGenomes-Gn; ROD_11371.
DR   EnsemblGenomes-Gn; ROD_11411.
DR   EnsemblGenomes-Gn; ROD_11412.
DR   EnsemblGenomes-Gn; ROD_11741.
DR   EnsemblGenomes-Gn; ROD_12051.
DR   EnsemblGenomes-Gn; ROD_12081.
DR   EnsemblGenomes-Gn; ROD_12851.
DR   EnsemblGenomes-Gn; ROD_13611.
DR   EnsemblGenomes-Gn; ROD_13871.
DR   EnsemblGenomes-Gn; ROD_14811.
DR   EnsemblGenomes-Gn; ROD_15501.
DR   EnsemblGenomes-Gn; ROD_15511.
DR   EnsemblGenomes-Gn; ROD_15781.
DR   EnsemblGenomes-Gn; ROD_16201.
DR   EnsemblGenomes-Gn; ROD_16492.
DR   EnsemblGenomes-Gn; ROD_16501.
DR   EnsemblGenomes-Gn; ROD_16541.
DR   EnsemblGenomes-Gn; ROD_16542.
DR   EnsemblGenomes-Gn; ROD_16561.
DR   EnsemblGenomes-Gn; ROD_16911.
DR   EnsemblGenomes-Gn; ROD_17541.
DR   EnsemblGenomes-Gn; ROD_19101.
DR   EnsemblGenomes-Gn; ROD_19121.
DR   EnsemblGenomes-Gn; ROD_19261.
DR   EnsemblGenomes-Gn; ROD_19521.
DR   EnsemblGenomes-Gn; ROD_20071.
DR   EnsemblGenomes-Gn; ROD_20531.
DR   EnsemblGenomes-Gn; ROD_20721.
DR   EnsemblGenomes-Gn; ROD_21471.
DR   EnsemblGenomes-Gn; ROD_22471.
DR   EnsemblGenomes-Gn; ROD_22621.
DR   EnsemblGenomes-Gn; ROD_23641.
DR   EnsemblGenomes-Gn; ROD_23781.
DR   EnsemblGenomes-Gn; ROD_24181.
DR   EnsemblGenomes-Gn; ROD_24371.
DR   EnsemblGenomes-Gn; ROD_24381.
DR   EnsemblGenomes-Gn; ROD_24621.
DR   EnsemblGenomes-Gn; ROD_26351.
DR   EnsemblGenomes-Gn; ROD_26391.
DR   EnsemblGenomes-Gn; ROD_26491.
DR   EnsemblGenomes-Gn; ROD_26751.
DR   EnsemblGenomes-Gn; ROD_27502.
DR   EnsemblGenomes-Gn; ROD_27701.
DR   EnsemblGenomes-Gn; ROD_28201.
DR   EnsemblGenomes-Gn; ROD_28261.
DR   EnsemblGenomes-Gn; ROD_28291.
DR   EnsemblGenomes-Gn; ROD_28941.
DR   EnsemblGenomes-Gn; ROD_29351.
DR   EnsemblGenomes-Gn; ROD_29421.
DR   EnsemblGenomes-Gn; ROD_29461.
DR   EnsemblGenomes-Gn; ROD_29641.
DR   EnsemblGenomes-Gn; ROD_29811.
DR   EnsemblGenomes-Gn; ROD_30031.
DR   EnsemblGenomes-Gn; ROD_30221.
DR   EnsemblGenomes-Gn; ROD_31521.
DR   EnsemblGenomes-Gn; ROD_31701.
DR   EnsemblGenomes-Gn; ROD_31741.
DR   EnsemblGenomes-Gn; ROD_31761.
DR   EnsemblGenomes-Gn; ROD_31781.
DR   EnsemblGenomes-Gn; ROD_31801.
DR   EnsemblGenomes-Gn; ROD_31831.
DR   EnsemblGenomes-Gn; ROD_31851.
DR   EnsemblGenomes-Gn; ROD_31861.
DR   EnsemblGenomes-Gn; ROD_31951.
DR   EnsemblGenomes-Gn; ROD_31961.
DR   EnsemblGenomes-Gn; ROD_32771.
DR   EnsemblGenomes-Gn; ROD_33321.
DR   EnsemblGenomes-Gn; ROD_33391.
DR   EnsemblGenomes-Gn; ROD_33451.
DR   EnsemblGenomes-Gn; ROD_33471.
DR   EnsemblGenomes-Gn; ROD_33472.
DR   EnsemblGenomes-Gn; ROD_33491.
DR   EnsemblGenomes-Gn; ROD_33511.
DR   EnsemblGenomes-Gn; ROD_33591.
DR   EnsemblGenomes-Gn; ROD_33611.
DR   EnsemblGenomes-Gn; ROD_33621.
DR   EnsemblGenomes-Gn; ROD_33622.
DR   EnsemblGenomes-Gn; ROD_33651.
DR   EnsemblGenomes-Gn; ROD_33771.
DR   EnsemblGenomes-Gn; ROD_33841.
DR   EnsemblGenomes-Gn; ROD_34121.
DR   EnsemblGenomes-Gn; ROD_34312.
DR   EnsemblGenomes-Gn; ROD_34381.
DR   EnsemblGenomes-Gn; ROD_34911.
DR   EnsemblGenomes-Gn; ROD_35291.
DR   EnsemblGenomes-Gn; ROD_35341.
DR   EnsemblGenomes-Gn; ROD_35381.
DR   EnsemblGenomes-Gn; ROD_35471.
DR   EnsemblGenomes-Gn; ROD_35581.
DR   EnsemblGenomes-Gn; ROD_35741.
DR   EnsemblGenomes-Gn; ROD_36221.
DR   EnsemblGenomes-Gn; ROD_36261.
DR   EnsemblGenomes-Gn; ROD_36451.
DR   EnsemblGenomes-Gn; ROD_36581.
DR   EnsemblGenomes-Gn; ROD_37911.
DR   EnsemblGenomes-Gn; ROD_39811.
DR   EnsemblGenomes-Gn; ROD_40661.
DR   EnsemblGenomes-Gn; ROD_40741.
DR   EnsemblGenomes-Gn; ROD_40761.
DR   EnsemblGenomes-Gn; ROD_40772.
DR   EnsemblGenomes-Gn; ROD_40773.
DR   EnsemblGenomes-Gn; ROD_40781.
DR   EnsemblGenomes-Gn; ROD_40831.
DR   EnsemblGenomes-Gn; ROD_40861.
DR   EnsemblGenomes-Gn; ROD_40961.
DR   EnsemblGenomes-Gn; ROD_40991.
DR   EnsemblGenomes-Gn; ROD_41061.
DR   EnsemblGenomes-Gn; ROD_41081.
DR   EnsemblGenomes-Gn; ROD_41121.
DR   EnsemblGenomes-Gn; ROD_41571.
DR   EnsemblGenomes-Gn; ROD_41701.
DR   EnsemblGenomes-Gn; ROD_42151.
DR   EnsemblGenomes-Gn; ROD_42581.
DR   EnsemblGenomes-Gn; ROD_42871.
DR   EnsemblGenomes-Gn; ROD_42901.
DR   EnsemblGenomes-Gn; ROD_43031.
DR   EnsemblGenomes-Gn; ROD_43081.
DR   EnsemblGenomes-Gn; ROD_45781.
DR   EnsemblGenomes-Gn; ROD_46891.
DR   EnsemblGenomes-Gn; ROD_47391.
DR   EnsemblGenomes-Gn; ROD_47721.
DR   EnsemblGenomes-Gn; ROD_47791.
DR   EnsemblGenomes-Gn; ROD_47801.
DR   EnsemblGenomes-Gn; ROD_47821.
DR   EnsemblGenomes-Gn; ROD_47831.
DR   EnsemblGenomes-Gn; ROD_47841.
DR   EnsemblGenomes-Gn; ROD_47941.
DR   EnsemblGenomes-Gn; ROD_48171.
DR   EnsemblGenomes-Gn; ROD_48761.
DR   EnsemblGenomes-Gn; ROD_48791.
DR   EnsemblGenomes-Gn; ROD_48851.
DR   EnsemblGenomes-Gn; ROD_48921.
DR   EnsemblGenomes-Gn; ROD_48941.
DR   EnsemblGenomes-Gn; ROD_48951.
DR   EnsemblGenomes-Gn; ROD_49201.
DR   EnsemblGenomes-Gn; ROD_49321.
DR   EnsemblGenomes-Gn; ROD_49561.
DR   EnsemblGenomes-Gn; ROD_49611.
DR   EnsemblGenomes-Gn; ROD_49621.
DR   EnsemblGenomes-Gn; ROD_49851.
DR   EnsemblGenomes-Gn; ROD_50031.
DR   EnsemblGenomes-Gn; ROD_50161.
DR   EnsemblGenomes-Gn; ROD_50162.
DR   EnsemblGenomes-Gn; ROD_50181.
DR   EnsemblGenomes-Gn; ROD_50191.
DR   EnsemblGenomes-Gn; ROD_50631.
DR   EnsemblGenomes-Gn; ROD_50651.
DR   EnsemblGenomes-Gn; ROD_t01.
DR   EnsemblGenomes-Gn; ROD_t02.
DR   EnsemblGenomes-Gn; ROD_t03.
DR   EnsemblGenomes-Gn; ROD_t04.
DR   EnsemblGenomes-Gn; ROD_t05.
DR   EnsemblGenomes-Gn; ROD_t06.
DR   EnsemblGenomes-Gn; ROD_t07.
DR   EnsemblGenomes-Gn; ROD_t08.
DR   EnsemblGenomes-Gn; ROD_t09.
DR   EnsemblGenomes-Gn; ROD_t10.
DR   EnsemblGenomes-Gn; ROD_t11.
DR   EnsemblGenomes-Gn; ROD_t12.
DR   EnsemblGenomes-Gn; ROD_t13.
DR   EnsemblGenomes-Gn; ROD_t14.
DR   EnsemblGenomes-Gn; ROD_t15.
DR   EnsemblGenomes-Gn; ROD_t16.
DR   EnsemblGenomes-Gn; ROD_t17.
DR   EnsemblGenomes-Gn; ROD_t18.
DR   EnsemblGenomes-Gn; ROD_t19.
DR   EnsemblGenomes-Gn; ROD_t20.
DR   EnsemblGenomes-Gn; ROD_t21.
DR   EnsemblGenomes-Gn; ROD_t22.
DR   EnsemblGenomes-Gn; ROD_t23.
DR   EnsemblGenomes-Gn; ROD_t24.
DR   EnsemblGenomes-Gn; ROD_t25.
DR   EnsemblGenomes-Gn; ROD_t26.
DR   EnsemblGenomes-Gn; ROD_t27.
DR   EnsemblGenomes-Gn; ROD_t28.
DR   EnsemblGenomes-Gn; ROD_t29.
DR   EnsemblGenomes-Gn; ROD_t30.
DR   EnsemblGenomes-Gn; ROD_t31.
DR   EnsemblGenomes-Gn; ROD_t32.
DR   EnsemblGenomes-Gn; ROD_t33.
DR   EnsemblGenomes-Gn; ROD_t34.
DR   EnsemblGenomes-Gn; ROD_t35.
DR   EnsemblGenomes-Gn; ROD_t36.
DR   EnsemblGenomes-Gn; ROD_t37.
DR   EnsemblGenomes-Gn; ROD_t38.
DR   EnsemblGenomes-Gn; ROD_t39.
DR   EnsemblGenomes-Gn; ROD_t40.
DR   EnsemblGenomes-Gn; ROD_t41.
DR   EnsemblGenomes-Gn; ROD_t42.
DR   EnsemblGenomes-Gn; ROD_t43.
DR   EnsemblGenomes-Gn; ROD_t44.
DR   EnsemblGenomes-Gn; ROD_t45.
DR   EnsemblGenomes-Gn; ROD_t46.
DR   EnsemblGenomes-Gn; ROD_t47.
DR   EnsemblGenomes-Gn; ROD_t48.
DR   EnsemblGenomes-Gn; ROD_t49.
DR   EnsemblGenomes-Gn; ROD_t50.
DR   EnsemblGenomes-Gn; ROD_t51.
DR   EnsemblGenomes-Gn; ROD_t52.
DR   EnsemblGenomes-Gn; ROD_t53.
DR   EnsemblGenomes-Gn; ROD_t54.
DR   EnsemblGenomes-Gn; ROD_t55.
DR   EnsemblGenomes-Gn; ROD_t56.
DR   EnsemblGenomes-Gn; ROD_t57.
DR   EnsemblGenomes-Gn; ROD_t58.
DR   EnsemblGenomes-Gn; ROD_t59.
DR   EnsemblGenomes-Gn; ROD_t60.
DR   EnsemblGenomes-Gn; ROD_t61.
DR   EnsemblGenomes-Gn; ROD_t62.
DR   EnsemblGenomes-Gn; ROD_t63.
DR   EnsemblGenomes-Gn; ROD_t64.
DR   EnsemblGenomes-Gn; ROD_t65.
DR   EnsemblGenomes-Gn; ROD_t66.
DR   EnsemblGenomes-Gn; ROD_t67.
DR   EnsemblGenomes-Gn; ROD_t68.
DR   EnsemblGenomes-Gn; ROD_t69.
DR   EnsemblGenomes-Gn; ROD_t70.
DR   EnsemblGenomes-Gn; ROD_t71.
DR   EnsemblGenomes-Gn; ROD_t72.
DR   EnsemblGenomes-Gn; ROD_t73.
DR   EnsemblGenomes-Gn; ROD_t74.
DR   EnsemblGenomes-Gn; ROD_t75.
DR   EnsemblGenomes-Gn; ROD_t76.
DR   EnsemblGenomes-Gn; ROD_t77.
DR   EnsemblGenomes-Gn; ROD_t78.
DR   EnsemblGenomes-Gn; ROD_t79.
DR   EnsemblGenomes-Gn; ROD_t80.
DR   EnsemblGenomes-Gn; ROD_t81.
DR   EnsemblGenomes-Gn; ROD_t82.
DR   EnsemblGenomes-Gn; ROD_t83.
DR   EnsemblGenomes-Gn; ROD_t84.
DR   EnsemblGenomes-Gn; ROD_t85.
DR   EnsemblGenomes-Gn; ROD_t86.
DR   EnsemblGenomes-Tr; EBG00000016930-1.
DR   EnsemblGenomes-Tr; EBG00000016931-1.
DR   EnsemblGenomes-Tr; EBG00000016932-1.
DR   EnsemblGenomes-Tr; EBG00000016933-1.
DR   EnsemblGenomes-Tr; EBG00000016934-1.
DR   EnsemblGenomes-Tr; EBG00000016935-1.
DR   EnsemblGenomes-Tr; EBG00000016936-1.
DR   EnsemblGenomes-Tr; EBG00000016937-1.
DR   EnsemblGenomes-Tr; EBG00000016938-1.
DR   EnsemblGenomes-Tr; EBG00000016939-1.
DR   EnsemblGenomes-Tr; EBG00000016940-1.
DR   EnsemblGenomes-Tr; EBG00000016941-1.
DR   EnsemblGenomes-Tr; EBG00000016942-1.
DR   EnsemblGenomes-Tr; EBG00000016943-1.
DR   EnsemblGenomes-Tr; EBG00000016944-1.
DR   EnsemblGenomes-Tr; EBG00000016945-1.
DR   EnsemblGenomes-Tr; EBG00000016946-1.
DR   EnsemblGenomes-Tr; EBG00000016947-1.
DR   EnsemblGenomes-Tr; EBG00000016948-1.
DR   EnsemblGenomes-Tr; EBG00000016949-1.
DR   EnsemblGenomes-Tr; EBG00000016950-1.
DR   EnsemblGenomes-Tr; EBG00000016951-1.
DR   EnsemblGenomes-Tr; EBT00001533876.
DR   EnsemblGenomes-Tr; EBT00001533878.
DR   EnsemblGenomes-Tr; EBT00001533880.
DR   EnsemblGenomes-Tr; EBT00001533885.
DR   EnsemblGenomes-Tr; EBT00001533888.
DR   EnsemblGenomes-Tr; EBT00001533891.
DR   EnsemblGenomes-Tr; EBT00001533894.
DR   EnsemblGenomes-Tr; EBT00001533899.
DR   EnsemblGenomes-Tr; EBT00001533902.
DR   EnsemblGenomes-Tr; EBT00001533905.
DR   EnsemblGenomes-Tr; EBT00001533908.
DR   EnsemblGenomes-Tr; EBT00001533910.
DR   EnsemblGenomes-Tr; EBT00001533914.
DR   EnsemblGenomes-Tr; EBT00001533918.
DR   EnsemblGenomes-Tr; EBT00001533921.
DR   EnsemblGenomes-Tr; EBT00001533925.
DR   EnsemblGenomes-Tr; EBT00001533928.
DR   EnsemblGenomes-Tr; EBT00001533932.
DR   EnsemblGenomes-Tr; EBT00001533935.
DR   EnsemblGenomes-Tr; EBT00001533940.
DR   EnsemblGenomes-Tr; EBT00001533944.
DR   EnsemblGenomes-Tr; EBT00001533949.
DR   EnsemblGenomes-Tr; EBT00001533951.
DR   EnsemblGenomes-Tr; EBT00001533956.
DR   EnsemblGenomes-Tr; EBT00001533959.
DR   EnsemblGenomes-Tr; EBT00001533962.
DR   EnsemblGenomes-Tr; EBT00001533965.
DR   EnsemblGenomes-Tr; EBT00001533968.
DR   EnsemblGenomes-Tr; EBT00001533970.
DR   EnsemblGenomes-Tr; EBT00001533972.
DR   EnsemblGenomes-Tr; EBT00001533975.
DR   EnsemblGenomes-Tr; EBT00001533979.
DR   EnsemblGenomes-Tr; EBT00001533983.
DR   EnsemblGenomes-Tr; EBT00001533987.
DR   EnsemblGenomes-Tr; EBT00001533990.
DR   EnsemblGenomes-Tr; EBT00001533992.
DR   EnsemblGenomes-Tr; EBT00001533995.
DR   EnsemblGenomes-Tr; EBT00001533998.
DR   EnsemblGenomes-Tr; EBT00001534000.
DR   EnsemblGenomes-Tr; EBT00001534002.
DR   EnsemblGenomes-Tr; EBT00001534004.
DR   EnsemblGenomes-Tr; EBT00001534010.
DR   EnsemblGenomes-Tr; EBT00001534013.
DR   EnsemblGenomes-Tr; EBT00001534016.
DR   EnsemblGenomes-Tr; EBT00001534020.
DR   EnsemblGenomes-Tr; EBT00001534022.
DR   EnsemblGenomes-Tr; EBT00001534025.
DR   EnsemblGenomes-Tr; EBT00001534028.
DR   EnsemblGenomes-Tr; EBT00001534031.
DR   EnsemblGenomes-Tr; EBT00001534034.
DR   EnsemblGenomes-Tr; EBT00001534036.
DR   EnsemblGenomes-Tr; EBT00001534038.
DR   EnsemblGenomes-Tr; EBT00001534043.
DR   EnsemblGenomes-Tr; EBT00001534046.
DR   EnsemblGenomes-Tr; EBT00001534049.
DR   EnsemblGenomes-Tr; EBT00001534051.
DR   EnsemblGenomes-Tr; EBT00001534052.
DR   EnsemblGenomes-Tr; EBT00001534056.
DR   EnsemblGenomes-Tr; EBT00001534058.
DR   EnsemblGenomes-Tr; EBT00001534061.
DR   EnsemblGenomes-Tr; EBT00001534062.
DR   EnsemblGenomes-Tr; EBT00001534065.
DR   EnsemblGenomes-Tr; EBT00001534067.
DR   EnsemblGenomes-Tr; EBT00001534069.
DR   EnsemblGenomes-Tr; EBT00001534071.
DR   EnsemblGenomes-Tr; EBT00001534073.
DR   EnsemblGenomes-Tr; EBT00001534074.
DR   EnsemblGenomes-Tr; EBT00001534076.
DR   EnsemblGenomes-Tr; EBT00001534078.
DR   EnsemblGenomes-Tr; EBT00001534080.
DR   EnsemblGenomes-Tr; EBT00001534082.
DR   EnsemblGenomes-Tr; EBT00001534084.
DR   EnsemblGenomes-Tr; EBT00001534086.
DR   EnsemblGenomes-Tr; EBT00001534087.
DR   EnsemblGenomes-Tr; EBT00001534088.
DR   EnsemblGenomes-Tr; EBT00001534089.
DR   EnsemblGenomes-Tr; EBT00001534091.
DR   EnsemblGenomes-Tr; EBT00001534092.
DR   EnsemblGenomes-Tr; EBT00001534094.
DR   EnsemblGenomes-Tr; EBT00001534095.
DR   EnsemblGenomes-Tr; EBT00001534096.
DR   EnsemblGenomes-Tr; EBT00001534097.
DR   EnsemblGenomes-Tr; EBT00001534098.
DR   EnsemblGenomes-Tr; EBT00001534100.
DR   EnsemblGenomes-Tr; EBT00001534102.
DR   EnsemblGenomes-Tr; EBT00001534105.
DR   EnsemblGenomes-Tr; EBT00001534109.
DR   EnsemblGenomes-Tr; EBT00001534111.
DR   EnsemblGenomes-Tr; EBT00001534113.
DR   EnsemblGenomes-Tr; EBT00001534116.
DR   EnsemblGenomes-Tr; EBT00001534120.
DR   EnsemblGenomes-Tr; EBT00001534124.
DR   EnsemblGenomes-Tr; EBT00001534128.
DR   EnsemblGenomes-Tr; EBT00001534131.
DR   EnsemblGenomes-Tr; EBT00001534133.
DR   EnsemblGenomes-Tr; EBT00001534137.
DR   EnsemblGenomes-Tr; EBT00001534142.
DR   EnsemblGenomes-Tr; EBT00001534146.
DR   EnsemblGenomes-Tr; EBT00001534149.
DR   EnsemblGenomes-Tr; EBT00001534151.
DR   EnsemblGenomes-Tr; EBT00001534155.
DR   EnsemblGenomes-Tr; EBT00001534160.
DR   EnsemblGenomes-Tr; EBT00001534165.
DR   EnsemblGenomes-Tr; EBT00001534168.
DR   EnsemblGenomes-Tr; EBT00001534170.
DR   EnsemblGenomes-Tr; EBT00001534174.
DR   EnsemblGenomes-Tr; EBT00001534179.
DR   EnsemblGenomes-Tr; EBT00001534183.
DR   EnsemblGenomes-Tr; EBT00001534187.
DR   EnsemblGenomes-Tr; EBT00001534190.
DR   EnsemblGenomes-Tr; EBT00001534194.
DR   EnsemblGenomes-Tr; EBT00001534198.
DR   EnsemblGenomes-Tr; EBT00001534204.
DR   EnsemblGenomes-Tr; EBT00001534209.
DR   EnsemblGenomes-Tr; EBT00001534214.
DR   EnsemblGenomes-Tr; EBT00001534218.
DR   EnsemblGenomes-Tr; EBT00001534222.
DR   EnsemblGenomes-Tr; EBT00001534228.
DR   EnsemblGenomes-Tr; EBT00001534232.
DR   EnsemblGenomes-Tr; EBT00001534237.
DR   EnsemblGenomes-Tr; EBT00001534241.
DR   EnsemblGenomes-Tr; EBT00001534245.
DR   EnsemblGenomes-Tr; EBT00001534250.
DR   EnsemblGenomes-Tr; EBT00001534252.
DR   EnsemblGenomes-Tr; EBT00001534257.
DR   EnsemblGenomes-Tr; EBT00001534261.
DR   EnsemblGenomes-Tr; EBT00001534266.
DR   EnsemblGenomes-Tr; EBT00001534270.
DR   EnsemblGenomes-Tr; EBT00001534276.
DR   EnsemblGenomes-Tr; EBT00001534277.
DR   EnsemblGenomes-Tr; EBT00001534281.
DR   EnsemblGenomes-Tr; EBT00001534287.
DR   EnsemblGenomes-Tr; EBT00001534292.
DR   EnsemblGenomes-Tr; EBT00001534297.
DR   EnsemblGenomes-Tr; EBT00001534303.
DR   EnsemblGenomes-Tr; EBT00001534309.
DR   EnsemblGenomes-Tr; EBT00001534313.
DR   EnsemblGenomes-Tr; EBT00001534317.
DR   EnsemblGenomes-Tr; EBT00001534320.
DR   EnsemblGenomes-Tr; EBT00001534325.
DR   EnsemblGenomes-Tr; EBT00001534330.
DR   EnsemblGenomes-Tr; EBT00001534333.
DR   EnsemblGenomes-Tr; EBT00001534337.
DR   EnsemblGenomes-Tr; EBT00001534342.
DR   EnsemblGenomes-Tr; EBT00001534348.
DR   EnsemblGenomes-Tr; EBT00001534353.
DR   EnsemblGenomes-Tr; EBT00001534357.
DR   EnsemblGenomes-Tr; EBT00001534360.
DR   EnsemblGenomes-Tr; EBT00001534364.
DR   EnsemblGenomes-Tr; EBT00001534368.
DR   EnsemblGenomes-Tr; EBT00001534372.
DR   EnsemblGenomes-Tr; EBT00001534374.
DR   EnsemblGenomes-Tr; EBT00001534383.
DR   EnsemblGenomes-Tr; EBT00001534387.
DR   EnsemblGenomes-Tr; EBT00001534390.
DR   EnsemblGenomes-Tr; EBT00001534393.
DR   EnsemblGenomes-Tr; EBT00001534396.
DR   EnsemblGenomes-Tr; EBT00001534399.
DR   EnsemblGenomes-Tr; EBT00001534405.
DR   EnsemblGenomes-Tr; EBT00001534408.
DR   EnsemblGenomes-Tr; EBT00001534412.
DR   EnsemblGenomes-Tr; EBT00001534416.
DR   EnsemblGenomes-Tr; EBT00001534420.
DR   EnsemblGenomes-Tr; EBT00001534423.
DR   EnsemblGenomes-Tr; EBT00001534426.
DR   EnsemblGenomes-Tr; EBT00001534429.
DR   EnsemblGenomes-Tr; EBT00001534434.
DR   EnsemblGenomes-Tr; EBT00001534439.
DR   EnsemblGenomes-Tr; EBT00001534442.
DR   EnsemblGenomes-Tr; EBT00001534447.
DR   EnsemblGenomes-Tr; EBT00001534452.
DR   EnsemblGenomes-Tr; EBT00001534457.
DR   EnsemblGenomes-Tr; EBT00001534462.
DR   EnsemblGenomes-Tr; EBT00001534465.
DR   EnsemblGenomes-Tr; EBT00001534469.
DR   EnsemblGenomes-Tr; EBT00001534475.
DR   EnsemblGenomes-Tr; EBT00001534478.
DR   EnsemblGenomes-Tr; EBT00001534480.
DR   EnsemblGenomes-Tr; EBT00001534484.
DR   EnsemblGenomes-Tr; EBT00001534487.
DR   EnsemblGenomes-Tr; EBT00001534492.
DR   EnsemblGenomes-Tr; EBT00001534497.
DR   EnsemblGenomes-Tr; EBT00001534507.
DR   EnsemblGenomes-Tr; EBT00001534512.
DR   EnsemblGenomes-Tr; EBT00001534514.
DR   EnsemblGenomes-Tr; EBT00001534519.
DR   EnsemblGenomes-Tr; EBT00001534522.
DR   EnsemblGenomes-Tr; EBT00001534527.
DR   EnsemblGenomes-Tr; EBT00001534529.
DR   EnsemblGenomes-Tr; EBT00001534530.
DR   EnsemblGenomes-Tr; EBT00001534532.
DR   EnsemblGenomes-Tr; EBT00001534534.
DR   EnsemblGenomes-Tr; EBT00001534538.
DR   EnsemblGenomes-Tr; EBT00001534542.
DR   EnsemblGenomes-Tr; EBT00001534544.
DR   EnsemblGenomes-Tr; EBT00001534547.
DR   EnsemblGenomes-Tr; EBT00001534550.
DR   EnsemblGenomes-Tr; EBT00001534554.
DR   EnsemblGenomes-Tr; EBT00001534559.
DR   EnsemblGenomes-Tr; EBT00001534560.
DR   EnsemblGenomes-Tr; EBT00001534562.
DR   EnsemblGenomes-Tr; EBT00001534565.
DR   EnsemblGenomes-Tr; EBT00001534567.
DR   EnsemblGenomes-Tr; EBT00001534569.
DR   EnsemblGenomes-Tr; EBT00001534571.
DR   EnsemblGenomes-Tr; EBT00001534572.
DR   EnsemblGenomes-Tr; EBT00001534575.
DR   EnsemblGenomes-Tr; ROD_01891.
DR   EnsemblGenomes-Tr; ROD_02031.
DR   EnsemblGenomes-Tr; ROD_02381.
DR   EnsemblGenomes-Tr; ROD_02721.
DR   EnsemblGenomes-Tr; ROD_02841.
DR   EnsemblGenomes-Tr; ROD_02951.
DR   EnsemblGenomes-Tr; ROD_03001.
DR   EnsemblGenomes-Tr; ROD_03091.
DR   EnsemblGenomes-Tr; ROD_03411.
DR   EnsemblGenomes-Tr; ROD_03432.
DR   EnsemblGenomes-Tr; ROD_05231.
DR   EnsemblGenomes-Tr; ROD_05661.
DR   EnsemblGenomes-Tr; ROD_05781.
DR   EnsemblGenomes-Tr; ROD_05861.
DR   EnsemblGenomes-Tr; ROD_05881.
DR   EnsemblGenomes-Tr; ROD_06421.
DR   EnsemblGenomes-Tr; ROD_06641.
DR   EnsemblGenomes-Tr; ROD_07161.
DR   EnsemblGenomes-Tr; ROD_07162.
DR   EnsemblGenomes-Tr; ROD_08491.
DR   EnsemblGenomes-Tr; ROD_08971.
DR   EnsemblGenomes-Tr; ROD_08982.
DR   EnsemblGenomes-Tr; ROD_10341.
DR   EnsemblGenomes-Tr; ROD_10431.
DR   EnsemblGenomes-Tr; ROD_10521.
DR   EnsemblGenomes-Tr; ROD_10522.
DR   EnsemblGenomes-Tr; ROD_10751.
DR   EnsemblGenomes-Tr; ROD_10762.
DR   EnsemblGenomes-Tr; ROD_10771.
DR   EnsemblGenomes-Tr; ROD_10791.
DR   EnsemblGenomes-Tr; ROD_10801.
DR   EnsemblGenomes-Tr; ROD_10811.
DR   EnsemblGenomes-Tr; ROD_10821.
DR   EnsemblGenomes-Tr; ROD_10851.
DR   EnsemblGenomes-Tr; ROD_10891.
DR   EnsemblGenomes-Tr; ROD_11261.
DR   EnsemblGenomes-Tr; ROD_11301.
DR   EnsemblGenomes-Tr; ROD_11371.
DR   EnsemblGenomes-Tr; ROD_11411.
DR   EnsemblGenomes-Tr; ROD_11412.
DR   EnsemblGenomes-Tr; ROD_11741.
DR   EnsemblGenomes-Tr; ROD_12051.
DR   EnsemblGenomes-Tr; ROD_12081.
DR   EnsemblGenomes-Tr; ROD_12851.
DR   EnsemblGenomes-Tr; ROD_13611.
DR   EnsemblGenomes-Tr; ROD_13871.
DR   EnsemblGenomes-Tr; ROD_14811.
DR   EnsemblGenomes-Tr; ROD_15501.
DR   EnsemblGenomes-Tr; ROD_15511.
DR   EnsemblGenomes-Tr; ROD_15781.
DR   EnsemblGenomes-Tr; ROD_16201.
DR   EnsemblGenomes-Tr; ROD_16492.
DR   EnsemblGenomes-Tr; ROD_16501.
DR   EnsemblGenomes-Tr; ROD_16541.
DR   EnsemblGenomes-Tr; ROD_16542.
DR   EnsemblGenomes-Tr; ROD_16561.
DR   EnsemblGenomes-Tr; ROD_16911.
DR   EnsemblGenomes-Tr; ROD_17541.
DR   EnsemblGenomes-Tr; ROD_19101.
DR   EnsemblGenomes-Tr; ROD_19121.
DR   EnsemblGenomes-Tr; ROD_19261.
DR   EnsemblGenomes-Tr; ROD_19521.
DR   EnsemblGenomes-Tr; ROD_20071.
DR   EnsemblGenomes-Tr; ROD_20531.
DR   EnsemblGenomes-Tr; ROD_20721.
DR   EnsemblGenomes-Tr; ROD_21471.
DR   EnsemblGenomes-Tr; ROD_22471.
DR   EnsemblGenomes-Tr; ROD_22621.
DR   EnsemblGenomes-Tr; ROD_23641.
DR   EnsemblGenomes-Tr; ROD_23781.
DR   EnsemblGenomes-Tr; ROD_24181.
DR   EnsemblGenomes-Tr; ROD_24371.
DR   EnsemblGenomes-Tr; ROD_24381.
DR   EnsemblGenomes-Tr; ROD_24621.
DR   EnsemblGenomes-Tr; ROD_26351.
DR   EnsemblGenomes-Tr; ROD_26391.
DR   EnsemblGenomes-Tr; ROD_26491.
DR   EnsemblGenomes-Tr; ROD_26751.
DR   EnsemblGenomes-Tr; ROD_27502.
DR   EnsemblGenomes-Tr; ROD_27701.
DR   EnsemblGenomes-Tr; ROD_28201.
DR   EnsemblGenomes-Tr; ROD_28261.
DR   EnsemblGenomes-Tr; ROD_28291.
DR   EnsemblGenomes-Tr; ROD_28941.
DR   EnsemblGenomes-Tr; ROD_29351.
DR   EnsemblGenomes-Tr; ROD_29421.
DR   EnsemblGenomes-Tr; ROD_29461.
DR   EnsemblGenomes-Tr; ROD_29641.
DR   EnsemblGenomes-Tr; ROD_29811.
DR   EnsemblGenomes-Tr; ROD_30031.
DR   EnsemblGenomes-Tr; ROD_30221.
DR   EnsemblGenomes-Tr; ROD_31521.
DR   EnsemblGenomes-Tr; ROD_31701.
DR   EnsemblGenomes-Tr; ROD_31741.
DR   EnsemblGenomes-Tr; ROD_31761.
DR   EnsemblGenomes-Tr; ROD_31781.
DR   EnsemblGenomes-Tr; ROD_31801.
DR   EnsemblGenomes-Tr; ROD_31831.
DR   EnsemblGenomes-Tr; ROD_31851.
DR   EnsemblGenomes-Tr; ROD_31861.
DR   EnsemblGenomes-Tr; ROD_31951.
DR   EnsemblGenomes-Tr; ROD_31961.
DR   EnsemblGenomes-Tr; ROD_32771.
DR   EnsemblGenomes-Tr; ROD_33321.
DR   EnsemblGenomes-Tr; ROD_33391.
DR   EnsemblGenomes-Tr; ROD_33451.
DR   EnsemblGenomes-Tr; ROD_33471.
DR   EnsemblGenomes-Tr; ROD_33472.
DR   EnsemblGenomes-Tr; ROD_33491.
DR   EnsemblGenomes-Tr; ROD_33511.
DR   EnsemblGenomes-Tr; ROD_33591.
DR   EnsemblGenomes-Tr; ROD_33611.
DR   EnsemblGenomes-Tr; ROD_33621.
DR   EnsemblGenomes-Tr; ROD_33622.
DR   EnsemblGenomes-Tr; ROD_33651.
DR   EnsemblGenomes-Tr; ROD_33771.
DR   EnsemblGenomes-Tr; ROD_33841.
DR   EnsemblGenomes-Tr; ROD_34121.
DR   EnsemblGenomes-Tr; ROD_34312.
DR   EnsemblGenomes-Tr; ROD_34381.
DR   EnsemblGenomes-Tr; ROD_34911.
DR   EnsemblGenomes-Tr; ROD_35291.
DR   EnsemblGenomes-Tr; ROD_35341.
DR   EnsemblGenomes-Tr; ROD_35381.
DR   EnsemblGenomes-Tr; ROD_35471.
DR   EnsemblGenomes-Tr; ROD_35581.
DR   EnsemblGenomes-Tr; ROD_35741.
DR   EnsemblGenomes-Tr; ROD_36221.
DR   EnsemblGenomes-Tr; ROD_36261.
DR   EnsemblGenomes-Tr; ROD_36451.
DR   EnsemblGenomes-Tr; ROD_36581.
DR   EnsemblGenomes-Tr; ROD_37911.
DR   EnsemblGenomes-Tr; ROD_39811.
DR   EnsemblGenomes-Tr; ROD_40661.
DR   EnsemblGenomes-Tr; ROD_40741.
DR   EnsemblGenomes-Tr; ROD_40761.
DR   EnsemblGenomes-Tr; ROD_40772.
DR   EnsemblGenomes-Tr; ROD_40773.
DR   EnsemblGenomes-Tr; ROD_40781.
DR   EnsemblGenomes-Tr; ROD_40831.
DR   EnsemblGenomes-Tr; ROD_40861.
DR   EnsemblGenomes-Tr; ROD_40961.
DR   EnsemblGenomes-Tr; ROD_40991.
DR   EnsemblGenomes-Tr; ROD_41061.
DR   EnsemblGenomes-Tr; ROD_41081.
DR   EnsemblGenomes-Tr; ROD_41121.
DR   EnsemblGenomes-Tr; ROD_41571.
DR   EnsemblGenomes-Tr; ROD_41701.
DR   EnsemblGenomes-Tr; ROD_42151.
DR   EnsemblGenomes-Tr; ROD_42581.
DR   EnsemblGenomes-Tr; ROD_42871.
DR   EnsemblGenomes-Tr; ROD_42901.
DR   EnsemblGenomes-Tr; ROD_43031.
DR   EnsemblGenomes-Tr; ROD_43081.
DR   EnsemblGenomes-Tr; ROD_45781.
DR   EnsemblGenomes-Tr; ROD_46891.
DR   EnsemblGenomes-Tr; ROD_47391.
DR   EnsemblGenomes-Tr; ROD_47721.
DR   EnsemblGenomes-Tr; ROD_47791.
DR   EnsemblGenomes-Tr; ROD_47801.
DR   EnsemblGenomes-Tr; ROD_47821.
DR   EnsemblGenomes-Tr; ROD_47831.
DR   EnsemblGenomes-Tr; ROD_47841.
DR   EnsemblGenomes-Tr; ROD_47941.
DR   EnsemblGenomes-Tr; ROD_48171.
DR   EnsemblGenomes-Tr; ROD_48761.
DR   EnsemblGenomes-Tr; ROD_48791.
DR   EnsemblGenomes-Tr; ROD_48851.
DR   EnsemblGenomes-Tr; ROD_48921.
DR   EnsemblGenomes-Tr; ROD_48941.
DR   EnsemblGenomes-Tr; ROD_48951.
DR   EnsemblGenomes-Tr; ROD_49201.
DR   EnsemblGenomes-Tr; ROD_49321.
DR   EnsemblGenomes-Tr; ROD_49561.
DR   EnsemblGenomes-Tr; ROD_49611.
DR   EnsemblGenomes-Tr; ROD_49621.
DR   EnsemblGenomes-Tr; ROD_49851.
DR   EnsemblGenomes-Tr; ROD_50031.
DR   EnsemblGenomes-Tr; ROD_50161.
DR   EnsemblGenomes-Tr; ROD_50162.
DR   EnsemblGenomes-Tr; ROD_50181.
DR   EnsemblGenomes-Tr; ROD_50191.
DR   EnsemblGenomes-Tr; ROD_50631.
DR   EnsemblGenomes-Tr; ROD_50651.
DR   EnsemblGenomes-Tr; ROD_t01-1.
DR   EnsemblGenomes-Tr; ROD_t02-1.
DR   EnsemblGenomes-Tr; ROD_t03-1.
DR   EnsemblGenomes-Tr; ROD_t04-1.
DR   EnsemblGenomes-Tr; ROD_t05-1.
DR   EnsemblGenomes-Tr; ROD_t06-1.
DR   EnsemblGenomes-Tr; ROD_t07-1.
DR   EnsemblGenomes-Tr; ROD_t08-1.
DR   EnsemblGenomes-Tr; ROD_t09-1.
DR   EnsemblGenomes-Tr; ROD_t10-1.
DR   EnsemblGenomes-Tr; ROD_t11-1.
DR   EnsemblGenomes-Tr; ROD_t12-1.
DR   EnsemblGenomes-Tr; ROD_t13-1.
DR   EnsemblGenomes-Tr; ROD_t14-1.
DR   EnsemblGenomes-Tr; ROD_t15-1.
DR   EnsemblGenomes-Tr; ROD_t16-1.
DR   EnsemblGenomes-Tr; ROD_t17-1.
DR   EnsemblGenomes-Tr; ROD_t18-1.
DR   EnsemblGenomes-Tr; ROD_t19-1.
DR   EnsemblGenomes-Tr; ROD_t20-1.
DR   EnsemblGenomes-Tr; ROD_t21-1.
DR   EnsemblGenomes-Tr; ROD_t22-1.
DR   EnsemblGenomes-Tr; ROD_t23-1.
DR   EnsemblGenomes-Tr; ROD_t24-1.
DR   EnsemblGenomes-Tr; ROD_t25-1.
DR   EnsemblGenomes-Tr; ROD_t26-1.
DR   EnsemblGenomes-Tr; ROD_t27-1.
DR   EnsemblGenomes-Tr; ROD_t28-1.
DR   EnsemblGenomes-Tr; ROD_t29-1.
DR   EnsemblGenomes-Tr; ROD_t30-1.
DR   EnsemblGenomes-Tr; ROD_t31-1.
DR   EnsemblGenomes-Tr; ROD_t32-1.
DR   EnsemblGenomes-Tr; ROD_t33-1.
DR   EnsemblGenomes-Tr; ROD_t34-1.
DR   EnsemblGenomes-Tr; ROD_t35-1.
DR   EnsemblGenomes-Tr; ROD_t36-1.
DR   EnsemblGenomes-Tr; ROD_t37-1.
DR   EnsemblGenomes-Tr; ROD_t38-1.
DR   EnsemblGenomes-Tr; ROD_t39-1.
DR   EnsemblGenomes-Tr; ROD_t40-1.
DR   EnsemblGenomes-Tr; ROD_t41-1.
DR   EnsemblGenomes-Tr; ROD_t42-1.
DR   EnsemblGenomes-Tr; ROD_t43-1.
DR   EnsemblGenomes-Tr; ROD_t44-1.
DR   EnsemblGenomes-Tr; ROD_t45-1.
DR   EnsemblGenomes-Tr; ROD_t46-1.
DR   EnsemblGenomes-Tr; ROD_t47-1.
DR   EnsemblGenomes-Tr; ROD_t48-1.
DR   EnsemblGenomes-Tr; ROD_t49-1.
DR   EnsemblGenomes-Tr; ROD_t50-1.
DR   EnsemblGenomes-Tr; ROD_t51-1.
DR   EnsemblGenomes-Tr; ROD_t52-1.
DR   EnsemblGenomes-Tr; ROD_t53-1.
DR   EnsemblGenomes-Tr; ROD_t54-1.
DR   EnsemblGenomes-Tr; ROD_t55-1.
DR   EnsemblGenomes-Tr; ROD_t56-1.
DR   EnsemblGenomes-Tr; ROD_t57-1.
DR   EnsemblGenomes-Tr; ROD_t58-1.
DR   EnsemblGenomes-Tr; ROD_t59-1.
DR   EnsemblGenomes-Tr; ROD_t60-1.
DR   EnsemblGenomes-Tr; ROD_t61-1.
DR   EnsemblGenomes-Tr; ROD_t62-1.
DR   EnsemblGenomes-Tr; ROD_t63-1.
DR   EnsemblGenomes-Tr; ROD_t64-1.
DR   EnsemblGenomes-Tr; ROD_t65-1.
DR   EnsemblGenomes-Tr; ROD_t66-1.
DR   EnsemblGenomes-Tr; ROD_t67-1.
DR   EnsemblGenomes-Tr; ROD_t68-1.
DR   EnsemblGenomes-Tr; ROD_t69-1.
DR   EnsemblGenomes-Tr; ROD_t70-1.
DR   EnsemblGenomes-Tr; ROD_t71-1.
DR   EnsemblGenomes-Tr; ROD_t72-1.
DR   EnsemblGenomes-Tr; ROD_t73-1.
DR   EnsemblGenomes-Tr; ROD_t74-1.
DR   EnsemblGenomes-Tr; ROD_t75-1.
DR   EnsemblGenomes-Tr; ROD_t76-1.
DR   EnsemblGenomes-Tr; ROD_t77-1.
DR   EnsemblGenomes-Tr; ROD_t78-1.
DR   EnsemblGenomes-Tr; ROD_t79-1.
DR   EnsemblGenomes-Tr; ROD_t80-1.
DR   EnsemblGenomes-Tr; ROD_t81-1.
DR   EnsemblGenomes-Tr; ROD_t82-1.
DR   EnsemblGenomes-Tr; ROD_t83-1.
DR   EnsemblGenomes-Tr; ROD_t84-1.
DR   EnsemblGenomes-Tr; ROD_t85-1.
DR   EnsemblGenomes-Tr; ROD_t86-1.
DR   EuropePMC; PMC2805327; 19897651.
DR   EuropePMC; PMC3072379; 21490962.
DR   EuropePMC; PMC3294861; 22247511.
DR   EuropePMC; PMC3865928; 24358033.
DR   EuropePMC; PMC3993218; 24590485.
DR   EuropePMC; PMC4363417; 25624355.
DR   EuropePMC; PMC4562240; 26355540.
DR   EuropePMC; PMC4924136; 27366640.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00014; DsrA.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00035; OxyS.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00077; SraB.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00084; CsrC.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00113; QUAD.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00118; rydB.
DR   RFAM; RF00121; MicC.
DR   RFAM; RF00124; IS102.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00369; sroC.
DR   RFAM; RF00370; sroD.
DR   RFAM; RF00371; sroE.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00534; SgrS.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01056; Mg_sensor.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01385; isrA.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01397; isrO.
DR   RFAM; RF01400; istR.
DR   RFAM; RF01401; rseX.
DR   RFAM; RF01405; STnc490k.
DR   RFAM; RF01407; STnc560.
DR   RFAM; RF01408; sraL.
DR   RFAM; RF01409; STnc250.
DR   RFAM; RF01517; iscRS.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01728; STAXI.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01771; rnk_leader.
DR   RFAM; RF01794; sok.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01813; rdlD.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01832; ROSE_2.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01988; SECIS_2.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02051; STnc450.
DR   RFAM; RF02052; STnc630.
DR   RFAM; RF02053; STnc430.
DR   RFAM; RF02060; STnc410.
DR   RFAM; RF02064; STnc370.
DR   RFAM; RF02069; STnc70.
DR   RFAM; RF02074; STnc240.
DR   RFAM; RF02075; STnc230.
DR   RFAM; RF02076; STnc100.
DR   RFAM; RF02079; STnc180.
DR   RFAM; RF02081; STnc550.
DR   RFAM; RF02082; STnc540.
DR   RFAM; RF02084; STnc130.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; FN543502.
DR   SILVA-SSU; FN543502.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5346659
FT                   /organism="Citrobacter rodentium ICC168"
FT                   /strain="ICC168"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:637910"
FT   misc_RNA        160..287
FT                   /note="Rfam:RF00506;Thr_leader;Score=126.03;positions 1 to
FT                   60"
FT   CDS_pept        166..231
FT                   /transl_table=11
FT                   /gene="thrL"
FT                   /locus_tag="ROD__00001"
FT                   /product="Thr operon leader peptide (Thr operon
FT                   attenuator)"
FT                   /db_xref="EnsemblGenomes-Gn:ROD__00001"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86780"
FT                   /db_xref="GOA:D2TGH6"
FT                   /db_xref="InterPro:IPR011720"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGH6"
FT                   /protein_id="CBG86780.1"
FT                   /translation="MKRISTTIITTTTITTGNGAG"
FT   misc_feature    166..228
FT                   /locus_tag="ROD_00001"
FT                   /note="HMMPfam hit to PF08254, Thr operon leader
FT                   peptide,score 7.6e-07"
FT                   /inference="protein motif:PFAM:PF08254"
FT   CDS_pept        313..2775
FT                   /transl_table=11
FT                   /gene="thrA"
FT                   /locus_tag="ROD_00011"
FT                   /product="bifunctional aspartokinase I/homoserine
FT                   dehydrogenase I"
FT                   /EC_number="2.7.2.4"
FT                   /EC_number="1.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00011"
FT                   /db_xref="EnsemblGenomes-Tr:CBA35022"
FT                   /db_xref="GOA:D2TGQ2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGQ2"
FT                   /protein_id="CBA35022.1"
FT                   /translation="MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITN
FT                   HLVAMIEKTIGGQDALPNISDAERIFAELLTGLAQVQTGFPLAQLKAFVEQEFAQIKHV
FT                   LHGISLLGQCPDSINAALICRGEKMSIAIMAGLLEARGHHVTVIDPVEKLLAVGHYLES
FT                   TVDIAESTRRIAAARIPADHMVLMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADC
FT                   CEIWTDVDGVYTCDPRQVPDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCL
FT                   IKNTGNPQAPGTLIGASRDEDDLPVKGISNLNNMAMFNVSGPGMKGMIGMAARVFAVMS
FT                   RSGISVVLITQSSSEYSISFCVPQADCARAQRALQDEFYLELKEGLLEPLAVTERLAII
FT                   SVVGDGMRTLRGISAKFFAALARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQM
FT                   LFNTDQVIEVFVIGVGGVGGALLEQLKRQQTWLKSKHIDLRVCGVANSRALLTNVHGLN
FT                   LENWQAALAEAKEPFNLGRLIRLVKEYHLLNPVIVDCTSSQAVADQYADFLREGFHVVT
FT                   PNKKANTSSMDYYHQLRFAAAKSRRKFLYDTNVGAGLPVIENLQNLLNAGDELQKFSGI
FT                   LSGSLSFIFGKLDEGMSLSEATKVAREMGYTEPDPRDDLSGMDVARKLLILARETGREL
FT                   ELSDIVIEPVLPETFDNSGDVAAFMAKLPQLDDAFAARVAKARDEGKVLRYVGNIEEDG
FT                   VCRVKIAEVDGNDPLYKVKNGENALAFYSHYYQPLPLVLRGYGAGNDVTAAGVFADLLR
FT                   TLSWKLGV"
FT   misc_feature    313..1164
FT                   /gene="thrA"
FT                   /locus_tag="ROD_00011"
FT                   /note="HMMPfam hit to PF00696,Aspartate/glutamate/uridylate
FT                   kinase, score 1.3e-64"
FT                   /inference="protein motif:PFAM:PF00696"
FT   misc_feature    319..345
FT                   /note="PS00324 Aspartokinase signature."
FT                   /inference="protein motif:Prosite:PS00324"
FT   misc_feature    1282..1449
FT                   /gene="thrA"
FT                   /locus_tag="ROD_00011"
FT                   /note="HMMPfam hit to PF01842, Amino acid-binding ACT,score
FT                   1.6e-05"
FT                   /inference="protein motif:PFAM:PF01842"
FT   misc_feature    1510..1692
FT                   /gene="thrA"
FT                   /locus_tag="ROD_00011"
FT                   /note="HMMPfam hit to PF01842, Amino acid-binding ACT,score
FT                   3.8e-07"
FT                   /inference="protein motif:PFAM:PF01842"
FT   misc_feature    1726..2130
FT                   /gene="thrA"
FT                   /locus_tag="ROD_00011"
FT                   /note="HMMPfam hit to PF03447, Aspartate/homoserine
FT                   dehydrogenase, NAD-binding, score 1.1e-48"
FT                   /inference="protein motif:PFAM:PF03447"
FT   misc_feature    2152..2745
FT                   /gene="thrA"
FT                   /locus_tag="ROD_00011"
FT                   /note="HMMPfam hit to PF00742, Homoserine
FT                   dehydrogenase,catalytic, score 5.3e-104"
FT                   /inference="protein motif:PFAM:PF00742"
FT   misc_feature    2290..2358
FT                   /note="PS01042 Homoserine dehydrogenase signature."
FT                   /inference="protein motif:Prosite:PS01042"
FT   CDS_pept        2778..3707
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="ROD_00021"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00021"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86781"
FT                   /db_xref="GOA:D2TGH7"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGH7"
FT                   /protein_id="CBG86781.1"
FT                   /translation="MVKVYAPASSANMSVGFDVLGAAVTPVDGSLLGDVVSVEAADAFS
FT                   LTNQGRFADKLPPEPRENIVYQCWERFCQELGKSIPVAMSLEKNMPIGSGLGSSACSVV
FT                   AALVAMNEHCGKPLNDTRLLALMGELEGRISGSIHYDNVAPCFLGGMQLMIEENGIISQ
FT                   QVPGFDEWLWVLAYPGIKVSTAEARAILPAQYRRQDCIAHGRHLAGFIHACYSRQPQLA
FT                   AKLMKDVIAEPHRERLLPGFSQARQAVAEIGALASGISGSGPTLFALCDKPDTAQRVAD
FT                   WLGKNYLQNQEGFVHICRLDTAGARVLG"
FT   misc_feature    3024..3227
FT                   /gene="thrB"
FT                   /locus_tag="ROD_00021"
FT                   /note="HMMPfam hit to PF00288, GHMP kinase, score 3.1e-20"
FT                   /inference="protein motif:PFAM:PF00288"
FT   misc_feature    3045..3080
FT                   /note="PS00627 GHMP kinases putative ATP-binding domain."
FT                   /inference="protein motif:Prosite:PS00627"
FT   misc_feature    3048..3080
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    3450..3644
FT                   /gene="thrB"
FT                   /locus_tag="ROD_00021"
FT                   /note="HMMPfam hit to PF08544, GHMP kinase,
FT                   C-terminal,score 3.6e-09"
FT                   /inference="protein motif:PFAM:PF08544"
FT   CDS_pept        3711..4997
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="ROD_00031"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00031"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86782"
FT                   /db_xref="GOA:D2TGI0"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGI0"
FT                   /protein_id="CBG86782.1"
FT                   /translation="MKLYNLKDHNEQVNFAQAITQGLGKNQGLFFPHDLPEFSLTEVDE
FT                   MLSQDFVSRSAKILSAFIGDEIPQQILEERVRAAFAFPAPVAQVESDVGCLELFHGPTL
FT                   AFKDFGGRFMAQMLTQISGDRPVTILTATSGDTGAAVAHAFYGLPNVRVVILYPRGKIS
FT                   PLQEKLFCTLGGNIETVAIDGDFDACQALVKQAFDDHELKDALGLNSANSINISRLLAQ
FT                   ICYYFEAVAQLPQEARNQLVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPR
FT                   YLQEGKWTPKATQATLSNAMDVSQPNNWPRVEELFRRKIWRLNELGYAAVDDATTQETM
FT                   RELQAKGYLSEPHAAVAYRALRDQLNPGEYGLFLGTAHPAKFKESVEAILGETLELPKA
FT                   LAERADLPLLSHELPADFAALRKLMMSRR"
FT   misc_feature    3939..4844
FT                   /gene="thrC"
FT                   /locus_tag="ROD_00031"
FT                   /note="HMMPfam hit to PF00291, Pyridoxal
FT                   phosphate-dependent enzyme, beta subunit, score 1.7e-34"
FT                   /inference="protein motif:PFAM:PF00291"
FT   misc_feature    3999..4043
FT                   /note="PS00165 Serine/threonine dehydratases
FT                   pyridoxal-phosphate attachment site."
FT                   /inference="protein motif:Prosite:PS00165"
FT   CDS_pept        complement(5147..5920)
FT                   /transl_table=11
FT                   /locus_tag="ROD_00041"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00041"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86783"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGI1"
FT                   /protein_id="CBG86783.1"
FT                   /translation="MLILISPAKTLDYQSPLATTRYTLPELLDHSRQLIDVAKKLSAPQ
FT                   IGKLMGISDKLADLNATRFHDWQPDFTPDNARQAILAFKGDVYTGLQAETFSEADFDFA
FT                   QQHLRMLSGLYGVLRPLDLMQPYRLEMGIRLENAKGKDLYQFWGDVITDKLNEALAAQG
FT                   DQVVINLASDEYFKSVKPQKLNAELIKPVFLDEKNGTFKVISFYAKKARGLMSRYIIEN
FT                   RLTKPEQLMDFSSEGYFFDEAASGHSELVFKRHEQ"
FT   misc_feature    complement(5153..5920)
FT                   /locus_tag="ROD_00041"
FT                   /note="HMMPfam hit to PF03883, Protein of unknown function
FT                   DUF328, score 1.5e-171"
FT                   /inference="protein motif:PFAM:PF03883"
FT   misc_feature    complement(5636..5683)
FT                   /note="PS00225 Crystallins beta and gamma 'Greek key' motif
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00225"
FT   CDS_pept        complement(5990..7420)
FT                   /transl_table=11
FT                   /locus_tag="ROD_00051"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00051"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86784"
FT                   /db_xref="GOA:D2TGI2"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGI2"
FT                   /protein_id="CBG86784.1"
FT                   /translation="MADFFSFINDVLWGSVMIYLLFGAGCWFTFRTGGVQFRYIRQFGK
FT                   SLKNSVAPQAGGLTSFQALSITLAARIGSGNVAGVALAITAGGPGAVFWMWLAALIGMA
FT                   TSFAECSLAQLYKERDRHGQFRGGPAWYMSRGLGMRWMGVLFAIFLLLAYGLIFTSVQA
FT                   NSVSRALHFAFDFPPLATGIMMALGALLVIMGGIKSVARIMQWFVPVMALVWAIASLSI
FT                   CALHITQIPEVIISIVKCAFGWQEAAGGAAGYTLSQALTSGFQRSMFSNEAGMGSSPNA
FT                   AAAAASWPPHPAAQGIVQMIGIFIDTLVVCSATAMLILLAGNDVAYGPMAGIQLIQKAM
FT                   HTLVGDWGAAFVAVVMILFAFSSIVANYIYAENNLFFLRLDNVRTVWILRIATCVTVIA
FT                   GTLLSFPMLWQLADMIMACMAITNLTAILLLSPVVHTIASDYLRQRKLGVRPVFDPLRY
FT                   PEIEQQLAPDAWDNIPRH"
FT   misc_feature    complement(6047..7303)
FT                   /locus_tag="ROD_00051"
FT                   /note="HMMPfam hit to PF01235, Sodium:alanine
FT                   symporter,score 5.7e-248"
FT                   /inference="protein motif:PFAM:PF01235"
FT   misc_feature    complement(join(6110..6178,6206..6265,6326..6394,
FT                   6452..6520,6746..6814,6842..6910,6947..7015,7127..7195,
FT                   7316..7384))
FT                   /locus_tag="ROD_00051"
FT                   /note="9 probable transmembrane helices predicted for
FT                   ROD00051 by TMHMM2.0 at aa 13-35, 76-98, 136-158,
FT                   171-193,203-225, 301-323, 343-365, 386-405 and 415-437"
FT   misc_feature    complement(7115..7162)
FT                   /note="PS00873 Sodium:alanine symporter family signature."
FT                   /inference="protein motif:Prosite:PS00873"
FT   misc_feature    complement(7343..7375)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        7691..8644
FT                   /transl_table=11
FT                   /gene="talB"
FT                   /locus_tag="ROD_00061"
FT                   /product="transaldolase B"
FT                   /EC_number="2.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00061"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86785"
FT                   /db_xref="GOA:D2TGI4"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGI4"
FT                   /protein_id="CBG86785.1"
FT                   /translation="MTDKLTSLRQFTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQI
FT                   PEYRKLIDDAVAWAKQQSSDRAQQIVDATDKLAVNIGLEILKLVPGRISTEVDARLSYD
FT                   TEASIAKAKRIIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFSFAQ
FT                   ARACAEAGVYLISPFVGRILDWYKANTDKKEYAASEDPGVVSVTEIYEYYKQHGYETVV
FT                   MGASFRNVGEILELAGCDRLTIAPALLKELAESEGAVERKLSFSGEVKARPERITESEF
FT                   LWQHNQDPMAVDKLADGIRKFAVDQEKLEKMIGDLL"
FT   misc_feature    7727..8629
FT                   /gene="talB"
FT                   /locus_tag="ROD_00061"
FT                   /note="HMMPfam hit to PF00923, Transaldolase, score
FT                   3.2e-188"
FT                   /inference="protein motif:PFAM:PF00923"
FT   misc_feature    7781..7807
FT                   /note="PS01054 Transaldolase signature 1."
FT                   /inference="protein motif:Prosite:PS01054"
FT   misc_feature    8075..8128
FT                   /note="PS00958 Transaldolase active site."
FT                   /inference="protein motif:Prosite:PS00958"
FT   CDS_pept        8758..9345
FT                   /transl_table=11
FT                   /gene="mog"
FT                   /locus_tag="ROD_00071"
FT                   /product="molybdopterin biosynthesis Mog protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00071"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86786"
FT                   /db_xref="GOA:D2TGI7"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGI7"
FT                   /protein_id="CBG86786.1"
FT                   /translation="MNTLRIGLVSISDRASSGVYQDKGIPALEEWLASALTTPFEVQTR
FT                   LIPDEQAIIEQTLCELVDEMSCHLVLTTGGTGPARRDVTPDATLAIADREMPGFGEQMR
FT                   QISLHFVPTAILSRQVGVIRKQALILNLPGQPKSIKETLEGVKDADGNVVVAGIFASVP
FT                   YCIQLLDGPYVETAPAVVASFRPKSARRDINA"
FT   misc_feature    8776..9213
FT                   /gene="mog"
FT                   /locus_tag="ROD_00071"
FT                   /note="HMMPfam hit to PF00994, Molybdopterin binding, score
FT                   3.1e-30"
FT                   /inference="protein motif:PFAM:PF00994"
FT   misc_feature    8962..9003
FT                   /note="PS01078 Molybdenum cofactor biosynthesis proteins
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS01078"
FT   CDS_pept        9467..10774
FT                   /transl_table=11
FT                   /locus_tag="ROD_00081"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00081"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86787"
FT                   /db_xref="GOA:D2TGI8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGI8"
FT                   /protein_id="CBG86787.1"
FT                   /translation="MSLHPRPLNRQDYKTLTLAALGGALEFYDFIIFVFFAAVVSELFF
FT                   PADIPEWLRQLQTFGIFAAGYLARPLGGIIMAHFGDLVGRKKMFTLSILLMAAPTLAIG
FT                   LLPTYASMGIVAPLLLLLMRILQGAAIGGEVPGAWVFVAEHVPEQRIGIACGTLTAGLT
FT                   IGILLGSVVATQVNTHLSAQAVHDYGWRIPFLLGGVFGLVAMYLRRWLQETPVFLEMQQ
FT                   RKALARELPVKSVVVRHQKAVAISMLLTWLLSAGIVVVILMSPVWLQKQYGLAPALTLQ
FT                   ANSVATIMLCVGCLLAGFIVDRVGASKTFIVGSILLACSSWAFWHLAGVHPQYLFLLYG
FT                   LVGLCVGVVGAVPYVLVRAFPAEVRFTGISFSYNVSYAIFGGLTPIAVTLLMNVSPMAP
FT                   AWYVLALSLVGAGLGVWLRQDLYHRDSQMSAELQGQ"
FT   misc_feature    join(9527..9595,9638..9706,9743..9811,9824..9892,
FT                   9917..9985,10028..10087,10190..10258,10301..10369,
FT                   10388..10456,10469..10537,10574..10642,10655..10717)
FT                   /locus_tag="ROD_00081"
FT                   /note="12 probable transmembrane helices predicted for
FT                   ROD00081 by TMHMM2.0 at aa 21-43, 58-80, 93-115,
FT                   120-142,151-173, 188-207, 242-264, 279-301, 308-330,
FT                   335-357,370-392 and 397-417"
FT   misc_feature    9557..10645
FT                   /locus_tag="ROD_00081"
FT                   /note="HMMPfam hit to PF07690, Major facilitator
FT                   superfamily MFS-1, score 1.7e-26"
FT                   /inference="protein motif:PFAM:PF07690"
FT   misc_feature    10391..10423
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(10809..11375)
FT                   /transl_table=11
FT                   /locus_tag="ROD_00091"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00091"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86788"
FT                   /db_xref="GOA:D2TGI9"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGI9"
FT                   /protein_id="CBG86788.1"
FT                   /translation="MGNTKLANPAPLGLMGFGMTTILLNLHNAGFFAFDGIILAMGIFY
FT                   GGIAQIFAGLLEYKKGNTFGLTAFTSYGSFWLTLVAILLMPKMGLTDAPNAQFLGVYLG
FT                   LWGVFTLFMFFGTLKGARALQFVFLSLTVLFALLAVGNIAGNEAVIHVAGWIGLICGAS
FT                   AIYLAMGEVLNEQFGRTVLPIGEAH"
FT   misc_feature    complement(10812..11375)
FT                   /locus_tag="ROD_00091"
FT                   /note="HMMPfam hit to PF01184, GPR1/FUN34/yaaH, score
FT                   5e-122"
FT                   /inference="protein motif:PFAM:PF01184"
FT   misc_feature    complement(join(10866..10934,10944..11003,11022..11090,
FT                   11118..11186,11205..11264,11274..11342))
FT                   /locus_tag="ROD_00091"
FT                   /note="6 probable transmembrane helices predicted for
FT                   ROD00091 by TMHMM2.0 at aa 12-34, 38-57, 64-86,
FT                   96-118,125-144 and 148-170"
FT   misc_feature    complement(11325..11354)
FT                   /note="PS01114 GPR1/FUN34/yaaH family signature."
FT                   /inference="protein motif:Prosite:PS01114"
FT   CDS_pept        11731..13647
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="ROD_00101"
FT                   /product="chaperone protein DnaK (heat shock protein 70)"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00101"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86789"
FT                   /db_xref="GOA:D2TGJ0"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGJ0"
FT                   /protein_id="CBG86789.1"
FT                   /translation="MGKIIGIDLGTTNSCVAIMDGTQARVLENAEGDRTTPSIIAYTQD
FT                   GETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPYKIIGADNGDAWLD
FT                   VKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGL
FT                   EVKRIINEPTAAALAYGLDKEVGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATN
FT                   GDTHLGGEDFDSRMINYLVEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDV
FT                   NLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDINDVILV
FT                   GGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSL
FT                   GIETMGGVMTALISKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRASDNKSLGQFN
FT                   LDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEEEIQKMVR
FT                   EAEANAESDRKFEELVQTRNQGDHLLHSTRKQVEEAGDQLPADDKTAIESALSALETAL
FT                   KGEDKAAIEAKMQELAQVSQKLMEIAQQQHAQQQAGSADASANNAKDDDVVDAEFEEVK
FT                   DKK"
FT   misc_feature    11740..13542
FT                   /gene="dnaK"
FT                   /locus_tag="ROD_00101"
FT                   /note="HMMPfam hit to PF00012, Heat shock protein 70, score
FT                   0"
FT                   /inference="protein motif:PFAM:PF00012"
FT   misc_feature    11749..11772
FT                   /note="PS00297 Heat shock hsp70 proteins family signature
FT                   1."
FT                   /inference="protein motif:Prosite:PS00297"
FT   misc_feature    12304..12345
FT                   /note="PS00329 Heat shock hsp70 proteins family signature
FT                   2."
FT                   /inference="protein motif:Prosite:PS00329"
FT   misc_feature    12739..12783
FT                   /note="PS01036 Heat shock hsp70 proteins family signature
FT                   3."
FT                   /inference="protein motif:Prosite:PS01036"
FT   CDS_pept        13734..14864
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="ROD_00111"
FT                   /product="chaperone protein DnaJ (heat shock protein J)"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00111"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86790"
FT                   /db_xref="GOA:D2TGJ1"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGJ1"
FT                   /protein_id="CBG86790.1"
FT                   /translation="MAKKDYYEILGVSRSAEEREIKKAYKRLAMKYHPDRNQGDKEAEG
FT                   KFKEIKEAYEVLTDSQKRAAYDQYGHAAFEQGGMGGGGFGGGADFSDIFGDVFGDIFGG
FT                   GRGRQRAARGADLRYNMDLTLEEAVRGVTKEIRIPTLEECDVCHGSGAKAGTQPQTCPT
FT                   CHGSGQVQMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVEKSKTLSVKIPAGVDT
FT                   GDRIRLSGEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIE
FT                   VPTLDGRVKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQL
FT                   LQDLQESFGGPTGEKNSPRSKNFFEGVKKFFDDLTR"
FT   misc_feature    13746..13934
FT                   /gene="dnaJ"
FT                   /locus_tag="ROD_00111"
FT                   /note="HMMPfam hit to PF00226, Heat shock protein
FT                   DnaJ,N-terminal, score 2.3e-40"
FT                   /inference="protein motif:PFAM:PF00226"
FT   misc_feature    13872..13931
FT                   /note="PS00636 Nt-dnaJ domain signature."
FT                   /inference="protein motif:Prosite:PS00636"
FT   misc_feature    14124..14366
FT                   /gene="dnaJ"
FT                   /locus_tag="ROD_00111"
FT                   /note="HMMPfam hit to PF00684, DnaJ central region, score
FT                   4e-50"
FT                   /inference="protein motif:PFAM:PF00684"
FT   misc_feature    14163..14237
FT                   /note="PS00637 CXXCXGXG dnaJ domain signature."
FT                   /inference="protein motif:Prosite:PS00637"
FT   misc_feature    14163..14180
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   misc_feature    14322..14339
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   misc_feature    14403..14768
FT                   /gene="dnaJ"
FT                   /locus_tag="ROD_00111"
FT                   /note="HMMPfam hit to PF01556, Chaperone DnaJ,
FT                   C-terminal,score 2.4e-75"
FT                   /inference="protein motif:PFAM:PF01556"
FT   CDS_pept        15180..16112
FT                   /transl_table=11
FT                   /locus_tag="ROD_00121"
FT                   /product="putative LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00121"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86791"
FT                   /db_xref="GOA:D2TGJ2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGJ2"
FT                   /protein_id="CBG86791.1"
FT                   /translation="MKKEFDYNLIKVLDAVISAGNVTKASKRLAVTPAAVSIALTRLQG
FT                   FYNEALFVRGRSGLIPTMKALEIHERFCQAIDLIKLTLTPQKQSAERNKITILGGDITE
FT                   NYYLSQLYDDKLFERFTFRHFSNRNRDGEEMKRLLIMEECDIAISPTLVNDNDFECKPI
FT                   DNFKHFCVICGKDNLLSELSQLSLHNFFSAHHAVFKANDYTAVTIKDNNLYNNNADYKE
FT                   RRIVGYKSDSLTGLISIVERTQLVALMPLKVATFFKNQRKYNINILQPPREMLIKPINV
FT                   YAYWHKRNTKYPHIEEIVTMLHTLSAFRH"
FT   misc_feature    15198..15377
FT                   /locus_tag="ROD_00121"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   protein, LysR, score 1.2e-11"
FT                   /inference="protein motif:PFAM:PF00126"
FT   misc_feature    15237..15302
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1048.000, SD 2.76 at aa 20-41, sequence
FT                   GNVTKASKRLAVTPAAVSIALT"
FT   CDS_pept        16228..16578
FT                   /transl_table=11
FT                   /locus_tag="ROD_00122"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00122"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86792"
FT                   /db_xref="GOA:D2TGJ3"
FT                   /db_xref="InterPro:IPR032126"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGJ3"
FT                   /protein_id="CBG86792.1"
FT                   /translation="MLLPGQLETPKAILLEIEIVAIVIATGAWGGIVSYLLKSEKFKAS
FT                   DFHKRLMGCITQVIISCFTSFLLSVVAVEKGYSFNMILLFAGIGGVFAVPILKILGARV
FT                   KRMMNGNDELVK"
FT   CDS_pept        complement(16662..17195)
FT                   /transl_table=11
FT                   /locus_tag="ROD_00131"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00131"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86793"
FT                   /db_xref="InterPro:IPR008565"
FT                   /db_xref="InterPro:IPR018537"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGJ4"
FT                   /protein_id="CBG86793.1"
FT                   /translation="MNPVIDGILALEGGYTNNPHDRGGETHWGITEATARANGYNGEMK
FT                   ALTRDEAYAILENAYWIKPGFENVSHLSWPISFELCDAAVNIGPRFPCIWLQRWLNVFN
FT                   KEQKLYHDIKVDGRIGAMTLQALESFLQARGAEGEKVLLKALNCSQGAYYLNITEERVQ
FT                   NEQFVYGWLNNRVA"
FT   misc_feature    complement(16668..17189)
FT                   /locus_tag="ROD_00131"
FT                   /note="HMMPfam hit to PF05838, Protein of unknown function
FT                   DUF847, score 1.6e-88"
FT                   /inference="protein motif:PFAM:PF05838"
FT   CDS_pept        complement(17229..17642)
FT                   /transl_table=11
FT                   /locus_tag="ROD_00141"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00141"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86794"
FT                   /db_xref="GOA:D2TGJ5"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGJ5"
FT                   /protein_id="CBG86794.1"
FT                   /translation="MKTYIINRDCIFNERKYELRNITNSLVIRMTAMRARCLSFIIEHA
FT                   QDEVIERQELTTALWGSRGNFVNDANLTQILYLIRKDLKSFGINDLLITIPRKGIQVND
FT                   SIPIESTDNDMPRPPAPSLFRQIKQSITSLFQR"
FT   CDS_pept        18027..20102
FT                   /transl_table=11
FT                   /locus_tag="ROD_00151"
FT                   /product="putative polysaccharide degrading enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00151"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86795"
FT                   /db_xref="GOA:D2TGJ6"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGJ6"
FT                   /protein_id="CBG86795.1"
FT                   /translation="MATSKLIKGDTLTETSNAADGFNPATEVSKYSYTSARVANPVYNV
FT                   YKADAKKPKVFGYYTDWSQYDSRLQGGDNPADRGRGYDLANVDPLAYDKIIFGFLGIVG
FT                   DKGEKQATIERAAAQTGKTTNEPTFLDPWGDFQSYVNCNQETSGWDVEPMTVTQQNTHG
FT                   LLGGLRDLQQKAKQLGHTLALSMSIGGWTMSNGFHEMAKTEAARKTFAAGVVKLFKQFP
FT                   MFSEVDIDWEYPNAVGNNNPYGPEDGANYALVIKELKKQLDAAGRSDVKISIASSAVIE
FT                   TLGHSNVKALLDAGLYGINVMTYDFFGTPWAETLTHHTNLSPLSAGGWSIEAVIDYLIA
FT                   EGFPADRINIGYAGYTRNARNVEIESFSPLKGTYNPGEGTTTGSFESGCTEWYDTIYNY
FT                   LDLENQKGRNGFNVYTDKVANADYLYNPQSRLFMSLDTPRSVKAKGEYAAKLGLGGLFT
FT                   WTIDQDNGVLVNAAREGLGYEISKEVVDMDPFYFEGINIEPADQDEDEGEKVNHAPKAA
FT                   IALRVVGGSRVQLSGEESSDEDKDALTFSWGVPTAIDVADKTTAVIEFAVPVVEAATDF
FT                   QFTLFVRDAQGEPSTQQRFVLTVVPAGTVEPTPADDKEDDVTPTPVPSDDTDELPDDSA
FT                   SSYPQWDADTIYGANWGEFEIVSWKGHNYQVNWWCQGLQPDLNCGPAQAWTDLGAY"
FT   misc_feature    18183..19418
FT                   /locus_tag="ROD_00151"
FT                   /note="HMMPfam hit to PF00704, Glycoside hydrolase, family
FT                   18, catalytic domain, score 1.1e-76"
FT                   /inference="protein motif:PFAM:PF00704"
FT   misc_feature    18372..18395
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    19938..20081
FT                   /locus_tag="ROD_00151"
FT                   /note="HMMPfam hit to PF02839, Carbohydrate-binding family
FT                   V/XII, score 1.8e-06"
FT                   /inference="protein motif:PFAM:PF02839"
FT   CDS_pept        20703..21869
FT                   /transl_table=11
FT                   /gene="nhaA"
FT                   /locus_tag="ROD_00161"
FT                   /product="Na(+)/H(+) antiporter 1"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00161"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86796"
FT                   /db_xref="GOA:D2TGJ7"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGJ7"
FT                   /protein_id="CBG86796.1"
FT                   /translation="MKHLHRFFSSDASGGIILIIAAALAMLMANVGLTSGWYHAFLDTP
FT                   VQLKVGALEINKNMLLWINDALMAIFFLLIGLEVKRELMQGSLASLRQAAFPVIAAIGG
FT                   MIVPAVLYLAFNYADPITREGWAIPAATDIAFALGVLALLGSRVPLALKIFLMALAIID
FT                   DLGAIVIIALFYTSDLSMVSLGVAACAIAVLALLNVCGVRRTGVYILVGAVLWTAVLKS
FT                   GVHATLAGVIVGFFIPLREKHGRSPAKRLEHVLHPWVAYLILPLFAFANAGVSLQGVTI
FT                   DGLTSILPLGIIAGLLIGKPLGISLFCWLALRLKMAQLPAGTTFPQIMAVGILCGIGFT
FT                   MSIFIASLAFGGVDAELINWAKLGILIGSLLSAVIGYSWLRARLSPAV"
FT   sig_peptide     20703..20789
FT                   /gene="nhaA"
FT                   /locus_tag="ROD_00161"
FT                   /note="Signal peptide predicted for ROD00161 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.975) with cleavage site
FT                   probability 0.565 between residues 29 and 30"
FT   misc_feature    20712..21842
FT                   /gene="nhaA"
FT                   /locus_tag="ROD_00161"
FT                   /note="HMMPfam hit to PF06965, Na+/H+ antiporter NhaA,score
FT                   2.2e-253"
FT                   /inference="protein motif:PFAM:PF06965"
FT   misc_feature    join(20736..20804,20877..20930,20988..21047,21075..21143,
FT                   21162..21230,21240..21308,21345..21413,21471..21539,
FT                   21573..21641,21684..21752,21771..21839)
FT                   /gene="nhaA"
FT                   /locus_tag="ROD_00161"
FT                   /note="11 probable transmembrane helices predicted for
FT                   ROD00161 by TMHMM2.0 at aa 12-34, 59-76, 96-115,
FT                   125-147,154-176, 180-202, 215-237, 257-279, 291-313,
FT                   328-350 and 357-379"
FT   misc_feature    21216..21308
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    21237..21269
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        21929..22825
FT                   /transl_table=11
FT                   /gene="nhaR"
FT                   /locus_tag="ROD_00171"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00171"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86797"
FT                   /db_xref="GOA:D2TGH8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGH8"
FT                   /protein_id="CBG86797.1"
FT                   /translation="MSHINYNHLYYFWNVYKEGSVVGAAEALYLTPQTITGQIKALEER
FT                   LQGKLFKRKGRGLEPSELGELVFRYADKMFTLSQEMLDIVNYRKESNLLFDVGVADALS
FT                   KRLVSSVLDAAVVEDEQIHLRCFESTHEMLLEQLSQHKLDMIISDCPIDSTQQEGLFSV
FT                   KIGECGVSFWCTHPQPEKPFPACLEERRLLVPGRRSMLGRKLLNWFNSQGLNVEILGEF
FT                   DDAALMKAFGATHNAIFVAPTLYANDFYADDSIVEIGRVENVMEEYHAIFAERMIQHPA
FT                   VQRICNSDYSRLFGKPD"
FT   misc_feature    21944..22123
FT                   /gene="nhaR"
FT                   /locus_tag="ROD_00171"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   protein, LysR, score 2.9e-17"
FT                   /inference="protein motif:PFAM:PF00126"
FT   misc_feature    21986..22078
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    22190..22810
FT                   /gene="nhaR"
FT                   /locus_tag="ROD_00171"
FT                   /note="HMMPfam hit to PF03466, LysR,
FT                   substrate-binding,score 3.7e-05"
FT                   /inference="protein motif:PFAM:PF03466"
FT   CDS_pept        complement(22860..24899)
FT                   /transl_table=11
FT                   /locus_tag="ROD_00181"
FT                   /product="putative glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00181"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86798"
FT                   /db_xref="GOA:D2TGH9"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGH9"
FT                   /protein_id="CBG86798.1"
FT                   /translation="MSFIKHDPQRLVWQHNDRYLWIEAWGENSLRVRSGRHMPVMRNEN
FT                   WALTETPVASAAQVTYEEKRATLQNGKITAVVNQQGQVSFYRHPDKCLLQEFWRLRGEI
FT                   GEDESSHGQYVSALNLEEREFRPIPGGKYTIKARFEANEGEKLYGMGQYQQPNLDLKGC
FT                   MLELAQRNSQASVPFLLSSHGYGFLWNNPAIGRVIFANNGTEWEAAVSEQLDYWITAGD
FT                   TPAEISEAYARATGTPPMMPDYAMGFWQCKLRYRNQQELLEVAREYKRRNLPLSVIVID
FT                   FFHWPNQGDWTFDPCDWPDPDAMIAELKAMGTELMVSFWPTVDNRTESYREMKEHGWLV
FT                   HTERGLPINMDFLGNTTFFDATHPEARNYVWGKAKRNYYDKGVKLFWLDEAEPEFSVYD
FT                   YDNYRYHTGPVLETGNIYPRMYARTFFDGMRAAGEQQIINLLRCAWAGSQKYGALVWSG
FT                   DIHSSFRSLRNQFAAGLNMGIAGIPWWTTDIGGFHGGNIHDPAFHELLIRWFQWGIFSP
FT                   VMRLHGNRDPQILPEQPYREGIAQCPTGAPNEIWSYGEEVCEVLTGCLQLRESLKPYIK
FT                   QIMQETHEKNTPVMRTLFFEFPHQPESWEIDDQYCFGPDLLVAPVMYAGARERTVWLPD
FT                   GDTWIDLCTRERYQGGQTRLHAAPLNRIPVFIREKGKYRHLLPV"
FT   misc_feature    complement(22881..24254)
FT                   /locus_tag="ROD_00181"
FT                   /note="HMMPfam hit to PF01055, Glycoside hydrolase, family
FT                   31, score 5.7e-168"
FT                   /inference="protein motif:PFAM:PF01055"
FT   CDS_pept        complement(24938..26311)
FT                   /transl_table=11
FT                   /locus_tag="ROD_00191"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00191"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86799"
FT                   /db_xref="GOA:D2TGI3"
FT                   /db_xref="InterPro:IPR001927"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGI3"
FT                   /protein_id="CBG86799.1"
FT                   /translation="MSSVIEEAHLTEHQRLSSLQRISYGLLDVAGNLLYCFGSTYILYF
FT                   YTDVAGITLAIAGTILLLARIVDGIDAPVWGIIIDKTRSRYGKCRPWFLWLPLPFAVFS
FT                   ALSFWSPDISMTGKTLYAAISYMIASILFTGLNTPLSAILPLMTLSAKERLILNSYRMT
FT                   GGQIGVLLMNATALPLVAFLGGGNDKSGFFYTAIVFAIISCALTLFAFRNIRELDTDKI
FT                   QQQPQLPMKKSFRAMKGNWPWILMVLANLIFWVALQQRASTIVYYLTYNLDRKDLVPLV
FT                   NSLATIQILFIIAIPFFSRYLSKTGIWIAGLLLSTAGGILVWLAAGNVTLLIVAWVLAN
FT                   IGSGIACSMPFAMLGFAVDYGAWKTGVKATSILIAFGSTFCIKMGSGIGTAFAAWIMNS
FT                   FGYLPNQAQTAAGLEGITWAFIWTPALLFALAALPLLFFRQYEAMERRIQQDLQSGAH"
FT   misc_feature    complement(join(24998..25066,25124..25192,25250..25318,
FT                   25331..25396,25415..25483,25541..25594,25673..25741,
FT                   25754..25813,25874..25942,25985..26038,26120..26188))
FT                   /locus_tag="ROD_00191"
FT                   /note="11 probable transmembrane helices predicted for
FT                   ROD00191 by TMHMM2.0 at aa 42-64, 92-109, 124-146,
FT                   167-186,191-213, 240-257, 277-299, 306-327, 332-354,
FT                   374-396 and 416-438"
FT   misc_feature    complement(25118..26230)
FT                   /locus_tag="ROD_00191"
FT                   /note="HMMPfam hit to PF07690, Major facilitator
FT                   superfamily MFS-1, score 1.8e-05"
FT                   /inference="protein motif:PFAM:PF07690"
FT   misc_feature    complement(25271..25303)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(25700..25732)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        26543..26671
FT                   /transl_table=11
FT                   /locus_tag="ROD_00201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00201"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86800"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGI5"
FT                   /protein_id="CBG86800.1"
FT                   /translation="MQVTFLRTMKGKFFQNKTKLFSGTPRSAEEGAGSRKKKAAEV"
FT   CDS_pept        complement(26742..27005)
FT                   /transl_table=11
FT                   /locus_tag="ROD_00212"
FT                   /product="30S ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00212"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86801"
FT                   /db_xref="GOA:D2TGI6"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGI6"
FT                   /protein_id="CBG86801.1"
FT                   /translation="MANIKSAKKRAVQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKA
FT                   AAQKAFNEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA"
FT   misc_feature    complement(26751..27002)
FT                   /locus_tag="ROD_00212"
FT                   /note="HMMPfam hit to PF01649, Ribosomal protein S20, score
FT                   9.9e-46"
FT                   /inference="protein motif:PFAM:PF01649"
FT   CDS_pept        27111..27326
FT                   /transl_table=11
FT                   /locus_tag="ROD_00213"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00213"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86802"
FT                   /db_xref="GOA:D2TGJ8"
FT                   /db_xref="InterPro:IPR020105"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGJ8"
FT                   /protein_id="CBG86802.1"
FT                   /translation="MRRSLRSDGAGFYQLAGREYSFSARKIELRCLLTACICLIAMKSI
FT                   LFLFRGINRRLTLTAVQGILWRFSLF"
FT   misc_feature    27189..27257
FT                   /locus_tag="ROD_00213"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD00213 by TMHMM2.0 at aa 27-49"
FT   CDS_pept        27334..28272
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="ROD_00221"
FT                   /product="riboflavin biosynthesis protein"
FT                   /EC_number="2.7.1.26"
FT                   /EC_number="2.7.7.2"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00221"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86803"
FT                   /db_xref="GOA:D2TGJ9"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGJ9"
FT                   /protein_id="CBG86803.1"
FT                   /translation="MKLIRGIHNLSQAPHGCVLTIGNFDGVHRGHRALLQSLQEEGRRR
FT                   GLPVMVMIFEPQPLELFATDKAPARLTRLREKLRYLAQCGVDYVLCVRFDRRFAALTAQ
FT                   TFISDLLVDRLGVRFLAVGDDFRFGAGRTGDFLLLQKAGAEYGFAVTNTQTFCEGGVRI
FT                   SSTAVRQALAEDNLALAESLLGHPFTISGRVVHGDELGRTIGFPTANIPLRRQVSPVKG
FT                   VYAVEVMGAGEQPMPGVANIGTRPTVAGVRQQLEVHVLDVVMDLYGRHIDVVLRKKIRN
FT                   EQRFASLDELKAQIARDELTARDFFGLSKPA"
FT   misc_feature    27376..27834
FT                   /gene="ribF"
FT                   /locus_tag="ROD_00221"
FT                   /note="HMMPfam hit to PF06574, FAD synthetase, score
FT                   4.2e-87"
FT                   /inference="protein motif:PFAM:PF06574"
FT   misc_feature    27880..28254
FT                   /gene="ribF"
FT                   /locus_tag="ROD_00221"
FT                   /note="HMMPfam hit to PF01687, Riboflavin kinase, score
FT                   2e-63"
FT                   /inference="protein motif:PFAM:PF01687"
FT   CDS_pept        28310..31126
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="ROD_00231"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00231"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86804"
FT                   /db_xref="GOA:D2TGK1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGK1"
FT                   /protein_id="CBG86804.1"
FT                   /translation="MSDYKSTLNLPETGFPMRGDLAKREPGMLARWTDDDLYGIIRAAK
FT                   KGKKTFILHDGPPYANGSIHIGHSVNKILKDIIVKSKGLSGFDSPYVPGWDCHGLPIEL
FT                   KVEQEYGKPGEKFTAAEFRAKCREYAATQVDGQRKDFIRLGVLGDWSHPYLTMDFKTEA
FT                   NIIRALGKIIGNGHLHKGAKPVHWCVDCRSALAEAEVEYYDKTSPSIDVAFRAVDQNAV
FT                   QAKFGLPGVSGPISLVIWTTTPWTLPANRAISLAPDFDYALVQIDGQALILAKDLVESV
FT                   MQRIGVADYSILGTVKGAELELLRFTHPFMGFDVPAILGDHVTLDAGTGAVHTAGGHGP
FT                   DDYTISLKYGLEIANPVGPDGAYLAGTYPGLDGVNVFKANDTIVELLREKGALLHVEKM
FT                   QHSYPCCWRHKSPIIFRATPQWFISMDQKGLRAQSLKEIKGVQWIPDWGQARIESMVAN
FT                   RPDWCISRQRTWGVPMALFVHKDTEELHPRAVELMEEVAKRVEVDGIQAWWDLDPKAIL
FT                   GDEADQYVKVPDTLDVWFDSGSTHASVVDVRPEFAGHAADMYLEGSDQHRGWFMSSLMI
FT                   STAMKGKAPYRQVLTHGFTVDGQGRKMSKSIGNTVSPQDVMNKLGADILRLWVASTDYT
FT                   GEMAVSDEILKRAADSYRRIRNTARFLLANLNGFDPVKDMVKPEEMVVLDRWAVGCAKA
FT                   AQEDILKAYEDYDFHEVVQRLMRFCSVEMGSFYLDIIKDRQYTAKADSVARRSCQSALY
FT                   HIAEALVRWMAPIMSFTADEIWGYLPGEREKYVFTGEWYEGLFGLGETEPMNDAFWDEL
FT                   LKVRGEVNKVIEQARADKKVGGSLEAAVTLYAEPELAAKLTALGDELRFVLLTSGAKVA
FT                   DYAEASADAQQSELLKGLKVALSKAEGEKCPRCWHYTTDVGKVAEHAEICGRCVSNVAG
FT                   DGEKRKFA"
FT   misc_feature    28388..30232
FT                   /gene="ileS"
FT                   /locus_tag="ROD_00231"
FT                   /note="HMMPfam hit to PF00133, Aminoacyl-tRNA
FT                   synthetase,class Ia, score 0"
FT                   /inference="protein motif:PFAM:PF00133"
FT   misc_feature    28481..28516
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00178"
FT   misc_feature    30362..30838
FT                   /gene="ileS"
FT                   /locus_tag="ROD_00231"
FT                   /note="HMMPfam hit to PF08264, Valyl/Leucyl/Isoleucyl-tRNA
FT                   synthetase, class I, anticodon-binding, score 8.5e-58"
FT                   /inference="protein motif:PFAM:PF08264"
FT   misc_feature    31001..31090
FT                   /gene="ileS"
FT                   /locus_tag="ROD_00231"
FT                   /note="HMMPfam hit to PF06827, Formamidopyrimidine-DNA
FT                   glycolase, C-terminal, score 2.5e-14"
FT                   /inference="protein motif:PFAM:PF06827"
FT   CDS_pept        31126..31623
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="ROD_00241"
FT                   /product="lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00241"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86805"
FT                   /db_xref="GOA:D2TGK3"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGK3"
FT                   /protein_id="CBG86805.1"
FT                   /translation="MSKSLSSTGLRWLWLVVVVLIIDLGSKFLILQNFALGDTVPLFPS
FT                   LNLHYARNYGAAFSFLADSGGWQRWFFAGIAIGICVILTVLMYRAKATQKLNNIAYALI
FT                   IGGALGNLFDRLWHGFVVDMIDFYVGEWHFATFNLADSAICIGAALIVLEGFIPSKQKT
FT                   TA"
FT   misc_feature    31153..31617
FT                   /gene="lspA"
FT                   /locus_tag="ROD_00241"
FT                   /note="HMMPfam hit to PF01252, Peptidase A8, signal
FT                   peptidase II, score 3.6e-84"
FT                   /inference="protein motif:PFAM:PF01252"
FT   misc_feature    join(31162..31230,31321..31389,31423..31491,31534..31602)
FT                   /gene="lspA"
FT                   /locus_tag="ROD_00241"
FT                   /note="4 probable transmembrane helices predicted for
FT                   ROD00241 by TMHMM2.0 at aa 13-35, 66-88, 100-122 and
FT                   137-159"
FT   misc_feature    31441..31473
FT                   /note="PS00855 Signal peptidases II signature."
FT                   /inference="protein motif:Prosite:PS00855"
FT   CDS_pept        32133..32582
FT                   /transl_table=11
FT                   /gene="fkpB"
FT                   /locus_tag="ROD_00251"
FT                   /product="FkbB-type 16 kD peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00251"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86806"
FT                   /db_xref="GOA:D2TGK4"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGK4"
FT                   /protein_id="CBG86806.1"
FT                   /translation="MSKSVQSNSAVLVHFTLKLDDGSTAESTRNNGKPALFRLGDGSLS
FT                   EGLEQHLLGLKDGDKATFSLEPDAAFGVPTPDLIQYFSRREFMDAGEPEIGAIMLFTAM
FT                   DGSEMPGVIREINGDSITVDFNHPLAGHTVHFDIDVLEVDPALEG"
FT   misc_feature    32145..32555
FT                   /gene="fkpB"
FT                   /locus_tag="ROD_00251"
FT                   /note="HMMPfam hit to PF00254, Peptidyl-prolyl cis-trans
FT                   isomerase, FKBP-type, score 6.8e-13"
FT                   /inference="protein motif:PFAM:PF00254"
FT   misc_feature    32169..32216
FT                   /note="PS00453 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase signature 1."
FT                   /inference="protein motif:Prosite:PS00453"
FT   misc_feature    32262..32348
FT                   /note="PS00454 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase signature 2."
FT                   /inference="protein motif:Prosite:PS00454"
FT   CDS_pept        32584..33534
FT                   /transl_table=11
FT                   /gene="ispH"
FT                   /gene_synonym="lytB"
FT                   /locus_tag="ROD_00261"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /EC_number="1.17.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00261"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86807"
FT                   /db_xref="GOA:D2TGK7"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGK7"
FT                   /protein_id="CBG86807.1"
FT                   /translation="MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYV
FT                   VDSLRERGAIFIEQISEVPDGAILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHM
FT                   EVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPEDVWTLNVKNEGKLSF
FT                   MTQTTLSVDDTSDVIDALRQRFPKIVGPRKDDICYATTNRQEAVRRLAEQADVVLVVGS
FT                   KNSSNSNRLAELAQRMGKTAFLIDDATDIQEAWVKEAKCVGVTAGASAPDILVQNVITR
FT                   LQALGGGEAIPLEGREENIVFEVPKELRMDVREIG"
FT   misc_feature    32590..33438
FT                   /gene="ispH"
FT                   /gene_synonym="lytB"
FT                   /locus_tag="ROD_00261"
FT                   /note="HMMPfam hit to PF02401, LytB protein, score
FT                   8.3e-189"
FT                   /inference="protein motif:PFAM:PF02401"
FT   CDS_pept        33775..34557
FT                   /transl_table=11
FT                   /locus_tag="ROD_00271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00271"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86808"
FT                   /db_xref="GOA:D2TGK8"
FT                   /db_xref="InterPro:IPR010551"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGK8"
FT                   /protein_id="CBG86808.1"
FT                   /translation="MADALHSFGLDMAVHHHPPGFSYGDEVTGPMPEIRRLDQIRASLR
FT                   DPHCSGPQEVYAIAMDVARMQDRDELRKRMLLFGVVTYAAGRLGEEPVRSQGHVHRISQ
FT                   HSGWSPPELYEIWQGKAIVYMQEHVGDDPGRCFAVIAGPGEKVLVPPGWGHATISADPD
FT                   APLTFGAWCDREYGFEYEAIRARKGLAWYPLLQDKNVVWQHNPRYLPGRLQVVTPRQYT
FT                   EFAITSAPVYQQFIDDPARFQFISRPDKVAELWAHFHP"
FT   CDS_pept        complement(34609..35427)
FT                   /transl_table=11
FT                   /locus_tag="ROD_00281"
FT                   /product="putative PTS system protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00281"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86809"
FT                   /db_xref="GOA:D2TGK9"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGK9"
FT                   /protein_id="CBG86809.1"
FT                   /translation="MEQRTLTRKDLRRCWRAWMMHNLSSMSFERLASFGFCLSMLPVAK
FT                   KLYPDAAQRHEMLRRHASFYNTEPQIGAIVNGMALGLEEKKANGEPIDGETINTLKVGL
FT                   MGPIAGIGDSMIPGMLIPILLSIGMALAAGGNILGPLFYTVAWLAIIIPGSWFLFLKGY
FT                   KMGSGSVEMLVSSKSARLREALSLLGVFVMGGVAASYVKLGTGLEFITKDGVNIHVQQM
FT                   LDGIFPQLLPLAVVLGTWYLMAKRGVSPVKAMVLLLVLAALGVATGLFAG"
FT   misc_feature    complement(join(34615..34683,34696..34764,34807..34875,
FT                   34951..35019,35032..35100))
FT                   /locus_tag="ROD_00281"
FT                   /note="5 probable transmembrane helices predicted for
FT                   ROD00281 by TMHMM2.0 at aa 110-132, 137-159,
FT                   185-207,222-244 and 249-271"
FT   misc_feature    complement(34618..35418)
FT                   /locus_tag="ROD_00281"
FT                   /note="HMMPfam hit to PF03613, Phosphotransferase
FT                   system,mannose/fructose/sorbose family IID component, score
FT                   3.6e-95"
FT                   /inference="protein motif:PFAM:PF03613"
FT   misc_feature    complement(35326..35355)
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   CDS_pept        complement(35427..36230)
FT                   /transl_table=11
FT                   /locus_tag="ROD_00291"
FT                   /product="putative PTS system protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00291"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86810"
FT                   /db_xref="GOA:D2TGL0"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGL0"
FT                   /protein_id="CBG86810.1"
FT                   /translation="MIFEATLIGILCYLGALSSPWLFGLTGGWYLITRPLISGMLVGLI
FT                   LGDMQTGIVIGVAVQAVYIAMVTPGGSMPADLNFVAYPAIALGILSGKGPEVAVALAAT
FT                   IGIAGTILFNAMMVLNSFWNHRADVALERGDERGLYLNSAIWPQVSNFILRFVPTFIAV
FT                   YFGAQYISGFMDSLPGIVLSTMNVLGGILPAVGIAILLKQIIKNYSMLIYFLVGFVCIV
FT                   FLKLNMVALVIVGSLLALIHYNYKPEAPQAVNAASAAKDDDEDEF"
FT   misc_feature    complement(35505..36227)
FT                   /locus_tag="ROD_00291"
FT                   /note="HMMPfam hit to PF03609, Phosphotransferase
FT                   system,sorbose-specific IIC subunit, score 3.3e-16"
FT                   /inference="protein motif:PFAM:PF03609"
FT   misc_feature    complement(join(35526..35594,35628..35696,35709..35777,
FT                   35874..35942,36006..36074,36135..36203))
FT                   /locus_tag="ROD_00291"
FT                   /note="6 probable transmembrane helices predicted for
FT                   ROD00291 by TMHMM2.0 at aa 10-32, 53-75, 97-119,
FT                   152-174,179-201 and 213-235"
FT   CDS_pept        complement(36241..36735)
FT                   /transl_table=11
FT                   /locus_tag="ROD_00301"
FT                   /product="putative PTS system protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00301"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86811"
FT                   /db_xref="GOA:D2TGL1"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGL1"
FT                   /protein_id="CBG86811.1"
FT                   /translation="MSISFVRIDDRVIHGQLVTRWARELPCDGIIAIDDAVAADPLLSS
FT                   VMKGAVQDTKVWLFDTATAIEKLPKVIASEKRYFVIAKSPVTLKGIEEAGISLQNGNGK
FT                   INVGPMSARADTVTIGPNQSVNADEIAAFDWLTQCGHLVEFRLVPDASFYSWQDARQKM
FT                   K"
FT   misc_feature    complement(36274..36732)
FT                   /locus_tag="ROD_00301"
FT                   /note="HMMPfam hit to PF03830, Phosphotransferase
FT                   system,sorbose subfamily IIB component, score 1.1e-15"
FT                   /inference="protein motif:PFAM:PF03830"
FT   CDS_pept        complement(36747..37175)
FT                   /transl_table=11
FT                   /locus_tag="ROD_00311"
FT                   /product="putative PTS system protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00311"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86812"
FT                   /db_xref="GOA:D2TGL2"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGL2"
FT                   /protein_id="CBG86812.1"
FT                   /translation="MINIIVATHGPLAEALLASARMVYGDLPHVYTATLSEQSGIEGFK
FT                   ESFAKTLAEAGQNADGVLVLCDMQSGTPWNVACQYAFSPDTQPPVAVVAGVNFPMLLQS
FT                   EEINPLTDVHAAADELLALTVPTLVKAAPVVTTQSEDF"
FT   misc_feature    complement(36801..37172)
FT                   /locus_tag="ROD_00311"
FT                   /note="HMMPfam hit to PF03610, Phosphotransferase
FT                   system,fructose subfamily IIA component, score 2.3e-17"
FT                   /inference="protein motif:PFAM:PF03610"
FT   CDS_pept        complement(37180..38925)
FT                   /transl_table=11
FT                   /locus_tag="ROD_00321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00321"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86813"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016847"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGL3"
FT                   /protein_id="CBG86813.1"
FT                   /translation="MPTTYNKYPDVVVQGYDHQAWQGWNTILSALNTKLSDSTKTVLVV
FT                   DCYPGVRTDELEQQLLANLDVALAVNIDSARLEKEALDYLLARNLTDDRIFGVLSCHQL
FT                   VEFFDPDRLEQIRQQIASVKKGVVVVYGPGAALAHSGDVLVYADLPRWEIQQRMRHDGL
FT                   ANWGAENADEDILRRYKRAYFIEWRVFDRHKTPLLKRADFLLDTTIENAPAMVSGDALR
FT                   AGLQQTTTQPFRVVPFFDPGIWGGQWMKQQFDLDPAAPNYAWCFDCVPEENSLLLRFGA
FT                   VRIELPSQDLVLLYPHPLLGEKVHARFGTDFPIRFDFLDTIDGQNLSFQVHPLTEYIQQ
FT                   QFGMHYTQDESYYILDAQPEAKVYLGTRTGIEPQEMLEDLRAAQRGEKAFDDARFVNQI
FT                   PARKHDHFLIPAGTVHCSGAGTMVLEISATPYIFTFKLWDWGRLGLDGLPRPVHLEHGE
FT                   QVIDWQRDTQWVYDNLVNRIEPVAEGEGWKEERTGLHEREFIETRRHWFTAPVIHHTQG
FT                   GVNVLNLVEGAEAIVDSPSGAFAPFTVHYAETFIIPAAVGEYRISPSGKGVGQKLATIK
FT                   AWVRG"
FT   CDS_pept        39111..40118
FT                   /transl_table=11
FT                   /locus_tag="ROD_00331"
FT                   /product="putative LacI-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00331"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86814"
FT                   /db_xref="GOA:D2TGL4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGL4"
FT                   /protein_id="CBG86814.1"
FT                   /translation="MTTVTLAQVAKRAGVSTATVSMVLRNRGRISQATRERVLQALDAS
FT                   GYVYNQTAANLRNRSSNQVGLLLHDITNPFYGEMTAGLSDEMERHDLLLFLANSEESGE
FT                   RQQKFVDSLMRNNACGMVLCAARETPVSFFDALKRRNIPAIMVVRTVNDPDFDYVGTDN
FT                   FLGTQMATTHLLRLGHKNIAFIGGSPGSGTRAQRIGGFTSTLLEWGISPDPDWIVAAGA
FT                   SQPDGAKAAESILGRYPQITAAVCYQDIVALGVMQALRKMGREPGRDFALVGFDDITEA
FT                   ALVQPALTTVSVAAKEIGRKAGELLYSRIQGNDEPPKRIILPPALVIRESCGFH"
FT   misc_feature    39120..39197
FT                   /locus_tag="ROD_00331"
FT                   /note="HMMPfam hit to PF00356, Bacterial regulatory
FT                   protein, LacI, score 5e-09"
FT                   /inference="protein motif:PFAM:PF00356"
FT   misc_feature    39120..39185
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2025.000, SD 6.08 at aa 4-25, sequence
FT                   VTLAQVAKRAGVSTATVSMVLR"
FT   misc_feature    39291..40100
FT                   /locus_tag="ROD_00331"
FT                   /note="HMMPfam hit to PF00532, Periplasmic binding
FT                   protein/LacI transcriptional regulator, score 2.5e-29"
FT                   /inference="protein motif:PFAM:PF00532"
FT   CDS_pept        40252..41073
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="ROD_00341"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.3.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00341"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86815"
FT                   /db_xref="GOA:D2TGL8"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGL8"
FT                   /protein_id="CBG86815.1"
FT                   /translation="MHDAQVRVAIAGAGGRMGRQLIQAVLQMEGVALGAALEREGSSLL
FT                   GSDAGELAGAGKTGVTVQSSLEAVKDDFDVFIDFTRPEGTLNHLAFCREHGKAMVIGTT
FT                   GFDEAGKQAIRDASRQIGIVFAANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHK
FT                   VDAPSGTALAMGEAIAHALDKDLKACAVYSREGYTGERVPGTIGFATVRAGDIVGEHTA
FT                   MFADIGERVEITHKASSRMTFANGAVRSALWLSAKQNGLFDMRDVLDLNNL"
FT   misc_feature    40267..40638
FT                   /gene="dapB"
FT                   /locus_tag="ROD_00341"
FT                   /note="HMMPfam hit to PF01113, Dihydrodipicolinate
FT                   reductase, score 9.9e-68"
FT                   /inference="protein motif:PFAM:PF01113"
FT   misc_feature    40645..41058
FT                   /gene="dapB"
FT                   /locus_tag="ROD_00341"
FT                   /note="HMMPfam hit to PF05173, Dihydrodipicolinate
FT                   reductase, score 3.5e-80"
FT                   /inference="protein motif:PFAM:PF05173"
FT   misc_feature    40711..40764
FT                   /note="PS01298 Dihydrodipicolinate reductase signature."
FT                   /inference="protein motif:Prosite:PS01298"
FT   CDS_pept        41527..42675
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="ROD_00351"
FT                   /product="carbamoyl-phosphate synthase small chain"
FT                   /EC_number="6.3.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00351"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86816"
FT                   /db_xref="GOA:D2TGL9"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGL9"
FT                   /protein_id="CBG86816.1"
FT                   /translation="MIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTD
FT                   PSYSRQIVTLTYPHIGNVGTNAADEESSRVHAQGLVIRDLPLIASNFRNTEDLSSYLKR
FT                   HNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDAQLALEKAKAFPGLNGMDLAKEVT
FT                   TTETYSWTQGSWTLSGDLPEAKKEDDLPFHVVAYDFGAKRNILRMLVDRGCRLTVVPAK
FT                   TSAEEVLKMNPDGIFLSNGPGDPAPCDYAIDAIQQFLNTDIPLFGICLGHQLLALASGA
FT                   KTVKMKFGHHGGNHPVKDIDNNTVMITAQNHGFAVDEATLPANLRVTHKSLFDQTLQGI
FT                   HRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIEQYRQSAK"
FT   misc_feature    41533..41979
FT                   /gene="carA"
FT                   /locus_tag="ROD_00351"
FT                   /note="HMMPfam hit to PF00988, Carbamoyl-phosphate
FT                   synthase, small chain, score 1.5e-95"
FT                   /inference="protein motif:PFAM:PF00988"
FT   misc_feature    42109..42645
FT                   /gene="carA"
FT                   /locus_tag="ROD_00351"
FT                   /note="HMMPfam hit to PF00117, Glutamine amidotransferase
FT                   class-I, score 1.1e-75"
FT                   /inference="protein motif:PFAM:PF00117"
FT   misc_feature    42316..42351
FT                   /note="PS00442 Glutamine amidotransferases class-I active
FT                   site."
FT                   /inference="protein motif:Prosite:PS00442"
FT   CDS_pept        42694..45918
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="ROD_00361"
FT                   /product="carbamoyl-phosphate synthase large chain"
FT                   /EC_number="6.3.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00361"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86817"
FT                   /db_xref="GOA:D2TGM0"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGM0"
FT                   /protein_id="CBG86817.1"
FT                   /translation="MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVI
FT                   LVNSNPATIMTDPEMADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALELER
FT                   QGVLEEFGVTMIGATAYAIDKAEDRRRFDIAMKKIGLETARSGIAHTMEEALAVAADVG
FT                   YPCIIRPSFTMGGTGGGIAYNREEFEEICARGLDLSPTKELLIDESLIGWKEYEMEVVR
FT                   DKNDNCIIVCSIENFDAMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGG
FT                   SNVQFAVNPKNGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELMNDIT
FT                   GGRTPASFEPSIDYVVTKIPRFNFEKFAGSNDRLTTQMKSVGEVMAIGRTQQESMQKAL
FT                   RGLEVGATGFDPKVSLDDPEALTKIRRELKDAGADRIWYIADAFRAGLSVDGVFNLTNI
FT                   DRWFLVQIEELVRLEEKVAELGINGLTADFLRQLKRKGFADARLAKLAGVREAEIRKLR
FT                   DQYDLHPVYKRVDTCAAEFATDTAYMYSTYEDECEANPSVDRDKIMVLGGGPNRIGQGI
FT                   EFDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVTLEDVLEIVRIEKP
FT                   KGVIVQYGGQTPLKLARALEAAGVPVIGTSPDAIDRAEDRERFQHAVDRLKLKQPANAT
FT                   VTTIEQAVEKAKEISYPLVVRPSYVLGGRAMEIVYDEADLRRYFQTAVSVSNDAPVLLD
FT                   RFLDDAVEVDVDAICDGEMVLIGGIMEHIEQAGVHSGDSACSLPAYTLSQEIQDVMRQQ
FT                   VQKLAFELQVRGLMNVQFAVKDNEVYLIEVNPRAARTVPFVSKATGVPLAKVAARVMTG
FT                   KSLAEQGVTKEIIPPYYSVKEVVLPFNKFPGVDPLLGPEMRSTGEVMGVGRTFAEAFAK
FT                   AQLGSNSTMKKQGRALLSVREGDKERVVDLAAKLLKQGFELDATHGTAIVLGEAGINPR
FT                   LVNKVHEGRPHIQDRIKNGEYTYIINTTAGRRAIEDSRVIRRSALQYKVHYDTTLNGGF
FT                   ATAMALNADATEKVISVQEMHAQIKK"
FT   sig_peptide     42694..42762
FT                   /gene="carB"
FT                   /locus_tag="ROD_00361"
FT                   /note="Signal peptide predicted for ROD00361 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.643) with cleavage site
FT                   probability 0.569 between residues 23 and 24"
FT   misc_feature    42709..43071
FT                   /gene="carB"
FT                   /locus_tag="ROD_00361"
FT                   /note="HMMPfam hit to PF00289, Carbamoyl-phosphate
FT                   synthetase large chain, N-terminal, score 4.3e-63"
FT                   /inference="protein motif:PFAM:PF00289"
FT   misc_feature    42733..42765
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    43075..43785
FT                   /gene="carB"
FT                   /locus_tag="ROD_00361"
FT                   /note="HMMPfam hit to PF02786, Carbamoyl-phosphate synthase
FT                   L chain, ATP-binding, score 1.9e-147"
FT                   /inference="protein motif:PFAM:PF02786"
FT   misc_feature    43183..43227
FT                   /note="PS00866 Carbamoyl-phosphate synthase subdomain
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00866"
FT   misc_feature    43582..43605
FT                   /note="PS00867 Carbamoyl-phosphate synthase subdomain
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00867"
FT   misc_feature    43963..44334
FT                   /gene="carB"
FT                   /locus_tag="ROD_00361"
FT                   /note="HMMPfam hit to PF02787, Carbamoyl-phosphate
FT                   synthetase large chain, oligomerisation, score 3.2e-68"
FT                   /inference="protein motif:PFAM:PF02787"
FT   misc_feature    44365..44709
FT                   /gene="carB"
FT                   /locus_tag="ROD_00361"
FT                   /note="HMMPfam hit to PF00289, Carbamoyl-phosphate
FT                   synthetase large chain, N-terminal, score 2.9e-26"
FT                   /inference="protein motif:PFAM:PF00289"
FT   misc_feature    44713..44964
FT                   /gene="carB"
FT                   /locus_tag="ROD_00361"
FT                   /note="HMMPfam hit to PF02786, Carbamoyl-phosphate synthase
FT                   L chain, ATP-binding, score 2.1e-18"
FT                   /inference="protein motif:PFAM:PF02786"
FT   misc_feature    44821..44865
FT                   /note="PS00866 Carbamoyl-phosphate synthase subdomain
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00866"
FT   misc_feature    45049..45336
FT                   /gene="carB"
FT                   /locus_tag="ROD_00361"
FT                   /note="HMMPfam hit to PF02786, Carbamoyl-phosphate synthase
FT                   L chain, ATP-binding, score 2.5e-14"
FT                   /inference="protein motif:PFAM:PF02786"
FT   misc_feature    45208..45231
FT                   /note="PS00867 Carbamoyl-phosphate synthase subdomain
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00867"
FT   misc_feature    45289..45312
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    45559..45819
FT                   /gene="carB"
FT                   /locus_tag="ROD_00361"
FT                   /note="HMMPfam hit to PF02142, MGS-like, score 7.4e-31"
FT                   /inference="protein motif:PFAM:PF02142"
FT   CDS_pept        46165..46554
FT                   /transl_table=11
FT                   /gene="caiF"
FT                   /locus_tag="ROD_00371"
FT                   /product="transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00371"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86818"
FT                   /db_xref="GOA:D2TGM1"
FT                   /db_xref="InterPro:IPR020357"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGM1"
FT                   /protein_id="CBG86818.1"
FT                   /translation="MCEERVDKPLYLLIADWVMAEKRWVSAKEIAKQFNMDHCKASNTV
FT                   SYILAEVAEIHCETKTIPNQLEGRGCQCQRLVRVTHIAPQLYARLGQGAQQKMVNRTPQ
FT                   MTAVPPSELNREQKWQMMLSKSLRR"
FT   CDS_pept        complement(46781..47566)
FT                   /transl_table=11
FT                   /gene="caiD"
FT                   /locus_tag="ROD_00381"
FT                   /product="carnitinyl-CoA dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00381"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86819"
FT                   /db_xref="GOA:D2TGM2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR022852"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGM2"
FT                   /protein_id="CBG86819.1"
FT                   /translation="MSESLHLTRNGAVLEIILDRPKANAIDARTSFQMGEVFLNFRDDP
FT                   ELRVAIVTGAGEKFFSAGWDLKAAAEGEAPDADFGPGGFAGLTECFDLDKPVIAAVNGY
FT                   AFGGGFELALAADFIVCADHASFALPEARLGIVPDSGGVLRLPKRLPPVIANEMVMTGR
FT                   RMSAGEALRWGIVNRVVSQQALMDSARELAQQLVSSAPLAIAALKEIYRATGEMSVEEG
FT                   YRCLRSGALKHYPAVLHSEDALEGPRAFAEKRDPVWKGR"
FT   misc_feature    complement(47024..47527)
FT                   /gene="caiD"
FT                   /locus_tag="ROD_00381"
FT                   /note="HMMPfam hit to PF00378, Crotonase, core, score
FT                   1.1e-78"
FT                   /inference="protein motif:PFAM:PF00378"
FT   misc_feature    complement(47213..47275)
FT                   /note="PS00166 Enoyl-CoA hydratase/isomerase signature."
FT                   /inference="protein motif:Prosite:PS00166"
FT   misc_feature    complement(47366..47452)
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS_pept        complement(47619..49172)
FT                   /transl_table=11
FT                   /gene="caiC"
FT                   /locus_tag="ROD_00391"
FT                   /product="probable crotonobetaine/carnitine-CoA ligase"
FT                   /EC_number="6.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00391"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86820"
FT                   /db_xref="GOA:D2TGM3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGM3"
FT                   /protein_id="CBG86820.1"
FT                   /translation="MDIVGGQHLRQMWDDLAEKYGGKTALIYESCAGKAQQFSYASLNQ
FT                   EINRTANLFYASGIRKGDKVALHLDNCPAFFFCWFGLAKIGAIMVPVNARLLRDESEWI
FT                   LQSSQARLLVTSAAFLPMYRQILRQSDTMLTDIWITDADAGEETNVMNFTQRKDRQPAT
FT                   LRDVPPLSVDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQCALREDDVYLTVMP
FT                   AFHIDCQCTAAMAAFSAGATFVLIEKYSARAFWQQVRKYRATVTECIPMMIRTLMAQPA
FT                   TPQDRQHALREVMFYLNLSEQEKDAFIARFGVRLLTSYGMTETIVGIIGDRPGDKRRWP
FT                   SIGRPGFCYEAEIRDEHNRVLPAGEIGEICIKGVPGKTIFKEYYARPDATAKALEPTGW
FT                   LHTGDSGYRDEEGFFYFVDRRCNMIKRGGENVSCVELENIISAHPKIQDIVVIGIKDSI
FT                   RDEAIKAFVVLNEGETLTQEEFFSFCEQNMAKFKVPSFMEIRSDLPRNCSGKIIKKNLK
FT                   "
FT   misc_feature    complement(47820..49058)
FT                   /gene="caiC"
FT                   /locus_tag="ROD_00391"
FT                   /note="HMMPfam hit to PF00501, AMP-dependent synthetase and
FT                   ligase, score 5.8e-125"
FT                   /inference="protein motif:PFAM:PF00501"
FT   misc_feature    complement(48606..48641)
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT                   /inference="protein motif:Prosite:PS00455"
FT   misc_feature    complement(49101..49124)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(49229..50446)
FT                   /transl_table=11
FT                   /gene="caiB"
FT                   /locus_tag="ROD_00401"
FT                   /product="crotonobetainyl-CoA:carnitine CoA-transferase"
FT                   /EC_number="2.8.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00401"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86821"
FT                   /db_xref="GOA:D2TGM4"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023452"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGM4"
FT                   /protein_id="CBG86821.1"
FT                   /translation="MNRLSMPTFGPLAGVRVVFSGIEIAGPFAGQMFAEWGAEVIWIEN
FT                   VAWADTIRVQPNYPQLSRRNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARR
FT                   GISDEVLWQHNPKLVIAHLSGFGQYGSEEYTHLPAYNTIAQAFSGYLIQNGDIDQPMPA
FT                   FPYTADYFSGMTATTAALAALHKARETGKGESIDVAMYEVMLRMGQYFMMDYFNGGEIC
FT                   PRMSKGKDPYYAGCGLYKCADGYIVMELVGITQISECFKDIGLEHLLGTPEVPQGTQLI
FT                   HRIECPYGPLVEEKLDAWLASRTIAGVQARFAELNIACAKVLTIPELEDNPQYVARESI
FT                   TQWQTLDGRTCKGPNIMPKFKNNPGKIWRGMPSHGMDTAAILQNIGYSEADIKKLVSKG
FT                   LAKVED"
FT   misc_feature    complement(49667..50242)
FT                   /gene="caiB"
FT                   /locus_tag="ROD_00401"
FT                   /note="HMMPfam hit to PF02515, CoA-transferase family
FT                   III,score 2.7e-97"
FT                   /inference="protein motif:PFAM:PF02515"
FT   CDS_pept        complement(50550..51692)
FT                   /transl_table=11
FT                   /gene="caiA"
FT                   /locus_tag="ROD_00411"
FT                   /product="crotonobetainyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00411"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86822"
FT                   /db_xref="GOA:D2TGK0"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023450"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGK0"
FT                   /protein_id="CBG86822.1"
FT                   /translation="MDFNFNDEQELFVAGIRELMASENWEAYFAECDRDSVYPERFVKA
FT                   LAEMGIDSLLIPEEHGGLDAGFVTVAAVWMELGRLGAPTYVLYQLPGGFNTFLREGTPE
FT                   QIDKIMAFRGTGKQMWNSAITEPGAGSDVGSLKTTYTRKNGKVYLNGSKCFITSSAYTP
FT                   YIVVMARDGASPDKPVYTEWFVDMSKPGIKVNKLEKLGLRMDSCCEINFDDVELDEKDM
FT                   FGREGNGFNRVKEEFDHERFLVALTNYGTAMCAFEDAARYANQRVQFGETIGRFQLIQE
FT                   KFAHMAIKLNSMKNMLLEAAWKADNGTITSGDAAMCKYFCANAAFEVVDTAMQVLGGVG
FT                   IAGNHRITRFWRDLRVDRVSGGSDEMQILTLGRAVLKQYR"
FT   misc_feature    complement(50565..51014)
FT                   /gene="caiA"
FT                   /locus_tag="ROD_00411"
FT                   /note="HMMPfam hit to PF00441, Acyl-CoA
FT                   oxidase/dehydrogenase, type 1, score 9.4e-60"
FT                   /inference="protein motif:PFAM:PF00441"
FT   misc_feature    complement(50634..50693)
FT                   /note="PS00073 Acyl-CoA dehydrogenases signature 2."
FT                   /inference="protein motif:Prosite:PS00073"
FT   misc_feature    complement(51177..51332)
FT                   /gene="caiA"
FT                   /locus_tag="ROD_00411"
FT                   /note="HMMPfam hit to PF02770, Acyl-CoA
FT                   dehydrogenase/oxidase, central region, score 1.4e-16"
FT                   /inference="protein motif:PFAM:PF02770"
FT   misc_feature    complement(51288..51326)
FT                   /note="PS00072 Acyl-CoA dehydrogenases signature 1."
FT                   /inference="protein motif:Prosite:PS00072"
FT   misc_feature    complement(51342..51677)
FT                   /gene="caiA"
FT                   /locus_tag="ROD_00411"
FT                   /note="HMMPfam hit to PF02771, Acyl-CoA
FT                   dehydrogenase,N-terminal, score 4.7e-50"
FT                   /inference="protein motif:PFAM:PF02771"
FT   CDS_pept        complement(51726..53243)
FT                   /transl_table=11
FT                   /gene="caiT"
FT                   /locus_tag="ROD_00421"
FT                   /product="L-carnitine/gamma-butyrobetaine antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00421"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86823"
FT                   /db_xref="GOA:D2TGK2"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="InterPro:IPR023449"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGK2"
FT                   /protein_id="CBG86823.1"
FT                   /translation="MSNQKKKSGIEPKVFFPPLIIVGILCWLTVRDLDAANVVINAVFS
FT                   YVTNIWGWAFEWYMVVMLIGWFWLVFGPYAKKRLGDEKPEFSTASWIFMMFASCTSAAV
FT                   LFWGSIEIYYYISTPPFALQANSTSAKELGLAYSLFHWGPLPWATYSFLSVAFAYFFFV
FT                   RKMDVIRPSSTLAPLIGEKHAKGLPGTIIDNFYLVALIFAMGTSLGLATPLVTECMQYL
FT                   FGIPHTLQLDAIIITCWIVLNAICVACGLQKGVRIASDVRSYLSFLMLGWVFIVSGASF
FT                   IMNYFTDSVGMLLMYLPRMLFYTDPIAKGGFPQGWTVFYWAWWVIYAIQMSIFLARISR
FT                   GRTVRELCFGMVLGLTASTWILWTVLGSNTLLLMDKNIINIPQLIEQHGVARAIIETWA
FT                   ALPLSTATMWGFFILCFIATVTLINACSYTLAMSTCREVREGDEPPLLVRIGWSVLVGV
FT                   IGIVLLALGGLKPIQTAIIAGGCPLFFVNIMVTLSFIKDARVHWKDQ"
FT   misc_feature    complement(51741..53204)
FT                   /gene="caiT"
FT                   /locus_tag="ROD_00421"
FT                   /note="HMMPfam hit to PF02028, BCCT transporter, score
FT                   8.2e-297"
FT                   /inference="protein motif:PFAM:PF02028"
FT   misc_feature    complement(join(51762..51830,51843..51911,51948..52016,
FT                   52146..52205,52242..52310,52386..52454,52491..52559,
FT                   52602..52661,52755..52823,52902..52970,53028..53096,
FT                   53154..53207))
FT                   /gene="caiT"
FT                   /locus_tag="ROD_00421"
FT                   /note="12 probable transmembrane helices predicted for
FT                   ROD00421 by TMHMM2.0 at aa 13-30, 50-72, 92-114,
FT                   141-163,195-214, 229-251, 264-286, 312-334, 347-366,
FT                   410-432,445-467 and 472-494"
FT   misc_feature    complement(51801..51833)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(52272..52301)
FT                   /note="PS01303 BCCT family of transporters signature."
FT                   /inference="protein motif:Prosite:PS01303"
FT   misc_feature    complement(52947..52979)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        53357..53506
FT                   /transl_table=11
FT                   /locus_tag="ROD_00431"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00431"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86824"
FT                   /db_xref="GOA:D2TGK5"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGK5"
FT                   /protein_id="CBG86824.1"
FT                   /translation="MGIRLRVFCYLYHTLMRQEEQADFGFYCFKINCFVVYLLAFSASD
FT                   VQYW"
FT   misc_feature    53426..53485
FT                   /locus_tag="ROD_00431"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD00431 by TMHMM2.0 at aa 24-43"
FT   CDS_pept        53700..54473
FT                   /transl_table=11
FT                   /gene="fixA"
FT                   /locus_tag="ROD_00441"
FT                   /product="probable electron transfer flavoprotein subunit
FT                   of oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00441"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86825"
FT                   /db_xref="GOA:D2TGK6"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR023463"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGK6"
FT                   /protein_id="CBG86825.1"
FT                   /translation="MKIITCYKSVPDEQDIAINRADGSLDFSKADGKISQYDLNAIEAA
FT                   CQLKQQSDDVQIIALSVGGKALTSVKGRKDVLSRGPDELVVVIDEQFEQALPQHTTAAL
FT                   AAAAQKLGFDLLICGDGSADLYAQQVSLLLGETLNIPAINGVSRILSLTENTLSVEREL
FT                   EDETETLHIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFSALDAWSAQ
FT                   TVAAPEQRARQRNVIEGDGEEQIAAFVESLRKIIN"
FT   misc_feature    53763..54344
FT                   /gene="fixA"
FT                   /locus_tag="ROD_00441"
FT                   /note="HMMPfam hit to PF01012, Electron transfer
FT                   flavoprotein, alpha/beta-subunit, N-terminal, score
FT                   1.4e-58"
FT                   /inference="protein motif:PFAM:PF01012"
FT   misc_feature    54174..54236
FT                   /note="PS01065 Electron transfer flavoprotein beta-subunit
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01065"
FT   CDS_pept        54485..55426
FT                   /transl_table=11
FT                   /gene="fixB"
FT                   /locus_tag="ROD_00451"
FT                   /product="probable electron transfer flavoprotein subunit
FT                   of oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00451"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86826"
FT                   /db_xref="GOA:D2TGL5"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR023461"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGL5"
FT                   /protein_id="CBG86826.1"
FT                   /translation="MSKFSSVWVFSDTASRLPELMSGARALGEQVNAFVENAAEETMVI
FT                   QSGADRAWLLRGKPENRMVEDYANVMARTIRQQASEGLVLLPNTRRGKLLAAKLGYRLA
FT                   AAVSNDASEIGGQDGQAVVRHMVYGGLATGEEVIASPFAVITVNSGTFEAQQPDTSRSG
FT                   ETQVVEWQAPDITVTRTATQPRQSSSVNLDKARLVVSVGRGIGSKENIALAEALCQAIG
FT                   AELACSRPVAENEKWMAHERYVGISNLMLKPELYLAVGISGQIQHMVGANGAQTICAIN
FT                   KDKNAPIFQYADYGIVGDALKILPALTAALSR"
FT   misc_feature    54500..55030
FT                   /gene="fixB"
FT                   /locus_tag="ROD_00451"
FT                   /note="HMMPfam hit to PF01012, Electron transfer
FT                   flavoprotein, alpha/beta-subunit, N-terminal, score
FT                   3.4e-38"
FT                   /inference="protein motif:PFAM:PF01012"
FT   misc_feature    55049..55309
FT                   /gene="fixB"
FT                   /locus_tag="ROD_00451"
FT                   /note="HMMPfam hit to PF00766, Electron transfer
FT                   flavoprotein, alpha subunit, C-terminal, score 7e-42"
FT                   /inference="protein motif:PFAM:PF00766"
FT   misc_feature    55247..55327
FT                   /note="PS00696 Electron transfer flavoprotein alpha-subunit
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00696"
FT   CDS_pept        55448..56734
FT                   /transl_table=11
FT                   /gene="fixC"
FT                   /locus_tag="ROD_00461"
FT                   /product="FAD-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00461"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86827"
FT                   /db_xref="GOA:D2TGL6"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGL6"
FT                   /protein_id="CBG86827.1"
FT                   /translation="MSEDIFDAIVVGAGLAGSVAALVLAREGAQVLVIERGNSPGAKNV
FT                   TGGRIYAHSLERIIPGFAEQAPVERRIVREKLAFMTDCGAMTVDYLNAEEAASAGGSYS
FT                   VLRSRFDAWLMEQAEAAGAQLIAGIRVDNVVQREGRVVGVEADGEIIESKVVILADGVN
FT                   SLLAEKLGMAKRVEAAQVAVGVKELIELPKSVIEDRFQLQGNEGAACLFAGSPTDGLMG
FT                   GGFLYTNENTLSLGLVCGLHQLKEAKKSVPQMLEDFKHHPAVAPLIAGGRLVEYAAHLV
FT                   PEAGLAMQPELVGDGVLIAGDAAGMCMNLGFTIRGMDLAVAAGEAAAKTVLSAMQRNDF
FT                   SRQGLAEYRQRLEDGPLRDMRMYQRLPAFLDNPRMFTRYPEMAVGIARDLFSVDGSAPV
FT                   PMRKKILRHAKQVGFINLIRDGLKGASVL"
FT   misc_feature    55466..56437
FT                   /gene="fixC"
FT                   /locus_tag="ROD_00461"
FT                   /note="HMMPfam hit to PF01266, FAD dependent
FT                   oxidoreductase, score 4e-15"
FT                   /inference="protein motif:PFAM:PF01266"
FT   CDS_pept        56731..57018
FT                   /transl_table=11
FT                   /gene="fixX"
FT                   /locus_tag="ROD_00471"
FT                   /product="ferredoxin like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00471"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86828"
FT                   /db_xref="GOA:D2TGL7"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGL7"
FT                   /protein_id="CBG86828.1"
FT                   /translation="MTSPVNVDVKLGVNKFNVDEEYPHIVVKEEPDRLTLDLLVKACPA
FT                   GLYKKQDDGSVRFDYAGCLECGTCRILGLDSALEEWQYPRGTFGVEFRYG"
FT   repeat_region   complement(57085..58379)
FT                   /note="Insertion sequence ISCro4. No inverted or direct
FT                   repeats apparent. 1 of 13 100% identical ISCro4 elements in
FT                   CR chromosome"
FT   CDS_pept        complement(57194..58174)
FT                   /transl_table=11
FT                   /locus_tag="ROD_00481"
FT                   /product="ISCro4 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00481"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86829"
FT                   /db_xref="GOA:D2TGM5"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGM5"
FT                   /protein_id="CBG86829.1"
FT                   /translation="MEQELHFIGIDVSKAKLDVDVLRPDGRHRSKKFANTPKGHDELLR
FT                   WLSGHRVAPAHICMEATSTYMEDVAAHLSDAGYTVSVINPALGKAFAQSEGLRSKTDAV
FT                   DARMLAEFCRQKRPPAWEAPHPVERALRALVLRHQSLTDMHTQELNRLETAREVQRPSI
FT                   DAHLLWLHAELKRIEKQIKDLTDDDPDMKHRRKLLESIPGIGEKTSAVLLAYTGLKERF
FT                   THARQFAAFAGLTPRRYESGSSVNRASRMSKAGHASLRRALYMPAMVAVSKTEWGRAFR
FT                   DRLAGNGKKGKVIIGAMMRKLAQVAYGVLKSGVPFDASRHNPVAA"
FT   misc_feature    complement(57323..57589)
FT                   /locus_tag="ROD_00481"
FT                   /note="HMMPfam hit to PF02371,
FT                   Transposase,IS116/IS110/IS902, score 1.2e-27"
FT                   /inference="protein motif:PFAM:PF02371"
FT   misc_feature    complement(57668..57958)
FT                   /locus_tag="ROD_00481"
FT                   /note="HMMPfam hit to PF01548,
FT                   Transposase,IS111A/IS1328/IS1533, score 1.2e-17"
FT                   /inference="protein motif:PFAM:PF01548"
FT   CDS_pept        58420..59751
FT                   /transl_table=11
FT                   /locus_tag="ROD_00491"
FT                   /product="major facilitator superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00491"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86830"
FT                   /db_xref="GOA:D2TGE6"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGE6"
FT                   /protein_id="CBG86830.1"
FT                   /translation="MQQPRNFEDIKFSSIHRRIMLWGSGGPFLDGYVLVIIGVALEQLT
FT                   PALKLDAGWLGLLGAGTLAGLFVGTSLFGYISDKVGRRKMFLIDIIAIGVISLATMFVS
FT                   SPVELLIMRILIGVVIGADYPIATSMITEFSSTRQRAFAISFIAAMWYVGATCADLVGY
FT                   WLYDVDGGWRWMFGSAAIPCLFILIGRFDLPESPRWLLRKGRVKECEEMMMKLFGEPVA
FT                   FDEEPPQETHFLQLFNRRHLPFVLFVAAIWTCQVIPMFAIYTFGPQIVGLLGLGAGKSA
FT                   ALGNVVISLFFMLGCIPPMFWLNSAGRRPLLIGSFVMMTLALAVLGLIPEMGSWLVVAA
FT                   FAVYAFFSGGPGNLQWLYPNELFPTDIRASAVGVIMSLSRIGTILSTWALPIFITRYGI
FT                   SHVMLMGAGISLAGLLISIAFAPETRGLTLAETSSMTFRRWPLY"
FT   misc_feature    join(58474..58542,58579..58647,58672..58731,58744..58812,
FT                   58849..58917,58930..58998,59149..59217,59260..59328,
FT                   59347..59415,59425..59493,59530..59598,59611..59679)
FT                   /locus_tag="ROD_00491"
FT                   /note="12 probable transmembrane helices predicted for
FT                   ROD00491 by TMHMM2.0 at aa 19-41, 54-76, 85-104,
FT                   109-131,144-166, 171-193, 244-266, 281-303, 310-332,
FT                   336-358,371-393 and 398-420"
FT   misc_feature    58486..59604
FT                   /locus_tag="ROD_00491"
FT                   /note="HMMPfam hit to PF07690, Major facilitator
FT                   superfamily MFS-1, score 8.9e-35"
FT                   /inference="protein motif:PFAM:PF07690"
FT   misc_feature    59275..59307
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    59689..59736
FT                   /note="PS00038 Myc-type, 'helix-loop-helix' dimerization
FT                   domain signature."
FT                   /inference="protein motif:Prosite:PS00038"
FT   CDS_pept        59856..60089
FT                   /transl_table=11
FT                   /locus_tag="ROD_00501"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00501"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86831"
FT                   /db_xref="InterPro:IPR010305"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGE7"
FT                   /protein_id="CBG86831.1"
FT                   /translation="MQKKLFIASIFAAATVFTVAGCSSDQAVRTTDGKTIVTDGKPQVD
FT                   DDTGMVSYKNAETGQTEQINRDQLKNMSELDN"
FT   sig_peptide     59856..59936
FT                   /locus_tag="ROD_00501"
FT                   /note="Signal peptide predicted for ROD00501 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.553 between residues 27 and 28"
FT   misc_feature    59859..60080
FT                   /locus_tag="ROD_00501"
FT                   /note="HMMPfam hit to PF06004, Protein of unknown function
FT                   DUF903, bacterial, score 1.2e-39"
FT                   /inference="protein motif:PFAM:PF06004"
FT   misc_feature    59868..59927
FT                   /locus_tag="ROD_00501"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD00501 by TMHMM2.0 at aa 5-24"
FT   misc_feature    59889..59921
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(60142..63009)
FT                   /transl_table=11
FT                   /locus_tag="ROD_00511"
FT                   /product="putative adhesin autotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00511"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86832"
FT                   /db_xref="GOA:D2TGE8"
FT                   /db_xref="InterPro:IPR004899"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR013425"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGE8"
FT                   /protein_id="CBG86832.1"
FT                   /translation="MVNKCFSLNHATRILKQIFPAVILFTPIISHAETIISESTSTPQT
FT                   FAEDSSFTINKDVTISSSSDEAAVTMNSTMISSMTNKGNISGTGDALYVNTGAQRVTIT
FT                   NDEQAVISSTTANAINIRSLRGDIVNNGKITGATNGIYIGPGLSGLNITNSETGNITGT
FT                   TGIYTKSGLGLDNTGVIKGTNGDGIHSESGDAKITNTSTISGTRYGIYASNTTKMDIIS
FT                   SGIISGKEAAIFFNSASINTLTLDTGSELVGNVVSAVSKENTITLIGSGSEDSSFIGLE
FT                   EDDGFASLTMKGKDWSLTGDVDLIGTGETLLVNSGKLTLGGNVANSGSTHIQQNATLQL
FT                   GDGQKKASLTGKVINEGTFIFNQGENSTYSGDITGSGNVEKTDANVLTLSGNNTYTGNT
FT                   QLHAGVTLVAEGATLGAEGSNATLTIEDGAAFASAGTVYDNIAILSGGTLAAWNAVAGN
FT                   SLSTSSTVDTINGNVSNSGTLLIGGQNNAVGNNFIINGDYTGAAGSRIVMNSKPGDDNA
FT                   PTDRLSIKGSSYGVSDLVVNNVGGMGALTVNGMEVINVGGNSNAEFTLAKPVVAGAWEY
FT                   NLFQHENGNWYLESKAASSDDDSDSNDGGNSGDDGNGGDSGNGGDGGNGGNGGNGDDDG
FT                   NGGDGGNSSPEIMAPEVGAYLGNYQAAQGMFLHKRDDRDQLTLRGEDDLNTWLYVKGRY
FT                   HENDVAGDKLSYDTTSTVLQIGTDFVSKPLDKGILHAGAMAGAGQAKTHSDSKNNARNA
FT                   QGKVDGFNVGIYATWQEDEKLRLGSYIDTWAAYSWYNNNVSSNRNDEDYNSEGFAASLE
FT                   AGHAWVIDSERQRTWKIEPQVQVIYSYLDQDNHTDPDGVRVTQLDNDSVFGRLGVKSSY
FT                   FDRQDVQAWQPYVAVNWLKGAGQNELAFNSESISNDTPEDRGQLELGVTGNLNETTTFS
FT                   VRISGEWGKNSYDAYGGHILLNHRW"
FT   misc_feature    complement(60172..60966)
FT                   /locus_tag="ROD_00511"
FT                   /note="HMMPfam hit to PF03797, Autotransporter
FT                   beta-domain,score 2.9e-24"
FT                   /inference="protein motif:PFAM:PF03797"
FT   misc_feature    complement(61240..61614)
FT                   /locus_tag="ROD_00511"
FT                   /note="HMMPfam hit to PF03212, Pertactin, score 0.00051"
FT                   /inference="protein motif:PFAM:PF03212"
FT   sig_peptide     complement(62914..63009)
FT                   /locus_tag="ROD_00511"
FT                   /note="Signal peptide predicted for ROD00511 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.733) with cleavage site
FT                   probability 0.732 between residues 32 and 33"
FT   CDS_pept        63395..63925
FT                   /transl_table=11
FT                   /gene="kefF"
FT                   /locus_tag="ROD_00521"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   ancillary protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00521"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86833"
FT                   /db_xref="GOA:D2TGF0"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023948"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGF0"
FT                   /protein_id="CBG86833.1"
FT                   /translation="MILIIYAHPYPQHSHANKRMLEQVRTLEEVEIRSLYQLYPDFNID
FT                   IAAEQQALSRADLIIWQHPMQWYSVPPLLKLWFDKVLSHGWAYGHGGTALRGKQVMWAV
FT                   TTGGGEGHFDIGSYPGFDVLSQPLQATALYCGLNWLPPFAMHCTFSCDDETLQAQARQY
FT                   RQRLLSWLETHHG"
FT   misc_feature    63398..63910
FT                   /gene="kefF"
FT                   /locus_tag="ROD_00521"
FT                   /note="HMMPfam hit to PF02525, Flavodoxin-like fold, score
FT                   2.9e-54"
FT                   /inference="protein motif:PFAM:PF02525"
FT   CDS_pept        63918..65792
FT                   /transl_table=11
FT                   /gene="kefC"
FT                   /locus_tag="ROD_00531"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00531"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86834"
FT                   /db_xref="GOA:D2TGF1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR023941"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGF1"
FT                   /protein_id="CBG86834.1"
FT                   /translation="MDSHTLIQALIYLGSAALIVPVAVRLGLGSVLGYLIAGCIIGPWG
FT                   LRLVTDAESILHFAEIGVVLMLFVIGLELDPQRLWKLRASVFGGGALQMAVCGGLIGLF
FT                   CALLGLRWPVAALTGMTLALSSTAIAMQAMNERNLTVSQMGRSAFAVLLFQDIAAIPLV
FT                   AMIPLLATSGAATTLGAFALSALKVAGALVLVILLGRYVTRPALRFVARSGLREVFSAV
FT                   ALFLVFGFGLLLEEVGLSMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVG
FT                   MSIDFGTLIENPLRIAILLAGFLVIKIGILWLIARPLSVPNKQRRWFAVLLGQGSEFAF
FT                   VVFGAARMAEVLDPEWAKALTLAVALSMAATPVLLVILSRLEASAAGDEREADEIDEEQ
FT                   PRVIIAGFGRFGQIAGRLLLSSGVKMVVLDHDPDHIETLRKFGMKVFYGDATRMELLES
FT                   AGAAKAEVLINAIDDPQTSLQLTEMVKAHFPNLHIIARARDVDHYIRLRQVGVAQPERE
FT                   TFEGALKSGRLALESLGLGRYEARERAYLFRRYNTRMVEEMAKGENDATSRAAVYKRTS
FT                   AMLSEIITEDREHLSLIQRHGWQGTEEGKHTGNPADEPEVKPSARVKV"
FT   misc_feature    join(63930..63989,63993..64052,64080..64139,64173..64241,
FT                   64251..64319,64356..64424,64452..64520,64557..64616,
FT                   64626..64679,64716..64784,64794..64862,64896..64964,
FT                   64992..65060)
FT                   /gene="kefC"
FT                   /locus_tag="ROD_00531"
FT                   /note="13 probable transmembrane helices predicted for
FT                   ROD00531 by TMHMM2.0 at aa 5-24, 26-45, 55-74,
FT                   86-108,112-134, 147-169, 179-201, 214-233, 237-254,
FT                   267-289,293-315, 327-349 and 359-381"
FT   misc_feature    63945..65045
FT                   /gene="kefC"
FT                   /locus_tag="ROD_00531"
FT                   /note="HMMPfam hit to PF00999, Sodium/hydrogen
FT                   exchanger,score 3.6e-68"
FT                   /inference="protein motif:PFAM:PF00999"
FT   misc_feature    64002..64034
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    65121..65459
FT                   /gene="kefC"
FT                   /locus_tag="ROD_00531"
FT                   /note="HMMPfam hit to PF02254, TrkA-N, score 1.8e-34"
FT                   /inference="protein motif:PFAM:PF02254"
FT   CDS_pept        65839..65973
FT                   /transl_table=11
FT                   /locus_tag="ROD_00541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00541"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86835"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGF2"
FT                   /protein_id="CBG86835.1"
FT                   /translation="MPGVHYQVVDSPAERKIFVLLLFSSVDERMLFTYSGDNFFVSGK"
FT   CDS_pept        65977..66456
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="ROD_00551"
FT                   /product="dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00551"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86836"
FT                   /db_xref="GOA:D2TGF3"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGF3"
FT                   /protein_id="CBG86836.1"
FT                   /translation="MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRH
FT                   TWESIGRPLPGRKNIVISSQPGTDDRVQWVKSVDEAIAACGDAPEIMVIGGGRVYEQFL
FT                   PKAQKLYLTHIDAEVEGDTHFPDYDPDDWESVFSEFHDADAQNSHSYCFEILERR"
FT   misc_feature    65977..66450
FT                   /gene="folA"
FT                   /locus_tag="ROD_00551"
FT                   /note="HMMPfam hit to PF00186, Dihydrofolate reductase
FT                   region, score 4.5e-59"
FT                   /inference="protein motif:PFAM:PF00186"
FT   misc_feature    65995..66024
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   misc_feature    66013..66081
FT                   /note="PS00075 Dihydrofolate reductase signature."
FT                   /inference="protein motif:Prosite:PS00075"
FT   CDS_pept        complement(66501..67349)
FT                   /transl_table=11
FT                   /gene="apaH"
FT                   /locus_tag="ROD_00561"
FT                   /product="bis(5'-nucleosyl)-tetraphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00561"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86837"
FT                   /db_xref="GOA:D2TGF4"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGF4"
FT                   /protein_id="CBG86837.1"
FT                   /translation="MATYLIGDVHGCYDELIALLDQVTFTPESDTLWLTGDLVARGPGS
FT                   LDVLRFVKSLDDSVRLVLGNHDLHLLAVFAGISRNKPKDRLNALLEAPDADELLNWLRR
FT                   QPLLQVDEGKKLVMAHAGITPQWDLQTARECARDVEAVLSSDSYPFFLDAMYGDMPNNW
FT                   SPELSGLARLRFITNAFTRMRYCFPNGQLDMYSKESPENAPAPLKPWFAIPGPVSEEYS
FT                   IVFGHWASLEGKGTPEGIYALDTGCCWGGELTCLRWEDKRYFVQPSNRQMDLGEGEAVN
FT                   A"
FT   misc_feature    complement(66900..67349)
FT                   /gene="apaH"
FT                   /locus_tag="ROD_00561"
FT                   /note="HMMPfam hit to PF00149, Metallophosphoesterase,score
FT                   5e-17"
FT                   /inference="protein motif:PFAM:PF00149"
FT   CDS_pept        complement(67360..67737)
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="ROD_00571"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00571"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86838"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGF5"
FT                   /protein_id="CBG86838.1"
FT                   /translation="MINSPRVCVQVQSVYIEAQSSPEDERYVFAYTVTIRNLGRAPVQL
FT                   LGRYWLITNGHGRETEVQGEGVVGMQPHIAPGEEYQYTSGAVIETPLGTMQGHYEMIDE
FT                   NGVAFTIDIPVFRLAVPTLIH"
FT   misc_feature    complement(67375..67737)
FT                   /gene="apaG"
FT                   /locus_tag="ROD_00571"
FT                   /note="HMMPfam hit to PF04379, ApaG, score 8.2e-77"
FT                   /inference="protein motif:PFAM:PF04379"
FT   CDS_pept        complement(67740..68561)
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="ROD_00581"
FT                   /product="dimethyladenosine transferase
FT                   (S-adenosylmethionine-6-N',N'-adenosyl (rRNA)
FT                   dimethyltransferase)"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00581"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86839"
FT                   /db_xref="GOA:D2TGF6"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGF6"
FT                   /protein_id="CBG86839.1"
FT                   /translation="MNNRVHQGHLARKRFGQNFLNDQFVIDSIVSAINPQKGQAMVEIG
FT                   PGLAALTEPVGERLDRLTVIELDRDLAARLQTHPFLGPKLTIYQQDAMTMNFGELAEKM
FT                   GQPLRVFGNLPYNISTPLMFHLFSYTDAIADMHFMLQKEVVNRLVAGPNSKAYGRLSVM
FT                   AQYYCNVIPVLEVPPSAFTPPPKVDSAVVRLVPHATMPYPVKDIRVLSRITTEAFNQRR
FT                   KTIRNSLGNLFSVEVLTELGVDPAMRAENISVAQYCRMANYLAENAPLKES"
FT   misc_feature    complement(67764..68540)
FT                   /gene="ksgA"
FT                   /locus_tag="ROD_00581"
FT                   /note="HMMPfam hit to PF00398, Ribosomal RNA adenine
FT                   methylase transferase, score 2e-108"
FT                   /inference="protein motif:PFAM:PF00398"
FT   misc_feature    complement(68358..68441)
FT                   /note="PS01131 Ribosomal RNA adenine dimethylases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01131"
FT   CDS_pept        complement(68558..69547)
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="ROD_00591"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00591"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86840"
FT                   /db_xref="GOA:D2TGF7"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGF7"
FT                   /protein_id="CBG86840.1"
FT                   /translation="MTVARRVVITPGEPAGIGPDLLVQLAQREWPVELVVCADPTLLTE
FT                   RAALLGLPLSLLPYAPHSPATPQAVGTLTLLPIALRASVTPGRLAVENGEYVVQTLARA
FT                   CDGCLQGEFAALITGPVHKGVINDAGVPFTGHTEFFEQRSQTKKVVMMLATEELRVALA
FT                   TTHLPLRDVADAITPELLHEVIGILHHDLRSKFGVADPRILVCGLNPHAGEGGHMGTEE
FT                   IDTINPVLDTLRKQGMKLTGPLPADTLFQPKYLQQADAVLAMYHDQGLPVLKYQGFGRG
FT                   VNITLGLPFIRTSVDHGTALELAGRGEADVGSFITALNLAIKMIVNTQ"
FT   misc_feature    complement(68582..69475)
FT                   /gene="pdxA"
FT                   /locus_tag="ROD_00591"
FT                   /note="HMMPfam hit to PF04166, Pyridoxal phosphate (active
FT                   vitamin B6) biosynthesis PdxA, score 4.7e-179"
FT                   /inference="protein motif:PFAM:PF04166"
FT   CDS_pept        complement(69547..70833)
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="ROD_00601"
FT                   /product="chaperone precursor (peptidyl-prolyl cis-trans
FT                   isomerase)"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00601"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86841"
FT                   /db_xref="GOA:D2TGF8"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGF8"
FT                   /protein_id="CBG86841.1"
FT                   /translation="MKNWKTLLLGIAMIANTSFAAPQVVDKVAAVVNNGVVLESDVDGL
FT                   MQSVKLNASQAGQQLPDDATLRHQILERLIMDQIVLQMGQKMGVKISDEQLDQAIANIA
FT                   RQNNMTLDQMRSRLAYDGLNYSTYRNQIRKEMIISEVRNNEVRRRVTILPQEVEALAQQ
FT                   VGNQNDASTELNLSHILIPLPENPTSDQVSEAEAQARSIVDQARSGSDFGKLAIAYSAD
FT                   QQALKGGQMGWGRIQELPGIFAQALSTAKKGDVVGPIRSGVGFHILKVNDMRGQNQSIS
FT                   VTEVHARHILLKPSPIMTDQQARQKLEQIAADIKSGKTTFAAAAKEFSQDPGSANQGGD
FT                   LGWAAADIFDPAFRDALTRMNKGQISAPVHSSFGWHLIELLDTRSVDKTDAAQKDRAYR
FT                   MLMNRKFSEEAATWMQEQRASAYVKILSN"
FT   misc_feature    complement(69688..69969)
FT                   /gene="surA"
FT                   /locus_tag="ROD_00601"
FT                   /note="HMMPfam hit to PF00639, Peptidyl-prolyl cis-trans
FT                   isomerase, PpiC-type, score 2.3e-49"
FT                   /inference="protein motif:PFAM:PF00639"
FT   misc_feature    complement(69808..69873)
FT                   /note="PS01096 PpiC-type peptidyl-prolyl cis-trans
FT                   isomerase signature."
FT                   /inference="protein motif:Prosite:PS01096"
FT   misc_feature    complement(69877..69900)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(70018..70302)
FT                   /gene="surA"
FT                   /locus_tag="ROD_00601"
FT                   /note="HMMPfam hit to PF00639, Peptidyl-prolyl cis-trans
FT                   isomerase, PpiC-type, score 1.7e-41"
FT                   /inference="protein motif:PFAM:PF00639"
FT   misc_feature    complement(70138..70200)
FT                   /note="PS01096 PpiC-type peptidyl-prolyl cis-trans
FT                   isomerase signature."
FT                   /inference="protein motif:Prosite:PS01096"
FT   misc_feature    complement(70351..70761)
FT                   /gene="surA"
FT                   /locus_tag="ROD_00601"
FT                   /note="HMMPfam hit to PF09312, SurA N-terminal domain,score
FT                   2.1e-88"
FT                   /inference="protein motif:PFAM:PF09312"
FT   sig_peptide     complement(70774..70833)
FT                   /gene="surA"
FT                   /locus_tag="ROD_00601"
FT                   /note="Signal peptide predicted for ROD00601 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 20 and 21"
FT   CDS_pept        complement(70887..73244)
FT                   /transl_table=11
FT                   /gene="imp"
FT                   /locus_tag="ROD_00611"
FT                   /product="organic solvent tolerance protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00611"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86842"
FT                   /db_xref="GOA:D2TGF9"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGF9"
FT                   /protein_id="CBG86842.1"
FT                   /translation="MKKRIPTLLATMIATALYSQQGLAASLASQCMLGVPSYDRPLVQG
FT                   ETNELPVTINADSAKGNYPDDAVFTGNVDIMQGNSRLQADEVQLHQKAAPGQQEPIRTV
FT                   DALGNVHYDDNQVILKGPKGWANLNTKDTNVWKGDYQMVGRQGRGKADLMKQRGENRYT
FT                   ILENGSFTSCLPGSDTWSVVGSEVIHDREEQVAEIWNARFKVGPVPIFYSPYLQLPVGD
FT                   KRRSGFLIPNAKYTSKNYFEFYLPYYWNIAPNMDATITPHYMHRRGGIMWENEFRYLSQ
FT                   AGAGLMEFDYLNSDDVYEDEHPQDDNSRRWLFYWQHSGVMDQVWRFNIDYTKVSDPTYF
FT                   NDFDNKYGSSTDGYATQKFSVGYAVQNFDATVSSKQFQVFDTRNSNSYSAQPQLDVNYY
FT                   HNDLGPFDTRIYGQAVHFVNTNDNRPEATRLHLEPTINLPLSNAWGSLNTEAKLLATHY
FT                   QQTNLDWYNNTYKNTPLDDSANRVMPQFKVDGKMVFERDMNMLAPGYTQTMEPRVQYLY
FT                   VPYRDQSKIYNYDSSLLQSDYTGLFRDRTYGGLDRIASANQVTTGVTSRVYDDATVERF
FT                   NISVGQIYYFTESRTGDDNIKWENDDQKGSLVWAGDTYWRISDRWGLRGGIQYDTRLDS
FT                   VATSSSSIEYRRDEDRMLQLNYRYASPEYIQATLPSYYSTAEQYRNGISQIGSVASWPI
FT                   ADRWSIVGAYYYDTNVNKPADQMLGLQYNSCCYAIRVGYERKLNGWDNDKEHAVYDNII
FT                   GFNIELRGLSSNYGLGTTEMLRSNILPYQSSL"
FT   misc_feature    complement(71151..72323)
FT                   /gene="imp"
FT                   /locus_tag="ROD_00611"
FT                   /note="HMMPfam hit to PF04453, Organic solvent tolerance
FT                   protein, score 4.9e-150"
FT                   /inference="protein motif:PFAM:PF04453"
FT   misc_feature    complement(72660..73229)
FT                   /gene="imp"
FT                   /locus_tag="ROD_00611"
FT                   /note="HMMPfam hit to PF03968, OstA-like protein, score
FT                   1.2e-66"
FT                   /inference="protein motif:PFAM:PF03968"
FT   sig_peptide     complement(73173..73244)
FT                   /gene="imp"
FT                   /locus_tag="ROD_00611"
FT                   /note="Signal peptide predicted for ROD00611 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.987 between residues 24 and 25"
FT   CDS_pept        73499..74314
FT                   /transl_table=11
FT                   /gene="djlA"
FT                   /locus_tag="ROD_00621"
FT                   /product="DnaJ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00621"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86843"
FT                   /db_xref="GOA:D2TGG0"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR023749"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGG0"
FT                   /protein_id="CBG86843.1"
FT                   /translation="MQYWGKIIGVAVALIMGGGFWGVVLGLLIGHMFDKARSRKMAWFA
FT                   NQRERQALFFATTFEVMGHLTKSKGRVTEADIHIANVLMDRMNLHGESRSAAQNAFRVG
FT                   KSDNYPLREKMRQFRSVCFGRFDLIRMFLEIQIQAAFADGSLHPNEREVLYVIAEELGI
FT                   SRMQFEQFLRMMQGGAQFGGGYQQQSGSGSWQQAQRGPTLEDACNVLGVKPTDDATTIK
FT                   RAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQKAYELIKEQKGFK"
FT   misc_feature    73517..73585
FT                   /gene="djlA"
FT                   /locus_tag="ROD_00621"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD00621 by TMHMM2.0 at aa 7-29"
FT   misc_feature    73952..74017
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1088.000, SD 2.89 at aa 152-173, sequence
FT                   EVLYVIAEELGISRMQFEQFLR"
FT   misc_feature    74123..74284
FT                   /gene="djlA"
FT                   /locus_tag="ROD_00621"
FT                   /note="HMMPfam hit to PF00226, Heat shock protein
FT                   DnaJ,N-terminal, score 2.3e-12"
FT                   /inference="protein motif:PFAM:PF00226"
FT   CDS_pept        complement(74424..75083)
FT                   /transl_table=11
FT                   /gene="rluA"
FT                   /locus_tag="ROD_00631"
FT                   /product="ribosomal large subunit pseudouridine synthase A"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00631"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86844"
FT                   /db_xref="GOA:D2TGG2"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGG2"
FT                   /protein_id="CBG86844.1"
FT                   /translation="MGMENYNPPREPWLVVLYQDEHIMVVNKPSGLLSVPGRLEEHKDS
FT                   IMTRIQRDYPQAESVHRLDMATSGVIVVALTKAAERELKRQFREREPKKQYVARVWGHP
FT                   VPAEGVVDLPLICDWPNRPKQKVCYETGKAAQTGYEVVEYAADNTARVVLKPTTGRSHQ
FT                   LRVHMLALGHPILGDRFYASPEALAMAPRLLLHAEMLTITHPAYGNSMTFKAPADF"
FT   misc_feature    complement(74574..75020)
FT                   /gene="rluA"
FT                   /locus_tag="ROD_00631"
FT                   /note="HMMPfam hit to PF00849, Pseudouridine synthase,score
FT                   1.3e-59"
FT                   /inference="protein motif:PFAM:PF00849"
FT   misc_feature    complement(74862..74906)
FT                   /note="PS01129 Rlu family of pseudouridine synthase
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01129"
FT   CDS_pept        complement(75095..78001)
FT                   /transl_table=11
FT                   /gene="rapA"
FT                   /locus_tag="ROD_00641"
FT                   /product="RNA polymerase-associated protein"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00641"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86845"
FT                   /db_xref="GOA:D2TGG3"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGG3"
FT                   /protein_id="CBG86845.1"
FT                   /translation="MPFTLGQRWISDTESELGLGTVVAMDARTVTLLFPSTGENRLYAR
FT                   SDSPVTRVMFNPGDTITNHEGWQLHVEEVKEENGLLAYIGTRLDTEENGVMLREVLLDS
FT                   KLVFSKPQDRLFAGQIDRMDRFALRYRARKFQSEQYRMPWSGLRGQRTSLIPHQLNIAH
FT                   DVGRRHAPRVLLADEVGLGKTIEAGMILHQQLLSGAAERVLIIVPETLQHQWLVEMLRR
FT                   FNLRFALFDDERYAEAQHDAYNPFETEQLVICSLDFARRNKQRLEHLCEAEWDLLVVDE
FT                   AHHLVWSVDAPSREYQAIEQLAEHIPGVLLLTATPEQLGMESHFARLRLLDPDRFHDFT
FT                   QFVEEQKNYRPVADAVAMLLAGNKLSNEELNMLGELIGEQDIEPLLQAANSDRDGAQSA
FT                   REELVSMLMDRHGTSRVLFRNTRNGVKGFPKRELHTIKLPLPTQYQTAIKVSGIMGARK
FT                   SAEDRARDMLYPEQIYQEFEGDSGTWWNFDPRVEWLMGYLTSHRSQKVLVICAKATTAL
FT                   QLEQVLREREGIRAAVFHEGMSIIERDRAAAWFGEEDSGAQVLLCSEIGSEGRNFQFAS
FT                   NLVMFDLPFNPDLLEQRIGRLDRIGQAHDIQIHVPYLEKTAQSVLVRWYHEGLDAFEHT
FT                   CPTGRAIYDSVYHNLIGYLAAPEEADGFDELIKACREQHEALKAQLEQGRDRLLEIHSN
FT                   GGEKAQKLAESIEEQDDDTSLIAFAMNLFDIVGINQDDRGENLIVLTPSDHMLVPDFPG
FT                   LPEDGCTITFERDVALSREDAQFITWEHPLIRNGLDLILSGDTGSSTISLLKNKALPVG
FT                   TLLLELVYVVEAQAPKQLQLNRFLPPTPVRMLLDKNGNNLAAQVEFETFNRQLSAVNRH
FT                   TGSKLVNAVQQDVHAILQQGEAQIEKSARALIEAARNEADEKLSAELSRLEALRAVNPN
FT                   IRDDELAAIESNRQQVLESLSQAGWRLDALRLIVVTHQ"
FT   misc_feature    complement(76199..76435)
FT                   /gene="rapA"
FT                   /locus_tag="ROD_00641"
FT                   /note="HMMPfam hit to PF00271, DNA/RNA helicase,C-terminal,
FT                   score 3.2e-19"
FT                   /inference="protein motif:PFAM:PF00271"
FT   misc_feature    complement(76640..77533)
FT                   /gene="rapA"
FT                   /locus_tag="ROD_00641"
FT                   /note="HMMPfam hit to PF00176, SNF2-related, score 1.7e-86"
FT                   /inference="protein motif:PFAM:PF00176"
FT   CDS_pept        complement(78200..80551)
FT                   /transl_table=11
FT                   /gene="polB"
FT                   /locus_tag="ROD_00651"
FT                   /product="DNA polymerase II"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00651"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86846"
FT                   /db_xref="GOA:D2TGG5"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGG5"
FT                   /protein_id="CBG86846.1"
FT                   /translation="MAQAGFILTRHWRDTPQGTEISFWLATDSGPLLASLAPQESVAFI
FT                   PEQHVPRVKSLLGSENGFRLTPLNLKDFHRQPVSGLYCRSHRQLMRLEKLLRENGVTVY
FT                   EGDVRPPERYLMERFITAPVWVDGEARDGALVNARLKPHPDYRPPLRWLSLDIETTRHG
FT                   ELYCIGLEGCGQRIVYMLGPANGDASGLDFQLEYVTSRPQLLEKLNEWIARHDPDVIIG
FT                   WNLVQFDLRMLQKHAERYRIPLRFGRDSSELEWREHGFKNGVYFAQAKGRLIIDGIEAL
FT                   KSAFWNFSSFSLEAVSQELLGEGKSIDNPWDRMDEIDRRFAEDKPALATYNLKDCELVT
FT                   KIFHKTEIMPFLLERATVNGLPVDRHGGSVAAFGHLYFPRMHRAGYVAPNLGEVPPHAS
FT                   PGGYVMDSRPGLYDSVLVLDYKSLYPSIIRTFLIDPVGLVEGMAHPDPQHSTEGFLDAW
FT                   FSREKHCLPEIVTAIWHGRDEAKRQGNKPLSQALKIIMNAFYGVLGTTACRFFDPRLAS
FT                   SITMRGHAIMRQTKALIEAQGYDVIYGDTDSTFVWLKRARSEEEAAQIGRSLVAHVNAW
FT                   WQQELQRQNLTSALELEYETHFCRFLMPTIRGADTGSKKRYAGLIQEGDAQRMVFKGLE
FT                   TVRTDWTPLAQQFQQELYLRIFRHEPYQDYVRETIDKLMAGELDDRLVYRKRLRRPLSE
FT                   YQRNVPPHVRAARLADEENLKRGRPAQYQNRGTIQYLWTVNGPEPRDYQRSPLDYEHYL
FT                   TRQLQPVAEGILPFIDDNFATLLTGQLGLF"
FT   misc_feature    complement(78431..79084)
FT                   /gene="polB"
FT                   /locus_tag="ROD_00651"
FT                   /note="HMMPfam hit to PF00136, DNA polymerase, B
FT                   region,score 1e-30"
FT                   /inference="protein motif:PFAM:PF00136"
FT   misc_feature    complement(78899..78925)
FT                   /note="PS00116 DNA polymerase family B signature."
FT                   /inference="protein motif:Prosite:PS00116"
FT   misc_feature    complement(79028..79060)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(79664..80479)
FT                   /gene="polB"
FT                   /locus_tag="ROD_00651"
FT                   /note="HMMPfam hit to PF03104, DNA polymerase
FT                   B,exonuclease, score 1.4e-54"
FT                   /inference="protein motif:PFAM:PF03104"
FT   CDS_pept        80956..81339
FT                   /transl_table=11
FT                   /locus_tag="ROD_00661"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00661"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86847"
FT                   /db_xref="InterPro:IPR031855"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGG6"
FT                   /protein_id="CBG86847.1"
FT                   /translation="MNVCNHMQQSDYLNYFFVNTLIVRPYLKTVSRFIEYKTWTGQIWR
FT                   SEVIEDGNAFFHWQGTDRINGHRDTVINYFLHGQKWQSTITDYIFFHSLEGEEVRGYFD
FT                   NVIKYVSPNSFMLKSTFAECVPE"
FT   CDS_pept        complement(81375..82070)
FT                   /transl_table=11
FT                   /gene="araD"
FT                   /locus_tag="ROD_00671"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /EC_number="5.1.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00671"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86848"
FT                   /db_xref="GOA:D2TGG7"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR004661"
FT                   /db_xref="InterPro:IPR033748"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGG7"
FT                   /protein_id="CBG86848.1"
FT                   /translation="MLEDLKRQVLEANLALPQHNLVTLTWGNVSAVDRERGVFVIKPSG
FT                   VDYSVMSAEDMVVVSIATGEVVEGTKKPSSDTPTHRLLYQAFPTIGGIVHTHSRHATIW
FT                   AQAGQSIPATGTTHADYFYGAIPCTRKMTDAEINGEYEWETGNVIVETFEKQGIDAAHM
FT                   PGVLVHSHGPFAWGKNAEDAVHNAIVLEEVAYMGIFCRQLAPQLPEMQQTLLDKHYLRK
FT                   HGAKAYYGQ"
FT   misc_feature    complement(81417..82052)
FT                   /gene="araD"
FT                   /locus_tag="ROD_00671"
FT                   /note="HMMPfam hit to PF00596, Class II
FT                   aldolase/adducin,N-terminal, score 6.9e-107"
FT                   /inference="protein motif:PFAM:PF00596"
FT   CDS_pept        complement(82296..83798)
FT                   /transl_table=11
FT                   /gene="araA"
FT                   /locus_tag="ROD_00691"
FT                   /product="L-arabinose isomerase"
FT                   /EC_number="5.3.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00691"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86849"
FT                   /db_xref="GOA:D2TGG8"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGG8"
FT                   /protein_id="CBG86849.1"
FT                   /translation="MTIFDNYEVWFVIGSQHLYGPETLRQVTQHAEHVVKALNAEAKLP
FT                   CKLVLKPLGTTPDEITAICRDANYDDRCAGLVVWLHTFSPAKMWINGLTTLNKPLLQFH
FT                   TQFNAALPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHAVVTGHWQDKQAQARIGSW
FT                   MRHAVSKQDTRHLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSIS
FT                   DGDINALIDEYESSYTLTPATQIHGEKRQNVLEAARIELGMKRFLEQGGFHAFTTTFED
FT                   LHGLKQLPGLAVQRLMQQGYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFE
FT                   KGNDLVLGSHMLEVCPTIAVEEKPILDVQHLGIGGKDDPARLIFNTQTGPAIVASLIDL
FT                   GDRYRLLVNCIDTVKTPHSLPKLPVANALWKAQPDLPTASEAWILAGGAHHTVFSHALD
FT                   LNDMRQFAEMHDIEIAVIDNDTRLPAFKDALRWNEVYYGFKR"
FT   misc_feature    complement(82299..83798)
FT                   /gene="araA"
FT                   /locus_tag="ROD_00691"
FT                   /note="HMMPfam hit to PF02610, L-arabinose isomerase, score
FT                   0"
FT                   /inference="protein motif:PFAM:PF02610"
FT   CDS_pept        complement(83809..85518)
FT                   /transl_table=11
FT                   /gene="araB"
FT                   /locus_tag="ROD_00701"
FT                   /product="ribulokinase"
FT                   /EC_number="2.7.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00701"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86850"
FT                   /db_xref="GOA:D2TGG9"
FT                   /db_xref="InterPro:IPR005929"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGG9"
FT                   /protein_id="CBG86850.1"
FT                   /translation="MAIAIGLDFGSDSVRALAVDCATGDEVATSVEWYPRWQEGRYCDG
FT                   PNNQFRHHPRDYIESMEAALKSVLAALSAAQRAEVVGIGVDSTGSTPAPIDADGNVLAL
FT                   RPEFADNPNAMFVLWKDHTAVEEAEAITRLCHTPGKVDYSRYIGGIYSSEWFWAKILHV
FT                   TRQDSAVAQAAVSWIELCDWVPALLSGTTRPQEIRRGRCSAGHKSLWHESWGGLPPASF
FT                   FDELDPIINQHLAYPLFTETFTADLPVGTLCADWAQRLGLPQSVVISGGAFDCHMGAVG
FT                   AGAQPNALVKVIGTSTCDILIADRQSVGERAVKGICGQVDGSVVPGFIGLEAGQSAFGD
FT                   IYAWFGRVLGWPLEQLAAQHPELKTQIQASQKQLLPALTEAWAKNPSLDHLPVVLDWFN
FT                   GRRTPNANQRLKGVITDLNLATDAPALFGGLIAATAFGARAIMECFTEQGIAVNNVMAL
FT                   GGIARKNKVIMQACCDVLNRPLQIVASDQCCALGAAIFAAVAARVHTDIPAAQQKMASA
FT                   VENTLQPSAEQAQRFEQLYRRYQQWAVSAEQHYLPTAAPVINAPADQAILTH"
FT   misc_feature    complement(83935..84204)
FT                   /gene="araB"
FT                   /locus_tag="ROD_00701"
FT                   /note="HMMPfam hit to PF02782, Carbohydrate kinase,
FT                   FGGY,score 2.4e-07"
FT                   /inference="protein motif:PFAM:PF02782"
FT   misc_feature    complement(84676..85512)
FT                   /gene="araB"
FT                   /locus_tag="ROD_00701"
FT                   /note="HMMPfam hit to PF00370, Carbohydrate kinase,
FT                   FGGY,score 1.2e-05"
FT                   /inference="protein motif:PFAM:PF00370"
FT   CDS_pept        85857..86735
FT                   /transl_table=11
FT                   /gene="araC"
FT                   /locus_tag="ROD_00711"
FT                   /product="arabinose operon regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00711"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86851"
FT                   /db_xref="GOA:D2TGH0"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGH0"
FT                   /protein_id="CBG86851.1"
FT                   /translation="MAEPQNDPLLPGYSFNAHLVAGLTPIDANGYLDFFIDRPLGMKGY
FT                   ILNLTIRGEGVINNQGRQFVCRPGDILLFPPGEIHHYGRHPEASQWYHQWVYFRPRAYW
FT                   QEWLAWPSIFAQTGFFRPDEALQPHFNELFGQIISAGQGEGRYSELLAINLLEQLLLRR
FT                   MEAINASLHPPMDSRVRDACQYISDHLADSHFDIASVAQHVCLSPSRLSHLFRQQLGIS
FT                   VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE
FT                   EKVNDVSVKVS"
FT   misc_feature    85914..86342
FT                   /gene="araC"
FT                   /locus_tag="ROD_00711"
FT                   /note="HMMPfam hit to PF02311, AraC
FT                   protein,arabinose-binding/dimerisation, score 1.1e-28"
FT                   /inference="protein motif:PFAM:PF02311"
FT   misc_feature    86397..86540
FT                   /gene="araC"
FT                   /locus_tag="ROD_00711"
FT                   /note="HMMPfam hit to PF00165, Helix-turn-helix, AraC
FT                   type,score 2.6e-11"
FT                   /inference="protein motif:PFAM:PF00165"
FT   misc_feature    86439..86504
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1779.000, SD 5.25 at aa 195-216, sequence
FT                   FDIASVAQHVCLSPSRLSHLFR"
FT   misc_feature    86547..86675
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00041"
FT   misc_feature    86556..86690
FT                   /gene="araC"
FT                   /locus_tag="ROD_00711"
FT                   /note="HMMPfam hit to PF00165, Helix-turn-helix, AraC
FT                   type,score 4.8e-12"
FT                   /inference="protein motif:PFAM:PF00165"
FT   CDS_pept        86821..87588
FT                   /transl_table=11
FT                   /locus_tag="ROD_00721"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00721"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86852"
FT                   /db_xref="GOA:D2TGH1"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGH1"
FT                   /protein_id="CBG86852.1"
FT                   /translation="MQAFLEHFILQSAMYALIAVVLVAFLESLALVGLILPGTVLMAGL
FT                   GALIGSGELNFWHAWLAGIIGCLLGDWISFWLGWRFKKPLHRWSFLKKHKALLDKTEHA
FT                   LHQHSMFTILVGRFVGPTRPLVPMVAGMLDLPVAKFITPNIIGCLLWPPFYFLPGILAG
FT                   AAIDIPPGMQSGEFKWLLLATAIVLWLGGWLCWRLWRSGKAGTDRLSQYLPKARLLWLA
FT                   PGVLALGVVALVLLIRHPLMPVYVDILLKVVGV"
FT   misc_feature    join(86878..86946,86989..87057,87238..87306,87349..87417,
FT                   87475..87543)
FT                   /locus_tag="ROD_00721"
FT                   /note="5 probable transmembrane helices predicted for
FT                   ROD00721 by TMHMM2.0 at aa 20-42, 57-79, 140-162, 177-199
FT                   and 219-241"
FT   misc_feature    86926..87303
FT                   /locus_tag="ROD_00721"
FT                   /note="HMMPfam hit to PF09335, SNARE associated Golgi
FT                   protein, score 7.2e-05"
FT                   /inference="protein motif:PFAM:PF09335"
FT   misc_feature    86989..87021
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(87773..88483)
FT                   /transl_table=11
FT                   /gene="thiQ"
FT                   /locus_tag="ROD_00731"
FT                   /product="thiamine ABC transport system, ATP-binding
FT                   protein"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00731"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86853"
FT                   /db_xref="GOA:D2TGH2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005968"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGH2"
FT                   /protein_id="CBG86853.1"
FT                   /translation="MLKLTDITWLYHHLPMRFTLAVERGEQVAILGPSGAGKSTLLNLI
FT                   AGFLTPARGTLFIAGADHTATPPSRRPVSMLFQENNLFSHLNVAQNIGLGLDPGLKLSA
FT                   AQRDKRQRIAQQMGIDGLMDRLPGELSGGQRQRVALARCLVREQPVLLLDEPFSALDPA
FT                   LRQEMLTLVSDICRNQQLTMLMVSHSVEDAARIARRSVVVADGRIAWQGETQELLSGRA
FT                   SASALLGIKGHTVL"
FT   misc_feature    complement(87866..88411)
FT                   /gene="thiQ"
FT                   /locus_tag="ROD_00731"
FT                   /note="HMMPfam hit to PF00005, ABC transporter
FT                   related,score 4e-63"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    complement(88052..88096)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(88367..88390)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(88467..90077)
FT                   /transl_table=11
FT                   /gene="thiP"
FT                   /locus_tag="ROD_00741"
FT                   /product="thiamine ABC transport system, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00741"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86854"
FT                   /db_xref="GOA:D2TGH3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005947"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGH3"
FT                   /protein_id="CBG86854.1"
FT                   /translation="MATRRQPLIPGWLLPGLTAAALMTAVALAAFLALWLNAPQGEWRS
FT                   LWQDDYLWHVVRFSFWQAFLSALLSVVPAIFLARALYRRRFPGRLALLRLCAMTLILPV
FT                   LVAVFGILSVYGRQGWLASLWQAFGLEWTFSPYGLQGILLAHVFFNLPMATRLLLQSLE
FT                   NIPGEQRQLAAQLGIRGWHFFRFVEWPWLRRQIPPVAALIFMLCFASFATVLSLGGGPQ
FT                   ATTIELAIYQALSYDYDPARAAMLALIQMICCLALVLLSQRLSKAIAPGATLIQGWRDP
FT                   DDRPHSRITDALLIVFALLLLLPPLLAVIADGLNRHLPEVLAQPILWQAIWTSLRIALA
FT                   AGLLCVALTMMLLWSSRELRARQRLLAGQTLELSGMLILAMPGIVLATGFFLLLNNSTG
FT                   LPESADGIVLFTNALMAIPYALKVLENPMRDITSRYSMLCQSLGIEGWQRLKVVELRAL
FT                   KRPLAQALAFACVLSIGDFGVVALFGNDNFRTLPFYLYQQIGSYRSQDGAVTALLLLLL
FT                   CFLLFTVIEKLPGRNVKTD"
FT   misc_feature    complement(88473..89087)
FT                   /gene="thiP"
FT                   /locus_tag="ROD_00741"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component, score 0.00049"
FT                   /inference="protein motif:PFAM:PF00528"
FT   misc_feature    complement(join(88503..88556,88626..88694,88806..88859,
FT                   88902..88970,89007..89075,89133..89201,89298..89357,
FT                   89415..89483,89631..89699,89742..89810,89847..89915,
FT                   89973..90041))
FT                   /gene="thiP"
FT                   /locus_tag="ROD_00741"
FT                   /note="12 probable transmembrane helices predicted for
FT                   ROD00741 by TMHMM2.0 at aa 13-35, 55-77, 90-112,
FT                   127-149,199-221, 241-260, 293-315, 335-357, 370-392,
FT                   407-424,462-484 and 508-525"
FT   misc_feature    complement(89256..89924)
FT                   /gene="thiP"
FT                   /locus_tag="ROD_00741"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component, score 6.2e-07"
FT                   /inference="protein motif:PFAM:PF00528"
FT   sig_peptide     complement(89991..90077)
FT                   /gene="thiP"
FT                   /locus_tag="ROD_00741"
FT                   /note="Signal peptide predicted for ROD00741 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.957 between residues 29 and 30"
FT   CDS_pept        complement(90053..90997)
FT                   /transl_table=11
FT                   /gene="thiB"
FT                   /locus_tag="ROD_00751"
FT                   /product="thiamine ABC transport system, substrate-binding
FT                   protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00751"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86855"
FT                   /db_xref="GOA:D2TGH4"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGH4"
FT                   /protein_id="CBG86855.1"
FT                   /translation="MPVFAKPVLTVYTYDSFAADWGPGPAVKKAFEADCDCELKYVALE
FT                   DGVSLLNRLRMEGKNSKADVVLGLDNNLLEAATQTGLFAKTPIHTDAVNVPFNWNNDTF
FT                   IPYDYGWFAFVYDKTKLKNPPSSLKELVESPQKWRVIYEDPRTSTPGLGLMLWMKKVYG
FT                   DKAPEAWQKLAAKTVTVTKGWSEAYGLFLKGEGDLVLSYTTSPAYHLIEEKKEQYAAAN
FT                   FSEGHYVQVEVAARTVASKQPELASRFLRFILKPAFQKTIPTGNWMYPVTATPLPAGFE
FT                   QLTKPTTTLQFTSAEVAAQRQAWISEWQRAVSR"
FT   misc_RNA        complement(91068..91189)
FT                   /note="Rfam:RF00059;TPP;Score=57.72;positions 1 to 34"
FT   CDS_pept        complement(91223..92878)
FT                   /transl_table=11
FT                   /locus_tag="ROD_00761"
FT                   /product="putative substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00761"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86856"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGH5"
FT                   /protein_id="CBG86856.1"
FT                   /translation="MSSGRLQQQFIRLWQCCDGKTQDTTLNELAELLNCSRRHMRTLLN
FT                   TMQARGWLTWEAEVGRGKRSRLTFLYTGLALQQQRAEDLLEQDRIDQLVQLVGDKTAVR
FT                   QMLISHLGRSFRQGRHILRVLYYRPLQNLLPGTALRRSETHIARQIFSALTRVNEENGE
FT                   LEADIAHHWQQISPLHWRFFLRPGIHFHHGRELEMEDVIASLRRINDLPLYSHIAHIVS
FT                   PTPWTLDIHLSQPDRWLPLLLAQVPAMILPREWETLNNFASQPIGTGPYAVMRNTRNQL
FT                   KIHAFEDFFGYRALIDEVNVWVLPDICDERTGALTLKGPTDDEKAIESRLEEGCYYLLF
FT                   DARTHRGANQAVREWVSRILSPSNLLYYANEHYQRHWFPAYGLLPRWHHARPGHGEKPA
FT                   GLETLTLTFYRDHIEHQIIARIMSKLLAEHQVKLDIQEIDYDRWHAGDVESDIWLNSAN
FT                   FTLPLDFSLFAYLCEVPLLQHCIPLDWQADAARWRTGEMNLAAWCQQLLASKAIVPLIH
FT                   HWLIIEGQRSMRGLRMNTLGWFDFKSAWFAPPDP"
FT   misc_feature    complement(91403..92392)
FT                   /locus_tag="ROD_00761"
FT                   /note="HMMPfam hit to PF00496, Bacterial extracellular
FT                   solute-binding protein, family 5, score 1.1e-48"
FT                   /inference="protein motif:PFAM:PF00496"
FT   misc_feature    complement(92744..92809)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1534.000, SD 4.41 at aa 24-45, sequence
FT                   TTLNELAELLNCSRRHMRTLLN"
FT   misc_RNA        92946..93187
FT                   /note="Rfam:RF00534;SgrS;Score=153.87;positions 1 to 55"
FT   CDS_pept        93216..94394
FT                   /transl_table=11
FT                   /gene="setA"
FT                   /locus_tag="ROD_00781"
FT                   /product="sugar efflux transporter A"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00781"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86857"
FT                   /db_xref="GOA:D2TGE9"
FT                   /db_xref="InterPro:IPR004750"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGE9"
FT                   /protein_id="CBG86857.1"
FT                   /translation="MLWIMTMGRRLNGVYAAFMLVAFMMGIAGALQAPTLSLFLSREVG
FT                   AQPFWVGLFYTVNAIAGIGVSLALAKRSDSQGDRRKLIMFCCLMAIGNALLFAFNRHYL
FT                   TLITCGVLLASLANTAMPQLFALAREYADSSAREVVMFSSVMRAQLSLAWVIGPPLAFM
FT                   LALNYGFTVMFSIAAVIFVLSLLLIAFTLPSVARVEQPADVPVTRVSGWQDKNVRMLFI
FT                   ASTLMWTCNTMYIIDMPLWISAELGLPDKLAGILMGTAAGLEIPTMIVAGFYVKRFGKR
FT                   RMMVAAVAAGVLFYAGLIFFHSHSALLILQLFNAVFIGIIAGIGMLWFQDLMPGRAGSA
FT                   TTLFTNSISTGVILAGVIQGAVAQSYGHFAVYWVIAAISLVALVMTGRVKDV"
FT   sig_peptide     93216..93305
FT                   /gene="setA"
FT                   /locus_tag="ROD_00781"
FT                   /note="Signal peptide predicted for ROD00781 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.995) with cleavage site
FT                   probability 0.608 between residues 30 and 31"
FT   misc_feature    join(93246..93314,93357..93425,93459..93512,93525..93593,
FT                   93663..93731,93741..93809,93873..93941,93969..94037,
FT                   94062..94121,94134..94202,94239..94307,94320..94376)
FT                   /gene="setA"
FT                   /locus_tag="ROD_00781"
FT                   /note="12 probable transmembrane helices predicted for
FT                   ROD00781 by TMHMM2.0 at aa 11-33, 48-70, 82-99,
FT                   104-126,150-172, 176-198, 220-242, 252-274, 283-302,
FT                   307-329,342-364 and 369-387"
FT   misc_feature    93267..94307
FT                   /gene="setA"
FT                   /locus_tag="ROD_00781"
FT                   /note="HMMPfam hit to PF07690, Major facilitator
FT                   superfamily MFS-1, score 6.9e-27"
FT                   /inference="protein motif:PFAM:PF07690"
FT   CDS_pept        complement(94512..95117)
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="ROD_00791"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00791"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86858"
FT                   /db_xref="GOA:D2TGG1"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGG1"
FT                   /protein_id="CBG86858.1"
FT                   /translation="MAEKFTQHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFN
FT                   DWRFLDDKGEQPNPEFVLNFPEYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAP
FT                   SFADIFYGNSFNNQLLPVKLSDEEVDELFKLVQANPGIQFEVDLEAQVIKAGEKTYSFS
FT                   IDAFRRHCMLNGLDSIGLTLQHEAAIAAYEEKQPAFMR"
FT   misc_feature    complement(94737..95114)
FT                   /gene="leuD"
FT                   /locus_tag="ROD_00791"
FT                   /note="HMMPfam hit to PF00694, Aconitase A/isopropylmalate
FT                   dehydratase small subunit, swivel, score 1.3e-66"
FT                   /inference="protein motif:PFAM:PF00694"
FT   CDS_pept        complement(95128..96528)
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="ROD_00801"
FT                   /product="3-isopropylmalate dehydratase large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00801"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86859"
FT                   /db_xref="GOA:D2TGG4"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGG4"
FT                   /protein_id="CBG86859.1"
FT                   /translation="MAKTLYEKLFDAHVVYEAQNETPLLYIDRHLVHEVTSPQAFDGLR
FT                   AHGRPVRQPGKTFATMDHNVSTQTKDINASGEMARIQMQELIKNCKEFGVELYDLNHPY
FT                   QGIVHVMGPEQGVTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQGRA
FT                   RTMKIEVNGTAAPGITAKDIVLAIIGKTGSAGGTGHVVEFCGEAIRALSMEGRMTLCNM
FT                   AIEMGAKAGLVAPDETTFNYVKGRLHAPKGKDFDDAVAYWKTLQTDPDARFDTVVTLQA
FT                   EEIAPQVTWGTNPGQVISVADNIPDPASFTDPVERASAEKALAYMGLKPGVPLTEVAID
FT                   KVFIGSCTNSRIEDLRAAAEVAKGRKVAPGVQALVVPGSGPVKAQAEAEGLDKIFIEAG
FT                   FEWRLPGCSMCLAMNNDRLNPGERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGH
FT                   FADIRSIK"
FT   misc_feature    complement(95158..96519)
FT                   /gene="leuC"
FT                   /locus_tag="ROD_00801"
FT                   /note="HMMPfam hit to PF00330, Aconitase/3-isopropylmalate
FT                   dehydratase large subunit, alpha/beta/alpha, score
FT                   5.7e-290"
FT                   /inference="protein motif:PFAM:PF00330"
FT   misc_feature    complement(95293..95334)
FT                   /note="PS01244 Aconitase family signature 2."
FT                   /inference="protein motif:Prosite:PS01244"
FT   misc_feature    complement(95464..95514)
FT                   /note="PS00450 Aconitase family signature 1."
FT                   /inference="protein motif:Prosite:PS00450"
FT   CDS_pept        complement(96531..97622)
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="ROD_00811"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00811"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86860"
FT                   /db_xref="GOA:D2TGD1"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGD1"
FT                   /protein_id="CBG86860.1"
FT                   /translation="MSKNYHIAVLPGDGIGPEVMEQALKVMEAVRNRFDMRITTSRYDV
FT                   GGAAIDNHGEPLPKATVEGCEQADAVLFGSVGGPKWEHLPPDQQPERGALLPLRKHFKL
FT                   FSNLRPAKLYQGLEAFCPLRADIAASGFDILCVRELTGGIYFGQPKGREGSGQYEKAYD
FT                   TEVYHRFEIERIARIAFESARKRRRKVTSIDKANVLQTSILWREIVNEVAKAYPDVELA
FT                   HMYIDNATMQLIKDPSQFDVLLCSNLFGDILSDECAMITGSMGMLPSASLNEQGFGLYE
FT                   PAGGSAPDIAGKNIANPIAQILSLALLLRYSLDADEAASAIERAVNRALEEGIRTGDLA
FT                   RGAAAVGTDEMGDIIARYVAEGV"
FT   misc_feature    complement(96558..97607)
FT                   /gene="leuB"
FT                   /locus_tag="ROD_00811"
FT                   /note="HMMPfam hit to PF00180, Isocitrate/isopropylmalate
FT                   dehydrogenase, score 2.1e-227"
FT                   /inference="protein motif:PFAM:PF00180"
FT   misc_feature    complement(96825..96884)
FT                   /note="PS00470 Isocitrate and isopropylmalate
FT                   dehydrogenases signature."
FT                   /inference="protein motif:Prosite:PS00470"
FT   CDS_pept        complement(97622..99193)
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="ROD_00821"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00821"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86861"
FT                   /db_xref="GOA:D2TGD2"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGD2"
FT                   /protein_id="CBG86861.1"
FT                   /translation="MSQQVIIFDTTLRDGEQALQASLSVKEKLQIALALERMGVDVMEV
FT                   GFPVSSPGDFESVQTIARQVKNSRVCALARCVENDIDVAAESLKDADAFRIHTFIATSP
FT                   MHIATKLRSTLDEVIERAIYMVKRARNYTDDVEFSCEDAGRTPIADLARVVEAAINAGA
FT                   KTINIPDTVGYTMPFEFGGIISGLYERVPNIDKAIISVHTHDDLGLGVGNALAAVHAGA
FT                   RQVEGAMNGIGERAGNCSLEEVIMAIKVRQDILNVQTRINHQEIWRTSQLVSQICNMPI
FT                   PANKAIVGSGAFAHSSGIHQDGVLKNRENYEIMTPESIGLNQVQLNLTSRSGRAAVKHR
FT                   MDEMGYKESEYNLDDLYDAFLKLADKKGQVFDYDLEALAFINKQQEEPEHFRLDYFSVQ
FT                   SGSNAIATASVKLACGDEVKAEAANGNGPVDAIYQAINRITDYDIELVKYSLSAKGHGK
FT                   DALGQVDIVANYNGRRFHGVGLATDIVESSAKAMVHVLNNIWRAAEVEKELQRKAQNNE
FT                   KNKETV"
FT   misc_feature    complement(97694..98089)
FT                   /gene="leuA"
FT                   /locus_tag="ROD_00821"
FT                   /note="HMMPfam hit to PF08502, LeuA allosteric
FT                   (dimerisation) domain, score 4e-63"
FT                   /inference="protein motif:PFAM:PF08502"
FT   misc_feature    complement(98357..99157)
FT                   /gene="leuA"
FT                   /locus_tag="ROD_00821"
FT                   /note="HMMPfam hit to PF00682, Pyruvate
FT                   carboxyltransferase, score 2.8e-150"
FT                   /inference="protein motif:PFAM:PF00682"
FT   misc_feature    complement(98558..98599)
FT                   /note="PS00816 Alpha-isopropylmalate and homocitrate
FT                   synthases signature 2."
FT                   /inference="protein motif:Prosite:PS00816"
FT   misc_feature    complement(99110..99160)
FT                   /note="PS00815 Alpha-isopropylmalate and homocitrate
FT                   synthases signature 1."
FT                   /inference="protein motif:Prosite:PS00815"
FT   misc_RNA        complement(99235..99385)
FT                   /note="Rfam:RF00512;Leu_leader;Score=93.91;positions 1 to
FT                   59"
FT   CDS_pept        complement(99284..99370)
FT                   /transl_table=11
FT                   /gene="leuL"
FT                   /locus_tag="ROD_00822"
FT                   /product="leu operon leader peptide"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00822"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86862"
FT                   /db_xref="GOA:D2TGD3"
FT                   /db_xref="InterPro:IPR012570"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGD3"
FT                   /protein_id="CBG86862.1"
FT                   /translation="MIRITRFNGLLLLNAFSVRGRLVNGIQH"
FT   misc_feature    complement(99287..99370)
FT                   /gene="leuL"
FT                   /locus_tag="ROD_00822"
FT                   /note="HMMPfam hit to PF08054, Leucine operon leader
FT                   peptide, score 5.8e-11"
FT                   /inference="protein motif:PFAM:PF08054"
FT   CDS_pept        100028..100978
FT                   /transl_table=11
FT                   /gene="leuO"
FT                   /locus_tag="ROD_00831"
FT                   /product="LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00831"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86863"
FT                   /db_xref="GOA:D2TGD4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGD4"
FT                   /protein_id="CBG86863.1"
FT                   /translation="MPEVKVDKPDSPLADVEKPQLRMVDLNLLTVFDAVMQEQNITRAA
FT                   HALGMSQPAVSNAVARLKVMFNDELFVRYGRGIQPTARAFQLFGSVRQALQLVQNELPG
FT                   SGFEPASSERVFNLCVCSPLDNILTSKIYNRVEQIAPNIQVVFKSSLNKNTEHQLRYQE
FT                   TEFVISYEEFRRPEFTSISLFKDEMVLVASRKHPRINGPLLESDVYNEQHAVVSLDRFA
FT                   SFSQPWYDTPDKQCCVAYQGMALISVLNVVSQTQLVAIAPRWLAEEFASTLDLQILPLP
FT                   LKLNSRACYLSWHEAAGRDKGHQWMEELLASVCKR"
FT   misc_feature    100103..100282
FT                   /gene="leuO"
FT                   /locus_tag="ROD_00831"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   protein, LysR, score 4.4e-20"
FT                   /inference="protein motif:PFAM:PF00126"
FT   misc_feature    100142..100207
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1896.000, SD 5.64 at aa 39-60, sequence
FT                   QNITRAAHALGMSQPAVSNAVA"
FT   misc_feature    100145..100237
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    100352..100972
FT                   /gene="leuO"
FT                   /locus_tag="ROD_00831"
FT                   /note="HMMPfam hit to PF03466, LysR,
FT                   substrate-binding,score 3.5e-07"
FT                   /inference="protein motif:PFAM:PF03466"
FT   misc_feature    100670..100699
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   CDS_pept        101305..103029
FT                   /transl_table=11
FT                   /gene="ilvI"
FT                   /locus_tag="ROD_00841"
FT                   /product="acetolactate synthase isozyme III large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00841"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86864"
FT                   /db_xref="GOA:D2TGD5"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGD5"
FT                   /protein_id="CBG86864.1"
FT                   /translation="MEMLSGAEMVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIDH
FT                   VLVRHEQAAVHMADGLARATGEVGVVLVTSGPGATNAITGIATAYMDSIPLVILSGQVA
FT                   TSLIGYDAFQECDMVGISRPVVKHSFLVKQTEDIPQVLKKAFWLAASGRPGPVVVDLPK
FT                   DILNPAKKLPYTWPESVSMRSYNPTTAGHKGQIKRALQTLLSAKNPVAYVGGGAITAGC
FT                   HTQLQQLIETLNLPVVSSLMGLGAFPATHRQALGMLGMHGTYEANMTMHHSDVIFAVGV
FT                   RFDDRTTNNLAKYCPNATVLHIDIDPTSISKTVAADIPIVGDARQVLEQMLELLSQETA
FT                   AQPLDDIRDWWQQIERWRARQCLKYDAQSESIKPQAVIETLWRLTKGDAFVTSDVGQHQ
FT                   MFAALYYPFDKPRRWINSGGLGTMGFGLPAALGVKMALPDETVVCVTGDGSIQMNIQEL
FT                   STALQYELPVLVLNLNNRYLGMVKQWQDMIYSGRHSQSYMQSLPDFVRLAEAYGHVGIR
FT                   IARPDELEGQLSEALAQVQSGRLVFVDVTVDGSEHVYPMQIRGGGMDEMWLSKTERT"
FT   misc_feature    101314..101826
FT                   /gene="ilvI"
FT                   /locus_tag="ROD_00841"
FT                   /note="HMMPfam hit to PF02776, Thiamine pyrophosphate
FT                   enzyme, N-terminal TPP binding region, score 2.3e-103"
FT                   /inference="protein motif:PFAM:PF02776"
FT   misc_feature    101494..101586
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    101890..102297
FT                   /gene="ilvI"
FT                   /locus_tag="ROD_00841"
FT                   /note="HMMPfam hit to PF00205, Thiamine pyrophosphate
FT                   enzyme, central region, score 1.6e-67"
FT                   /inference="protein motif:PFAM:PF00205"
FT   misc_feature    101938..101970
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    102484..102939
FT                   /gene="ilvI"
FT                   /locus_tag="ROD_00841"
FT                   /note="HMMPfam hit to PF02775, Thiamine pyrophosphate
FT                   enzyme, C-terminal TPP-binding, score 5.1e-80"
FT                   /inference="protein motif:PFAM:PF02775"
FT   misc_feature    102595..102654
FT                   /note="PS00187 Thiamine pyrophosphate enzymes signature."
FT                   /inference="protein motif:Prosite:PS00187"
FT   CDS_pept        103032..103523
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="ROD_00851"
FT                   /product="acetolactate synthase isozyme III small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00851"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86865"
FT                   /db_xref="GOA:D2TGD6"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGD6"
FT                   /protein_id="CBG86865.1"
FT                   /translation="MRRILSVLLENESGALSRVIGLFAQRGYNIESLTVAPTDDPTLSR
FT                   MTIQTVGDEKVLEQIEKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGREEVKRN
FT                   TEIFRGQIIDVTPSLYTVQLAGTSDKLDAFLATLREVAKIVEVARSGVVGLSRGDKIMR
FT                   "
FT   misc_feature    103032..103145
FT                   /note="PS00430 TonB-dependent receptor proteins signature
FT                   1."
FT                   /inference="protein motif:Prosite:PS00430"
FT   misc_feature    103038..103238
FT                   /gene="ilvH"
FT                   /locus_tag="ROD_00851"
FT                   /note="HMMPfam hit to PF01842, Amino acid-binding ACT,score
FT                   1.6e-13"
FT                   /inference="protein motif:PFAM:PF01842"
FT   CDS_pept        103781..104785
FT                   /transl_table=11
FT                   /gene="fruR"
FT                   /locus_tag="ROD_00861"
FT                   /product="fructose repressor"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00861"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86866"
FT                   /db_xref="GOA:D2TGD7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012781"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGD7"
FT                   /protein_id="CBG86866.1"
FT                   /translation="MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREH
FT                   NYHPNAVAAGLRAGRTRSIGLVIPDLENTSYTRIANYLERQARQRGYQLLIACSEDQPD
FT                   NEMRCIEHLLQRQVDAIIVSTSLPPEHPFYQRWANDSFPIVALDRALDREHFTSVVGAD
FT                   QDDAEMLAQELRKFPAETVLYLGALPELSVSFLREQGFRSAWKDDPREVHFLYANSYER
FT                   EAAAQLFAKWLETHPMPQALFTTSFALLQGVMDVTLRRDGKLPSDLAIATFGDNELLDF
FT                   LQCPVLAVAQRHRDVAERVLEIVLASLDEPRKPKPGLTRIKRNLYRRGVLSRS"
FT   misc_feature    103781..103858
FT                   /gene="fruR"
FT                   /locus_tag="ROD_00861"
FT                   /note="HMMPfam hit to PF00356, Bacterial regulatory
FT                   protein, LacI, score 3.6e-10"
FT                   /inference="protein motif:PFAM:PF00356"
FT   misc_feature    103781..103846
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1821.000, SD 5.39 at aa 1-22, sequence
FT                   MKLDEIARLAGVSRTTASYVIN"
FT   misc_feature    103787..103843
FT                   /note="PS00356 Bacterial regulatory proteins, lacI family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00356"
FT   misc_feature    103961..104767
FT                   /gene="fruR"
FT                   /locus_tag="ROD_00861"
FT                   /note="HMMPfam hit to PF00532, Periplasmic binding
FT                   protein/LacI transcriptional regulator, score 5.7e-07"
FT                   /inference="protein motif:PFAM:PF00532"
FT   CDS_pept        105451..105858
FT                   /transl_table=11
FT                   /gene="mraZ"
FT                   /locus_tag="ROD_00871"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00871"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86867"
FT                   /db_xref="GOA:D2TGD8"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGD8"
FT                   /protein_id="CBG86867.1"
FT                   /translation="MPTRYREQLIESATGQMVCTIDIHHPCLLLYPLPEWEIIEQKLSR
FT                   LSSMNPVERRVQRLLLGHASECQMDSAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELWD
FT                   ETTWYQQVKEDIDAEQSATETLSERLQDLSL"
FT   misc_feature    105451..105627
FT                   /gene="mraZ"
FT                   /locus_tag="ROD_00871"
FT                   /note="HMMPfam hit to PF02381, MraZ, score 4.1e-09"
FT                   /inference="protein motif:PFAM:PF02381"
FT   misc_feature    105628..105837
FT                   /gene="mraZ"
FT                   /locus_tag="ROD_00871"
FT                   /note="HMMPfam hit to PF02381, MraZ, score 8.8e-24"
FT                   /inference="protein motif:PFAM:PF02381"
FT   CDS_pept        105860..106801
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="ROD_00881"
FT                   /product="S-adenosyl-L-methionine-dependent
FT                   methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="unknown EC_number=2.1.1.-."
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00881"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86868"
FT                   /db_xref="GOA:D2TGD9"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGD9"
FT                   /protein_id="CBG86868.1"
FT                   /translation="MMENFKHTTVLLDEAVNGLNIRPDGIYIDGTFGRGGHSRLILSQL
FT                   GEEGRLLAIDRDPQAIAVAQTINDPRFSIIHGPFSALAEYVAERNLTGRIDGILLDLGV
FT                   SSPQLDDAERGFSFMRDGPLDMRMDPTRGQSAAEWLQSAEEADIAWVLKTFGEERFAKR
FT                   IARAIVERNREQPMTRTKELAEVVAAATPVKDKFKHPATRTFQAVRIWVNSELEEIEQA
FT                   LKSSLSVLAPGGRLSIISFHSLEDRIVKRFMREQSRGPKVPAGIPMTEEQLSKLGGREL
FT                   RALGKLMPGEKEVAENPRARSSVLRIAERTNA"
FT   misc_feature    105869..106792
FT                   /gene="mraW"
FT                   /locus_tag="ROD_00881"
FT                   /note="HMMPfam hit to PF01795, Bacterial
FT                   methyltransferase,score 1.2e-191"
FT                   /inference="protein motif:PFAM:PF01795"
FT   CDS_pept        106798..107163
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="ROD_00891"
FT                   /product="cell division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00891"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86869"
FT                   /db_xref="GOA:D2TGE0"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGE0"
FT                   /protein_id="CBG86869.1"
FT                   /translation="MISRVTEALSKVKGSIGSNERHALPGVIGDDLLRFGKLPLCLFIC
FT                   IIVTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEK
FT                   LQMQHVDPSQENIVVQK"
FT   misc_feature    106867..107157
FT                   /gene="ftsL"
FT                   /locus_tag="ROD_00891"
FT                   /note="HMMPfam hit to PF04999, Cell division protein
FT                   FtsL,score 1.3e-65"
FT                   /inference="protein motif:PFAM:PF04999"
FT   misc_feature    106900..106968
FT                   /gene="ftsL"
FT                   /locus_tag="ROD_00891"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD00891 by TMHMM2.0 at aa 35-57"
FT   CDS_pept        107179..108936
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="ROD_00901"
FT                   /product="peptidoglycan synthetase (penicillin-binding
FT                   protein 3)"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00901"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86870"
FT                   /db_xref="GOA:D2TGE1"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGE1"
FT                   /protein_id="CBG86870.1"
FT                   /translation="MKAAAKPKRQEEQANFISWRFALLCGCILLALVFLLGRVAWLQII
FT                   APDMLVRQGDMRSLRVQEVATSRGMITDRSGRPLAVSVPVKAIWADPKEVHEAGGVRVG
FT                   DRWKALSTALNIPLDQLAARINANPKGRFIYLARQLNPDMADYIKKLKLPGIHLREESR
FT                   RYYPSGEVTAHLIGFTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDISSTD
FT                   SQAAHNLALSIDERLQALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSYNPN
FT                   NLSGTPKDAMRNRTITDVFEPGSTVKPMVVMTALQRGIVNENTVLNTVPYRINGHEIKD
FT                   VARYSELTLTGVLQKSSNVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSGLYP
FT                   QKQRWSDIERATFSFGYGLMVTPLQLARVYATIGSYGVYRPLSITKVDPPVPGERIFPE
FT                   SIVRTVVHMMESVALPGGGGVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAGVAP
FT                   ASQPRFALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNIEPDALATGEKSEFVIN
FT                   QGEGTGGRS"
FT   sig_peptide     107179..107304
FT                   /gene="ftsI"
FT                   /locus_tag="ROD_00901"
FT                   /note="Signal peptide predicted for ROD00901 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.749) with cleavage site
FT                   probability 0.354 between residues 42 and 43"
FT   misc_feature    107236..107304
FT                   /gene="ftsI"
FT                   /locus_tag="ROD_00901"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD00901 by TMHMM2.0 at aa 20-42"
FT   misc_feature    107365..107835
FT                   /gene="ftsI"
FT                   /locus_tag="ROD_00901"
FT                   /note="HMMPfam hit to PF03717, Penicillin-binding
FT                   protein,dimerisation domain, score 9.8e-67"
FT                   /inference="protein motif:PFAM:PF03717"
FT   misc_feature    107947..108834
FT                   /gene="ftsI"
FT                   /locus_tag="ROD_00901"
FT                   /note="HMMPfam hit to PF00905, Penicillin-binding
FT                   protein,transpeptidase, score 9.1e-120"
FT                   /inference="protein motif:PFAM:PF00905"
FT   CDS_pept        108923..110410
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="ROD_00911"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-dia
FT                   minopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00911"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86871"
FT                   /db_xref="GOA:D2TGE2"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGE2"
FT                   /protein_id="CBG86871.1"
FT                   /translation="MADRNLRDLLAPWVTGLPARELREMTLDSRVAASGDLFVAVKGHQ
FT                   ADGRRYIPQAIAQGVAAIIAEAKDEATDGEIREMHGVPVIYLSQLNERLSALAGRFYHE
FT                   PSENMRLVGVTGTNGKTTTTQLLAQWSQLLGETSAVMGTVGNGLLGKVTPTENTTGSAV
FT                   DVQHELAGLVAQGATFGAMEVSSHGLIQHRVAALKFAATVFTNLSRDHLDYHGDMEHYE
FT                   AAKWLLFSTHHYGQAIVNADDEVGRRWLTNLPDAVAVSMEDHINPNCHGRWLKAVAVDY
FT                   HDSGATIRFTSSWGEGEIESRLMGAFNVSNLLLALATLLALGYPLADLLKTATRLQPVC
FT                   GRMEVFSAPGKTTVVVDYAHTPDALEKALQAARLHCGGQLWCVFGCGGDRDKGKRPLMG
FT                   AIAEQYADVVVVTDDNPRTEEPRAIIDDILAGMLDAGRARVMEGRAEAVTNAIMQAKEN
FT                   DVVLVAGKGHEDYQIIGTQRLDYSDRVTAARLLGVIA"
FT   misc_feature    108983..109228
FT                   /gene="murE"
FT                   /locus_tag="ROD_00911"
FT                   /note="HMMPfam hit to PF01225, Mur ligase, N-terminal,score
FT                   6.6e-17"
FT                   /inference="protein motif:PFAM:PF01225"
FT   misc_feature    109256..109879
FT                   /gene="murE"
FT                   /locus_tag="ROD_00911"
FT                   /note="HMMPfam hit to PF08245, Mur ligase, central, score
FT                   4.4e-74"
FT                   /inference="protein motif:PFAM:PF08245"
FT   misc_feature    109937..110197
FT                   /gene="murE"
FT                   /locus_tag="ROD_00911"
FT                   /note="HMMPfam hit to PF02875, Mur ligase, C-terminal,score
FT                   1.9e-39"
FT                   /inference="protein motif:PFAM:PF02875"
FT   CDS_pept        110407..111765
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="ROD_00921"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-ala
FT                   nine ligase"
FT                   /EC_number="6.3.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00921"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86872"
FT                   /db_xref="GOA:D2TGE3"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGE3"
FT                   /protein_id="CBG86872.1"
FT                   /translation="MISVTLSQLAGILGGELKGDDLTLDAVTTDTRKLTPGCLFVALKG
FT                   ERFDAHDFADKAKAGGAGALLVSRPLDCDLPQLIVKDTRLAFGELAAWVRAQVPARVVA
FT                   LTGSSGKTSVKEMAAAILSQCGNTLYTAGNLNNDIGVPMTLLRLTKEHDFAVIELGANH
FT                   QGEIAWTVSLTRPEAALVNNLAAAHLEGFGSLAGVAKAKGEIYSGLPENGIAIMNADNN
FT                   DWLNWQSVIGDRKVWRFSANAADSDFTATNVHVTSHGTEFTLQTPVGSIDVLLPLPGRH
FT                   NIANALAAASLSMAAGAPLAAIKAGLANLKAVPGRLFPVQLAENQLLLDDSYNANVGSM
FT                   TAAVQVLAEMPGYRVLVVGDMAELGAESEACHLQVGNAAKAAGIDRVLSTGKLSQAISE
FT                   ASGVGEHFADKTALIARLKALVEEQQMITILVKGSRSAAMEEVVRALQEKGTC"
FT   misc_feature    110473..110691
FT                   /gene="murF"
FT                   /locus_tag="ROD_00921"
FT                   /note="HMMPfam hit to PF01225, Mur ligase, N-terminal,score
FT                   1.2e-22"
FT                   /inference="protein motif:PFAM:PF01225"
FT   misc_feature    110713..111285
FT                   /gene="murF"
FT                   /locus_tag="ROD_00921"
FT                   /note="HMMPfam hit to PF08245, Mur ligase, central, score
FT                   4.3e-70"
FT                   /inference="protein motif:PFAM:PF08245"
FT   misc_feature    111343..111597
FT                   /gene="murF"
FT                   /locus_tag="ROD_00921"
FT                   /note="HMMPfam hit to PF02875, Mur ligase, C-terminal,score
FT                   1.9e-19"
FT                   /inference="protein motif:PFAM:PF02875"
FT   CDS_pept        111759..112841
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="ROD_00931"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transfera
FT                   se"
FT                   /EC_number="2.7.8.13"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00931"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86873"
FT                   /db_xref="GOA:D2TGE4"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGE4"
FT                   /protein_id="CBG86873.1"
FT                   /translation="MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMI
FT                   ARLQKLSFGQVVRNDGPESHFSKRGTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVV
FT                   LIGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSVIALGVAFALYLAGKDTPATELVVP
FT                   FFKDVMPQLGLFYVLLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNM
FT                   NFANYLHIPYLRHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIA
FT                   VLLRQEFLLVIMGGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIV
FT                   RFWIISLMLVLIGLATLKVR"
FT   misc_feature    join(111801..111869,111981..112034,112047..112100,
FT                   112158..112211,112269..112337,112356..112415,
FT                   112458..112526,112545..112613,112623..112691,
FT                   112770..112829)
FT                   /gene="mraY"
FT                   /locus_tag="ROD_00931"
FT                   /note="10 probable transmembrane helices predicted for
FT                   ROD00931 by TMHMM2.0 at aa 15-37, 75-92, 97-114,
FT                   134-151,171-193, 200-219, 234-256, 263-285, 289-311 and
FT                   338-357"
FT   misc_feature    112050..112628
FT                   /gene="mraY"
FT                   /locus_tag="ROD_00931"
FT                   /note="HMMPfam hit to PF00953, Glycosyl transferase, family
FT                   4, score 2.1e-87"
FT                   /inference="protein motif:PFAM:PF00953"
FT   CDS_pept        112844..114160
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="ROD_00941"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00941"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86874"
FT                   /db_xref="GOA:D2TGE5"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGE5"
FT                   /protein_id="CBG86874.1"
FT                   /translation="MADYQGKNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRATPPGLD
FT                   KLPEAVERHIGSLNEDWLLAADLIVASPGIALAHPVLSAAADAGVEIVGDIELFCREAQ
FT                   APIVAITGSNGKSTVTTLVGEMAKAAGVNVGVGGNIGLPALMLLDAGRELYVLELSSFQ
FT                   LETTYSLQAEAATILNVTEDHMDRYPFGLQQYRAAKLRVYENASVCVVNADDALTMPVR
FT                   GADARCVSFGVNMGDYHLNRQQGETWLRVKGEKVLNVKEMKLSGQHNYTNALAALALAD
FT                   AAGLPRASSLKALTTFTGLAHRFQLALEHNGVRWINDSKATNVGSTEAALNGLQVDGTL
FT                   HLLLGGDGKSADFSPLGRYLTGDRVRLYCFGRDGAQLAALRPEIAEQTQTMEEAMRLIA
FT                   PRVKPGDMVLLSPACASLDQFKNFEQRGDLFTRLAKELG"
FT   misc_feature    112868..112936
FT                   /gene="murD"
FT                   /locus_tag="ROD_00941"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD00941 by TMHMM2.0 at aa 9-31"
FT   misc_feature    112874..112906
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    113165..113683
FT                   /gene="murD"
FT                   /locus_tag="ROD_00941"
FT                   /note="HMMPfam hit to PF08245, Mur ligase, central, score
FT                   1.6e-60"
FT                   /inference="protein motif:PFAM:PF08245"
FT   misc_feature    113177..113224
FT                   /note="PS00012 Phosphopantetheine attachment site."
FT                   /inference="protein motif:Prosite:PS00012"
FT   misc_feature    113741..113983
FT                   /gene="murD"
FT                   /locus_tag="ROD_00941"
FT                   /note="HMMPfam hit to PF02875, Mur ligase, C-terminal,score
FT                   1.2e-12"
FT                   /inference="protein motif:PFAM:PF02875"
FT   CDS_pept        114160..115404
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="ROD_00951"
FT                   /product="cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00951"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86875"
FT                   /db_xref="GOA:D2TGM6"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGM6"
FT                   /protein_id="CBG86875.1"
FT                   /translation="MRLSLPRLRMPRLPGVGLLGGILAALKGWVMGSRDKDTDSLVMYD
FT                   RMLLWLTFGLAAIGFVMVTSASMPVGQRLAGDPFLFAKRDALYILLAFCLAMITLRLPM
FT                   EFWQRYSTTMLIASIVMLLIVLVVGSSVNGASRWIAIGPLRIQPAEFTKLSLFCYLANY
FT                   LVRKVDEVRNNLRGFLKPMGVILVLAILLLAQPDLGTVVVLFVTTLAMLFLAGAKLWQF
FT                   IAIIGMGISAVVLLILAEPYRIRRVTSFWNPWEDPFGSGYQLTQSLMAFGRGEMWGQGL
FT                   GNSVQKLEYLPEAHTDFIFAIIGEELGYIGVVLALLMVFFVAFRAMSIGRKALQIDQRF
FT                   SGFLACSIGIWFSFQALVNVGAAAGMLPTKGLTLPLISYGGSSLLIMSTAIMMLLRIDY
FT                   ETRLEKAQAFTRGSR"
FT   misc_feature    join(114196..114255,114298..114357,114418..114471,
FT                   114499..114567,114682..114741,114751..114810,
FT                   114823..114891,115078..115146,115180..115248,
FT                   115276..115344)
FT                   /gene="ftsW"
FT                   /locus_tag="ROD_00951"
FT                   /note="10 probable transmembrane helices predicted for
FT                   ROD00951 by TMHMM2.0 at aa 13-32, 47-66, 87-104,
FT                   114-136,175-194, 198-217, 222-244, 307-329, 341-363 and
FT                   373-395"
FT   misc_feature    114295..115368
FT                   /gene="ftsW"
FT                   /locus_tag="ROD_00951"
FT                   /note="HMMPfam hit to PF01098, Cell cycle protein, score
FT                   6.7e-186"
FT                   /inference="protein motif:PFAM:PF01098"
FT   misc_feature    115234..115308
FT                   /note="PS00428 Cell cycle proteins ftsW / rodA / spoVE
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00428"
FT   CDS_pept        115401..116468
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="ROD_00961"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(penta
FT                   peptide) pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00961"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86876"
FT                   /db_xref="GOA:D2TGM7"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGM7"
FT                   /protein_id="CBG86876.1"
FT                   /translation="MSGQAKRLMVMAGGTGGHVFPGLAVAHHLMAQGWEVRWLGTADRM
FT                   EADLVPKHGIEIDFIRISGLRGKGVKALLAAPLRIFNAWRQARAIMKAFKPDVVLGMGG
FT                   YVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLAKIATRVMQAFPGAFPKAEVVGNPVR
FT                   TDVLALPLPQARLSGREGPIRVLVVGGSQGARVLNQTLPQAAAKLGSAVTIWHQSGKGA
FT                   QQAVEQAYADAGQPQHKVTEFIDDMAAAYAWADVVVCRSGALTVSEIAAAGLPALFVPF
FT                   QHKDRQQYWNALPLEQAGAARILEQPQFTVDAVVSTLSGWNREVLLEMAQRARAAAIPD
FT                   ATERVANEVSLVARA"
FT   sig_peptide     115401..115478
FT                   /gene="murG"
FT                   /locus_tag="ROD_00961"
FT                   /note="Signal peptide predicted for ROD00961 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.614) with cleavage site
FT                   probability 0.544 between residues 26 and 27"
FT   misc_feature    115422..115838
FT                   /gene="murG"
FT                   /locus_tag="ROD_00961"
FT                   /note="HMMPfam hit to PF03033, Glycosyl transferase, family
FT                   28, score 2.7e-54"
FT                   /inference="protein motif:PFAM:PF03033"
FT   misc_feature    115950..116435
FT                   /gene="murG"
FT                   /locus_tag="ROD_00961"
FT                   /note="HMMPfam hit to PF04101, Glycosyltransferase
FT                   28,C-terminal, score 1.3e-53"
FT                   /inference="protein motif:PFAM:PF04101"
FT   CDS_pept        116526..118001
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="ROD_00971"
FT                   /product="UDP-N-acetylmuramate:alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00971"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86877"
FT                   /db_xref="GOA:D2TGM8"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGM8"
FT                   /protein_id="CBG86877.1"
FT                   /translation="MNTQQLAKLRSIVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGYQ
FT                   ISGSDLAPNPVTQQLTNLGATIYFNHRPENVLDASVVVVSSAISADNPEIVAAHEARIP
FT                   VIRRAEMLAELMRFRHGIAIAGTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAGVHA
FT                   RLGHSRYLIAEADESDASFLHLQPMVAIVTNIEADHMDTYHGDFENLKQTFINFLHNLP
FT                   FYGRAVMCVDDPVIRELLPRVGRQITTYGFSDDADVRVEDYQQIGPQGHFSLLRQGMPE
FT                   LRVTLNAPGRHNALNAAAAVAVATEEGIDDEAILRALESFQGTGRRFDFLGEFPLAPVN
FT                   GKAGTAMLVDDYGHHPTEVDATIKAARAGWPDKHLVMLFQPHRFTRTRDLYDDFANVLT
FT                   QVDALLMLDVYAAGEAPIPGADSRSLCRTIRGRGKIDPILVSDPAQVAEMLAPVLTGND
FT                   LILVQGAGNIGKIARSLAEIKLKPQIQESEQHG"
FT   misc_feature    116586..116885
FT                   /gene="murC"
FT                   /locus_tag="ROD_00971"
FT                   /note="HMMPfam hit to PF01225, Mur ligase, N-terminal,score
FT                   1.2e-47"
FT                   /inference="protein motif:PFAM:PF01225"
FT   misc_feature    116889..117437
FT                   /gene="murC"
FT                   /locus_tag="ROD_00971"
FT                   /note="HMMPfam hit to PF08245, Mur ligase, central, score
FT                   2.1e-34"
FT                   /inference="protein motif:PFAM:PF08245"
FT   misc_feature    117495..117785
FT                   /gene="murC"
FT                   /locus_tag="ROD_00971"
FT                   /note="HMMPfam hit to PF02875, Mur ligase, C-terminal,score
FT                   4.5e-22"
FT                   /inference="protein motif:PFAM:PF02875"
FT   CDS_pept        117994..118914
FT                   /transl_table=11
FT                   /gene="ddlB"
FT                   /locus_tag="ROD_00981"
FT                   /product="D-alanine--D-alanine ligase B"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00981"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86878"
FT                   /db_xref="GOA:D2TGM9"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGM9"
FT                   /protein_id="CBG86878.1"
FT                   /translation="MADKIAVLFGGTSAEREVSLNSGAAVLAGLREGGVDAHPVDPKEV
FT                   DVTQLKAMGFQKVFIALHGRGGEDGTLQGLLELIGLPYTGSGVMASAISMDKLRSKLLW
FT                   QGAGLPVAPWVALTRAQFEKGLSEELVTQISALGLPLIVKPSREGSSVGMSKVAEYDAL
FT                   QSALALAFQHDEEVLIEKWLSGPEFTVAILGEEILPTIRIQPAGTFYDYEAKYLSDETQ
FT                   YFCPAGLETAQEALLRDLVRKAWSTLGCKGWGRIDAMLDSDGQFYLLEANTSPGMTSHS
FT                   LVPMAAREKGLSFSQLVVRILELAD"
FT   misc_feature    118000..118278
FT                   /gene="ddlB"
FT                   /locus_tag="ROD_00981"
FT                   /note="HMMPfam hit to PF01820, D-alanine--D-alanine
FT                   ligase,N-terminal, score 5.6e-55"
FT                   /inference="protein motif:PFAM:PF01820"
FT   misc_feature    118180..118215
FT                   /note="PS00843 D-alanine--D-alanine ligase signature 1."
FT                   /inference="protein motif:Prosite:PS00843"
FT   misc_feature    118234..118251
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT                   /inference="protein motif:Prosite:PS00343"
FT   misc_feature    118279..118902
FT                   /gene="ddlB"
FT                   /locus_tag="ROD_00981"
FT                   /note="HMMPfam hit to PF07478, D-alanine--D-alanine
FT                   ligase,C-terminal, score 5.4e-109"
FT                   /inference="protein motif:PFAM:PF07478"
FT   misc_feature    118735..118821
FT                   /note="PS00844 D-alanine--D-alanine ligase signature 2."
FT                   /inference="protein motif:Prosite:PS00844"
FT   CDS_pept        118916..119746
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="ROD_00991"
FT                   /product="cell division protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00991"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86879"
FT                   /db_xref="GOA:D2TGN0"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGN0"
FT                   /protein_id="CBG86879.1"
FT                   /translation="MSQAALNTRNSDEEVSSSRRNNGTRLAGILFLLTVLCTVLVSGWV
FT                   VLGWMEDAQRLPLSKLVLTGERHYTKNDDIRQSILALGAPGTFMTQDVNIIQSQIERLP
FT                   WIKQASVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNAFSVPSDRTSKQILPMLYGP
FT                   EGSASEVLQGYREMGQVLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLAR
FT                   FVELYPVLQQQAQTEGKRISYVDLRYDSGAAVGWEPLPPEETNQQQNQAQAEQQ"
FT   misc_feature    118991..119059
FT                   /gene="ftsQ"
FT                   /locus_tag="ROD_00991"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD00991 by TMHMM2.0 at aa 26-48"
FT   misc_feature    119081..119293
FT                   /gene="ftsQ"
FT                   /locus_tag="ROD_00991"
FT                   /note="HMMPfam hit to
FT                   PF08478,Polypeptide-transport-associated, FtsQ-type, score
FT                   9.8e-25"
FT                   /inference="protein motif:PFAM:PF08478"
FT   misc_feature    119300..119656
FT                   /gene="ftsQ"
FT                   /locus_tag="ROD_00991"
FT                   /note="HMMPfam hit to PF03799, Cell division protein
FT                   FtsQ,score 1.8e-35"
FT                   /inference="protein motif:PFAM:PF03799"
FT   CDS_pept        119743..121005
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="ROD_01001"
FT                   /product="cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01001"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86880"
FT                   /db_xref="GOA:D2TGN1"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGN1"
FT                   /protein_id="CBG86880.1"
FT                   /translation="MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMINIIGVGSCPSRG
FT                   MDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEV
FT                   TQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITC
FT                   HNDMAKNIVKAVERCGLKVDQLIFAGLAASYSVLTEDERELGVCVVDIGGGTMDIAVYT
FT                   GGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVG
FT                   GRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEQLRQQGVKHHLAAGIVLTGGAAQ
FT                   IEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLSGEADVEK
FT                   RVTASVGSWIKRLNSWLRKEF"
FT   misc_feature    119770..120330
FT                   /gene="ftsA"
FT                   /locus_tag="ROD_01001"
FT                   /note="HMMPfam hit to PF02491, Cell division protein
FT                   FtsA,score 3e-79"
FT                   /inference="protein motif:PFAM:PF02491"
FT   misc_feature    119833..119865
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    120358..120888
FT                   /gene="ftsA"
FT                   /locus_tag="ROD_01001"
FT                   /note="HMMPfam hit to PF02491, Cell division protein
FT                   FtsA,score 2.1e-79"
FT                   /inference="protein motif:PFAM:PF02491"
FT   CDS_pept        121122..122273
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="ROD_01011"
FT                   /product="cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01011"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86881"
FT                   /db_xref="GOA:D2TGN2"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGN2"
FT                   /protein_id="CBG86881.1"
FT                   /translation="MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTD
FT                   AQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDREALRAALDGADMVFIAAGM
FT                   GGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITI
FT                   PNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGY
FT                   AMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNT
FT                   IRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQ
FT                   QHGMAPLTQEQKPVAKVVNDNTPQTAKEPDYLDIPAFLRKQAD"
FT   misc_feature    121152..121733
FT                   /gene="ftsZ"
FT                   /locus_tag="ROD_01011"
FT                   /note="HMMPfam hit to PF00091, Tubulin/FtsZ, GTPase, score
FT                   1.8e-93"
FT                   /inference="protein motif:PFAM:PF00091"
FT   misc_feature    121248..121352
FT                   /note="PS01134 FtsZ protein signature 1."
FT                   /inference="protein motif:Prosite:PS01134"
FT   misc_feature    121407..121472
FT                   /note="PS01135 FtsZ protein signature 2."
FT                   /inference="protein motif:Prosite:PS01135"
FT   misc_feature    121737..122117
FT                   /gene="ftsZ"
FT                   /locus_tag="ROD_01011"
FT                   /note="HMMPfam hit to PF03953, Tubulin/FtsZ,
FT                   C-terminal,score 2.1e-44"
FT                   /inference="protein motif:PFAM:PF03953"
FT   CDS_pept        122374..123291
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="ROD_01021"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01021"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86882"
FT                   /db_xref="GOA:D2TGN3"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGN3"
FT                   /protein_id="CBG86882.1"
FT                   /translation="MIKQRTLKRIVQATGVGLHTGKKVTLTLRPAPANTGVIYRRTDLN
FT                   PPVDFPADAKSVRDTMLCTCLVNEHDVRISTVEHLNAALAGLGIDNIVIEVDAPEIPIM
FT                   DGSAAPFVYLLLDAGIEELSSAKKFVRIKETVRVEDGDKWAEFKPYNGFTLDFTIDFNH
FT                   PAIDSSTQRYAMNFSADAFMRQISRARTFGFMRDIEYLQSRGLCLGGSFDCAIVVDDYR
FT                   VLNEDGLRFEDEFVRHKMLDAIGDLFMCGHNIIGAFTAYKSGHALNNKLLQAVLAKQEA
FT                   WEFVTFEDDAELPLAFKAPSTVLA"
FT   misc_feature    122377..123213
FT                   /gene="lpxC"
FT                   /locus_tag="ROD_01021"
FT                   /note="HMMPfam hit to PF03331, UDP-3-O-acyl
FT                   N-acetylglucosamine deacetylase, score 2.9e-193"
FT                   /inference="protein motif:PFAM:PF03331"
FT   CDS_pept        123516..124073
FT                   /transl_table=11
FT                   /gene="secM"
FT                   /locus_tag="ROD_01031"
FT                   /product="secretion monitor precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01031"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86883"
FT                   /db_xref="GOA:D2TGN4"
FT                   /db_xref="InterPro:IPR009502"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGN4"
FT                   /protein_id="CBG86883.1"
FT                   /translation="MCAKKRFEQHDWDGFNVSGILTRWRQLGRRYFWPHLLLGMVAASL
FT                   GLPALSNAAEPNNAPAKATASSHDQHIRVNFSQLALLEASNRRPNFTVDYWHQHAIRTV
FT                   IRHLSFAMAPQALPVAEETSPLQAHHLALLNTLSAMLTQEGSPAAMTPRVSYSHFAPLA
FT                   AFTVPVWISQAQGIRAGPQRLS"
FT   sig_peptide     123516..123674
FT                   /gene="secM"
FT                   /locus_tag="ROD_01031"
FT                   /note="Signal peptide predicted for ROD01031 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.863) with cleavage site
FT                   probability 0.854 between residues 53 and 54"
FT   misc_feature    123606..123674
FT                   /gene="secM"
FT                   /locus_tag="ROD_01031"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD01031 by TMHMM2.0 at aa 31-53"
FT   misc_feature    123633..124070
FT                   /gene="secM"
FT                   /locus_tag="ROD_01031"
FT                   /note="HMMPfam hit to PF06558, Secretion monitor, score
FT                   5.9e-95"
FT                   /inference="protein motif:PFAM:PF06558"
FT   CDS_pept        124135..126840
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="ROD_01041"
FT                   /product="preprotein translocase SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01041"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86884"
FT                   /db_xref="GOA:D2TGN5"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGN5"
FT                   /protein_id="CBG86884.1"
FT                   /translation="MLIKMLTKVFGSRNDRTLRRMRKVVGVINAMEPEMEKLSDEELKA
FT                   KTAEFRARLEQGASVESLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNDRCIAEMRT
FT                   GEGKTLTATLPAYLNALSGKGVHVVTVNDYLAQRDAENNRPLFEFLGMTVGINLPGMPA
FT                   PAKREAYAADITYGTNNEYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDEARTP
FT                   LIISGPAEDSSEMYKKVNKIIPHLVRQEKEDSDTFQGEGHFSVDEKARQVNLTERGLVL
FT                   IEELLVKEGIMDEGESLYSPGNIMLMHHVTAALRAHVLFTRDVDYIVKDGEVIIVDEHT
FT                   GRTMQGRRWSDGLHQAVEAKEGVDIQNENQTLASITFQNYFRLYEKLAGMTGTADTEAF
FT                   EFSSIYKLDTVVVPTNRPMIRKDMPDLVYMTEAEKIQAIIEDIKERTANGQPVLVGTIS
FT                   IEKSEVVSNELTKAGIKHNVLNAKFHANEAAIVAQAGYPSAVTIATNMAGRGTDIMLGG
FT                   SWQAEIAALENPTPEQIAQIKADWQVRHDAVLAAGGLHIIGTERHESRRIDNQLRGRSG
FT                   RQGDPGSSRFYLSMEDALMRIFASDRVSGMMRKLGMKPGEAIEHPWVTKAIANAQRKVE
FT                   SRNFDIRKQLLEYDDVANDQRRAIYTQRNELLDVSDVSETINSIREDVFKATIDAYIPP
FT                   QSLEEMWDIPGLQERLKNDFDLDMPIAEWLDKEPELHEETLRERILSQAIEVYQRKEEV
FT                   VGAEMMRHFEKGVMLQTLDSLWKEHLAAMDYLRQGIHLRGYAQKDPKQEYKRESFAMFA
FT                   AMLESLKYEVISTLSKVQVRMPEEVEAMELQRREEAERLAQMQQLSHQDDHAAAAADLA
FT                   AQTGERKVGRNDPCPCGSGKKYKQCHGRLS"
FT   misc_feature    124150..125340
FT                   /gene="secA"
FT                   /locus_tag="ROD_01041"
FT                   /note="HMMPfam hit to PF07517, SecA DEAD-like, score
FT                   1e-216"
FT                   /inference="protein motif:PFAM:PF07517"
FT   misc_feature    124816..125208
FT                   /gene="secA"
FT                   /locus_tag="ROD_01041"
FT                   /note="HMMPfam hit to PF01043, SecA preprotein
FT                   cross-linking region, score 1.9e-83"
FT                   /inference="protein motif:PFAM:PF01043"
FT   misc_feature    125632..125679
FT                   /note="PS01312 Protein secA signatures."
FT                   /inference="protein motif:Prosite:PS01312"
FT   misc_feature    125686..125751
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1222.000, SD 3.35 at aa 518-539, sequence
FT                   SWQAEIAALENPTPEQIAQIKA"
FT   misc_feature    125983..126627
FT                   /gene="secA"
FT                   /locus_tag="ROD_01041"
FT                   /note="HMMPfam hit to PF07516, SecA Wing and Scaffold,score
FT                   5.2e-124"
FT                   /inference="protein motif:PFAM:PF07516"
FT   misc_feature    126775..126837
FT                   /gene="secA"
FT                   /locus_tag="ROD_01041"
FT                   /note="HMMPfam hit to PF02810, SEC-C motif, score 2.8e-11"
FT                   /inference="protein motif:PFAM:PF02810"
FT   CDS_pept        126947..127345
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="ROD_01051"
FT                   /product="mutator protein
FT                   (7,8-dihydro-8-oxoguanine-triphosphatase)"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01051"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86885"
FT                   /db_xref="GOA:D2TGN6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGN6"
FT                   /protein_id="CBG86885.1"
FT                   /translation="MKTLQIAVGIIRNPQNEIFITRRAADAHMANKLEFPGGKIEAGET
FT                   PEQTLSRELQEEVGITPANATLFEKLEYQFPDRHITLWFWLVESWQGEPWGKEGQSGNW
FT                   IAADALSADDFPPANEPVIAKLKHASLA"
FT   misc_feature    126956..127333
FT                   /gene="mutT"
FT                   /locus_tag="ROD_01051"
FT                   /note="HMMPfam hit to PF00293, NUDIX hydrolase, core, score
FT                   3.8e-30"
FT                   /inference="protein motif:PFAM:PF00293"
FT   misc_feature    127058..127117
FT                   /note="PS00893 mutT domain signature."
FT                   /inference="protein motif:Prosite:PS00893"
FT   CDS_pept        complement(127445..127639)
FT                   /transl_table=11
FT                   /locus_tag="ROD_01061"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01061"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86886"
FT                   /db_xref="GOA:D2TGN7"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGN7"
FT                   /protein_id="CBG86886.1"
FT                   /translation="MSETITVNCPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEK
FT                   RIPSSGDLSDSDDWSEEKE"
FT   misc_feature    complement(127448..127627)
FT                   /locus_tag="ROD_01061"
FT                   /note="HMMPfam hit to PF03884, Protein of unknown function
FT                   DUF329, score 7.8e-42"
FT                   /inference="protein motif:PFAM:PF03884"
FT   CDS_pept        complement(127649..128392)
FT                   /transl_table=11
FT                   /locus_tag="ROD_01071"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01071"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86887"
FT                   /db_xref="GOA:D2TGN8"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGN8"
FT                   /protein_id="CBG86887.1"
FT                   /translation="MHTQVLFEHPLNEKMRTWLRIEFLIQQLSANLPVASHADALHFFR
FT                   NVGDLLDVFERGEVRTELLKELERQQRKLQAWIEVPGVDQSRIEALRQQLKSAGSVLIS
FT                   APRIGQFLREDRLIALVRQRLSIPGGCCSFDLPTLHMWLHLPQAQRDAQVEAWLASLNP
FT                   LNQALTLILDLIRHSAPFRKQTSLNGFYQDNGEDADLLRLNLPLDIQLYPQISGHKSRF
FT                   AIRFMPIDSENGVVPERLDFELACC"
FT   misc_feature    complement(127652..128386)
FT                   /locus_tag="ROD_01071"
FT                   /note="HMMPfam hit to PF07072, Protein of unknown function
FT                   DUF1342, score 4.1e-164"
FT                   /inference="protein motif:PFAM:PF07072"
FT   CDS_pept        complement(128392..129012)
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="ROD_01081"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01081"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86888"
FT                   /db_xref="GOA:D2TGN9"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGN9"
FT                   /protein_id="CBG86888.1"
FT                   /translation="MRYTVALTGGIGSGKSTVANAFADLGVQIVDADIIARQVVAPGQP
FT                   ALEAIASRFGKALIGADGTLQRRLLRERIFANPQEKAWLNALLHPLIHQETQRQFRQAT
FT                   SSYVLWVVPLLVENGLHSKANRVLVVDVSAETQLSRTMLRDDVTRAHVEQILAAQATRE
FT                   ARLAVADDVIDNNGAPESIKPDVARLHALYLQLASQFVSQEKP"
FT   misc_feature    complement(128473..129006)
FT                   /gene="coaE"
FT                   /locus_tag="ROD_01081"
FT                   /note="HMMPfam hit to PF01121, Dephospho-CoA kinase, score
FT                   2e-103"
FT                   /inference="protein motif:PFAM:PF01121"
FT   misc_feature    complement(128737..128826)
FT                   /note="PS01294 Uncharacterized protein family UPF0038
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01294"
FT   sig_peptide     complement(128944..129012)
FT                   /gene="coaE"
FT                   /locus_tag="ROD_01081"
FT                   /note="Signal peptide predicted for ROD01081 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.627) with cleavage site
FT                   probability 0.304 between residues 23 and 24"
FT   misc_feature    complement(128965..128988)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        129238..130281
FT                   /transl_table=11
FT                   /gene="guaC"
FT                   /locus_tag="ROD_01091"
FT                   /product="GMP reductase"
FT                   /EC_number="1.7.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01091"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86889"
FT                   /db_xref="GOA:D2TGP0"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005993"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGP0"
FT                   /protein_id="CBG86889.1"
FT                   /translation="MRIEEDLKLGFKDVLIRPKRSTLKSRSEVELERQYTFKHSGQSWS
FT                   GVPIIAANMDTVGTFEMAKALAAFDILTAVHKHYSVEDWSAFIEGASASVLRHVMVSTG
FT                   TSDADFDKTKQILALNPELNFVCIDVANGYSEHFVQFVSKAREAWPNKTICAGNVVTGE
FT                   MCEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGGMIVSDGGC
FT                   TTPGDVAKAFGGGADFVMLGGMLAGHDESGGKIVDENGEKFMLFYGMSSESAMTRHVGG
FT                   VAQYRAAEGKTVKLPLRGPVENTARDILGGLRSACTYVGASRLKELTKRTTFIRVQEQE
FT                   NRIFNSL"
FT   misc_feature    129259..130278
FT                   /gene="guaC"
FT                   /locus_tag="ROD_01091"
FT                   /note="HMMPfam hit to PF00478, IMP dehydrogenase/GMP
FT                   reductase, score 1.2e-159"
FT                   /inference="protein motif:PFAM:PF00478"
FT   misc_feature    129763..129801
FT                   /note="PS00487 IMP dehydrogenase / GMP reductase
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00487"
FT   CDS_pept        complement(130353..131555)
FT                   /transl_table=11
FT                   /gene="hofC"
FT                   /locus_tag="ROD_01101"
FT                   /product="protein transport protein HofC"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01101"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86890"
FT                   /db_xref="GOA:D2TGP1"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGP1"
FT                   /protein_id="CBG86890.1"
FT                   /translation="MSANKLWRWQGIDNGGSPGEGTLWAENRALLMLALQQCGITPLRV
FT                   KRLRVNRALWRSDKCAEVIQQLATLLQAGLTLSDGLWLLAGQHPDKQWQALLESLAREL
FT                   ENGAPLSSALAQWPDIFPPLYLAMIRTGELTGKLDVCCSELARQQKAQKQLRDKVAKAL
FT                   RYPTIILTMAVMVVLAMLHFVLPEFAAIYRTFNTPLPALTQWIIAVANGSARWGWLVIL
FT                   TGVALTAVAAGLRHHVAWQVLRQRWLLRAPVVGRLLRGQKLTQIFTILALTQSAGISFL
FT                   PALESVRETLRCPYWTQRISQVQDDISRGIPVWQAFKNAQEFTPLCLQLVRTGEAAGSL
FT                   DAMLHNLARHHSESTLALADSLAALLEPALLVITGLIIGTLVVAMYLPIFHLGDAMSGM
FT                   G"
FT   misc_feature    complement(join(130386..130454,130842..130910,
FT                   131001..131069))
FT                   /gene="hofC"
FT                   /locus_tag="ROD_01101"
FT                   /note="3 probable transmembrane helices predicted for
FT                   ROD01101 by TMHMM2.0 at aa 163-185, 216-238 and 368-390"
FT   misc_feature    complement(130392..130760)
FT                   /gene="hofC"
FT                   /locus_tag="ROD_01101"
FT                   /note="HMMPfam hit to PF00482, Bacterial type II secretion
FT                   system protein, score 1.5e-14"
FT                   /inference="protein motif:PFAM:PF00482"
FT   misc_feature    complement(130998..131369)
FT                   /gene="hofC"
FT                   /locus_tag="ROD_01101"
FT                   /note="HMMPfam hit to PF00482, Bacterial type II secretion
FT                   system protein, score 9.9e-22"
FT                   /inference="protein motif:PFAM:PF00482"
FT   misc_feature    complement(130998..131084)
FT                   /note="PS00874 Bacterial type II secretion system protein F
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00874"
FT   CDS_pept        complement(131545..132930)
FT                   /transl_table=11
FT                   /gene="hofB"
FT                   /locus_tag="ROD_01111"
FT                   /product="protein transport protein HofB"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01111"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86891"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGP2"
FT                   /protein_id="CBG86891.1"
FT                   /translation="MNTTQLKALCQRYQGILLDADSEAVHVAVVDAPSHQLLDALHFAT
FT                   TKRIEIVCWTRQQMEGHLHQPQQTLPAVIPESSLSAATLLDKTLQAALTSRASDIHIEP
FT                   AEHHFRIRLRIDGVLHSLPDIAKETGVALTARLKVLSHLDIAEHRLPQDGQFTVELNGA
FT                   AVSFRIATLPCRQGEKVVLRLLHQVNQALEVTALGMHDTQLSAFNHALQQPQGLVLVTG
FT                   PTGSGKTVTLYSALQSRNATEVNLCSVEDPVEIPLEGINQTQIHPRAGLTFQSVLRALL
FT                   RQDPDVIMVGEIRDGETAEIAIKAAQTGHLVLSTLHTNSTCEALVRLQQMGVARWMLSS
FT                   ALTLVVAQRLVRKLCPHCRRLTDDPVRLPQAVCAMPLPRWLAPGCEHCYHGYYGRTALF
FT                   EVLPISAGLRQQIANGATAEALEGYARQAGMLTLFESGCRAVDQGLTTFEELVRILGIP
FT                   NER"
FT   misc_feature    complement(131869..132705)
FT                   /gene="hofB"
FT                   /locus_tag="ROD_01111"
FT                   /note="HMMPfam hit to PF00437, Bacterial type II secretion
FT                   system protein E, score 3.4e-129"
FT                   /inference="protein motif:PFAM:PF00437"
FT   misc_feature    complement(132046..132090)
FT                   /note="PS00662 Bacterial type II secretion system protein E
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00662"
FT   misc_feature    complement(132244..132267)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(132927..133379)
FT                   /transl_table=11
FT                   /gene="ppdD"
FT                   /locus_tag="ROD_01121"
FT                   /product="prepilin peptidase dependent protein D precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01121"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86892"
FT                   /db_xref="GOA:D2TGP3"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGP3"
FT                   /protein_id="CBG86892.1"
FT                   /translation="MDKQRGFTLIELMVVIGIIAILSAIGIPAYQNYLRKAALTDILQT
FT                   FVPYRTAVELCALEHGGVATCDAGSNGIPAPTTTRYVSAMSVAKGVVSMSGQESLNGLS
FT                   VVMTPVWDNANGITGWTRSCAIQNDGALQQACEDVFRFDANAGGSE"
FT   misc_feature    complement(133293..133361)
FT                   /gene="ppdD"
FT                   /locus_tag="ROD_01121"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD01121 by TMHMM2.0 at aa 7-29"
FT   misc_feature    complement(133296..133367)
FT                   /gene="ppdD"
FT                   /locus_tag="ROD_01121"
FT                   /note="HMMPfam hit to PF07963, Prepilin-type
FT                   cleavage/methylation, N-terminal, score 1.9e-08"
FT                   /inference="protein motif:PFAM:PF07963"
FT   misc_feature    complement(133305..133367)
FT                   /note="PS00409 Prokaryotic N-terminal methylation site."
FT                   /inference="protein motif:Prosite:PS00409"
FT   CDS_pept        complement(133578..134513)
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="ROD_01131"
FT                   /product="nicotinate-nucleotide pyrophosphorylase
FT                   [carboxylating]"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01131"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86893"
FT                   /db_xref="GOA:D2TGP4"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGP4"
FT                   /protein_id="CBG86893.1"
FT                   /translation="MFPPYDSLAIWSFIMPPRRYNPDYRRDALLERINLDIPAAVAQAL
FT                   REDLGGEVDAGNDITAQLLPENTRAHATVITRENGVFCGKRWVEEVFIQLAGDDVTLIW
FT                   HVEDGDSISASQPLFELEGPARILLTGERTALNFVQTLSGVASEVRKYVDLLAGTKTQL
FT                   LDTRKTLPGLRTALKYAVLCGGGANHRLGLSDAFLIKENHIIASGSVRQAVEKAFWLHP
FT                   DVPVEVEVENLDELDEALKAGADIIMLDNFETEQMREAVKRANGQARLEVSGNVTDATL
FT                   REFAETGVDFISVGALTKHVRALDLSMRFR"
FT   misc_feature    complement(133587..134081)
FT                   /gene="nadC"
FT                   /locus_tag="ROD_01131"
FT                   /note="HMMPfam hit to PF01729, Quinolinate phosphoribosyl
FT                   transferase, score 3.2e-99"
FT                   /inference="protein motif:PFAM:PF01729"
FT   misc_feature    complement(134085..134354)
FT                   /gene="nadC"
FT                   /locus_tag="ROD_01131"
FT                   /note="HMMPfam hit to PF02749, Quinolinate phosphoribosyl
FT                   transferase, score 1.4e-42"
FT                   /inference="protein motif:PFAM:PF02749"
FT   CDS_pept        134559..135122
FT                   /transl_table=11
FT                   /gene="ampD"
FT                   /locus_tag="ROD_01141"
FT                   /product="N-acetyl-anhydromuramyl-L-alanine-amidase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01141"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86894"
FT                   /db_xref="GOA:D2TGP5"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGP5"
FT                   /protein_id="CBG86894.1"
FT                   /translation="MLLDKGWLAEARRVPSPHYDCRPDDENPSLLVVHNISLPPGEFGG
FT                   PWIDALFSGTIDPAAHPFFAEIAHLRVSAHCLIRRDGEIVQYVPFDKRAWHAGVSHYRG
FT                   RERCNDFSIGIELEGTDTLAYTDAQYQQLAAITRTLITHYPAIADNTTGHCDIAPERKT
FT                   DPGPAFDWTRFRALVTPSSDKEMT"
FT   misc_feature    134607..135089
FT                   /gene="ampD"
FT                   /locus_tag="ROD_01141"
FT                   /note="HMMPfam hit to PF01510, N-acetylmuramoyl-L-alanine
FT                   amidase, family 2, score 5.7e-60"
FT                   /inference="protein motif:PFAM:PF01510"
FT   CDS_pept        135119..135973
FT                   /transl_table=11
FT                   /gene="ampE"
FT                   /locus_tag="ROD_01151"
FT                   /product="AmpE protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01151"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86895"
FT                   /db_xref="GOA:D2TGP6"
FT                   /db_xref="InterPro:IPR031347"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGP6"
FT                   /protein_id="CBG86895.1"
FT                   /translation="MTLFTTLLVLLIERLFKLGEHWQFDHRLEAFFRRVKRFSMVRTLG
FT                   MTLIAMALTFLLLRALDGLLFNVPTIVAWILIGLLCIGAGKVRMHYHAYLTAASRDDAH
FT                   ARTAMASELTMIHGVPPGCDEREFLRELQNALLWINFRFYLAPLFWLIVGGTVGPVLLV
FT                   GYAFLRAWQSWLARYLTPHERLQSGIDAILHVLDWIPVRLAGVVYALIGHGEKALPAWF
FT                   ASLTDLHTAQYQVVTRLAQFSLAREPHTDKVGTPKAAVSMAKKTSLVGVVAIAFLTIYG
FT                   ALV"
FT   misc_feature    join(135233..135292,135305..135373,135554..135622,
FT                   135914..135967)
FT                   /gene="ampE"
FT                   /locus_tag="ROD_01151"
FT                   /note="4 probable transmembrane helices predicted for
FT                   ROD01151 by TMHMM2.0 at aa 39-58, 63-85, 146-168 and
FT                   266-283"
FT   CDS_pept        complement(136206..137156)
FT                   /transl_table=11
FT                   /locus_tag="ROD_01161"
FT                   /product="putatuve glycosysl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01161"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86896"
FT                   /db_xref="GOA:D2TGP7"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR016828"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGP7"
FT                   /protein_id="CBG86896.1"
FT                   /translation="MPNWPNPFIEQRADPFILRDGSDYYFIASVPEYDRLEIRRAASLE
FT                   GLRNAEPVVVWRKPETGPMCELIWAPEIHRINGKWYIYFAAAHTQALDKLGMFQHRMYA
FT                   LECADADPLTGLWREKGQIKTPFDTFALDATTFHHQGKQWYLWAQKSPHIAGNSNIYLA
FT                   ELENPWTLKGEPVMLSQPEYDWECRGFWVNEGPAVLTHGDRLFISYSASATDENYCMGL
FT                   LWIDMNADPQDPANWHKSPRPVFATSYENRQYGPGHNSFTQTPEGEDVLVYHARNYTEI
FT                   EGDPLYDPNRHTRLKLVRWDENGMPDFGIPPADTL"
FT   misc_feature    complement(136239..137147)
FT                   /locus_tag="ROD_01161"
FT                   /note="HMMPfam hit to PF04616, Glycoside hydrolase, family
FT                   43, score 2.4e-127"
FT                   /inference="protein motif:PFAM:PF04616"
FT   CDS_pept        complement(137156..138562)
FT                   /transl_table=11
FT                   /locus_tag="ROD_01171"
FT                   /product="putative symporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01171"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86897"
FT                   /db_xref="GOA:D2TGP8"
FT                   /db_xref="InterPro:IPR001927"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGP8"
FT                   /protein_id="CBG86897.1"
FT                   /translation="MDKGKLSVREKIGYGMGDAGCNIIFGAIMLFVNYFYTDIFGLAPA
FT                   LVGVLLLSVRVIDAVTDPVMGAIADRTQSKYGRFRPWLLWIAFPYALFSILMFTTPDWS
FT                   YNSKVIYAFVTYFLLSITYTAINIPYCSLGGVITNDPKERVACQSYRFVLVGIATLLLS
FT                   LTLLPMVDWFGGGDKAKGYQMAMTVLAIIGMCMFLFCFATVRERVRPAVPTHDDMKNDF
FT                   KDVWKNDQWVRILLLTLCNVCPGFIRMAATMYYVTWVMGQSTHFATLFISLGVVGMMIG
FT                   SMLAKVLTDRWCKLKVFFWTNIALALFSCAFYFFDPKTTALIVVLYFLLNILHQIPSPL
FT                   HWSLMADVDDYGEWKTGKRITGISFSGNLFFLKLGLAIAGAMVGFLLSWYGYDAGAKAQ
FT                   SDTAINGIVLLFTVIPGVGYLITAGVVRLLKVDRELMKQIQDDLEKRRVNYRELNEYQE
FT                   LKATESVRKA"
FT   misc_feature    complement(join(137276..137344,137402..137470,
FT                   137531..137599,137612..137680,137699..137767,
FT                   137795..137863,137960..138013,138041..138109,
FT                   138170..138238,138266..138319,138380..138448,
FT                   138461..138529))
FT                   /locus_tag="ROD_01171"
FT                   /note="12 probable transmembrane helices predicted for
FT                   ROD01171 by TMHMM2.0 at aa 12-34, 39-61, 82-99,
FT                   109-131,152-174, 184-201, 234-256, 266-288, 295-317,
FT                   322-344,365-387 and 407-429"
FT   misc_feature    complement(137399..138508)
FT                   /locus_tag="ROD_01171"
FT                   /note="HMMPfam hit to PF07690, Major facilitator
FT                   superfamily MFS-1, score 1.9e-10"
FT                   /inference="protein motif:PFAM:PF07690"
FT   misc_feature    complement(137633..137665)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(138722..140095)
FT                   /transl_table=11
FT                   /gene="aroP"
FT                   /locus_tag="ROD_01181"
FT                   /product="aromatic amino acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01181"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86898"
FT                   /db_xref="GOA:D2TGP9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGP9"
FT                   /protein_id="CBG86898.1"
FT                   /translation="MMDSQQHGEQLKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAG
FT                   PGIILGYAIAGFIAFLIMRQLGEMVVEEPVAGSFSHFAYKYWGGFAGFASGWNYWVLYV
FT                   LVAMAELTAVGKYIQFWYPEIPTWVSAAAFFILINAINLTNVKVFGEMEFWFAIIKVIA
FT                   VVAMILFGGWLLFSGNGGPQATVRNLWEQGGFLPHGMTGLVMMMAIIMFSFGGLELVGI
FT                   TAAEADNPEQSIPKATNQVIYRILIFYVGSLAVLLSLLPWTRVTADTSPFVLIFHELGD
FT                   TFVANALNIVVLTAALSVYNSCVYCNSRMLFGLAQQGNAPKALLSVDKRGVPVNTILVS
FT                   ALVTALCVLINYMAPESAFGLLMALVVSALVINWAMISLAHIKFRRAKQQQGVKTRFPA
FT                   LLYPLGNWICLLFMAAVLVIMLITPGMAISVYLIPVWLLILGVGYLCKQKTAKTVKAH"
FT   misc_feature    complement(138725..140041)
FT                   /gene="aroP"
FT                   /locus_tag="ROD_01181"
FT                   /note="HMMPfam hit to PF00324, Amino acid
FT                   permease-associated region, score 1.1e-176"
FT                   /inference="protein motif:PFAM:PF00324"
FT   misc_feature    complement(join(138758..138817,138830..138898,
FT                   138956..139024,139034..139102,139181..139249,
FT                   139307..139375,139433..139501,139568..139636,
FT                   139673..139741,139769..139837,139898..139957,
FT                   139970..140038))
FT                   /gene="aroP"
FT                   /locus_tag="ROD_01181"
FT                   /note="12 probable transmembrane helices predicted for
FT                   ROD01181 by TMHMM2.0 at aa 20-42, 47-66, 87-109,
FT                   119-141,154-176, 199-221, 241-263, 283-305, 332-354,
FT                   358-380,400-422 and 427-446"
FT   misc_feature    complement(139874..139966)
FT                   /note="PS00218 Amino acid permeases signature."
FT                   /inference="protein motif:Prosite:PS00218"
FT   CDS_pept        140658..141422
FT                   /transl_table=11
FT                   /gene="pdhR"
FT                   /locus_tag="ROD_01191"
FT                   /product="pyruvate dehydrogenase complex repressor"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01191"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86899"
FT                   /db_xref="GOA:D2TGQ0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGQ0"
FT                   /protein_id="CBG86899.1"
FT                   /translation="MAYSKIRQPKLSDVIEQQLEFLILEGTLRPGEKLPPERELAKQFD
FT                   VSRPSLREAIQRLEAKGLLLRRQGGGTFVQSSLWQSFSDPLVELLSDHLESQFDLLETR
FT                   HALEGIAAYYAALRSTSEDKTRIRELHHAIELAQQSGDLDAESDAVLQYQIAVTEAAHN
FT                   VVLLHLLRCMEPMLAQNVRQNFELLYSRREMLPLVSSHRTRIFEAIMAGNPEEAREASH
FT                   RHLAFIEEILLDRSREESRRERALRRLEQRKN"
FT   misc_feature    140688..140879
FT                   /gene="pdhR"
FT                   /locus_tag="ROD_01191"
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory protein
FT                   GntR, HTH, score 3.9e-34"
FT                   /inference="protein motif:PFAM:PF00392"
FT   misc_feature    140757..140831
FT                   /note="PS00043 Bacterial regulatory proteins, gntR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00043"
FT   misc_feature    140760..140825
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1327.000, SD 3.71 at aa 35-56, sequence
FT                   PPERELAKQFDVSRPSLREAIQ"
FT   misc_feature    140952..141338
FT                   /gene="pdhR"
FT                   /locus_tag="ROD_01191"
FT                   /note="HMMPfam hit to PF07729, GntR, C-terminal, score
FT                   2.6e-32"
FT                   /inference="protein motif:PFAM:PF07729"
FT   CDS_pept        141581..144244
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="ROD_01201"
FT                   /product="pyruvate dehydrogenase E1 component"
FT                   /EC_number="1.2.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01201"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86900"
FT                   /db_xref="GOA:D2TGQ1"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGQ1"
FT                   /protein_id="CBG86900.1"
FT                   /translation="MSERFQNDVDPIETRDWLQAIESVIREEGVERAQYLIDQLLSEAR
FT                   KGGVKVAAGAGASNYINTIAVEDEPEYPGNLELERRIRSAIRWNAIMTVLRASKKDLEL
FT                   GGHMASFQSSATIYDVCFNHFFRARNEQDGGDLVYFQGHISPGVYARAFLEGRLTEEQM
FT                   DNFRQEVHGNGLSSYPHPKLMPEFWQFPTVSMGLGPIGAIYQAKFLKYLEHRGLKDTSK
FT                   QTVYAFLGDGEMDEPESKGAITIATREKLDNLVFVINCNLQRLDGPVTGNGKIINELEG
FT                   IFEGAGWNVIKVMWGSRWDELLRKDTSGKLIQLMNETVDGDYQTFKSKDGAYVREHFFG
FT                   KYPETAALVADWTDEQIWALNRGGHDPKKVYAALKKAQETKGKATVILAHTIKGYGMGD
FT                   SAEGKNIAHQVKKMNMDGVRYVRDRFNVPVSDADLEKLPYITFPEGSDEHKYLHERRQA
FT                   LHGYLPSRQPNFTEKLELPTLEDFGALLEEQNKEISTTIAFVRALNVMLKNKSIKDRLV
FT                   PIIADEARTFGMEGLFRQIGIYSPNGQQYTPQDREQVAYYKEDEKGQILQEGINELGAG
FT                   SSWLAAATSYSTNNLPMIPFYIYYSMFGFQRIGDLCWAAGDQQARGFLIGGTSGRTTLN
FT                   GEGLQHEDGHSHIQSLTIPNCISYDPAYAYEVAVIMHDGLERMYGEKQENVYYYITTLN
FT                   ENYHMPAMPEGAEEGIRKGIYKLDTLEGNKGKVQLLGSGSILRHVREAAEILAKEYGVG
FT                   SDVYSVTSFTELARDGQDCERWNMLHPLETPRVPYIAQVMNDAPAVASTDYMKLFAEQV
FT                   RTYVPADDYRVLGTDGFGRSDSRENLRHHFEVDASYVVVAALGELAKRGEIDKKVVADA
FT                   IAKFNIDAEKVNPRLA"
FT   misc_feature    142667..142768
FT                   /gene="aceE"
FT                   /locus_tag="ROD_01201"
FT                   /note="HMMPfam hit to PF00456, Transketolase,
FT                   N-terminal,score 7e-05"
FT                   /inference="protein motif:PFAM:PF00456"
FT   CDS_pept        144259..145869
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="ROD_01211"
FT                   /product="dihydrolipoamide acetyltransferase component (E2)
FT                   of pyruvate dehydrogenase"
FT                   /EC_number="2.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01211"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86901"
FT                   /db_xref="GOA:D2THC6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:D2THC6"
FT                   /protein_id="CBG86901.1"
FT                   /translation="MAIEIKVPDIGADEVEITEILVKVGDKVEAEQSLITVEGDKASME
FT                   VPSPQAGVVKEIKVSVGDKTETGKLIMIFDSADGAADAAPAPAEEKKEAAPAKAEAAPA
FT                   AAAPAATGAKEVNVPDIGGDEVEVTEVMVKVGDKVAAEQSLITVEGDKASMEVPAPFAG
FT                   TVKEIKISTGDKVKTGSLIMIFEVEGAAPAAAPAKQEAAAPAPAAKAEAPAAAAKAEGK
FT                   SAFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILREDVQAYVKEAIKRAEAAP
FT                   AAASGGGLPGMLPWPKVDFSKFGEIEEVELGRIQKISGANLSRNWVMIPHVTHFDKTDI
FT                   TDLEAFRKQQNAEAEKRKLDVKFTPVVFIMKAVAAALEQMPRFNSSLSEDGQRLTLKKY
FT                   INIGVAVDTPNGLVVPVFKDVNKKSITELSRELTTISKKARDGKLTAGEMQGGCFTISS
FT                   IGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMMPISLSFDHRVIDGADG
FT                   ARFITIINNMLSDIRRLVM"
FT   misc_feature    144265..144480
FT                   /gene="aceF"
FT                   /locus_tag="ROD_01211"
FT                   /note="HMMPfam hit to PF00364, Biotin/lipoyl
FT                   attachment,score 2.5e-28"
FT                   /inference="protein motif:PFAM:PF00364"
FT   misc_feature    144331..144420
FT                   /note="PS00189 2-oxo acid dehydrogenases acyltransferase
FT                   component lipoyl binding site."
FT                   /inference="protein motif:Prosite:PS00189"
FT   misc_feature    144598..144813
FT                   /gene="aceF"
FT                   /locus_tag="ROD_01211"
FT                   /note="HMMPfam hit to PF00364, Biotin/lipoyl
FT                   attachment,score 3.9e-28"
FT                   /inference="protein motif:PFAM:PF00364"
FT   misc_feature    144664..144753
FT                   /note="PS00189 2-oxo acid dehydrogenases acyltransferase
FT                   component lipoyl binding site."
FT                   /inference="protein motif:Prosite:PS00189"
FT   misc_feature    144904..144927
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    144958..145068
FT                   /gene="aceF"
FT                   /locus_tag="ROD_01211"
FT                   /note="HMMPfam hit to PF02817, E3 binding, score 2e-18"
FT                   /inference="protein motif:PFAM:PF02817"
FT   misc_feature    145165..145866
FT                   /gene="aceF"
FT                   /locus_tag="ROD_01211"
FT                   /note="HMMPfam hit to PF00198, Catalytic domain of
FT                   components of various dehydrogenase complexes, score
FT                   6.5e-111"
FT                   /inference="protein motif:PFAM:PF00198"
FT   CDS_pept        146068..147492
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /locus_tag="ROD_01221"
FT                   /product="dihydrolipoyl dehydrogenase (E3 component of
FT                   pyruvate and 2-oxoglutarate dehydrogenase complexes)"
FT                   /EC_number="1.8.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01221"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86902"
FT                   /db_xref="GOA:D2THC7"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2THC7"
FT                   /protein_id="CBG86902.1"
FT                   /translation="MSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYNTLGGVC
FT                   LNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPKTDIDKIRTWKEKVITQLTGGLAGM
FT                   AKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHEDPRVW
FT                   DSTDALELKEVPKRMLVMGGGIIGLEMGTVYHALGSEIDVVEMFDQVIPAADKDIVKVF
FT                   TKRISKKFNLMLETKVTAVEAKEDGIYVSMEGKKAPAEAQRYDAVLVAIGRVPNGKNLD
FT                   AGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAAEVIAGKKH
FT                   YFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKL
FT                   IFDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEV
FT                   FEGSITDLPNPKAKKK"
FT   misc_feature    146089..147024
FT                   /gene="lpdA"
FT                   /locus_tag="ROD_01221"
FT                   /note="HMMPfam hit to PF07992, FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase, score 1.1e-76"
FT                   /inference="protein motif:PFAM:PF07992"
FT   misc_feature    146191..146223
FT                   /note="PS00076 Pyridine nucleotide-disulphide
FT                   oxidoreductases class-I active site."
FT                   /inference="protein motif:Prosite:PS00076"
FT   misc_feature    146596..146883
FT                   /gene="lpdA"
FT                   /locus_tag="ROD_01221"
FT                   /note="HMMPfam hit to PF00070, Pyridine
FT                   nucleotide-disulphide oxidoreductase, NAD-binding
FT                   region,score 1.3e-24"
FT                   /inference="protein motif:PFAM:PF00070"
FT   misc_feature    147106..147435
FT                   /gene="lpdA"
FT                   /locus_tag="ROD_01221"
FT                   /note="HMMPfam hit to PF02852, Pyridine
FT                   nucleotide-disulphide oxidoreductase dimerisation
FT                   region,score 2.5e-52"
FT                   /inference="protein motif:PFAM:PF02852"
FT   CDS_pept        complement(147571..148362)
FT                   /transl_table=11
FT                   /locus_tag="ROD_01231"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01231"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86903"
FT                   /db_xref="InterPro:IPR021556"
FT                   /db_xref="UniProtKB/TrEMBL:D2THC8"
FT                   /protein_id="CBG86903.1"
FT                   /translation="MKKMLFSALLLSLPLLSHAQQMFATPDEAASAFASAVASKNDAQL
FT                   TALLGDNWRQFLPPDGADPQAVARFNRDWKISHRIVRQGNVAYLNVGQQNWQLPIPVVK
FT                   SDTGWHFDMSAAQDEILTRTIGRNELSAIQAMRAYVDAQYDYRQRKQMFATKLISSEGQ
FT                   QDGLYWPVQPGERPSPLGPAFSPDMHSEGYHGYHFRIIASNSSRGFALLAWPVTWGETG
FT                   VMSFVVNQDDKVYQADLGKETEKKAAAITQYSDQQPWQPVE"
FT   sig_peptide     complement(148306..148362)
FT                   /locus_tag="ROD_01231"
FT                   /note="Signal peptide predicted for ROD01231 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.993 between residues 19 and 20"
FT   CDS_pept        complement(148375..149991)
FT                   /transl_table=11
FT                   /locus_tag="ROD_01241"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01241"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86904"
FT                   /db_xref="InterPro:IPR021728"
FT                   /db_xref="UniProtKB/TrEMBL:D2THC9"
FT                   /protein_id="CBG86904.1"
FT                   /translation="MTLSFKPHVLALVCSAGLFAASGVIYVKSRTPEAPSQPVPVTTPA
FT                   PAPAAPVVQPAFTTAQIDQWIAPIALYPDPLLSQVLMAATYPANVVQAVQWSRDNPTLQ
FT                   GDAAIQAVSGQPWDPSVKSLVAFPQLMALMGENPQWVQDLGDAFLAQPQDVMDAVQRLR
FT                   QLAQQTGSLQSTPQQTVTSTPKKSVATAQPAPAARTASATASTPTVIKIEPADPQVVYV
FT                   PSYNPATVYGTWPNTAYPPVYLPPPPGEQFASSFVKGFGYSLGVATTYALFSNIDWDDD
FT                   DDHHHHHDDDHHHDDHDHHHDGYQHNGDNININVNNFNRITGQHLQEQNLTWRHNPAYR
FT                   DGVPYHNSATAQRFHQTNVSGGLSATRQPTAATRDSQRQAAMAQLQQRHPTAAAQQQSP
FT                   SRDARRKAASQQLDQIARRNNYRGYDTDRASAPHQAIHKPTAVPLQQRREALKTRAQPH
FT                   PVTQQQRDNARQRIAASTPEQRQTFRQNHANAFSGNDSRSPDWQSQQRRGQESRRVGHL
FT                   SGEQRAAAREHLSERHEFRHR"
FT   sig_peptide     complement(149932..149991)
FT                   /locus_tag="ROD_01241"
FT                   /note="Signal peptide predicted for ROD01241 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.992) with cleavage site
FT                   probability 0.580 between residues 20 and 21"
FT   CDS_pept        150393..152990
FT                   /transl_table=11
FT                   /gene="acnB"
FT                   /locus_tag="ROD_01251"
FT                   /product="aconitate hydratase 2 (citrate hydro-lyase 2)"
FT                   /EC_number="4.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01251"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86905"
FT                   /db_xref="GOA:D2THD0"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/TrEMBL:D2THD0"
FT                   /protein_id="CBG86905.1"
FT                   /translation="MLEEYRKHVAERAAEGIVPKPLDATQMAALVELLKNPPAGEEEFL
FT                   LDLLINRVPPGVDEAAYVKAGFLAAVAKGETTSPLVTPEKAIELLGTMQGGYNIHPLID
FT                   ALDNDKLAPIAAKALSHTLLMFDNFYDVEEKAKAGNAFAKQVMHSWADAEWFLSRPELA
FT                   EKMTVTVFKVTGETNTDDLSPAPDAWSRPDIPLHALAMLKNAREGIEPDQPGAVGPIKQ
FT                   IEALQQKGFPLAYVGDVVGTGSSRKSATNSVLWFMGDDIPYVPNKRGGGLVLGGKIAPI
FT                   FFNTMEDAGALPVEVDVSNLNMGDVIDVYPYKGEVRNHESGELLATFALKTDVLIDEVR
FT                   AGGRIPLIIGRGLTTKAREALGLPHSDVFRQAKDVAESSRGFSLAQKMVGRACGVAGVR
FT                   PGAYCEPKMTSVGSQDTTGPMTRDELKDLACLGFSSDLVMQSFCHTAAYPKPVDVTTHH
FT                   TLPDFIMNRGGVSLRPGDGVIHSWLNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVAF
FT                   AAATGVMPLDMPESVLVRFKGKMQPGITLRDLVHAIPLYAIKQGLLTVEKKGKKNIFSG
FT                   RILEIEGLPDLKVEQAFELTDASAERSAAGCTIKLNKEPIIEYLNSNIVLLKWMIAEGY
FT                   GDRRTLERRIQGMEKWLADPQLLEADADAEYAAVIDIDLADIKEPILCAPNDPDDARLL
FT                   SDVQGEKIDEVFIGSCMTNIGHFRAAGKLLDAHKGQLPTRLWVAPPTRMDAAQLTEEGY
FT                   YSVFGKSGARIEIPGCSLCMGNQARVADGATVVSTSTRNFPNRLGTGANVFLASAELAA
FT                   VAALIGKLPTPEEYQTYVAQVDKTAVDTYRYLNFDQLSQYTEKADGVIFQTAV"
FT   misc_feature    150396..151538
FT                   /gene="acnB"
FT                   /locus_tag="ROD_01251"
FT                   /note="HMMPfam hit to PF06434, Aconitase B,
FT                   N-terminal,bacterial, score 4.1e-290"
FT                   /inference="protein motif:PFAM:PF06434"
FT   misc_feature    151539..152846
FT                   /gene="acnB"
FT                   /locus_tag="ROD_01251"
FT                   /note="HMMPfam hit to PF00330, Aconitase/3-isopropylmalate
FT                   dehydratase large subunit, alpha/beta/alpha, score 6.4e-11"
FT                   /inference="protein motif:PFAM:PF00330"
FT   misc_feature    152496..152549
FT                   /note="PS00450 Aconitase family signature 1."
FT                   /inference="protein motif:Prosite:PS00450"
FT   misc_feature    152673..152714
FT                   /note="PS01244 Aconitase family signature 2."
FT                   /inference="protein motif:Prosite:PS01244"
FT   CDS_pept        153192..153554
FT                   /transl_table=11
FT                   /locus_tag="ROD_01261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01261"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86906"
FT                   /db_xref="InterPro:IPR008249"
FT                   /db_xref="UniProtKB/TrEMBL:D2THD1"
FT                   /protein_id="CBG86906.1"
FT                   /translation="MDYEFLRDVTGRVLVRMSMGHEVVGHWFNEEVKENLTLLDEVEQA
FT                   AQAVKGSERSWQRAGHEYTLWMDGEEVMIRANQLEFTGDEMEEGMNYYDEESLSLCGVE
FT                   DFLQVVKAYRDFLRQS"
FT   misc_feature    153192..153545
FT                   /locus_tag="ROD_01261"
FT                   /note="HMMPfam hit to PF06062, Uncharacterised conserved
FT                   protein UCP006287, score 1.5e-74"
FT                   /inference="protein motif:PFAM:PF06062"
FT   CDS_pept        153736..154689
FT                   /transl_table=11
FT                   /locus_tag="ROD_01271"
FT                   /product="2-keto-3-deoxygluconate permease"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01271"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86907"
FT                   /db_xref="GOA:D2THD2"
FT                   /db_xref="InterPro:IPR004684"
FT                   /db_xref="UniProtKB/TrEMBL:D2THD2"
FT                   /protein_id="CBG86907.1"
FT                   /translation="MNIKKAIERVPGGMMVVPLVIGAIINTFAPQALEIGGFTTALFKN
FT                   GAAPLIGAFLLCMGAGISVKAAPQALLQGGTITLTKLLVAIAIGLGVEHLFGAEGIFGL
FT                   SGVAIIAAMSNSNGGLYAALVGEFGNERDVGAISILSLNDGPFFTMIALGAAGMANIPI
FT                   MALVAVLIPLVVGMILGNLDPHMRDFLTKGGPLLIPFFAFALGAGVNLEMLLQGGLAGV
FT                   LLGVLTTFVGGFFNIRADRLVGGSGIAGAAASSTAGNAVATPLAIAQADPSLAQVAAAA
FT                   APLIAASVITTAILTPILTSWVAKKQARQNVKEKKA"
FT   misc_feature    153736..154659
FT                   /locus_tag="ROD_01271"
FT                   /note="HMMPfam hit to PF03812, 2-keto-3-deoxygluconate
FT                   permease, score 1.3e-96"
FT                   /inference="protein motif:PFAM:PF03812"
FT   misc_feature    join(153772..153840,153868..153927,153946..154005,
FT                   154033..154101,154135..154203,154213..154281,
FT                   154300..154368,154378..154446,154465..154533,
FT                   154576..154644)
FT                   /locus_tag="ROD_01271"
FT                   /note="10 probable transmembrane helices predicted for
FT                   ROD01271 by TMHMM2.0 at aa 13-35, 45-64, 71-90,
FT                   100-122,134-156, 160-182, 189-211, 215-237, 244-266 and
FT                   281-303"
FT   CDS_pept        154686..155957
FT                   /transl_table=11
FT                   /locus_tag="ROD_01281"
FT                   /product="conserved hypothetical protein"
FT                   /note="Note the database hits to type III effectors"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01281"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86908"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:D2THD3"
FT                   /protein_id="CBG86908.1"
FT                   /translation="MKMIVIADDFTGSNDTGVQLAKKGARTEVMLTPEQKPSRRADVLV
FT                   INTESRAIPAEQAAKAVQQALAPWCEGDRMPLVYKKIDSTFRGNVGAEVTAAMRAARRR
FT                   LAVIAAAIPAAGRTTRDGLCLVNGTPLLETEFASDPKTPILSSRIAELVALQSDVPVHE
FT                   VSLDAVRRGELSALLAAYAAEGECMVVADAVEDRDLSLIAHAVCEQKEMPLLVGAAGLA
FT                   NALPVRTFMQAKQELPVLVVAGSMSEATRRQVEKALCHGRAKVVDIDASRLASAQAEQE
FT                   IASVVEQACALLGQRHHTILRTSRSAEDRQMIDSLCRELGVSRQQLGEQLSQRLGKITL
FT                   RIIERSRIGGLFLTGGDIATAVASALGAEGYRIQSEVASCIPCGTFVNSEIDDLPVITK
FT                   AGGFGSDSTLCDALYFIEEMYRGN"
FT   misc_feature    155151..155810
FT                   /locus_tag="ROD_01281"
FT                   /note="HMMPfam hit to PF07005, Type III effector
FT                   Hrp-dependent outers, score 4.9e-06"
FT                   /inference="protein motif:PFAM:PF07005"
FT   CDS_pept        155947..156930
FT                   /transl_table=11
FT                   /locus_tag="ROD_01291"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01291"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86909"
FT                   /db_xref="GOA:D2THD4"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:D2THD4"
FT                   /protein_id="CBG86909.1"
FT                   /translation="MVTKTIAITMGDPAGIGPEIIVKALGEEELNGAPLVVVGCLQTLK
FT                   RLQAKGLAEGVTFRAIEQVADARFAPGVIHVIDEPLAQPEALEPGKVQAQAGDLAYRCV
FT                   KRATELAMKGDVHAIATAPLNKEALHLAGHNYPGHTELLATLTDSRDYAMVLYTDRLKV
FT                   IHVSTHIALRKFLDTLNGQRVETVIGIADRFLKRVGFAHPRIAVAGVNPHAGENGLFGD
FT                   EEIRIVAPAIENMKAQGMDVYGPCPPDTVFLQAYEGQYDMVVAMYHDQGHIPLKLLGFY
FT                   DGVNITAGLPFIRTSADHGTAFDIAWTGKAKSESMAVSIKLAMQLA"
FT   misc_feature    156016..156918
FT                   /locus_tag="ROD_01291"
FT                   /note="HMMPfam hit to PF04166, Pyridoxal phosphate (active
FT                   vitamin B6) biosynthesis PdxA, score 1.5e-115"
FT                   /inference="protein motif:PFAM:PF04166"
FT   misc_feature    156034..156066
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        156940..157719
FT                   /transl_table=11
FT                   /locus_tag="ROD_01301"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01301"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86910"
FT                   /db_xref="GOA:D2THD5"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D2THD5"
FT                   /protein_id="CBG86910.1"
FT                   /translation="MKGQHRLDKIVAYLKNHTLVTVEQLVDAVEASPATIRRDLIKLDE
FT                   QGVISRSHGGVALRRFEPAQPTTNEKQLRSPAEKRAIARFAASMVRPGDAVVLDAGTTM
FT                   LELAKCLTHLPLRVITVDLHIALFLCEFRQIEVTIIGGRIDDSSQSCIGESGRKMLRSV
FT                   YPDIAFMSCNTWSMEKGVTTPTEDKAGLKQEIIANAQRKVLLADSSKYGAHSLFNVTPL
FT                   SRFTDVVTDINLPHSAQDELKALPVALTLVQPEPSEF"
FT   misc_feature    156955..157113
FT                   /locus_tag="ROD_01301"
FT                   /note="HMMPfam hit to PF08220, Bacterial regulatory
FT                   protein, DeoR N-terminal, score 5.9e-18"
FT                   /inference="protein motif:PFAM:PF08220"
FT   misc_feature    156955..157059
FT                   /note="PS00894 Bacterial regulatory proteins, deoR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00894"
FT   misc_feature    157165..157632
FT                   /locus_tag="ROD_01301"
FT                   /note="HMMPfam hit to PF00455, Bacterial regulatory
FT                   protein, DeoR, score 1.2e-48"
FT                   /inference="protein motif:PFAM:PF00455"
FT   CDS_pept        complement(158031..158825)
FT                   /transl_table=11
FT                   /gene="speD"
FT                   /locus_tag="ROD_01311"
FT                   /product="S-adenosylmethionine decarboxylase proenzyme"
FT                   /EC_number="4.1.1.50"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01311"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86911"
FT                   /db_xref="GOA:D2THD6"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR009165"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="UniProtKB/TrEMBL:D2THD6"
FT                   /protein_id="CBG86911.1"
FT                   /translation="MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNA
FT                   NRLTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVDPLLIDKTEHPGPLPET
FT                   VVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPLKALNYLIHQLESDIVTI
FT                   DYRVRGFTRDINGMKHFIDHEINSIQNFMSEDMKSLYDMVDVNVYQENIFHTKMLLKEF
FT                   DLKHYMFHTRPEDLTEAERQEITTALWKEMREIYYGRNIPAV"
FT   misc_feature    complement(158319..158714)
FT                   /gene="speD"
FT                   /locus_tag="ROD_01311"
FT                   /note="HMMPfam hit to PF02675, S-adenosylmethionine
FT                   decarboxylase related, score 2.1e-78"
FT                   /inference="protein motif:PFAM:PF02675"
FT   CDS_pept        complement(158841..159707)
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="ROD_01321"
FT                   /product="spermidine synthase"
FT                   /EC_number="2.5.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01321"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86912"
FT                   /db_xref="GOA:D2THD7"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/TrEMBL:D2THD7"
FT                   /protein_id="CBG86912.1"
FT                   /translation="MAENPQWHETLHDQFGQYFAVDNVLYHEKTDHQDLIIFENAAFGR
FT                   VMALDGVVQTTERDEFIYHEMMTHVPLFAHGHARHVLIIGGGDGAMLREVTRHKNVETI
FT                   TMVEIDAGVVSFCRQYLPNHNAGSYDDPRFTLVIDDGVNFVNQTQQTFDVIISDCTDPI
FT                   GPGESLFTSAFYEGCKRCLNPGGIFVAQNGVCFLQQDEALDSHRKLSHYFADVGFYQAA
FT                   IPTYYGGIMTFAWATDNEALRHLSTEIIQARFHTSGLKCRYYNPAIHTAAFALPQYLQD
FT                   ALTSSSS"
FT   misc_feature    complement(158976..159692)
FT                   /gene="speE"
FT                   /locus_tag="ROD_01321"
FT                   /note="HMMPfam hit to PF01564, Spermine synthase, score
FT                   1.1e-133"
FT                   /inference="protein motif:PFAM:PF01564"
FT   misc_feature    complement(159270..159305)
FT                   /note="PS00136 Serine proteases, subtilase family, aspartic
FT                   acid active site."
FT                   /inference="protein motif:Prosite:PS00136"
FT   misc_feature    complement(159426..159467)
FT                   /note="PS01330 Spermidine/spermine synthases family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01330"
FT   CDS_pept        complement(159812..160120)
FT                   /transl_table=11
FT                   /locus_tag="ROD_01331"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01331"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86913"
FT                   /db_xref="InterPro:IPR019114"
FT                   /db_xref="InterPro:IPR038432"
FT                   /db_xref="UniProtKB/TrEMBL:D2THD8"
FT                   /protein_id="CBG86913.1"
FT                   /translation="MAVCANSYALSESEAEDMADLTAVFVFLKNDCGYQNLPNGQIRRA
FT                   LVFFAQQNQWDLSNYDTFDMKSLGEDSYRDLSGIGIPVAKKCKALARDSLSLLAYVK"
FT   CDS_pept        160327..161877
FT                   /transl_table=11
FT                   /gene="cueO"
FT                   /locus_tag="ROD_01341"
FT                   /product="blue copper oxidase precursor (copper efflux
FT                   oxidase)"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01341"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86914"
FT                   /db_xref="GOA:D2THD9"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:D2THD9"
FT                   /protein_id="CBG86914.1"
FT                   /translation="MQRRDFLKYSVALGMASALPLWSRAAFAAGRPALPVPQLLTADAR
FT                   NRISLMVQAGQSTFSGKTATTWGYNGSLLGPALKLQKGKAVTVDIHNQLAEETTVHWHG
FT                   LEVPGEVDGGPQGIIPAGGKRTVTFTPQQRAATCWFHPHQHGKTGHQVAMGLAGLVIIE
FT                   DEEMHKLLLPKQWGIDDVPVIVQDKRFTDAGQIDYQLDVMTAAVGWFGDTLLTNGAIYP
FT                   QHAAPRGWLRLRLLNGCNARSLNFAASDNRPLYVIASDGGLLAEPVKVNELPVLMGERF
FT                   EVLVDISDGKPFDLVTLPVSQMGMAVAPFDKPHPVMRVQPVAVNASGMLPDTLATMPGL
FT                   PPLEGLTTRTLQLSMDPMLDMMGMQKLMEKYGDQAMAGMSHGQMQGHMQHGRMGEMHHG
FT                   GHFDFHNANKINGVAFDMNKPMFAASKGQYERWVISGVGDMMLHPFHIHGTQFRILSEN
FT                   GQPPAAHRAGWKDTVHVEGGVSEVLVRFEHEAPKEFAYMAHCHLLEHEDTGMMAGFTV"
FT   sig_peptide     160327..160410
FT                   /gene="cueO"
FT                   /locus_tag="ROD_01341"
FT                   /note="Signal peptide predicted for ROD01341 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 28 and 29"
FT   misc_feature    160477..160827
FT                   /gene="cueO"
FT                   /locus_tag="ROD_01341"
FT                   /note="HMMPfam hit to PF07732, Multicopper oxidase, type
FT                   3,score 4.1e-47"
FT                   /inference="protein motif:PFAM:PF07732"
FT   misc_feature    161458..161874
FT                   /gene="cueO"
FT                   /locus_tag="ROD_01341"
FT                   /note="HMMPfam hit to PF07731, Multicopper oxidase, type
FT                   2,score 3e-20"
FT                   /inference="protein motif:PFAM:PF07731"
FT   misc_feature    161821..161856
FT                   /note="PS00080 Multicopper oxidases signature 2."
FT                   /inference="protein motif:Prosite:PS00080"
FT   repeat_region   complement(161908..163279)
FT                   /note="Insertion sequence ISCro5. Has 13 bp
FT                   perfect,subterminal inverted repeats but no direct repeats.
FT                   1 of 5 100% identical ISCro5 elements in CR chromosome,
FT                   ISCro5 includes 7 bp 5' and 3 bp 3' outside of the inverted
FT                   repeats, common to the IS1111 subgroup of the IS110 family.
FT                   Each IS element is flanked by the same 4 bp sequence 5' and
FT                   7 bp sequence 3' which likely represents its target
FT                   sequence"
FT   repeat_region   161911..161923
FT                   /note="13 bp subterminal inverted repeat of ISCro5"
FT   CDS_pept        complement(162185..163195)
FT                   /transl_table=11
FT                   /locus_tag="ROD_01351"
FT                   /product="ISCro5 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01351"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86915"
FT                   /db_xref="GOA:D2THE0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D2THE0"
FT                   /protein_id="CBG86915.1"
FT                   /translation="MNIKRIGLDLAKLVFQLHGVDHHERVVLRKTLRRSQMLVFFARLE
FT                   PCLIGIEACGSSHYWARELTRLGHSVRIIPPRFVKPYLKGNKNDANDAEAICEAVSRPG
FT                   MRYVAVKSEAQQSMQAEHRVRARLLRDRTALSNEIRGMLGEFGLVLPVGLAALRRALPE
FT                   ILSQQEQWDNRFIRLLCELAEELQILDDRLARYDRRLKQLAQDDDRIRRLQEISGIGPV
FT                   TASALVAAVGNARQFKNGREMAAWLGLVPGQHSSGGKNRLGHISKRGDSYLRTLLIHGA
FT                   RAVLNACGNKEDRRSQWLQSVAERRNRNVATVAMANKNARIAWAVLSREEEYRVM"
FT   misc_feature    complement(162302..162565)
FT                   /locus_tag="ROD_01351"
FT                   /note="HMMPfam hit to PF02371,
FT                   Transposase,IS116/IS110/IS902, score 2.7e-31"
FT                   /inference="protein motif:PFAM:PF02371"
FT   repeat_region   complement(163260..163272)
FT                   /note="13 bp subterminal inverted repeat of ISCro5"
FT   CDS_pept        complement(163358..165748)
FT                   /transl_table=11
FT                   /gene="gcd"
FT                   /locus_tag="ROD_01361"
FT                   /product="quinoprotein glucose dehydrogenase"
FT                   /EC_number="1.1.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01361"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86916"
FT                   /db_xref="GOA:D2THE1"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017511"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:D2THE1"
FT                   /protein_id="CBG86916.1"
FT                   /translation="MAENNARSPRLLVTLTALFAALCGLYLLIGGGWLVAIGGSWYYPI
FT                   AGLAMLGVAWLLWRSRRTALWLYAALLLATMIWGVWEVGFDFWALTPRSDILVFFGIWL
FT                   ILPFVWHRLMVPSRGAVAALVAALLISGGILTWAGFNDPQEIDGALSAESTPAQAISPV
FT                   ADGDWPAYGRNQEGQRYSPLKQINADNVHKLKEAWVFRTGDLKQPDDPGELTNEVTPIK
FT                   VGDTLYLCTAHQRLFALEAATGKEKWHYDPELKTNESFQHVTCRGVSYHEATAGNASPE
FT                   VIADCPRRIILPVNDGRLIALNAETGKLCETFGNKGVLNLQTNMPDQTPGLYEPTSPPI
FT                   ITDKTIVIAGSVTDNFSTRETSGVIRGFDVNNGKLLWAFDPGAKDPNAIPSDEHTFTFN
FT                   SPNSWAPAAYDAKLDLVYLPMGVSTPDIWGGHRTPEQERYASSILALNATTGKLAWSYQ
FT                   TVHHDLWDMDLPAQPTLADITVNGQTVPVIYAPAKTGNIFVLDRRNGELVVPAPETPVP
FT                   QGAAKGDYVSKTQPFSELSFRPKKDLSGADMWGATMFDQLVCRVMFHQLRYEGIFTPPS
FT                   EQGTLVFPGNLGMFEWGGISVDPNRQVAIANPMALPFVSKLIPRGPGNPMEQPKDAKGT
FT                   GTEAGIQPQYGVPYGVTLNPFLSPFGLPCKQPAWGYISALDLKTNEVVWKKRIGTPQDS
FT                   MPFPMPVPLPFNMGMPMLGGPISTAGNVLFIAATADNYLRAYNMSNGEKLWQARLPAGG
FT                   QATPMTYEVNGKQYVVISAGGHGSFGTKMGDYIVAYALPDDEK"
FT   misc_feature    complement(163472..163588)
FT                   /gene="gcd"
FT                   /locus_tag="ROD_01361"
FT                   /note="HMMPfam hit to PF01011, Pyrrolo-quinoline
FT                   quinone,score 2.2e-08"
FT                   /inference="protein motif:PFAM:PF01011"
FT   misc_feature    complement(163655..163771)
FT                   /gene="gcd"
FT                   /locus_tag="ROD_01361"
FT                   /note="HMMPfam hit to PF01011, Pyrrolo-quinoline
FT                   quinone,score 4.3e-06"
FT                   /inference="protein motif:PFAM:PF01011"
FT   misc_feature    complement(164180..164293)
FT                   /gene="gcd"
FT                   /locus_tag="ROD_01361"
FT                   /note="HMMPfam hit to PF01011, Pyrrolo-quinoline
FT                   quinone,score 0.00093"
FT                   /inference="protein motif:PFAM:PF01011"
FT   misc_feature    complement(164342..164449)
FT                   /gene="gcd"
FT                   /locus_tag="ROD_01361"
FT                   /note="HMMPfam hit to PF01011, Pyrrolo-quinoline
FT                   quinone,score 0.0021"
FT                   /inference="protein motif:PFAM:PF01011"
FT   misc_feature    complement(164474..164539)
FT                   /note="PS00364 Bacterial quinoprotein dehydrogenases
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00364"
FT   misc_feature    complement(164576..164692)
FT                   /gene="gcd"
FT                   /locus_tag="ROD_01361"
FT                   /note="HMMPfam hit to PF01011, Pyrrolo-quinoline
FT                   quinone,score 0.0004"
FT                   /inference="protein motif:PFAM:PF01011"
FT   misc_feature    complement(164774..164887)
FT                   /gene="gcd"
FT                   /locus_tag="ROD_01361"
FT                   /note="HMMPfam hit to PF01011, Pyrrolo-quinoline
FT                   quinone,score 5.3e-05"
FT                   /inference="protein motif:PFAM:PF01011"
FT   misc_feature    complement(164963..165076)
FT                   /gene="gcd"
FT                   /locus_tag="ROD_01361"
FT                   /note="HMMPfam hit to PF01011, Pyrrolo-quinoline
FT                   quinone,score 3e-08"
FT                   /inference="protein motif:PFAM:PF01011"
FT   misc_feature    complement(165164..165250)
FT                   /note="PS00363 Bacterial quinoprotein dehydrogenases
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00363"
FT   misc_feature    complement(join(165332..165391,165410..165463,
FT                   165506..165559,165578..165631,165644..165712))
FT                   /gene="gcd"
FT                   /locus_tag="ROD_01361"
FT                   /note="5 probable transmembrane helices predicted for
FT                   ROD01361 by TMHMM2.0 at aa 13-35, 40-57, 64-81, 96-113 and
FT                   120-139"
FT   CDS_pept        165954..166490
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="ROD_01371"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01371"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86917"
FT                   /db_xref="GOA:D2THE2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D2THE2"
FT                   /protein_id="CBG86917.1"
FT                   /translation="MKHTVEVMIPEAEIKARIAELGRQITQRYKDSGSEMVLVGLLRGS
FT                   FMFMADLCREVQVSHEVDFMTASSYGSGMSTTRDVKILKDLDEDIRGKDVLIVEDIIDS
FT                   GNTLSKVREILSLREPKSLAICTLLDKPSRREVNVPVEFVGFSIPDEFVVGYGIDYAQR
FT                   YRHLPYVGKVVLLDE"
FT   misc_feature    165960..166400
FT                   /gene="hpt"
FT                   /locus_tag="ROD_01371"
FT                   /note="HMMPfam hit to PF00156,
FT                   Phosphoribosyltransferase,score 9.1e-38"
FT                   /inference="protein motif:PFAM:PF00156"
FT   misc_feature    166236..166274
FT                   /note="PS00103 Purine/pyrimidine phosphoribosyl
FT                   transferases signature."
FT                   /inference="protein motif:Prosite:PS00103"
FT   CDS_pept        complement(166550..167212)
FT                   /transl_table=11
FT                   /gene="can"
FT                   /locus_tag="ROD_01381"
FT                   /product="carbonic anhydrase 2"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01381"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86918"
FT                   /db_xref="GOA:D2THE3"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D2THE3"
FT                   /protein_id="CBG86918.1"
FT                   /translation="MKDIDTLISNNALWSKMLVEEDPGFFEKLAQAQKPRFLWIGCSDS
FT                   RVPAERLTGLEPGELFVHRNVANLVIHTDLNCLSVVQYAVDVLEVEHIIICGHSGCGGI
FT                   QAAVENPELGLINNWLLHIRDIWLKHSSLLGEMPEERRLDALYELNVMEQVYNLGHSTI
FT                   MQSAWKRGQKVTIHGWAYSINDGLLRDLDVTATNRETLENRYHKGVSALGKKYINHE"
FT   misc_feature    complement(166637..167125)
FT                   /gene="can"
FT                   /locus_tag="ROD_01381"
FT                   /note="HMMPfam hit to PF00484, Carbonic anhydrase, score
FT                   2.5e-62"
FT                   /inference="protein motif:PFAM:PF00484"
FT   misc_feature    complement(166907..166969)
FT                   /note="PS00705 Prokaryotic-type carbonic anhydrases
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00705"
FT   misc_feature    complement(167066..167089)
FT                   /note="PS00704 Prokaryotic-type carbonic anhydrases
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00704"
FT   CDS_pept        167321..168247
FT                   /transl_table=11
FT                   /locus_tag="ROD_01391"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01391"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86919"
FT                   /db_xref="GOA:D2THE4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2THE4"
FT                   /protein_id="CBG86919.1"
FT                   /translation="MTIALELQQLKKTYPGGVQALRGIDLQVEAGDFYALLGPNGAGKS
FT                   TTIGIISSLVNKTSGRVCVFGYDLEKDIVNAKRQLGLVPQEFNFNPFETVQQIVVNQAG
FT                   YYGVERKEAVARSEKYLKQLDLWEKRNERARMLSGGMKRRLMIARALMHEPKLLILDEP
FT                   TAGVDIELRRSMWGFLKDLNDKGTTIILTTHYLEEAEMLCRNIGIIQHGELVENTSMKS
FT                   LLSKLKSETFILDLAPRSPLPKLNGYQYRLVDTSTLEVEVLREQGINSVFSQLSEQGIQ
FT                   VLSMRNKANRLEELFVSLVHEKQGDRA"
FT   misc_feature    167411..167956
FT                   /locus_tag="ROD_01391"
FT                   /note="HMMPfam hit to PF00005, ABC transporter
FT                   related,score 3.5e-53"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    167432..167455
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    167729..167773
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        168244..169014
FT                   /transl_table=11
FT                   /locus_tag="ROD_01401"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01401"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86920"
FT                   /db_xref="GOA:D2THE5"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D2THE5"
FT                   /protein_id="CBG86920.1"
FT                   /translation="MMQLYWVALKSIWAKEINRFMRIWVQTLVPPVITMTLYFIIFGNL
FT                   IGSRIGEMHGFSYMQFIVPGLIMMAVITNAYANVASSFFSAKFQRNIEELLVAPVPTHV
FT                   IIAGFVGGGVARGLCVGVLVTAVSLFFVPFQVHSWLFVAMTLVLTAILFSLAGLLNAVF
FT                   AKTFDDISLIPTFVLTPLTYLGGVFYSLTLLPPFWQGLSHLNPIVYMISGFRYGFLGIH
FT                   DVPLVTTFGVLLIFIIAFYLLCWTLIQRGRGLRS"
FT   misc_feature    168262..168900
FT                   /locus_tag="ROD_01401"
FT                   /note="HMMPfam hit to PF01061, ABC-2 type transporter,score
FT                   2.3e-48"
FT                   /inference="protein motif:PFAM:PF01061"
FT   misc_feature    join(168301..168369,168427..168495,168553..168621,
FT                   168664..168732,168751..168819,168919..168987)
FT                   /locus_tag="ROD_01401"
FT                   /note="6 probable transmembrane helices predicted for
FT                   ROD01401 by TMHMM2.0 at aa 20-42, 62-84, 104-126,
FT                   141-163,170-192 and 226-248"
FT   misc_feature    168775..168888
FT                   /note="PS00890 ABC-2 type transport system integral
FT                   membrane proteins signature."
FT                   /inference="protein motif:Prosite:PS00890"
FT   CDS_pept        169120..169560
FT                   /transl_table=11
FT                   /locus_tag="ROD_01411"
FT                   /product="PTS system IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01411"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86921"
FT                   /db_xref="GOA:D2THE6"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:D2THE6"
FT                   /protein_id="CBG86921.1"
FT                   /translation="MLGWVITCHDDRAQELLERLEKRYGPLTQCRAVNYWQGLSANMLS
FT                   RIMCDALHETDSGEGVIFLTDISGAAPYRVASLLSHKHPLCEVISGVSFSLLEQMLLLR
FT                   ETMNSAAFRDRIVALGAPEVTSLWHQQQKNPPFVLLHDLYAC"
FT   misc_feature    169123..169470
FT                   /locus_tag="ROD_01411"
FT                   /note="HMMPfam hit to PF03610, Phosphotransferase
FT                   system,fructose subfamily IIA component, score 2e-26"
FT                   /inference="protein motif:PFAM:PF03610"
FT   CDS_pept        169646..170872
FT                   /transl_table=11
FT                   /locus_tag="ROD_01421"
FT                   /product="putative polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01421"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86922"
FT                   /db_xref="GOA:D2THE7"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D2THE7"
FT                   /protein_id="CBG86922.1"
FT                   /translation="MMKYLVLLLCWLSTAVSAALPARYMQTTENAAIWAQIGDKMITVG
FT                   HVRSGQILSVIPVAADYYEFSFGFGTGFIDKQHLGPVQGKQRVADSLGDLNKPLSNQNL
FT                   ITWQATPVYNAPNVGSAPFGVLSENLRYPIVSKLKDRLNQTWYQIRIADRLAWISALDA
FT                   QEDRGMPVLTYHHILRDEENTRFRHTSTTTSVRAFSNQMTWLRDRGYATLTMAQLEGYV
FT                   RNQLNLPAKAVAITFDDGLKSVSRYAYPVLKQYGMKATAFIITSRIKGRPQKWDPRSLQ
FT                   FMSVSELKGIQDVFDLQSHTHFLHRVDGDRHPILLSRSEHNILFDFKRSRRVLSRFNSQ
FT                   ALFLSYPFGGYNSKAVEAAKDAGFHLAVTTVKGKVKPGDNPFLLKRLYILRTDSLEMMS
FT                   RLISNQPQG"
FT   sig_peptide     169646..169699
FT                   /locus_tag="ROD_01421"
FT                   /note="Signal peptide predicted for ROD01421 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.945 between residues 18 and 19"
FT   misc_feature    170321..170746
FT                   /locus_tag="ROD_01421"
FT                   /note="HMMPfam hit to PF01522, Polysaccharide
FT                   deacetylase,score 6.1e-23"
FT                   /inference="protein motif:PFAM:PF01522"
FT   misc_feature    170687..170773
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS_pept        complement(170876..171256)
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="ROD_01431"
FT                   /product="aspartate L-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01431"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86923"
FT                   /db_xref="GOA:D2THE8"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:D2THE8"
FT                   /protein_id="CBG86923.1"
FT                   /translation="MIRKMLQGKLHRVKVTQADLHYEGSCAIDQDFLDAAGILENEAID
FT                   IWNVSNGNRFSTYAIAAERGSRIISVNGAAAHCANVGDIVIIASFVTMTDEEARRWQPK
FT                   VAYFEGDNEMKRTAKAIPVQVA"
FT   misc_feature    complement(170909..171256)
FT                   /gene="panD"
FT                   /locus_tag="ROD_01431"
FT                   /note="HMMPfam hit to PF02261, Aspartate
FT                   decarboxylase,score 2e-84"
FT                   /inference="protein motif:PFAM:PF02261"
FT   misc_feature    complement(171110..171154)
FT                   /note="PS00678 Trp-Asp (WD) repeats signature."
FT                   /inference="protein motif:Prosite:PS00678"
FT   CDS_pept        complement(171400..172254)
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="ROD_01441"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01441"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86924"
FT                   /db_xref="GOA:D2THE9"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:D2THE9"
FT                   /protein_id="CBG86924.1"
FT                   /translation="MLIIETLPLLRQHIRRARQEGKRIALVPTMGNLHDGHLKLVDEAK
FT                   ARADIVVVSIFVNPMQFDRPDDLARYPRTLQEDCEKLNKRKVDVVFAPAADQIYPQGTE
FT                   GQTYVDVPGLSTMLEGASRPGHFRGVSTIVSKLFNLVGPDIACFGEKDFQQLALIRKMV
FT                   ADMGYDIEIVGVPIIRAKDGLALSSRNGYLTAEQRKIAPGLYKAMCGIGEKLQAGEREL
FT                   DELIALAEKELNEKGFRADDIQIRDADTLLELTESSQRAVILAAAWLGQARLIDNQIVT
FT                   LTQ"
FT   misc_feature    complement(171415..172251)
FT                   /gene="panC"
FT                   /locus_tag="ROD_01441"
FT                   /note="HMMPfam hit to PF02569, Pantoate-beta-alanine
FT                   ligase, score 5.8e-172"
FT                   /inference="protein motif:PFAM:PF02569"
FT   CDS_pept        complement(172318..173109)
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="ROD_01451"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01451"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86925"
FT                   /db_xref="GOA:D2THF0"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D2THF0"
FT                   /protein_id="CBG86925.1"
FT                   /translation="MKPTTLSLLQKCKQEKKRFATITAYDYSFAKLFAEEGINVMLVGD
FT                   SLGMTVQGHDSTLPVTVEDIAYHTHAVRRGAPNCLLLADLPFMAYATPQQACENAAIVM
FT                   RAGANMVKIEGGAWLVDTVRMLTERAVPVCGHLGLTPQSVNIFGGYKVQGRGDAGQRLL
FT                   DDALALEAAGAQLIVLECVPVALAKRVTDALSIPVIGIGAGNVTDGQILVMHDAFGITG
FT                   GHIPKFAKNFLSEAGDMRAAVRQYIAEVESGLYPGEEHSFH"
FT   misc_feature    complement(172333..173106)
FT                   /gene="panB"
FT                   /locus_tag="ROD_01451"
FT                   /note="HMMPfam hit to PF02548, Ketopantoate
FT                   hydroxymethyltransferase, score 2.8e-168"
FT                   /inference="protein motif:PFAM:PF02548"
FT   CDS_pept        complement(173228..173707)
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="ROD_01461"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridi
FT                   ne pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01461"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86926"
FT                   /db_xref="GOA:D2THF1"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:D2THF1"
FT                   /protein_id="CBG86926.1"
FT                   /translation="MTPAYIAIGSNLASPLEQVNAAITALGDIPHSRIIAVSSFYRTPP
FT                   LGPQDQPDYLNAAVALETDLEPEALLDHTQRIELQQGRVRKAERWGPRTLDLDIMLFGD
FT                   RIINSERLTVPHYDMHNRGFMLWPLFEIAPDLRFPQGESLQHLLAGLGAGKPDRW"
FT   misc_feature    complement(173309..173695)
FT                   /gene="folK"
FT                   /locus_tag="ROD_01461"
FT                   /note="HMMPfam hit to
FT                   PF01288,7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase,
FT                   HPPK,score 1e-74"
FT                   /inference="protein motif:PFAM:PF01288"
FT   misc_feature    complement(173408..173443)
FT                   /note="PS00794
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00794"
FT   CDS_pept        complement(173704..175122)
FT                   /transl_table=11
FT                   /gene="pcnB"
FT                   /locus_tag="ROD_01471"
FT                   /product="poly(A) polymerase"
FT                   /EC_number="2.7.7.19"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01471"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86927"
FT                   /db_xref="GOA:D2THF2"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:D2THF2"
FT                   /protein_id="CBG86927.1"
FT                   /translation="MTLPRCTIFTRVANFCRKVLSREESEAEVAVARPHMTVIPREQHA
FT                   ISRKDISENALKVMYRLNKAGYEAWLVGGGVRDLLLGKKPKDFDVTTNATPDQVRKLFR
FT                   NCRLVGRRFRLAHVMFGPEIIEVATFRGHHEGSESDRTTSQRGQNGMLLRDNIFGSIEE
FT                   DAQRRDFTINSLYYSVADFTVRDYVGGMKDLQDGVIRLIGNPETRYREDPVRMLRAVRF
FT                   AAKLDMRISPETAEPIPRLATLLNDIPPARLFEESLKLLQSGYGYETYLKLREYSLFQP
FT                   LFPTITRYFTENGDSPMERIIAQVLKNTDNRIHNDMRVNPAFLFAAMFWYPLLEMAQKI
FT                   AQESGLAYYDAFALAMNEVLDEACRSLAIPKRLTALTRDIWQLQLRMSRRQGKRAWKLM
FT                   EHPKFRAAYDLLALRAEAENNPELQRLAQWWGEFQVSAPPEQKGMLNELDEDPAPRRRH
FT                   RRPRKRSPRREGSA"
FT   misc_feature    complement(174523..174918)
FT                   /gene="pcnB"
FT                   /locus_tag="ROD_01471"
FT                   /note="HMMPfam hit to PF01743, Polynucleotide
FT                   adenylyltransferase region, score 6.2e-74"
FT                   /inference="protein motif:PFAM:PF01743"
FT   CDS_pept        complement(175207..176103)
FT                   /transl_table=11
FT                   /gene="gluQ"
FT                   /locus_tag="ROD_01481"
FT                   /product="glutamyl-Q tRNA(Asp) synthetase"
FT                   /EC_number="6.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01481"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86928"
FT                   /db_xref="GOA:D2THF3"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/TrEMBL:D2THF3"
FT                   /protein_id="CBG86928.1"
FT                   /translation="MTDSHYIGRFAPSPSGELHFGSLIAALGSYLQARARNGIWRVRIE
FT                   DIDPPREVPGAADAILRQLEHYGLHWNGEVLWQSRRHEAYREALAWLYDQGLSYYCTCT
FT                   RARIQSIGGIYDGHCRELCNGPQQAAVRIKQQHPVTRFYDRLRGEIQADERLAREDFII
FT                   HRRDGLFAYNLAVVVDDHFQGVTEIVRGADLIEPTVRQISLYQQFGWTPPDYVHLPLAL
FT                   NAHGAKLSKQNHAPALPPGDPRPVLLAALRFLGQHTEAEWQALPVEQLLRLAVTHWRLT
FT                   AVPESAYVNPPFSNASC"
FT   misc_feature    complement(175225..175245)
FT                   /note="PS00092 N-6 Adenine-specific DNA methylases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00092"
FT   misc_feature    complement(175231..176079)
FT                   /gene="gluQ"
FT                   /locus_tag="ROD_01481"
FT                   /note="HMMPfam hit to PF00749, Glutamyl/glutaminyl-tRNA
FT                   synthetase, class Ic, score 7.7e-29"
FT                   /inference="protein motif:PFAM:PF00749"
FT   CDS_pept        complement(176176..176649)
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="ROD_01491"
FT                   /product="dosage-dependent dnaK suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01491"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86929"
FT                   /db_xref="GOA:D2TI33"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI33"
FT                   /protein_id="CBG86929.1"
FT                   /translation="MLRRSNMQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLSH
FT                   FRRILEAWRNQLRDEVDRTVTHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKK
FT                   IEKTLKKVEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG"
FT   misc_feature    complement(176194..176406)
FT                   /gene="dksA"
FT                   /locus_tag="ROD_01491"
FT                   /note="HMMPfam hit to PF01258, Zinc finger, DksA/TraR
FT                   C4-type, score 3.4e-36"
FT                   /inference="protein motif:PFAM:PF01258"
FT   misc_feature    complement(176218..176292)
FT                   /note="PS01102 Prokaryotic dksA/traR C4-type zinc finger."
FT                   /inference="protein motif:Prosite:PS01102"
FT   CDS_pept        complement(176809..177513)
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="ROD_01501"
FT                   /product="sugar fermentation stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01501"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86930"
FT                   /db_xref="GOA:D2TI34"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI34"
FT                   /protein_id="CBG86930.1"
FT                   /translation="MQFTPPLQRATLVQRYKRFLADVITPEGVELTIHCPNTGAMTGCA
FT                   DPGDTVWYSTSENTKRKYPHTWELTETRNGALICVNTLWANRLTKEAIEQGQVSELSGY
FT                   SVLRSEVKYGAERSRIDFMLQEDLRPDCYIEVKSVTLAENEKGYFPDAITQRGQKHLRE
FT                   LMNVAAEGKRAVIFFAVLHSAITRFSPARHIDAKYAQLLNEAQRKGVEVLAYKAELSAD
FT                   SMTLMESLPVTL"
FT   misc_feature    complement(176821..177477)
FT                   /gene="sfsA"
FT                   /locus_tag="ROD_01501"
FT                   /note="HMMPfam hit to PF03749, Sugar fermentation
FT                   stimulation protein, score 2e-106"
FT                   /inference="protein motif:PFAM:PF03749"
FT   misc_feature    complement(177382..177414)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(177526..178056)
FT                   /transl_table=11
FT                   /gene="ligT"
FT                   /locus_tag="ROD_01511"
FT                   /product="2'-5' RNA ligase"
FT                   /EC_number="6.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01511"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86931"
FT                   /db_xref="GOA:D2TI35"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI35"
FT                   /protein_id="CBG86931.1"
FT                   /translation="MSEPKRLFFAIELPADVREQIVAWRAAHFPGEAGRPVAADNLHLT
FT                   LAFLGEVSADKQKALAALAGRIRQPGFTLTLDDAGQWLRSRVVWLGTRRSPRGLLQLAD
FT                   MLRAQAARSGCYQSPRPFHPHITLLRDASHAVALPPPGFCWSFPVSEFVLYASSFTRGR
FT                   TRYTPLQRWTLVK"
FT   misc_feature    complement(177559..177789)
FT                   /gene="ligT"
FT                   /locus_tag="ROD_01511"
FT                   /note="HMMPfam hit to PF02834, Phosphoesterase, HXTX, score
FT                   2.5e-10"
FT                   /inference="protein motif:PFAM:PF02834"
FT   misc_feature    complement(177790..178026)
FT                   /gene="ligT"
FT                   /locus_tag="ROD_01511"
FT                   /note="HMMPfam hit to PF02834, Phosphoesterase, HXTX, score
FT                   2.6e-20"
FT                   /inference="protein motif:PFAM:PF02834"
FT   CDS_pept        178085..180559
FT                   /transl_table=11
FT                   /gene="hrpB"
FT                   /locus_tag="ROD_01521"
FT                   /product="ATP-dependent helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01521"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86932"
FT                   /db_xref="GOA:D2TI36"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI36"
FT                   /protein_id="CBG86932.1"
FT                   /translation="MLQCSAKNVNPPELFVTSLPVAAVLPELLAALDRSPQVLLSAPTG
FT                   AGKSTWLPLQFLTHKGIEGRIILLEPRRLAARNVAQRLAEQLNEQPGGTVGYRMRAQSC
FT                   VGPATRLEVVTEGVLTRMLQRNPELNGVGLVILDEFHERSLQADLALALLLDVQQGLRD
FT                   DLKLLIMSATLDNERLRQCLPDAPAVVSEGRAYPVERRYHPLSPQLRFDEAVAVATAEL
FT                   LRHEAGSLLLFLPGVGEIQRVREQLRDRVGSDVLLCPLYGALPLNEQRKAILPAPQGSR
FT                   KVVLATNIAETSLTIEGIRLVVDCAQERVARFDARTGLTRLITQRVSQASMTQRAGRAG
FT                   RLEPGICLHLIAKEQAERAAAQGEPEILQSDLSGLLMELLQWGCRDPAQLTWLDRPPAI
FT                   HLQAAKRLLQMLGALEGDRLSAVGQKMAALGNDPRLAAMLVSASDPDEAATAARLAAIL
FT                   EEPPRMGNTDLGVAFSRTQPGWQQRSQQLLKRLKAGRGEADASHIAPLLARAFADRIAR
FT                   RRSQDGRYQLANGMGAALDADDALGRHEWLIAPLLLQGSASPDARILLALPLDIDALVQ
FT                   RCPALLQQSDTVEWDEAQGTLKAWRRMRIGQLTVKVQPLAKPSEEELHLAMLNGIRDKG
FT                   LGVLNWTPAAEQLRLRLQCAAKWLPEYDWPAVDEQTLLAALESWLLPHMSGVHSLKSLK
FT                   SLDVHQALLGLLDYPRQQRLVSSLPTHYTVPTGSRIAIRYHEDNPPGLAVRMQEMFGEA
FT                   STPTIAEGRVPLVLELLSPAQRPLQITRDLSAFWQGSYREVQKEMKGRYPKHVWPDDPA
FT                   NTAPTRRTKKYS"
FT   misc_feature    178139..178627
FT                   /gene="hrpB"
FT                   /locus_tag="ROD_01521"
FT                   /note="HMMPfam hit to PF00270, DNA/RNA helicase, DEAD/DEAH
FT                   box type, N-terminal, score 3.3e-07"
FT                   /inference="protein motif:PFAM:PF00270"
FT   misc_feature    178208..178231
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    178829..179113
FT                   /gene="hrpB"
FT                   /locus_tag="ROD_01521"
FT                   /note="HMMPfam hit to PF00271, DNA/RNA helicase,C-terminal,
FT                   score 7.1e-12"
FT                   /inference="protein motif:PFAM:PF00271"
FT   misc_feature    179291..179470
FT                   /gene="hrpB"
FT                   /locus_tag="ROD_01521"
FT                   /note="HMMPfam hit to PF04408, Helicase-associated
FT                   region,score 1.1e-09"
FT                   /inference="protein motif:PFAM:PF04408"
FT   misc_feature    180119..180517
FT                   /gene="hrpB"
FT                   /locus_tag="ROD_01521"
FT                   /note="HMMPfam hit to PF08482, RNA helicase,
FT                   ATP-dependent,HrpB type, C-terminal, score 3.7e-92"
FT                   /inference="protein motif:PFAM:PF08482"
FT   CDS_pept        180691..183225
FT                   /transl_table=11
FT                   /gene="mrcB"
FT                   /locus_tag="ROD_01531"
FT                   /product="penicillin-binding protein 1B [includes:
FT                   penicillin-insensitive transglycosylase; penicillin
FT                   sensitive transpeptidase]"
FT                   /EC_number="2.4.1.129"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01531"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86933"
FT                   /db_xref="GOA:D2TI37"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR011813"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR028166"
FT                   /db_xref="InterPro:IPR032730"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI37"
FT                   /protein_id="CBG86933.1"
FT                   /translation="MAGNDREPIGRKGKPSRPVKQKVSRRQLRDDEYDDEYDDDYEDEE
FT                   PMPRKGKGKGRKPRGKRGWLWLLLKIAIVFLVLFAIYGVYLDQKIRSRIDGKVWQLPAA
FT                   VYGRMVNLEPDMSVSKNEMVRLLEATQYRQVTKMTRPGEFTVQANSIEMIRRPFDFPDS
FT                   KEGQVRARLTFDDGHLNTIVNMDNNRQFGFFRLDPRLITMLSSPNGEQRLFVPRSGFPD
FT                   LLVDTLLATEDRHFYEHDGVSLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLTSER
FT                   SYWRKANEAYMALLMDARYSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVEE
FT                   LSLDQQALLVGMVKGASIYNPWRNPKLALERRNLVLRLLQQQQIIDQELYDMLSARPLG
FT                   VQPRGGVISPQPAFMQMVRQELQAKLGDKVKDLSGVKIFTTFDPVAQDAAEKAAVEGIP
FT                   ALKKQRKLSDLETAIVVVDRFSGEVRAMVGGAEPQFAGYNRAMQARRSIGSLAKPATYL
FT                   TALSQPKIYRLNTWIADAPIALRQPNGQVWSPQNDERRYSESGKVMLVDALTRSMNVPT
FT                   VNLGMALGLPAVTDTWTKLGVPKDQLHPVPAMLLGALNLTPIEVAQAFQTIASGGNRAP
FT                   LSALRSVIAEDGAVLYQSFPQAERAVPAQAAYMTLWTMQQVVQRGTGRQLGAKYPGLHL
FT                   AGKTGTTNNNVDTWFAGIDGSQVTITWVGRDNNQPTKLYGASGAMSIYQRYLANQTPTA
FT                   LTLTPPEDIVDMGVDYDGNFVCSGGMRTLPVWTSDPDALCQQGEMQQQQQQPSGNPFDQ
FT                   SSQPQQQQQPPQEEKKDSDGVAGWIKDMFGGN"
FT   misc_feature    180880..180948
FT                   /gene="mrcB"
FT                   /locus_tag="ROD_01531"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD01531 by TMHMM2.0 at aa 64-86"
FT   misc_feature    181270..181785
FT                   /gene="mrcB"
FT                   /locus_tag="ROD_01531"
FT                   /note="HMMPfam hit to PF00912, Glycosyl transferase, family
FT                   51, score 1.7e-83"
FT                   /inference="protein motif:PFAM:PF00912"
FT   misc_feature    182101..182931
FT                   /gene="mrcB"
FT                   /locus_tag="ROD_01531"
FT                   /note="HMMPfam hit to PF00905, Penicillin-binding
FT                   protein,transpeptidase, score 1.2e-19"
FT                   /inference="protein motif:PFAM:PF00905"
FT   misc_feature    182761..182784
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        183532..185787
FT                   /transl_table=11
FT                   /gene="fhuA"
FT                   /locus_tag="ROD_01541"
FT                   /product="ferrichrome-iron TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01541"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86934"
FT                   /db_xref="GOA:D2TI38"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI38"
FT                   /protein_id="CBG86934.1"
FT                   /translation="MARLKTAQPNSSLRKLAVVVATAVSGMSVYAQAAVQPKEETITVT
FT                   AAPAPQESAWGPAATIAARQSATATKTDTPIQKVPQSISVVTAEEMALHQPKSVKEALS
FT                   YTPGVAVGTRGASNTYDYLIIRGFAADGQSQNNYLNGLKMQGNFYNDAVIDPYMLERAE
FT                   VMRGPVSVLYGKSNPGGLLNMVSKRPTTEPLKEVQFKMGTNSLFQTGFDFSDALNDDGV
FT                   YSYRLTGLARSANAQQQGAEEQRYAIAPSFSWRPDDKTNFTFLSYFQNEPETGYYGWLP
FT                   KEGTVSTLPNGKRLSTDFNEGANNNTYSRNEKMVGYSFDHEFNDTFTVRQNLRYAQNKV
FT                   AQKSVYGYGMCSDPMYSSNPDSSPCASVSQSEWGHTLTRQYVVDNEKLENFAVDTQLQS
FT                   KFATGSVDHTLLTGVDFMRMRNDIDSWFGYVGSVTPSDIYNLDRSDFDFNSRDPDTSGP
FT                   YQILNKQKQTGLYVQDQMQWDKVLVTLGGRYDWAKQDSLNRVSGTTDSREDKEFTWRGG
FT                   INYLFDNGVTPYFSYSESFEPASQTGASGNIFAPSKGKQYEAGVKYVPNDRPIVITGAV
FT                   YQLTKSNNLMSDPTPGSFFSIEGGEIRSRGVEIEAKAALSASVNVVGSYTYTDAEYTTD
FT                   TRYKGNTPAQVPEHMASLWGDYTFFDGALSGLTLGAGGRYSGSSYGDPANSFKVGSYTV
FT                   VDALVRYDLARLGMAGSNVALHVNNLFDREYVASCFNTYGCFWGAERQVVATATFRF"
FT   misc_feature    183532..183672
FT                   /note="PS00430 TonB-dependent receptor proteins signature
FT                   1."
FT                   /inference="protein motif:Prosite:PS00430"
FT   sig_peptide     183532..183630
FT                   /gene="fhuA"
FT                   /locus_tag="ROD_01541"
FT                   /note="Signal peptide predicted for ROD01541 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.983 between residues 33 and 34"
FT   misc_feature    183754..184074
FT                   /gene="fhuA"
FT                   /locus_tag="ROD_01541"
FT                   /note="HMMPfam hit to PF07715, TonB-dependent
FT                   receptor,plug, score 1.7e-21"
FT                   /inference="protein motif:PFAM:PF07715"
FT   misc_feature    185068..185784
FT                   /gene="fhuA"
FT                   /locus_tag="ROD_01541"
FT                   /note="HMMPfam hit to PF00593, TonB-dependent
FT                   receptor,beta-barrel, score 6e-27"
FT                   /inference="protein motif:PFAM:PF00593"
FT   misc_feature    185731..185784
FT                   /note="PS01156 TonB-dependent receptor proteins signature
FT                   2."
FT                   /inference="protein motif:Prosite:PS01156"
FT   CDS_pept        185835..186632
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="ROD_01551"
FT                   /product="ferrichrome transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01551"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86935"
FT                   /db_xref="GOA:D2TI39"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI39"
FT                   /protein_id="CBG86935.1"
FT                   /translation="MQEQTHHPDTTFALRDVTFRVPGRTLLHPLSLTFPVGKVTGLIGH
FT                   NGSGKSTLLKMLGRHQPPSEGEILLDAQPLESWSSKAFARKVAYLPQQLPPAEGMTVRE
FT                   LVAIGRYPWHGALGRFGIADREKVEEAITLVGLKPLAHRLVDSLSGGERQRAWIAMLVA
FT                   QDSRCLLLDEPTSALDIAHQVDVLALVHRLSQQRGLTVIAVLHDINMAARYCDYLVALR
FT                   GGEMIAEGTPAALMRGETLEQIYGIPMGILPHPAGAAPVSFVY"
FT   misc_feature    185943..186506
FT                   /gene="fhuC"
FT                   /locus_tag="ROD_01551"
FT                   /note="HMMPfam hit to PF00005, ABC transporter
FT                   related,score 8.5e-59"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    185964..185987
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    186276..186320
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        186632..187522
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="ROD_01561"
FT                   /product="ferrichrome-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01561"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86936"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI40"
FT                   /protein_id="CBG86936.1"
FT                   /translation="MSGLHHLTRRRLLTAMALSPLLWQMRPARAASIDLQRIVALEWLP
FT                   VELLLALGVTPYGVADIPNYRLWVNEPPLPASVIDVGLRTEPNLELLTEMKPSFMVWSA
FT                   GYGPSPEKLARIAPGRGFNFSDGKQPLAVARQSLLELGQLLNLAPAATRHLSEFDQFIA
FT                   SRKPRFARRGERPLLLITQLDARHMLVFGPNCLFQAVLDEYGIRNAWQGETNFWGSTVV
FT                   GIDRLAAYKDADVLCFDHGDNKEMDSLVRTPLWQAMPFVRAGRFQRVPAVWFYGATLSA
FT                   MRFVRILDQALGGKA"
FT   sig_peptide     186632..186721
FT                   /gene="fhuD"
FT                   /locus_tag="ROD_01561"
FT                   /note="Signal peptide predicted for ROD01561 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.999 between residues 30 and 31"
FT   misc_feature    186734..187447
FT                   /gene="fhuD"
FT                   /locus_tag="ROD_01561"
FT                   /note="HMMPfam hit to PF01497, Periplasmic binding
FT                   protein,score 4.6e-11"
FT                   /inference="protein motif:PFAM:PF01497"
FT   misc_feature    187292..187321
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   CDS_pept        187519..189501
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /locus_tag="ROD_01571"
FT                   /product="ferrichrome transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01571"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86937"
FT                   /db_xref="GOA:D2TI41"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI41"
FT                   /protein_id="CBG86937.1"
FT                   /translation="MSKRIALLPASLLALLFFVAAGLSWTNLSVALPRSQWQQALWSPD
FT                   IDSIGQMIFYYSLLPRLVISLLVGAGLGLVGVLFQQVLRNPLAEPTTLGVATGAQLGVT
FT                   VTTLWAIPGMMAAQFAALAGACIVGALVFGVAWGKRLSPVTLILAGLVVSLYCGAVNQL
FT                   LVLFHHDQLQSMFLWSTGTLTQTDWSGVQRLWPQLLGGVVLTLLLLRPLTLMGLDDGVA
FT                   RNLGLALSLARLAALTLAIVLSALLVNAVGIIGFIGLFAPLLAKMLGARRLLARLMLAP
FT                   LIGALILWLSDQIILWLSRVWMEVSTGSVTALIGAPLLLWLLPRLRSMSAPDMNVSNRV
FT                   ATERRHVAGYALAGLIILLLGAWVALSLGRDVHGWSWASGALLDELMPWRWPRILAALI
FT                   AGVMLAVAGCIIQRLTGNPMASPEVLGISSGAAFGVVLMLFLVPGDAFGWLLPAGSLGA
FT                   AATLLVIMIAAGRGGFSPQRMLLAGMALSTAFTMLLMMLQASGDPRMASVLTWISGSTY
FT                   NASGEQALRTGIVMVILLALTPLCRRWLTILTLGGDTARAVGMALTPSRIGLLLLAASL
FT                   TATATMTIGPLSFVGLMAPHIARMLGFRRTMPHIVMSGLVGGLLLVFADWCGRMVLFPY
FT                   QIPAGILSTFIGAPYFIYLLRKQSR"
FT   sig_peptide     187519..187596
FT                   /gene="fhuB"
FT                   /locus_tag="ROD_01571"
FT                   /note="Signal peptide predicted for ROD01571 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.307 between residues 26 and 27"
FT   misc_feature    join(187531..187599,187687..187755,187792..187851,
FT                   187861..187929,187948..188016,188230..188298,
FT                   188335..188391,188419..188487,188557..188625,
FT                   188683..188751,188788..188844,188854..188922,
FT                   188956..189015,189217..189285,189319..189387,
FT                   189415..189483)
FT                   /gene="fhuB"
FT                   /locus_tag="ROD_01571"
FT                   /note="16 probable transmembrane helices predicted for
FT                   ROD01571 by TMHMM2.0 at aa 5-27, 57-79, 92-111,
FT                   115-137,144-166, 238-260, 273-291, 301-323, 347-369,
FT                   389-411,424-442, 446-468, 480-499, 567-589, 601-623 and
FT                   633-655"
FT   misc_feature    187558..188493
FT                   /gene="fhuB"
FT                   /locus_tag="ROD_01571"
FT                   /note="HMMPfam hit to PF01032, Bacterial transport system
FT                   permease protein, score 1.5e-42"
FT                   /inference="protein motif:PFAM:PF01032"
FT   misc_feature    187864..187896
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    188674..189489
FT                   /gene="fhuB"
FT                   /locus_tag="ROD_01571"
FT                   /note="HMMPfam hit to PF01032, Bacterial transport system
FT                   permease protein, score 1.3e-62"
FT                   /inference="protein motif:PFAM:PF01032"
FT   misc_feature    188713..188745
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(189597..190877)
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="ROD_01581"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01581"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86938"
FT                   /db_xref="GOA:D2TI42"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI42"
FT                   /protein_id="CBG86938.1"
FT                   /translation="MSKSENLFSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLY
FT                   DVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAALVTELVP
FT                   TMDMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQP
FT                   NSPGVPADFAKHTLTCTYNDLDSVRAAFTQFPQEIACIIVEPVAGNMNCIPPLPEFLPG
FT                   LRALCDEFGALLIIDEVMTGFRVALAGAQDYYGVTPDLTCLGKIIGGGMPVGAFGGRRE
FT                   VMEALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGVHDTLDELTTRLAEGLLEAAQ
FT                   EAHIPLVVNHVGGMFGIFFTDAQSVTCYQDVMACDVERFKRFFHLMLEEGVYLAPSAFE
FT                   AGFMSVAHSMEDINNTIDAARRVFAKL"
FT   misc_feature    complement(189795..190775)
FT                   /gene="hemL"
FT                   /locus_tag="ROD_01581"
FT                   /note="HMMPfam hit to PF00202, Aminotransferase
FT                   class-III,score 1.6e-92"
FT                   /inference="protein motif:PFAM:PF00202"
FT   misc_feature    complement(189945..189977)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(190068..190178)
FT                   /note="PS00600 Aminotransferases class-III
FT                   pyridoxal-phosphate attachment site."
FT                   /inference="protein motif:Prosite:PS00600"
FT   CDS_pept        191046..192467
FT                   /transl_table=11
FT                   /gene="clcA"
FT                   /locus_tag="ROD_01591"
FT                   /product="H(+)/Cl(-) exchange transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01591"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86939"
FT                   /db_xref="GOA:D2TI43"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR023861"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI43"
FT                   /protein_id="CBG86939.1"
FT                   /translation="MKTETPSFEAQQIVRLRRRDQIRRLLERDKTPLAILCMAAVVGTI
FT                   TGIVGVAFEKAVTWVQNMRIGALASVADHAWLLWPLAFILSGLLAMVGYFLVRKFAPEA
FT                   GGSGIPEIEGALEELRPVRWWRVLPVKFIGGMGTLGAGMVLGREGPTVQLGGNIGRMVL
FT                   DIFRMRSAEARHTLLATGAAAGLSAAFNAPLAGILFIIEEMRPQFRYNLISIKAVFTGV
FT                   IMSSVVFRIFNGESPIIEIGKLSNAPVNTLWLYLVLGMIFGCVGPVFNKLVLRTQDMFQ
FT                   RFHGGNITKWVLMGGVIGGLCGILGLIEPEAAGGGFNLIPIAAAGNFSVGLLLFIFIAR
FT                   VITTLLCFSSGAPGGIFAPMLALGTLLGTAFGMAAAVSFPHYQLEAGTFAIAGMGALMA
FT                   ASVRAPLTGIVLVLEMTDNYQLILPMIITCLGATLLAQFLGGKPLYSTILARTLAKQEA
FT                   EQAAKSQAAAAGENT"
FT   misc_feature    join(191136..191204,191268..191336,191415..191483,
FT                   191580..191648,191673..191741,191799..191867,
FT                   191904..191972,192000..192068,192105..192173,
FT                   192216..192284,192297..192365)
FT                   /gene="clcA"
FT                   /locus_tag="ROD_01591"
FT                   /note="11 probable transmembrane helices predicted for
FT                   ROD01591 by TMHMM2.0 at aa 31-53, 75-97, 124-146,
FT                   179-201,210-232, 252-274, 287-309, 319-341, 354-376,
FT                   391-413 and 418-440"
FT   misc_feature    191298..192365
FT                   /gene="clcA"
FT                   /locus_tag="ROD_01591"
FT                   /note="HMMPfam hit to PF00654, Chloride channel, core,score
FT                   8e-119"
FT                   /inference="protein motif:PFAM:PF00654"
FT   misc_feature    191805..191837
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        192549..192893
FT                   /transl_table=11
FT                   /locus_tag="ROD_01601"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01601"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86940"
FT                   /db_xref="GOA:D2TI44"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI44"
FT                   /protein_id="CBG86940.1"
FT                   /translation="MSDDVALPLQFTEAAANKVKSLIADEDNPNLKLRVYITGGGCSGF
FT                   QYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLVGGSVDYTEGLEGSRFVVTNPNAKS
FT                   TCGCGSSFSI"
FT   misc_feature    192573..192848
FT                   /locus_tag="ROD_01601"
FT                   /note="HMMPfam hit to PF01521, HesB/YadR/YfhF, score
FT                   2.6e-42"
FT                   /inference="protein motif:PFAM:PF01521"
FT   misc_feature    192831..192884
FT                   /note="PS01152 Hypothetical hesB/yadR/yfhF family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01152"
FT   CDS_pept        complement(193014..193637)
FT                   /transl_table=11
FT                   /locus_tag="ROD_01611"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01611"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86941"
FT                   /db_xref="GOA:D2TI45"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI45"
FT                   /protein_id="CBG86941.1"
FT                   /translation="MLVYWLDIIGTAVFAISGVLLAGKLRMDPFGVLVLGVVTAVGGGT
FT                   IRDMALDNGPVFWVKDPTDLVVAMVTSMLTILLVRQPRRLPKWMLPVLDAVGLAVFVGI
FT                   GVNKAFIADSGPLVAICMGVITGVGGGIIRDVLAREIPMILRTEIYATACIIGGSVHAT
FT                   AFYTFAIPLETASMMGMVVTLCIRLAAIRWHLKLPTFALDESGR"
FT   misc_feature    complement(193113..193370)
FT                   /locus_tag="ROD_01611"
FT                   /note="HMMPfam hit to PF03458, Protein of unknown function
FT                   UPF0126, score 7.3e-32"
FT                   /inference="protein motif:PFAM:PF03458"
FT   misc_feature    complement(join(193122..193190,193224..193292,
FT                   193320..193376,193401..193454,193497..193550,
FT                   193569..193628))
FT                   /locus_tag="ROD_01611"
FT                   /note="6 probable transmembrane helices predicted for
FT                   ROD01611 by TMHMM2.0 at aa 4-23, 30-47, 62-79,
FT                   88-106,116-138 and 150-172"
FT   misc_feature    complement(193374..193631)
FT                   /locus_tag="ROD_01611"
FT                   /note="HMMPfam hit to PF03458, Protein of unknown function
FT                   UPF0126, score 5.4e-39"
FT                   /inference="protein motif:PFAM:PF03458"
FT   CDS_pept        complement(193672..194472)
FT                   /transl_table=11
FT                   /gene="btuF"
FT                   /locus_tag="ROD_01621"
FT                   /product="vitamin B12-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01621"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86942"
FT                   /db_xref="GOA:D2TI46"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR023544"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI46"
FT                   /protein_id="CBG86942.1"
FT                   /translation="MANSLSRALAALLLWLPVSLCAAPRVITLSPANTELAFAAGITPV
FT                   AVSSYSDYPPAARDIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVNQLTSLGIRV
FT                   MWVDAASIEQIAQTLRKLAAWSPQPEKAQHAARRLLDDYQQLKSEYADRSKKRLFLQFG
FT                   INPPFTSAKGSIQNEVLELCGGENIFADSRVPWPQVSREQVLARAPQAIVVAGNAEETL
FT                   KIKQYWGNQLKIPVIPLTSDWFERASPRIILAAKQLCTALSQVN"
FT   misc_feature    complement(193744..194403)
FT                   /gene="btuF"
FT                   /locus_tag="ROD_01621"
FT                   /note="HMMPfam hit to PF01497, Periplasmic binding
FT                   protein,score 1.5e-46"
FT                   /inference="protein motif:PFAM:PF01497"
FT   sig_peptide     complement(194407..194472)
FT                   /gene="btuF"
FT                   /locus_tag="ROD_01621"
FT                   /note="Signal peptide predicted for ROD01621 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.997 between residues 22 and 23"
FT   CDS_pept        complement(194465..195163)
FT                   /transl_table=11
FT                   /gene="mtn"
FT                   /locus_tag="ROD_01631"
FT                   /product="MTA/SAH nucleosidase (5'-methylthioadenosine
FT                   nucleosidase)"
FT                   /EC_number="3.2.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01631"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86943"
FT                   /db_xref="GOA:D2TI47"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI47"
FT                   /protein_id="CBG86943.1"
FT                   /translation="MKIGIIGAMEEEVTLLRDKIENRQTFSRGGCEIYTGQLNGTDVAL
FT                   LKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTA
FT                   FGYEFGQLPGCPAGFKADEKLVAAAESCIAQLNLNAVRGLIVSGDAFINGSVGLTRIRH
FT                   NFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMV
FT                   ETLVQKLAHG"
FT   misc_feature    complement(194486..195160)
FT                   /gene="mtn"
FT                   /locus_tag="ROD_01631"
FT                   /note="HMMPfam hit to PF01048, Nucleoside
FT                   phosphorylase,score 4.3e-110"
FT                   /inference="protein motif:PFAM:PF01048"
FT   CDS_pept        195244..196761
FT                   /transl_table=11
FT                   /gene="dgt"
FT                   /locus_tag="ROD_01641"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /EC_number="3.1.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01641"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86944"
FT                   /db_xref="GOA:D2TI48"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR020779"
FT                   /db_xref="InterPro:IPR023293"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI48"
FT                   /protein_id="CBG86944.1"
FT                   /translation="MAQIDFRKKINWHRRYRSPQGVKTEHEILRIFESDRGRIINSPAI
FT                   RRLQQKTQVFPLERNAAVRTRLTHSMEVQQVGRYIAKEVLSRLKEMKLLAQYGLDELTG
FT                   PFESIVEMSCLMHDIGNPPFGHFGEAAINDWFRQRLHPADAESQPLTEDRCKVASLRLR
FT                   EGEESLNDLRRKVRQDLCHFEGNAQGIRLVQTLMRMNLTWAQVGGILKYTRPAWWRGET
FT                   PATHNYLMKKPGYYLSEESYIARLRRELDLALYSRFPLTWIMEAADDISYCVADLEDAV
FT                   EKRIFSAEQLYHHLQEAWGVHEKGSLFALVVENAWEKSRANTLSRSTEDQFFMYLRVNT
FT                   LNKLVPYAAQRFIDNLEQIFAGTFNQALLEDGSSFSRLLKLYKNVAIKHVFSHPEVEQL
FT                   ELQGYRVISGLLDIYRPLLSLPLADFSELVEKERLMRFPIESRLFQKLSTRHRLAYIEA
FT                   VSKLAPDSLEYPVMEYYYRCRLIQDYISGMTDLYAWDEYRRLMAVEQ"
FT   misc_feature    195439..195801
FT                   /gene="dgt"
FT                   /locus_tag="ROD_01641"
FT                   /note="HMMPfam hit to PF01966, Metal-dependent
FT                   phosphohydrolase, HD region, subdomain, score 2.8e-09"
FT                   /inference="protein motif:PFAM:PF01966"
FT   CDS_pept        196891..198306
FT                   /transl_table=11
FT                   /gene="htrA"
FT                   /gene_synonym="degP"
FT                   /locus_tag="ROD_01651"
FT                   /product="protease Do precursor"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01651"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86945"
FT                   /db_xref="GOA:D2TI49"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI49"
FT                   /protein_id="CBG86945.1"
FT                   /translation="MKKTTLAMSALALSLGLALSPLSATAAETASATTSQQMPSLAPML
FT                   EKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGGQQ
FT                   QKFMALGSGVIIDAAKGYVVTNNHVVDNATVIKVQLSDGRKFDAKVVGKDPRSDIALIQ
FT                   IQDPKNLTAIKLADSDTLRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFI
FT                   QTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTAQMVEFG
FT                   QVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVMPNSSAAKAGIKAGDVITSLNGKP
FT                   ISSFAALRAQVGTMPVGSKITLGLLRDGKPVTVNLELQQSSQNQVDSSSIFSGIEGAEM
FT                   SNKGQDKGVVVNNVKANSPAAQIGLKKGDVIVGANQQRVKNIAELRKILDSKPSVLALN
FT                   IQRGDSSIYLLMQ"
FT   sig_peptide     196891..196968
FT                   /gene="htrA"
FT                   /gene_synonym="degP"
FT                   /locus_tag="ROD_01651"
FT                   /note="Signal peptide predicted for ROD01651 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.994 between residues 26 and 27"
FT   misc_feature    197194..197712
FT                   /gene="htrA"
FT                   /gene_synonym="degP"
FT                   /locus_tag="ROD_01651"
FT                   /note="HMMPfam hit to PF00089, Peptidase S1 and
FT                   S6,chymotrypsin/Hap, score 2.4e-34"
FT                   /inference="protein motif:PFAM:PF00089"
FT   misc_feature    197716..197985
FT                   /gene="htrA"
FT                   /gene_synonym="degP"
FT                   /locus_tag="ROD_01651"
FT                   /note="HMMPfam hit to PF00595, PDZ/DHR/GLGF, score 3.2e-22"
FT                   /inference="protein motif:PFAM:PF00595"
FT   misc_feature    198034..198270
FT                   /gene="htrA"
FT                   /gene_synonym="degP"
FT                   /locus_tag="ROD_01651"
FT                   /note="HMMPfam hit to PF00595, PDZ/DHR/GLGF, score 2e-16"
FT                   /inference="protein motif:PFAM:PF00595"
FT   CDS_pept        198456..199613
FT                   /transl_table=11
FT                   /gene="cdaR"
FT                   /locus_tag="ROD_01661"
FT                   /product="carbohydrate diacid regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01661"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86946"
FT                   /db_xref="InterPro:IPR008599"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI50"
FT                   /protein_id="CBG86946.1"
FT                   /translation="MAGWHLDTKMAQDIVARTMRIIDTNINVMDARGRIIGSGDRERIG
FT                   ELHEGALLVLSQGRVVDIDDAVARHLHGVRQGINLPLRLEGEIVGVIGLTGEPEHLRKY
FT                   GELVCMTAEMMLEQSRLMHLLAQDSRLREELVMNLIQAEENTPALTEWAQRLGIDLNQP
FT                   RVVAVVEVDSGQLGVDSAMAELQQLQNALTTPERNNLIAIVSLTEMVVLKPALNQFGRW
FT                   DAEDHRKRVEQLISRMKENGQLRFRVALGNYFTGPGSIARSYRTARTTMMVGKQRMPES
FT                   RSYFYQDLMLPVLLDSLRGGWQANELARPLTRLKAMDNNGLLRRTLTAWFRHNVQPLAT
FT                   SKALFIHRNTLEYRLNRISELTGLDLGNFDDRLLLYVALQLDEQR"
FT   misc_feature    198471..199385
FT                   /gene="cdaR"
FT                   /locus_tag="ROD_01661"
FT                   /note="HMMPfam hit to PF05651, Putative sugar diacid
FT                   recognition, score 1e-170"
FT                   /inference="protein motif:PFAM:PF05651"
FT   misc_feature    199386..199451
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1014.000, SD 2.64 at aa 311-332, sequence
FT                   LTRLKAMDNNGLLRRTLTAWFR"
FT   CDS_pept        199618..199896
FT                   /transl_table=11
FT                   /locus_tag="ROD_01671"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01671"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86947"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI51"
FT                   /protein_id="CBG86947.1"
FT                   /translation="MFVDGAFCLMALRLSGLGTENVFVDGGFCLMALRLSDLGTENVFV
FT                   DGVFCLMALRLSGLRTVMFCRPDKTLASPSGNGEQAWGDSQTSERKR"
FT   CDS_pept        complement(199923..200309)
FT                   /transl_table=11
FT                   /locus_tag="ROD_01681"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01681"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86948"
FT                   /db_xref="InterPro:IPR020911"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI52"
FT                   /protein_id="CBG86948.1"
FT                   /translation="MYDNLKSLGITNPEEIDRYSLRQEANNDILKIYFQKDRGEFFAKS
FT                   VKFKYPRQRKTVVADGVGQGYKEVQEISPNLRYVIDELDQICQRDRSEVDLKRKILDDL
FT                   RHLESVVANKITEIEADLEKLTRK"
FT   CDS_pept        complement(200420..201244)
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="ROD_01691"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01691"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86949"
FT                   /db_xref="GOA:D2TI53"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI53"
FT                   /protein_id="CBG86949.1"
FT                   /translation="MQQLQNVIETAFERRAEITPANVDTVTREAVNQVISLLDSGALRV
FT                   AEKIDGQWVTHQWLKKAVLLSFRINDNQVIDGAESRYFDKVPMKFADYDEARFQKEGFR
FT                   VVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVG
FT                   IGGVLEPLQANPTIIEDHCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEV
FT                   HYGRVPAGSVVVSGNLPSKDGKYSLYCAVIVKKVDAKTRGKVGINELLRTID"
FT   misc_feature    complement(200597..200650)
FT                   /gene="dapD"
FT                   /locus_tag="ROD_01691"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide repeat, score 2.7"
FT                   /inference="protein motif:PFAM:PF00132"
FT   misc_feature    complement(200651..200704)
FT                   /gene="dapD"
FT                   /locus_tag="ROD_01691"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide repeat, score 2"
FT                   /inference="protein motif:PFAM:PF00132"
FT   misc_feature    complement(200747..200800)
FT                   /gene="dapD"
FT                   /locus_tag="ROD_01691"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide repeat, score 0.82"
FT                   /inference="protein motif:PFAM:PF00132"
FT   misc_feature    complement(200759..200845)
FT                   /note="PS00101 Hexapeptide-repeat containing-transferases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00101"
FT   misc_feature    complement(200801..200854)
FT                   /gene="dapD"
FT                   /locus_tag="ROD_01691"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide repeat, score 30"
FT                   /inference="protein motif:PFAM:PF00132"
FT   CDS_pept        complement(201275..203947)
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="ROD_01701"
FT                   /product="[protein-PII] uridylyltransferase"
FT                   /EC_number="2.7.7.59"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01701"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86950"
FT                   /db_xref="GOA:D2TI54"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI54"
FT                   /protein_id="CBG86950.1"
FT                   /translation="MNTLPEQHANTALPTLPGQPQNPGAWPRDDLTISGIKSHIDTFQQ
FT                   WLGDAFDGGVSAEQLIEARTEFIDQLLQRLWIEAGFGQIADLALVAVGGYGRGELHPLS
FT                   DIDLLILSRKKLPDAQAQKVGELLTLLWDVRLEVGHSVRTLEECLLEGLSDLTVATNLI
FT                   ETRLLIGDVALFLELQKHIFSEGFWPSDKFYAAKVEEQNQRHQRYHGTSYNLEPDIKSS
FT                   PGGLRDIHTLQWVARRHFGATSLDEMVGFGFLTQAERAELNECLHILWRIRFALHLVVS
FT                   RYDNRLLFDRQLSVAQRLNYSGEGNEPVERMMKDYFRVTRRVSELNQMLLQLFDEAILA
FT                   LPADEKPRPIDDDFQLRGTLIDLRHDDLFIREPEAILRMFYTMVRNSAITGIYSTTLRH
FT                   LRHARRHLNQPLCYIPEARSLFLSMLRHPGAISRGLLPMHRHSVLWAYMPQWSHIVGQM
FT                   QFDLFHAYTVDEHTIRVMLKLESFAREETRQRHPLCVDLWPRLRQPELIFIAALFHDIA
FT                   KGRGGDHSVLGAQDVLKFAELHGLNSRETQLVAWLVRQHLLMSVTAQRRDIQDPEVIKQ
FT                   FAEEVQTEHRLRFLVCLTVADICATNETLWNSWKQSLLRELYFATEKQLRRGMQNTPDM
FT                   RERVRHHQLQALALLRMDNIDEAALHHIWSRCRANYFVRHSPNQLAWHARHLLQHDLSK
FT                   PLILLSPQATRGGTEIFIWSPDRPYLFAAVCAELDRRNLSVHDAQIFTTRDGMAMDTFI
FT                   VLEPDGSPLSSDRHEAIRFGLEQAITQRSWQPPQPRRQPAKLRHFTVDTEVTFLPTHTD
FT                   RKSFLELIALDQPGLLARVGQIFADLGISLHGARITTIGERVEDLFIIATADRRALNNE
FT                   LQQEVHQRLTEALNPNDKG"
FT   misc_feature    complement(201317..201505)
FT                   /gene="glnD"
FT                   /locus_tag="ROD_01701"
FT                   /note="HMMPfam hit to PF01842, Amino acid-binding ACT,score
FT                   8.4e-10"
FT                   /inference="protein motif:PFAM:PF01842"
FT   misc_feature    complement(201632..201826)
FT                   /gene="glnD"
FT                   /locus_tag="ROD_01701"
FT                   /note="HMMPfam hit to PF01842, Amino acid-binding ACT,score
FT                   3.2e-06"
FT                   /inference="protein motif:PFAM:PF01842"
FT   misc_feature    complement(202142..202546)
FT                   /gene="glnD"
FT                   /locus_tag="ROD_01701"
FT                   /note="HMMPfam hit to PF01966, Metal-dependent
FT                   phosphohydrolase, HD region, subdomain, score 2.5e-21"
FT                   /inference="protein motif:PFAM:PF01966"
FT   misc_feature    complement(202748..203377)
FT                   /gene="glnD"
FT                   /locus_tag="ROD_01701"
FT                   /note="HMMPfam hit to PF08335, GlnD
FT                   PII-uridylyltransferase, score 4.6e-117"
FT                   /inference="protein motif:PFAM:PF08335"
FT   misc_feature    complement(203441..203728)
FT                   /gene="glnD"
FT                   /locus_tag="ROD_01701"
FT                   /note="HMMPfam hit to PF01909, DNA polymerase, beta-like
FT                   region, score 1.5e-12"
FT                   /inference="protein motif:PFAM:PF01909"
FT   CDS_pept        complement(204056..204850)
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="ROD_01711"
FT                   /product="methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01711"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86951"
FT                   /db_xref="GOA:D2TI55"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI55"
FT                   /protein_id="CBG86951.1"
FT                   /translation="MAISIKTPEEIEKMRVAGRLAAEVLEMIEPYIKPGVSTGELDRLC
FT                   NDYIVNEQHAISACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDD
FT                   YHGDTSKMFIVGKPTILGERLCRVTQESLYLALRMVKPGIRLRTLGAAIQKYAEGEGFS
FT                   VVREYCGHGIGRGFHEEPQVLHYDADDGGVVLQPGMTFTIEPMLNAGDYRIRTMKDGWT
FT                   VKTKDRSLSAQYEHTIVVTENGCEILTLRKDDAIPAIITHDE"
FT   misc_feature    complement(204101..204817)
FT                   /gene="map"
FT                   /locus_tag="ROD_01711"
FT                   /note="HMMPfam hit to PF00557, Peptidase M24, catalytic
FT                   core, score 2.5e-106"
FT                   /inference="protein motif:PFAM:PF00557"
FT   misc_feature    complement(204293..204349)
FT                   /note="PS00680 Methionine aminopeptidase subfamily 1
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00680"
FT   misc_RNA        205134..205271
FT                   /note="Rfam:RF00127;t44;Score=110.41;positions 1 to 60"
FT   CDS_pept        205298..206023
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="ROD_01721"
FT                   /product="30S ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01721"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86952"
FT                   /db_xref="GOA:D2TI56"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI56"
FT                   /protein_id="CBG86952.1"
FT                   /translation="MATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEK
FT                   TVPMFNEALAELNKIASRKGKILFVGTKRAASEAVKEAANSCDQFFVNHRWLGGMLTNW
FT                   KTVRQSIKRLKDLETQSQDGTFEKLTKKEALMRTRELEKLENSLGGIKDMGGLPDALFV
FT                   IDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVSLYLGAVAATVR
FT                   EGRSQDLASQAEESFVEAE"
FT   misc_feature    205313..205348
FT                   /note="PS00962 Ribosomal protein S2 signature 1."
FT                   /inference="protein motif:Prosite:PS00962"
FT   misc_feature    205322..205972
FT                   /gene="rpsB"
FT                   /locus_tag="ROD_01721"
FT                   /note="HMMPfam hit to PF00318, Ribosomal protein S2, score
FT                   6.5e-131"
FT                   /inference="protein motif:PFAM:PF00318"
FT   misc_feature    205769..205843
FT                   /note="PS00963 Ribosomal protein S2 signature 2."
FT                   /inference="protein motif:Prosite:PS00963"
FT   CDS_pept        206159..207010
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="ROD_01731"
FT                   /product="elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01731"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86953"
FT                   /db_xref="GOA:D2TI57"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI57"
FT                   /protein_id="CBG86953.1"
FT                   /translation="MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSG
FT                   AIKAAKKAGNVAADGVIKTKIEGNTAFILEVNCQTDFVAKDGGFQAFADKVLDAAVAGK
FT                   ITDVEVLKAQFEEERVALVAKIGENINIRRIASLEGDVLGSYQHGARIGVLVAAKGADE
FT                   ELVKQLAMHVAASKPEFVKPEDVSADVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKK
FT                   FTGEVSLTGQPFVMDPSKSVGQLLKEHNADVTGFIRFEVGEGIEKVETDFAAEVAAMSK
FT                   QS"
FT   misc_feature    206168..206290
FT                   /gene="tsf"
FT                   /locus_tag="ROD_01731"
FT                   /note="HMMPfam hit to
FT                   PF00627,Ubiquitin-associated/translation elongation factor
FT                   EF1B,N-terminal, score 6.2e-13"
FT                   /inference="protein motif:PFAM:PF00627"
FT   misc_feature    206192..206239
FT                   /note="PS01126 Elongation factor Ts signature 1."
FT                   /inference="protein motif:Prosite:PS01126"
FT   misc_feature    206327..206947
FT                   /gene="tsf"
FT                   /locus_tag="ROD_01731"
FT                   /note="HMMPfam hit to PF00889, Translation elongation
FT                   factor EFTs/EF1B, dimerisation, score 2.8e-107"
FT                   /inference="protein motif:PFAM:PF00889"
FT   misc_feature    206381..206413
FT                   /note="PS01127 Elongation factor Ts signature 2."
FT                   /inference="protein motif:Prosite:PS01127"
FT   CDS_pept        207163..207888
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="ROD_01741"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01741"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86954"
FT                   /db_xref="GOA:D2TI58"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI58"
FT                   /protein_id="CBG86954.1"
FT                   /translation="MATNAKPVYKRILLKLSGEALQGSEGFGIDASILDRMAQEIKELV
FT                   ELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARL
FT                   MSAIPLNGVCDNYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEADVVLK
FT                   ATKVDGVFTTDPAKDPSATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNK
FT                   PGALRRVVMGEKEGTLITE"
FT   misc_feature    207190..207819
FT                   /gene="pyrH"
FT                   /locus_tag="ROD_01741"
FT                   /note="HMMPfam hit to PF00696,Aspartate/glutamate/uridylate
FT                   kinase, score 2.6e-63"
FT                   /inference="protein motif:PFAM:PF00696"
FT   CDS_pept        208189..208746
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="ROD_01751"
FT                   /product="ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01751"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86955"
FT                   /db_xref="GOA:D2TI59"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI59"
FT                   /protein_id="CBG86955.1"
FT                   /translation="MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYY
FT                   GTPTPLPQLASVTVEDSRTLKINVFDRSLSAAVEKAIMASDLGLNPSSAGSDIRVPLPP
FT                   LTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKEKEISEDDDRRSQDDIQKL
FT                   TDAAIKKVEAALADKEAELMQF"
FT   misc_feature    208243..208737
FT                   /gene="frr"
FT                   /locus_tag="ROD_01751"
FT                   /note="HMMPfam hit to PF01765, Ribosome recycling
FT                   factor,score 1.9e-101"
FT                   /inference="protein motif:PFAM:PF01765"
FT   CDS_pept        208854..210050
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /locus_tag="ROD_01761"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01761"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86956"
FT                   /db_xref="GOA:D2TI60"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI60"
FT                   /protein_id="CBG86956.1"
FT                   /translation="MKHITILGSTGSIGCSTLDVVRQNPGDYRVVALVAGKNVTRMVEQ
FT                   CLEFSPRYAVMDDEASAKLLKNTLQQHGSRTDVLSGQQAACEMAALDEVDQVMAAIVGA
FT                   AGLLPTLAAIRAGKTILLANKESLVTCGRLFMEAVKHSKARLLPVDSEHNAIFQSMPQP
FT                   IQHNLGYADLEQNGVMSVLLTGSGGPFRETPLRDLASMTPDRACRHPNWSMGRKISVDS
FT                   ATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIA
FT                   HTMAWPNRVTSGVKPLDFCKLSALTFSAPDYQRYPCLKLAMEAFEQGQAATTALNAANE
FT                   IVVAAFLAEDIRFTDIADLNLGVLEQMELQEPQSVDDVLRVDAIAREVARKQVMRLAS"
FT   misc_feature    208863..209249
FT                   /gene="dxr"
FT                   /locus_tag="ROD_01761"
FT                   /note="HMMPfam hit to PF02670, 1-deoxy-D-xylulose
FT                   5-phosphate reductoisomerase, N-terminal, score 2.9e-80"
FT                   /inference="protein motif:PFAM:PF02670"
FT   misc_feature    208866..208898
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    209187..209210
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    209289..209570
FT                   /gene="dxr"
FT                   /locus_tag="ROD_01761"
FT                   /note="HMMPfam hit to PF08436, 1-deoxy-D-xylulose
FT                   5-phosphate reductoisomerase, C-terminal, score 5.6e-59"
FT                   /inference="protein motif:PFAM:PF08436"
FT   CDS_pept        210239..210997
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="ROD_01771"
FT                   /product="undecaprenyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01771"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86957"
FT                   /db_xref="GOA:D2TI61"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI61"
FT                   /protein_id="CBG86957.1"
FT                   /translation="MLSATQPVSENLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAG
FT                   AKSVRRAVSFAANNGIDALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNV
FT                   RLRIIGDTSRFNSRLQERIRKSEALTARNTGLTLNIAANYGGRWDIVQGVRKLAEQVQE
FT                   GVLRPDQIDEEMLNQQICMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPD
FT                   FDEQDFEGALHAFANRERRFGGTEPGDDKA"
FT   misc_feature    210305..210970
FT                   /gene="uppS"
FT                   /locus_tag="ROD_01771"
FT                   /note="HMMPfam hit to
FT                   PF01255,Di-trans-poly-cis-decaprenylcistransferase, score
FT                   1.7e-150"
FT                   /inference="protein motif:PFAM:PF01255"
FT   misc_feature    210803..210856
FT                   /note="PS01066 Undecaprenyl pyrophosphate synthetase family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01066"
FT   CDS_pept        211010..211867
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="ROD_01781"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /EC_number="2.7.7.41"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01781"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86958"
FT                   /db_xref="GOA:D2TI62"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI62"
FT                   /protein_id="CBG86958.1"
FT                   /translation="MLKYRLISAFVLIPVVIAALFLLPPVGFAIVTLFVCMLAAWEWGQ
FT                   LSGFATRTQRVWLAVLCGLLLALMLFLLPEYHHNIRQPLVEVSLWASLGWWGVALLLVF
FT                   FYPGSAAIWRNSKTLRIIFGVLTIVPFFWGMLALRAWHYDDNHYSGALWLLYVMILVWG
FT                   ADSGAYMFGKLFGKHKLAPKVSPGKTWQGFFGGLATAAVISWGYSMWANLDVAPVTLLI
FT                   CSIVAALASVLGDLTESMFKREAGIKDSGHLIPGHGGILDRIDSLTAAVPVFACLLLLV
FT                   FKTL"
FT   sig_peptide     211010..211096
FT                   /gene="cdsA"
FT                   /locus_tag="ROD_01781"
FT                   /note="Signal peptide predicted for ROD01781 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.954) with cleavage site
FT                   probability 0.751 between residues 29 and 30"
FT   misc_feature    211016..211852
FT                   /gene="cdsA"
FT                   /locus_tag="ROD_01781"
FT                   /note="HMMPfam hit to PF01148, Phosphatidate
FT                   cytidylyltransferase, score 1.4e-83"
FT                   /inference="protein motif:PFAM:PF01148"
FT   misc_feature    join(211028..211132,211175..211231,211268..211327,
FT                   211370..211438,211457..211525,211583..211642,
FT                   211661..211729,211787..211855)
FT                   /gene="cdsA"
FT                   /locus_tag="ROD_01781"
FT                   /note="8 probable transmembrane helices predicted for
FT                   ROD01781 by TMHMM2.0 at aa 7-41, 56-74, 87-106,
FT                   121-143,150-172, 192-211, 218-240 and 260-282"
FT   misc_feature    211724..211804
FT                   /note="PS01315 Phosphatidate cytidylyltransferase
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01315"
FT   CDS_pept        211879..213231
FT                   /transl_table=11
FT                   /gene="ecfE"
FT                   /locus_tag="ROD_01791"
FT                   /product="protease"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01791"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86959"
FT                   /db_xref="GOA:D2TI63"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI63"
FT                   /protein_id="CBG86959.1"
FT                   /translation="MLSILWNLAAFIVALGVLITVHEFGHFWVARRCGVRVERFSIGFG
FT                   KALWRRTDRSGTEYVIALIPLGGYVKMLDERAEPVIPELRHHAFNNKTVGQRAAIIAAG
FT                   PVANFLFAIFAYWLVFIIGVPGVRPVVGEITPNSIAAEAQITPGTELKAVDGIETPDWD
FT                   AVRLQLVAKIGDEQTTLSVAPFGSNQRQEKTLDLRHWAFEPDKEDPVSSLGIRPRGPQI
FT                   EPVLSEVQAQSAASKAGLQAGDRIVKVDGQPLTKWVNFVTLVRDNPGKPLALEIERQGS
FT                   ALSLTLIPETKPGNGKAEGFAGVVPKIIPLPDEYKTVRQYGPFSAIAQATEKTWQLMKL
FT                   TVSMLGKLITGDVKLNNLSGPISIAQGAGMSAEFGVIYYLMFLALISVNLGIINLFPLP
FT                   VLDGGHLLFLAIEKLKGGPVSERVQDFSYRIGSILLVLLMGLALFNDFSRL"
FT   misc_feature    join(211882..211941,212170..212238,213004..213072,
FT                   213154..213213)
FT                   /gene="ecfE"
FT                   /locus_tag="ROD_01791"
FT                   /note="4 probable transmembrane helices predicted for
FT                   ROD01791 by TMHMM2.0 at aa 2-21, 98-120, 376-398 and
FT                   426-445"
FT   misc_feature    211906..213216
FT                   /gene="ecfE"
FT                   /locus_tag="ROD_01791"
FT                   /note="HMMPfam hit to PF02163, Peptidase M50, score
FT                   3.3e-95"
FT                   /inference="protein motif:PFAM:PF02163"
FT   misc_feature    211933..211962
FT                   /note="PS00142 Neutral zinc metallopeptidases, zinc-binding
FT                   region signature."
FT                   /inference="protein motif:Prosite:PS00142"
FT   misc_feature    212485..212709
FT                   /gene="ecfE"
FT                   /locus_tag="ROD_01791"
FT                   /note="HMMPfam hit to PF00595, PDZ/DHR/GLGF, score 2.5e-13"
FT                   /inference="protein motif:PFAM:PF00595"
FT   CDS_pept        213263..215692
FT                   /transl_table=11
FT                   /locus_tag="ROD_01801"
FT                   /product="outer membrane protein assembly factor"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01801"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86960"
FT                   /db_xref="GOA:D2TI64"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI64"
FT                   /protein_id="CBG86960.1"
FT                   /translation="MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLS
FT                   MPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKS
FT                   VKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRV
FT                   DLKLVFQEGVSAKIQQINIVGNHAFSTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGD
FT                   LETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYITVNVTEGDQYTLSGVQVSGNLAGHS
FT                   AEIESLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKTVKLRVN
FT                   VDAGNRFYVRKIRFEGNDTSKDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGYFETVD
FT                   TDTQRVPGSPDQVDVVYKVKERNTGSFNFGVGYGTESGVSFQAGVQQDNWLGTGYAVGI
FT                   NGTKNDYQTYSELSITNPYFTVDGVSLGGRIFYNDFRADDADLSDYTNKSYGTDVTLGF
FT                   PINEYNTLRAGLGYVHNRLSNMQPQLAMWRYLNSMGQYPDPTNDSNSFTADDFTFNYGW
FT                   TYNKLDRGFFPTEGTRINLNGKVTIPGSDNEYYKATLDTATYVPIDDDHKWVVLGRTRW
FT                   GYGDGIGSKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYLPASSRHDGDDDYDNECAST
FT                   NTAPCQSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSGY
FT                   SGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGKTW"
FT   sig_peptide     213263..213322
FT                   /locus_tag="ROD_01801"
FT                   /note="Signal peptide predicted for ROD01801 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.980 between residues 20 and 21"
FT   misc_feature    213332..213535
FT                   /locus_tag="ROD_01801"
FT                   /note="HMMPfam hit to PF07244, Surface antigen variable
FT                   number, score 3.2e-11"
FT                   /inference="protein motif:PFAM:PF07244"
FT   misc_feature    213536..213778
FT                   /locus_tag="ROD_01801"
FT                   /note="HMMPfam hit to PF07244, Surface antigen variable
FT                   number, score 2.6e-16"
FT                   /inference="protein motif:PFAM:PF07244"
FT   misc_feature    213785..214051
FT                   /locus_tag="ROD_01801"
FT                   /note="HMMPfam hit to PF07244, Surface antigen variable
FT                   number, score 9.1e-19"
FT                   /inference="protein motif:PFAM:PF07244"
FT   misc_feature    214058..214294
FT                   /locus_tag="ROD_01801"
FT                   /note="HMMPfam hit to PF07244, Surface antigen variable
FT                   number, score 4.7e-16"
FT                   /inference="protein motif:PFAM:PF07244"
FT   misc_feature    214301..214525
FT                   /locus_tag="ROD_01801"
FT                   /note="HMMPfam hit to PF07244, Surface antigen variable
FT                   number, score 1.1e-21"
FT                   /inference="protein motif:PFAM:PF07244"
FT   misc_feature    214604..215689
FT                   /locus_tag="ROD_01801"
FT                   /note="HMMPfam hit to PF01103, Bacterial surface antigen
FT                   (D15), score 1.7e-76"
FT                   /inference="protein motif:PFAM:PF01103"
FT   CDS_pept        215815..216300
FT                   /transl_table=11
FT                   /gene="skp"
FT                   /locus_tag="ROD_01811"
FT                   /product="chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01811"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86961"
FT                   /db_xref="GOA:D2TI65"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI65"
FT                   /protein_id="CBG86961.1"
FT                   /translation="MKKWLLAAGLGLAMVTSAQAADKIAIVNMGSLFQQVAQKTGVSKT
FT                   LENEFKSRASELQRMETDLQSKMQRLQSMKAGSERTKLEKDVMAQRQTFSQKAQAFEQD
FT                   RARRSNEERGKLVTRIQSAVKSVASSQSIDLVVDANTVAYNSSDVKDITADVLKQVK"
FT   sig_peptide     215815..215874
FT                   /gene="skp"
FT                   /locus_tag="ROD_01811"
FT                   /note="Signal peptide predicted for ROD01811 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 20 and 21"
FT   misc_feature    215833..216297
FT                   /gene="skp"
FT                   /locus_tag="ROD_01811"
FT                   /note="HMMPfam hit to PF03938, Outer membrane chaperone Skp
FT                   (OmpH), score 1.2e-37"
FT                   /inference="protein motif:PFAM:PF03938"
FT   CDS_pept        216304..217329
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="ROD_01821"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /note="unknown EC_number=2.3.1.-."
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01821"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86962"
FT                   /db_xref="GOA:D2TI66"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI66"
FT                   /protein_id="CBG86962.1"
FT                   /translation="MPSIRLSDLAEQLDAELHGDGDIVITGVASMQSAQTGHITFMVNP
FT                   KYREHLALCQASAVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAKDIAPSA
FT                   VVDATATLGNHVSIGANAVIESGVELGDNVVIGAGCFVGKNTKIGAGSRLWANVTVYHD
FT                   IQIGENCLIQSGTVIGADGFGYANDRGNWVKIPQLGRVIIGDRVEIGACTTIDRGALDD
FT                   TVIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICD
FT                   KVTVTGMGMVMRPITEPGVYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKAIERKVNQQ
FT                   D"
FT   misc_feature    216364..216573
FT                   /gene="lpxD"
FT                   /locus_tag="ROD_01821"
FT                   /note="HMMPfam hit to PF04613, UDP-3-O-[3-hydroxymyristoyl]
FT                   glucosamine N-acyltransferase, LpxD, score 3.3e-33"
FT                   /inference="protein motif:PFAM:PF04613"
FT   misc_feature    216601..216687
FT                   /note="PS00101 Hexapeptide-repeat containing-transferases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00101"
FT   misc_feature    216628..216681
FT                   /gene="lpxD"
FT                   /locus_tag="ROD_01821"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide repeat, score 0.14"
FT                   /inference="protein motif:PFAM:PF00132"
FT   misc_feature    216682..216735
FT                   /gene="lpxD"
FT                   /locus_tag="ROD_01821"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide repeat, score 0.0058"
FT                   /inference="protein motif:PFAM:PF00132"
FT   misc_feature    216691..216777
FT                   /note="PS00101 Hexapeptide-repeat containing-transferases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00101"
FT   misc_feature    216736..216789
FT                   /gene="lpxD"
FT                   /locus_tag="ROD_01821"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide repeat, score 0.051"
FT                   /inference="protein motif:PFAM:PF00132"
FT   misc_feature    216790..216843
FT                   /gene="lpxD"
FT                   /locus_tag="ROD_01821"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide repeat, score 0.019"
FT                   /inference="protein motif:PFAM:PF00132"
FT   misc_feature    216901..216954
FT                   /gene="lpxD"
FT                   /locus_tag="ROD_01821"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide repeat, score 0.3"
FT                   /inference="protein motif:PFAM:PF00132"
FT   misc_feature    216967..217020
FT                   /gene="lpxD"
FT                   /locus_tag="ROD_01821"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide repeat, score 0.021"
FT                   /inference="protein motif:PFAM:PF00132"
FT   misc_feature    216976..217062
FT                   /note="PS00101 Hexapeptide-repeat containing-transferases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00101"
FT   misc_feature    217021..217074
FT                   /gene="lpxD"
FT                   /locus_tag="ROD_01821"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide repeat, score 1"
FT                   /inference="protein motif:PFAM:PF00132"
FT   misc_feature    217075..217128
FT                   /gene="lpxD"
FT                   /locus_tag="ROD_01821"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide repeat, score 16"
FT                   /inference="protein motif:PFAM:PF00132"
FT   CDS_pept        217433..217888
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="ROD_01831"
FT                   /product="(3r)-hydroxymyristol acyl carrier protein
FT                   dehydratase (ec 4.2.1.-)"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01831"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86963"
FT                   /db_xref="GOA:D2TI67"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI67"
FT                   /protein_id="CBG86963.1"
FT                   /translation="MTTNTHTLHIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVS
FT                   VNEPFFQGHFPGKPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRP
FT                   VVPGDQMIMEVTFEKTRRGLTRFKGVALVDGKVVCEATMMCARSREA"
FT   misc_feature    217481..217858
FT                   /gene="fabZ"
FT                   /locus_tag="ROD_01831"
FT                   /note="HMMPfam hit to
FT                   PF07977,Beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase,FabA/FabZ, score 3.7e-68"
FT                   /inference="protein motif:PFAM:PF07977"
FT   CDS_pept        217892..218680
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="ROD_01841"
FT                   /product="acyl-[acyl-carrier-protein]--UDP-N-acetylglucos
FT                   amine O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01841"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86964"
FT                   /db_xref="GOA:D2TI68"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI68"
FT                   /protein_id="CBG86964.1"
FT                   /translation="MIDKSAFIHPTAIVEEGASVGANVHIGPFCLVGPHVEIGEGTVLK
FT                   SHVVVNGHTKIGRDNEIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHRGTVQ
FT                   GGGLTKVGSDNLLMINAHVAHDCTIGDRCILANNATLAGHVSLDDYVIIGGMTAVHQFC
FT                   IIGAHVMVGGCSGVAQDVPPYVIAQGNHATPFGVNIEGLKRRGFTREAITAIRNAYKAL
FT                   YRSGKTLEEAKPDIAELAKQHPEVQPFSDFFARSTRGLIR"
FT   misc_feature    217940..217993
FT                   /gene="lpxA"
FT                   /locus_tag="ROD_01841"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide repeat, score 0.089"
FT                   /inference="protein motif:PFAM:PF00132"
FT   misc_feature    217949..218035
FT                   /note="PS00101 Hexapeptide-repeat containing-transferases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00101"
FT   misc_feature    217994..218047
FT                   /gene="lpxA"
FT                   /locus_tag="ROD_01841"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide repeat, score 0.46"
FT                   /inference="protein motif:PFAM:PF00132"
FT   misc_feature    218048..218101
FT                   /gene="lpxA"
FT                   /locus_tag="ROD_01841"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide repeat, score 0.84"
FT                   /inference="protein motif:PFAM:PF00132"
FT   misc_feature    218138..218191
FT                   /gene="lpxA"
FT                   /locus_tag="ROD_01841"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide repeat, score 7.5"
FT                   /inference="protein motif:PFAM:PF00132"
FT   misc_feature    218213..218266
FT                   /gene="lpxA"
FT                   /locus_tag="ROD_01841"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide repeat, score 85"
FT                   /inference="protein motif:PFAM:PF00132"
FT   misc_feature    218267..218320
FT                   /gene="lpxA"
FT                   /locus_tag="ROD_01841"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide repeat, score 0.1"
FT                   /inference="protein motif:PFAM:PF00132"
FT   misc_feature    218339..218392
FT                   /gene="lpxA"
FT                   /locus_tag="ROD_01841"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide repeat, score 0.2"
FT                   /inference="protein motif:PFAM:PF00132"
FT   misc_feature    218348..218434
FT                   /note="PS00101 Hexapeptide-repeat containing-transferases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00101"
FT   misc_feature    218381..218413
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    218552..218575
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        218680..219828
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="ROD_01851"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01851"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86965"
FT                   /db_xref="GOA:D2TI69"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI69"
FT                   /protein_id="CBG86965.1"
FT                   /translation="MANPRPLTIALVAGETSGDILGAGLIRALKARVPHARFVGVAGPR
FT                   MQAEGCEAWYEMEELAVMGIVEVLGRLRRLLHIRADLTRRFTALQPDVFVGIDAPDFNI
FT                   TLEGNLKKQGIKTIHYVSPSVWAWRQKRVFKIGRSTDMVLAFLPFEKAFYDKYNVPCRF
FT                   IGHTMADAMPLDPDKNAARDAIGIPHDAHCLALLPGSRGAEVEMLSADFLKTAQLLRQR
FT                   YPDLEVVVPLVNARRREQFEKIKAETAPELHVHLLDGMGREAMVASDAALLASGTAALE
FT                   CMLAKCPMVVGYRMKPFTFWLAKRLVKTDYVSLPNLLAGRELVKELLQEECEPQKLAQA
FT                   LLPLLAKGETSHAMHDTFRELHQQIRCNADEQAADAVLELAQ"
FT   misc_feature    218704..219810
FT                   /gene="lpxB"
FT                   /locus_tag="ROD_01851"
FT                   /note="HMMPfam hit to PF02684, Glycosyl transferase, family
FT                   19, score 1.5e-214"
FT                   /inference="protein motif:PFAM:PF02684"
FT   CDS_pept        219825..220421
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="ROD_01861"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01861"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86966"
FT                   /db_xref="GOA:D2TI70"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI70"
FT                   /protein_id="CBG86966.1"
FT                   /translation="MIEFVYPHTRLVAGVDEVGRGPLVGAVVTAAVILDPARPIVGLND
FT                   SKKLSEKRRLALYQEIKEKALSWSLGRAEPHEIDKLNILHATMLAMQRAVAGLHIAPEY
FT                   VLIDGNRCPALPVPSMAVVKGDSRVAEISAASILAKVTRDAEMAALDSVFPQYGFAQHK
FT                   GYPTAFHLEALAAHGATEHHRRSFGPVKRALGLAS"
FT   misc_feature    219861..220394
FT                   /gene="rnhB"
FT                   /locus_tag="ROD_01861"
FT                   /note="HMMPfam hit to PF01351, Ribonuclease HII/HIII, score
FT                   7.3e-94"
FT                   /inference="protein motif:PFAM:PF01351"
FT   CDS_pept        220446..223928
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="ROD_01871"
FT                   /product="DNA polymerase III alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01871"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86967"
FT                   /db_xref="GOA:D2TI71"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI71"
FT                   /protein_id="CBG86967.1"
FT                   /translation="MSEPRFVHLRVHSDYSMIDGLAKTGPLVKKAAALGMPALAITDFT
FT                   NLCGLVKFYGAGHSAGIKPIVGADFHVQSELMGDELTHLTVLAANNTGYQNLTLLISKA
FT                   YQRGYGAAGPVIDRDWLIELNEGLILLSGGRMGDVGRGLLRGNSALVEECVAFYEQHFP
FT                   DRYFLELIRTGRPDEESYLHAAVELAEARGLPVVATNDVRFIDSADFDAHEIRVAIHDG
FT                   FTLDDPKRPRNYSPQQYMRTEEEMCELFSDIPEALENSVEIARRCNVTVRLGEYFLPQF
FT                   PTGDMTTEDFLVKKSKEGLEERLAFLFPDEEERKKRRPEYDERLDIELQVINQMGFPGY
FT                   FLIVMEFIQWSKDNGVPVGPGRGSGAGSLVAYALKITDLDPLEFDLLFERFLNPERVSM
FT                   PDFDVDFCMEKRDQVIEHVADMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDR
FT                   ISKLVPPDPGMTLAKAFEAEPQLPEIYEADEEVKALIDMARKLEGVTRNAGKHAGGVVI
FT                   APTKITDFAPLYCDEQGQHPVTQFDKNDVEYAGLVKFDFLGLRTLTIINWALEMINKRR
FT                   EKNGEPPLDIAAIPLDDKKSFDMLQRSETTAVFQLESRGMKDLIKRLQPDCFEDMIALV
FT                   ALFRPGPLQSGMVDNFIDRKHGREEISYPDVQWQHESLKPVLEPTYGIILYQEQVMQIA
FT                   QVLSGYTLGGADMLRRAMGKKKPEEMAKQRSVFEEGARKNGIDGELAIKIFDLVEKFAG
FT                   YGFNKSHSAAYALVSYQTLWLKAHYPAEFMAAVMTADMDNTEKVVGLVDECWRMGLKIL
FT                   PPDINSGLYHFHVNDEGEIVYGIGAIKGVGEGPIEAIIEARNNGGYFRELFDLCARTDT
FT                   KKLNRRVLEKLIMSGAFDRLGPHRAALMNSLGDALKAADQHAKAEAIGQADMFGVLAEE
FT                   PEQIEQSYASCQPWPEQVVLDGERETLGLYLTGHPINQYLKEIERYVGGYRLKDMHPTE
FT                   RGKVTTAAGLVIAARVMVTKRGNRIGICTLDDRSGRLEVMLFTDALDKYQQLLEKDRIL
FT                   IVSGQVSFDDFSGGLKMTAREVMDIDEAREKYARGLAISLTDRQIDDQLLNRLRQSLEP
FT                   HRSGTIPVHLYYQRADARARLRFGAAWRVSPSDRLLNDLRGLIGSEQVELEFD"
FT   misc_feature    220464..221063
FT                   /gene="dnaE"
FT                   /locus_tag="ROD_01871"
FT                   /note="HMMPfam hit to PF02811, PHP, C-terminal, score
FT                   2.4e-60"
FT                   /inference="protein motif:PFAM:PF02811"
FT   misc_feature    221157..222650
FT                   /gene="dnaE"
FT                   /locus_tag="ROD_01871"
FT                   /note="HMMPfam hit to PF07733, Bacterial DNA polymerase
FT                   III, alpha subunit, score 0"
FT                   /inference="protein motif:PFAM:PF07733"
FT   misc_feature    223440..223664
FT                   /gene="dnaE"
FT                   /locus_tag="ROD_01871"
FT                   /note="HMMPfam hit to PF01336, Nucleic acid
FT                   binding,OB-fold, tRNA/helicase-type, score 7.9e-13"
FT                   /inference="protein motif:PFAM:PF01336"
FT   CDS_pept        223941..224900
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="ROD_01881"
FT                   /product="acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit alpha"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01881"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86968"
FT                   /db_xref="GOA:D2TI72"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI72"
FT                   /protein_id="CBG86968.1"
FT                   /translation="MSLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINIDEEVHRLRE
FT                   KSVELTRKIFADLGAWQVAQLARHPQRPYTLDYVRLAFEEFDELAGDRAYADDKAIVGG
FT                   IARLEGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMEMAERFKMPIVTFIDT
FT                   PGAYPGVGAEERGQSEAIARNLREMSRLSVPVICTVIGEGGSGGALAIGVGDKVNMLQY
FT                   STYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELKLIDSIIQEPLGGAHRNPEA
FT                   MAASLKAQLLEDLADLDVLSTDDLKNRRYQRLMSYGYA"
FT   misc_feature    223950..224393
FT                   /gene="accA"
FT                   /locus_tag="ROD_01881"
FT                   /note="HMMPfam hit to PF03255, Acetyl-CoA carboxylase,alpha
FT                   subunit, score 9e-102"
FT                   /inference="protein motif:PFAM:PF03255"
FT   CDS_pept        join(225082..225405,228114..229544)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ROD_01891"
FT                   /product="putative polysaccharide degrading enzyme
FT                   (pseudogene)"
FT                   /note="pseudogene, disrupted by ISCro1 insertion"
FT   repeat_region   225396..225404
FT                   /note="9 bp direct repeat flanking ISCro1"
FT   repeat_region   225405..228103
FT                   /note="Insertion sequence ISCro1. 1 of 21 intact ISCro1
FT                   elements in CR chromosome, all have 30 bp inverted repeats
FT                   which contain 12 mismatches, and are flanked by direct
FT                   repeats of varying length. This element has 9 bp direct
FT                   repeats"
FT   repeat_region   225405..225434
FT                   /note="30 bp terminal inverted repeat of ISCro1, contains
FT                   12 mismatches"
FT   CDS_pept        225458..226135
FT                   /transl_table=11
FT                   /locus_tag="ROD_01901"
FT                   /product="ISCro1 transposase A"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01901"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86970"
FT                   /db_xref="GOA:D2TGY6"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGY6"
FT                   /protein_id="CBG86970.1"
FT                   /translation="MSIIFSGHYRMEYRTWITEALRLHFEEHLPRVVAGRRLGVPKSTV
FT                   CSMFVRFRRAGLSWPLPAGMSEQELDACLYGQFSTVPVVRPESTVISETPVVKKRPRRP
FT                   NFPYEFKIALVEQSLQPGACVAQIARENGINDNLLFNWRHQYRKGGLLPSGKNMPALLP
FT                   VTLTPEPDNKIPAPAQEPEQINTPSDSLCCELVLPAGTLRLKGKLTPALLQTLIREIKG
FT                   SSH"
FT   misc_feature    225542..225607
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1051.000, SD 2.77 at aa 29-50, sequence
FT                   LPRVVAGRRLGVPKSTVCSMFV"
FT   misc_feature    225764..226018
FT                   /locus_tag="ROD_01901"
FT                   /note="HMMPfam hit to PF01527, Transposase IS3/IS911, score
FT                   2e-22"
FT                   /inference="protein motif:PFAM:PF01527"
FT   CDS_pept        226135..226482
FT                   /transl_table=11
FT                   /locus_tag="ROD_01911"
FT                   /product="ISCro1 transposase B"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01911"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86971"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGY5"
FT                   /protein_id="CBG86971.1"
FT                   /translation="MISLPAGSRIWLVAGITDMRNGFNGLASKVQNVLKDDPFSGHLFI
FT                   FRGRRGDQIKVLWADSDGLCLFTKRLERGRFIWPVTRDGKVHLTPAQLSMLLEGINWKH
FT                   PKRTERAGIRI"
FT   misc_feature    226150..226476
FT                   /locus_tag="ROD_01911"
FT                   /note="HMMPfam hit to PF05717, Transposase (putative), IS66
FT                   Orf2 like, score 5.7e-70"
FT                   /inference="protein motif:PFAM:PF05717"
FT   CDS_pept        226502..228073
FT                   /transl_table=11
FT                   /locus_tag="ROD_01921"
FT                   /product="ISCro1 transposase C"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01921"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86972"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGY4"
FT                   /protein_id="CBG86972.1"
FT                   /translation="MDTSLAHENARLRALLQTQQDTIRQMAEYNRLLSQRVAAYASEIN
FT                   RLKALVAKLQRMQFGKSSEKLRAKTERQIQDAQERISALQEEMAETLGEQYDPALPSAL
FT                   RQSSARKPLPASLPRETRVIRPEEECCPACGGELSSLGCDVSEQLELISSAFKVIETQR
FT                   PKLACCRCDHIVQAPVPSKPIARSYAGAGLLAHVVTGKYADHLPLYRQSEIYRRQGVEL
FT                   SRATLGRWTGAVAELLEPLYDVLRQYVLMPGKVHADDIPVPVQEPGSGKTRTARLWVYV
FT                   RDDRNAGSQMPPAVWFAYSPDRKGIHPQNHLSGYSGVLQADAYGGYRALYESGRITEAA
FT                   CMAHARRKIHDVHARAPTDITTEALQRIGELYAIEAEVRGCSAEQRLAARKARAASLMQ
FT                   SLYDWIQTQMKTLSRHSDTAKAFAYLLKQWDSLNVYCSNGWVEIDNNIAENALRGVAVG
FT                   RKNWLFAGSDSGGEHAAVLYSLIGTCRLNNVEPEKWLRYVIEHIQDWPANRVRDLLPWK
FT                   VDLSSQ"
FT   misc_feature    226913..227509
FT                   /locus_tag="ROD_01921"
FT                   /note="HMMPfam hit to PF03050, Transposase, IS66, score
FT                   4.4e-129"
FT                   /inference="protein motif:PFAM:PF03050"
FT   repeat_region   complement(228074..228103)
FT                   /note="30 bp terminal inverted repeat of ISCro1, contains
FT                   12 mismatches"
FT   repeat_region   228104..228112
FT                   /note="9 bp direct repeat flanking ISCro1"
FT   misc_feature    228372..228809
FT                   /locus_tag="ROD_01891"
FT                   /note="HMMPfam hit to PF00182, Glycoside hydrolase, family
FT                   19, catalytic, score 1.4e-30"
FT                   /inference="protein motif:PFAM:PF00182"
FT   misc_feature    229089..229337
FT                   /locus_tag="ROD_01891"
FT                   /note="HMMPfam hit to PF00801, PKD, score 0.00016"
FT                   /inference="protein motif:PFAM:PF00801"
FT   misc_feature    229377..229475
FT                   /locus_tag="ROD_01891"
FT                   /note="HMMPfam hit to PF02839, Carbohydrate-binding family
FT                   V/XII, score 0.002"
FT                   /inference="protein motif:PFAM:PF02839"
FT   CDS_pept        229624..231762
FT                   /transl_table=11
FT                   /gene="ldcC"
FT                   /locus_tag="ROD_01941"
FT                   /product="lysine decarboxylase, constitutive"
FT                   /EC_number="4.1.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01941"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86973"
FT                   /db_xref="GOA:D2TI76"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI76"
FT                   /protein_id="CBG86973.1"
FT                   /translation="MNIIAIMGPHGVFYKDEPIKELERALQAQGFQIIWPQNSVDLLKF
FT                   IEHNPRICGVIFDWDEYSLDLCSDINQLNEYLPLYAFINTHSTMDVSVHDMRMALWFFE
FT                   YALGQAEDIATRIRQYTDEYLDNITPPFTKALFTYVKEGKYTFCTPGHMAGTAYQKSPP
FT                   GCLFYDFFGGNTLKADVSISVTELGSLLDHTGPHLEAEEYIARTFGAEQSYMVTNGTST
FT                   SNKIVGMYAAPTGSTLLIDRNCHKSLAHLLMMSDVVPLWLKPTRNALGILGGIPRREFT
FT                   RESIENKVAETPQAQWPVHAVITNSTYDGLLYNTNWIKQTLDVPSIHFDSAWVPYTHFH
FT                   PIYQGKSGMSGERVPGKVIFETQSTHKMLAALSQASLIHIKGEYDEDTFNEAFMMHTST
FT                   SPSYPIVASIETAAAMLRGNPGKRLINRSVERALHFRKEVQRLREESDSWFFDIWQPEE
FT                   VDAAECWPVAPGEEWYGFNDADHDHMFLDPVKVTILTPGMDEQGNMSDEGIPAALVAKF
FT                   LDERGVVVEKTGPYNLLFLFSIGIDKTRAMGLLRGLTEFKRAYDLNLRVKNMLPDLYAE
FT                   DPDFYRNMRIQDLAQGIHKLIRQHDLPGLMLRAFDTLPEMMMTPHQAWQRQIRGDVETV
FT                   TLDQLVGRVSANMILPYPPGVPLLMPGEMITEQSRAVLDFLLMLCSVGHHYPGFETDIH
FT                   GAKQDEEGVYRVRVLKNI"
FT   misc_feature    229663..229995
FT                   /gene="ldcC"
FT                   /locus_tag="ROD_01941"
FT                   /note="HMMPfam hit to PF03709, Orn/Lys/Arg
FT                   decarboxylase,N-terminal, score 6.4e-42"
FT                   /inference="protein motif:PFAM:PF03709"
FT   misc_feature    230011..231309
FT                   /gene="ldcC"
FT                   /locus_tag="ROD_01941"
FT                   /note="HMMPfam hit to PF01276, Orn/Lys/Arg
FT                   decarboxylase,major region, score 8.4e-287"
FT                   /inference="protein motif:PFAM:PF01276"
FT   misc_feature    230707..230751
FT                   /note="PS00703 Orn/Lys/Arg decarboxylases family 1
FT                   pyridoxal-P attachment site."
FT                   /inference="protein motif:Prosite:PS00703"
FT   misc_feature    231331..231735
FT                   /gene="ldcC"
FT                   /locus_tag="ROD_01941"
FT                   /note="HMMPfam hit to PF03711, Orn/Lys/Arg
FT                   decarboxylase,C-terminal, score 1.1e-84"
FT                   /inference="protein motif:PFAM:PF03711"
FT   CDS_pept        231795..232217
FT                   /transl_table=11
FT                   /locus_tag="ROD_01951"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01951"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86974"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037478"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI77"
FT                   /protein_id="CBG86974.1"
FT                   /translation="MQITNNGDNDAMLGLKQVHHIAIIATDYAVSKAFYCDILGFTLLS
FT                   EAWRAERDSWKGDLALNGQYVIELFSFPFPPPRPSRPEACGLRHLAFSVDDIEQAIAHL
FT                   EAHEVKCEPVRIDPFTGKRFTFFNDPDGLPLELYEQ"
FT   misc_feature    231843..232205
FT                   /locus_tag="ROD_01951"
FT                   /note="HMMPfam hit to PF00903, Glyoxalase/bleomycin
FT                   resistance protein/dioxygenase, score 1.7e-31"
FT                   /inference="protein motif:PFAM:PF00903"
FT   CDS_pept        232279..233577
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="ROD_01961"
FT                   /product="tRNA(Ile)-lysidine synthase"
FT                   /EC_number="6.3.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01961"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86975"
FT                   /db_xref="GOA:D2TI78"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI78"
FT                   /protein_id="CBG86975.1"
FT                   /translation="MTTLTLNTSLFNRPQILVAFSGGLDSTVLLHQLVQWRALRPELRL
FT                   RAIHIHHGLSPHADEWVAHCEAVCARWQVPLMVRRVQLADEGLGIEALARQARYQAFAQ
FT                   ALAPGEILATAQHLDDQCETFLLALKRGSGPAGLSAMAEVSAFADSRLVRPLLTQSRTA
FT                   LEQWAREHSLCWIEDESNQDDAYDRNFLRLRVLPLLQQRWPHFAQATARSAALCAEQES
FT                   LLDELLAEELSGCMTTNGTLRLSPLMAMHDVRRAALIRRWLAARNAPMPSRDGLARIWQ
FT                   EVALAREDASPCLCFGEYEVRRYQGQLWWVKSRPGQSETVLRWADWQTPLRLPAGLGTA
FT                   ALIPGGELRKPLDDEPVTLRFKAPGMLHIVGRHGGRKLKKIWQELGIPPWRRDTTPLLF
FT                   YGETLIAAAGVFVTHEGVAVEDDGVQLLWQEGE"
FT   misc_feature    232321..232860
FT                   /gene="tilS"
FT                   /locus_tag="ROD_01961"
FT                   /note="HMMPfam hit to PF01171, PP-loop, score 5.5e-87"
FT                   /inference="protein motif:PFAM:PF01171"
FT   misc_feature    232960..233562
FT                   /gene="tilS"
FT                   /locus_tag="ROD_01961"
FT                   /note="HMMPfam hit to PF09179, Protein of unkown function
FT                   DUF1946, PP-loop ATpase, score 2.9e-89"
FT                   /inference="protein motif:PFAM:PF09179"
FT   misc_feature    233422..233490
FT                   /note="PS00334 Myb DNA-binding domain repeat signature 2."
FT                   /inference="protein motif:Prosite:PS00334"
FT   CDS_pept        complement(233662..233922)
FT                   /transl_table=11
FT                   /gene="rof"
FT                   /locus_tag="ROD_01971"
FT                   /product="Rho-binding antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01971"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86976"
FT                   /db_xref="InterPro:IPR009778"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR038626"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI79"
FT                   /protein_id="CBG86976.1"
FT                   /translation="MSMNETYQPINCDDYDNLELACQHHLLLTLELKDGEVLQAKANDL
FT                   VSRKNVEYLITDVAGETRELRLDRIASFSHPEIGTVVVSES"
FT   misc_feature    complement(233674..233898)
FT                   /gene="rof"
FT                   /locus_tag="ROD_01971"
FT                   /note="HMMPfam hit to PF07073, Modulator of Rho-dependent
FT                   transcription termination, score 2.2e-43"
FT                   /inference="protein motif:PFAM:PF07073"
FT   CDS_pept        complement(233909..234127)
FT                   /transl_table=11
FT                   /locus_tag="ROD_01982"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01982"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86977"
FT                   /db_xref="InterPro:IPR009624"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI80"
FT                   /protein_id="CBG86977.1"
FT                   /translation="MLTGGHVEKYCELIRKRYAEIASGDLGYVPDALGCVLKVLNEMAA
FT                   DSALSESVREKAAYAAANLLVSDYVNE"
FT   misc_feature    complement(233912..234109)
FT                   /locus_tag="ROD_01982"
FT                   /note="HMMPfam hit to PF06786, Protein of unknown function
FT                   UPF0253, score 1.1e-41"
FT                   /inference="protein motif:PFAM:PF06786"
FT   CDS_pept        234298..234843
FT                   /transl_table=11
FT                   /locus_tag="ROD_01981"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01981"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86978"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI81"
FT                   /protein_id="CBG86978.1"
FT                   /translation="MALKATIYKAVVNVADLDRNQFLDAPLTLARHPSETQERMMLRLL
FT                   AWIKYADERLQFTRGLSAEDEPEAWLRNDHLGIDLWIELGLPDERRIKKACTQAQEVAL
FT                   FTYNSRAAQIWWQQQQSKCAQFTNLTVWYLDDEQLAQLSEFAGRTMALQATIQDGAIWL
FT                   SDAQNNLEIHLTAWQQPG"
FT   misc_feature    234298..234840
FT                   /locus_tag="ROD_01981"
FT                   /note="HMMPfam hit to PF07152, YaeQ, score 6.2e-122"
FT                   /inference="protein motif:PFAM:PF07152"
FT   CDS_pept        234840..235259
FT                   /transl_table=11
FT                   /locus_tag="ROD_01991"
FT                   /product="putative peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01991"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86979"
FT                   /db_xref="GOA:D2TI82"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI82"
FT                   /protein_id="CBG86979.1"
FT                   /translation="MIVISRTVSIAEDELEITAIRAQGAGGQHVNKASTAIHLRFDIRA
FT                   SGLPEYYKERLLAASHHLISPDGIIIIKAQEYRSQTLNREAALARLVAVIKELTVEQKS
FT                   RRATRPTRASKERRLVSKAQKSTVKALRGKVRRVD"
FT   misc_feature    234840..235235
FT                   /locus_tag="ROD_01991"
FT                   /note="HMMPfam hit to PF00472, Class I peptide chain
FT                   release factor, score 1.4e-37"
FT                   /inference="protein motif:PFAM:PF00472"
FT   misc_feature    234900..234950
FT                   /note="PS00745 Prokaryotic-type class I peptide chain
FT                   release factors signature."
FT                   /inference="protein motif:Prosite:PS00745"
FT   CDS_pept        235293..235994
FT                   /transl_table=11
FT                   /gene="cutF"
FT                   /locus_tag="ROD_02001"
FT                   /product="copper homeostasis protein (lipoprotein nlpE)"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02001"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86980"
FT                   /db_xref="InterPro:IPR007298"
FT                   /db_xref="InterPro:IPR033450"
FT                   /db_xref="InterPro:IPR038139"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI83"
FT                   /protein_id="CBG86980.1"
FT                   /translation="MKKTLISAIAVLSLFTLFGCNNRSEVDVLQPTRAAELKPMQQSWR
FT                   GILPCADCEGIETSLFLEKDGTWVMNQRYLGAREEPSSFASYGTWARTADKLVLTDSNG
FT                   EKTYYRAKGDSLEMLDRDGNPIQSQFNYTLAPVKAILPVTPMAMRGMYFYMADAATFTD
FT                   CATGRRVSVANNAELERGYLAARGAGEKPVLLTVEGHFTLEANPDTGAPVKTLKADKEI
FT                   KFISGQDCNSK"
FT   misc_feature    235293..235955
FT                   /gene="cutF"
FT                   /locus_tag="ROD_02001"
FT                   /note="HMMPfam hit to PF04170, Copper resistance
FT                   lipoprotein NlpE, score 5e-124"
FT                   /inference="protein motif:PFAM:PF04170"
FT   sig_peptide     235293..235349
FT                   /gene="cutF"
FT                   /locus_tag="ROD_02001"
FT                   /note="Signal peptide predicted for ROD02001 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.987) with cleavage site
FT                   probability 0.616 between residues 19 and 20"
FT   misc_feature    235320..235352
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    235644..235694
FT                   /note="PS00283 Soybean trypsin inhibitor (Kunitz) protease
FT                   inhibitors family signature."
FT                   /inference="protein motif:Prosite:PS00283"
FT   CDS_pept        236570..237907
FT                   /transl_table=11
FT                   /locus_tag="ROD_02011"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02011"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86981"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI84"
FT                   /protein_id="CBG86981.1"
FT                   /translation="MNKKLIALAILFAMGSAHACENTEDCKAAVDDVYEAINTKMQPKQ
FT                   ENESAAVWGEKYANWLGRVNEVAERRLGTTFDNLGDIARWEIANSKTGSSANADSGENG
FT                   NTGATDTNTKNPTGDFIEPELETAYVTAGQAQAGDRAAIAQAQDYADSVATEVENKTKD
FT                   YAAQVATETAATAANNAIGLAAQVATETAATAENNAKGYAANVATAAESKAKQYATSVA
FT                   TDAASTAQTNAEGYAAQVATETAATAENNAKGYASQIATKAADSAKNAAETHADKAATE
FT                   AKSAAVKEAKDDARAQVTAAEKRSNAHADATAKKAEVNANDYTDQQMATAEEYATTLAH
FT                   STIRYANQSLQESKSYTDRVARGLQKQINHNGKAIKRLGASAQATANLHYNANHNGYAI
FT                   AVGEYNSETALAGGLQFNTGKSTAVTVQGSYDAESFGGSVGLHGDW"
FT   sig_peptide     236570..236626
FT                   /locus_tag="ROD_02011"
FT                   /note="Signal peptide predicted for ROD02011 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 19 and 20"
FT   CDS_pept        238563..239669
FT                   /transl_table=11
FT                   /gene="ompN"
FT                   /locus_tag="ROD_02021"
FT                   /product="outer membrane protein n, non-specific porin"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02021"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86982"
FT                   /db_xref="GOA:D2TI85"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR001897"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI85"
FT                   /protein_id="CBG86982.1"
FT                   /translation="MKKVLMMAIPALLAAGSVHAAEIYNKDGNKLDLYGKVDARHTFSD
FT                   AKSKDGDATYVRLGFKGETQINRDLTGYGQWEYNIQGNKTEDEGADTATRLAFAGLNAG
FT                   DAGTFDYGRNYGVIYDVVAITDMLPVFGGDSYSASDNFMTGRANGLATYRNSNFFGLVE
FT                   GLGFALQYQGKNGAVGENINGRGKVLAQNGEGWGSSVSYDMPYGVSAVVAYSNSHRTGK
FT                   QRTETFNDAKHAEAWATGLKYDANSVYLAANYAETRNMTAMAGSVLSDLELSAVTDKTK
FT                   NLEVVAQYQFDSGLRPSIAYLQSKAQKDGYDYTQVKYIEAGATYYFNKNMSVYGDYKFN
FT                   LLNKNNSDVKNLGLTTDNEIGIGAIYQF"
FT   sig_peptide     238563..238622
FT                   /gene="ompN"
FT                   /locus_tag="ROD_02021"
FT                   /note="Signal peptide predicted for ROD02021 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 20 and 21"
FT   misc_feature    238599..238631
FT                   /note="PS00626 Regulator of chromosome condensation (RCC1)
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00626"
FT   misc_feature    238638..239666
FT                   /gene="ompN"
FT                   /locus_tag="ROD_02021"
FT                   /note="HMMPfam hit to PF00267, Porin, Gram-negative
FT                   type,score 2.6e-166"
FT                   /inference="protein motif:PFAM:PF00267"
FT   repeat_region   239703..239712
FT                   /note="10 bp direct repeat flanking ISCro6"
FT   repeat_region   239713..241128
FT                   /note="Insertion sequence ISCro6. Flanked by 18 bp inverted
FT                   repeats which contain 3 mismatches, and 10 bp direct
FT                   repeats. 1 of 6 ISCro6 elements in CR chromosome, of which
FT                   two are intact, two have been disrupted by ISCro1
FT                   insertion, and two have frameshift mutated transposases"
FT                   /note="The transposase of this copy has been truncated by a
FT                   frameshift mutation"
FT   repeat_region   239713..239730
FT                   /note="18 bp terminal inverted repeat of ISCro6, contains 3
FT                   mismatches"
FT   CDS_pept        join(239802..239942,239944..241116)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ROD_02031"
FT                   /product="ISCro6 transposase (pseudogene)"
FT                   /note="pseudogene, truncated by frameshift mutation"
FT   misc_feature    240187..240858
FT                   /locus_tag="ROD_02031"
FT                   /note="HMMPfam hit to PF01609, Transposase, IS4-like, score
FT                   3.5e-20"
FT                   /inference="protein motif:PFAM:PF01609"
FT   repeat_region   complement(241111..241128)
FT                   /note="18 bp terminal inverted repeat of ISCro6, contains 3
FT                   mismatches"
FT   repeat_region   241129..241138
FT                   /note="10 bp direct repeat flanking ISCro6"
FT   CDS_pept        complement(241198..242916)
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="ROD_02041"
FT                   /product="prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02041"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86984"
FT                   /db_xref="GOA:D2TI86"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI86"
FT                   /protein_id="CBG86984.1"
FT                   /translation="MRTSQYLLSTLKETPADAEVISHQLMLRAGMIRKLASGLYTWLPT
FT                   GLRVLKKVENIVREEMNNAGAIEVSMPVVQPADLWQESGRWEQYGPELLRFVDRGERPF
FT                   VLGPTHEEVITDLVRNELSSYKQLPLNFFQIQTKFRDEVRPRFGVMRSREFLMKDAYSF
FT                   HTSQESLQETYDAMYAAYSKIFTRIGLEFRAVQADTGSIGGSASHEFQVLAQSGEDDII
FT                   FSDTSDYAANIELAEAVAPKAPRAAATQEMTLVDTPDAKTIAELVEQYNLPIENTVKTL
FT                   LVKAAEGSSSPLVALLVRGDHELNEVKAEKLPQVASPLTFATEAEIRAVVNAGPGSLGP
FT                   VNMPVPVIIDRTVAAMSDFAAGANVDGKHYFGINWDRDVATPIVADIRNVVAGDPSPDG
FT                   QGTLLIKRGIEVGHIFQLGTKYSEALKAAVQGEDGRNQILTMGCYGIGVTRVVAAAIEQ
FT                   NYDERGIVWPDAIAPFQVAILPMNMHKSYRVQELAEKLYAELRAQGIEVLLDDRKERPG
FT                   VMFADMELIGIPHTIVLGDRNLDNDDIEYKYRRNGEKQLIKTGDIVSFLVNANKG"
FT   misc_feature    complement(241210..241494)
FT                   /gene="proS"
FT                   /locus_tag="ROD_02041"
FT                   /note="HMMPfam hit to PF03129, Anticodon-binding, score
FT                   3.6e-26"
FT                   /inference="protein motif:PFAM:PF03129"
FT   misc_feature    complement(241756..242184)
FT                   /gene="proS"
FT                   /locus_tag="ROD_02041"
FT                   /note="HMMPfam hit to PF04073, YbaK/prolyl-tRNA synthetase
FT                   associated region, score 5.6e-07"
FT                   /inference="protein motif:PFAM:PF04073"
FT   misc_feature    complement(242260..242772)
FT                   /gene="proS"
FT                   /locus_tag="ROD_02041"
FT                   /note="HMMPfam hit to PF00587, Aminoacyl-tRNA
FT                   synthetase,class II (G, H, P and S), score 1.2e-66"
FT                   /inference="protein motif:PFAM:PF00587"
FT   misc_feature    complement(242440..242502)
FT                   /note="PS00179 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00179"
FT   CDS_pept        complement(243027..243734)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02051"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02051"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86985"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI87"
FT                   /protein_id="CBG86985.1"
FT                   /translation="MSHFQFEQIGVIRSPYKEKFAVPRQPGLVKSARGELHLLPPYNQA
FT                   DAVRGLDAFSHLWVLFIFHQTMEGGWRPTVRPPRLGGNARMGIFATRSTFRPNPVGMSL
FT                   VELNAIVCQKDKVILKLGSLDLVDGTPVIDIKPYLPFAESLPEASASYAQHAPLAEMSV
FT                   SFTDEIERQLPVLEKRYPQLKTFICEVLAQDPRPAYRKGEETGKTYAVWLHDFNVRWRV
FT                   TDAGFEVFALEPR"
FT   misc_feature    complement(243303..243683)
FT                   /locus_tag="ROD_02051"
FT                   /note="HMMPfam hit to PF01980, Protein of unknown function
FT                   UPF0066, score 7.6e-54"
FT                   /inference="protein motif:PFAM:PF01980"
FT   CDS_pept        complement(243731..244135)
FT                   /transl_table=11
FT                   /gene="rcsF"
FT                   /locus_tag="ROD_02061"
FT                   /product="RcsF, phosphorelay glucose and zinc sensor"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02061"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86986"
FT                   /db_xref="GOA:D2TI88"
FT                   /db_xref="InterPro:IPR030852"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI88"
FT                   /protein_id="CBG86986.1"
FT                   /translation="MRALPICLLALVLSGCSMLSRSPVETVKSTPTPPKAVPEKPKAPR
FT                   VAPVRIYTNAEALVGKPFRDLGEVSGESCQATNQDSPPNIPTARKRMQINASKMKANAV
FT                   LLHSCEVTSGTPGCYRQAVCIGSALNISAK"
FT   sig_peptide     complement(244079..244135)
FT                   /gene="rcsF"
FT                   /locus_tag="ROD_02061"
FT                   /note="Signal peptide predicted for ROD02061 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.897) with cleavage site
FT                   probability 0.413 between residues 19 and 20"
FT   misc_feature    complement(244088..244120)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(244253..245068)
FT                   /transl_table=11
FT                   /gene="metQ"
FT                   /locus_tag="ROD_02071"
FT                   /product="D-methionine ABC transporter, substrate-binding
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02071"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86987"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI89"
FT                   /protein_id="CBG86987.1"
FT                   /translation="MAFKFKTFAAVGALIGSLALVGCGQDEKDPNHIKVGVIVGSEQQV
FT                   AEVAQKVAKEKYGLDVELVTFNDYVLPNEALSKGDIDANAFQHKPYLDQQIKDRGYKLV
FT                   AAGNTFVYPIAGYSKKIKSLDELQPGAQVAVPNDPTNLGRSLLLLQKVGLIKLKDGVGL
FT                   LPTSLDIAENPKNLKIVELEAPQLPRSLDDAQIALAVINTTYASQINLTPAKDGIFVED
FT                   KDSPYVNLIVTREDNKDAENVKKFVQAYQSDEVYEAANKVFNGGAVKGW"
FT   misc_feature    complement(244256..244972)
FT                   /gene="metQ"
FT                   /locus_tag="ROD_02071"
FT                   /note="HMMPfam hit to PF03180, NLPA lipoprotein, score
FT                   2.4e-148"
FT                   /inference="protein motif:PFAM:PF03180"
FT   misc_feature    complement(245000..245032)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   sig_peptide     complement(245003..245068)
FT                   /gene="metQ"
FT                   /locus_tag="ROD_02071"
FT                   /note="Signal peptide predicted for ROD02071 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.995) with cleavage site
FT                   probability 0.719 between residues 22 and 23"
FT   CDS_pept        complement(245110..245763)
FT                   /transl_table=11
FT                   /gene="metI"
FT                   /locus_tag="ROD_02081"
FT                   /product="D-methionine ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02081"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86988"
FT                   /db_xref="GOA:D2TI90"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI90"
FT                   /protein_id="CBG86988.1"
FT                   /translation="MSEPMMWLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQ
FT                   IIENAKLYRILSAVVNIFRSIPFIILLVWMIPFTRVIVGTSIGLQAAIVPLTVGAAPFI
FT                   ARMVENALLEIPVGLIEASRAMGATPLQIVRKVLLPEALPGLVNAATITLITLVGYSAM
FT                   GGAVGAGGLGQIGYQYGYIGYNATVMNTVLVLLVVLVYLIQFTGDRIVRSVTHK"
FT   misc_feature    complement(245116..245727)
FT                   /gene="metI"
FT                   /locus_tag="ROD_02081"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component, score 3.5e-22"
FT                   /inference="protein motif:PFAM:PF00528"
FT   misc_feature    complement(join(245155..245223,245266..245334,
FT                   245452..245520,245533..245601,245638..245706))
FT                   /gene="metI"
FT                   /locus_tag="ROD_02081"
FT                   /note="5 probable transmembrane helices predicted for
FT                   ROD02081 by TMHMM2.0 at aa 20-42, 55-77, 82-104, 144-166
FT                   and 181-203"
FT   misc_feature    complement(245344..245430)
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS_pept        complement(245756..246787)
FT                   /transl_table=11
FT                   /gene="metN"
FT                   /locus_tag="ROD_02091"
FT                   /product="D-methionine ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02091"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86989"
FT                   /db_xref="GOA:D2TI91"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012692"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI91"
FT                   /protein_id="CBG86989.1"
FT                   /translation="MIKLSNITKVFQQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKS
FT                   TLIRCVNLLERPTEGSVLVDGQELTTLSEAELTKARRQIGMIFQHFNLLSSRTVFGNVA
FT                   LPLELDNTPKEESKRRVTELLDLVGLGDKHDSYPANLSGGQKQRVAIARALASQPKVLL
FT                   CDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQ
FT                   DTVSEVFSHPKTPLAQKFIQSTLHLDIPEDYLQRLKVEPAAGSVPMLRMEFTGQSVDAP
FT                   LLSETARRFNVNNNIISAQMDYAGGVKFGIMLTEMHGTQQETQAAIAWLQEHHVKVEVL
FT                   GYV"
FT   misc_feature    complement(246137..246697)
FT                   /gene="metN"
FT                   /locus_tag="ROD_02091"
FT                   /note="HMMPfam hit to PF00005, ABC transporter
FT                   related,score 8.5e-76"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    complement(246323..246367)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(246653..246676)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        246979..247545
FT                   /transl_table=11
FT                   /gene="gmhB"
FT                   /locus_tag="ROD_02101"
FT                   /product="D,D-heptose 1,7-bisphosphate phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02101"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86990"
FT                   /db_xref="GOA:D2TI92"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI92"
FT                   /protein_id="CBG86990.1"
FT                   /translation="MAKSVPAIFLDRDGTINVDHGYVHEIDDFEFIEGVIDAMRELKTM
FT                   GFALVVVTNQSGIARGKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSVEEYR
FT                   QVCDCRKPHPGMLISARDFLHIDMAASYMVGDKLEDMQAAEAAGVGTKVLVRTGKPVTA
FT                   EAENAADWVISSLAELPAAIKKQQK"
FT   misc_feature    247075..247449
FT                   /gene="gmhB"
FT                   /locus_tag="ROD_02101"
FT                   /note="HMMPfam hit to PF00702, Haloacid dehalogenase-like
FT                   hydrolase, score 5.8e-08"
FT                   /inference="protein motif:PFAM:PF00702"
FT   rRNA            247916..249457
FT                   /note="16S rRNA"
FT   tRNA            249629..249701
FT                   /locus_tag="ROD_t01"
FT                   /product="transfer RNA-Glu"
FT                   /anticodon="(pos:249663..249665,aa:Glu)"
FT                   /note="tRNA Glu anticodon TTC, Cove score 56.72"
FT   rRNA            250022..253008
FT                   /note="23S rRNA"
FT   rRNA            253208..253323
FT                   /note="5S rRNA"
FT   tRNA            253378..253451
FT                   /locus_tag="ROD_t02"
FT                   /product="transfer RNA-Asp"
FT                   /anticodon="(pos:253412..253414,aa:Asp)"
FT                   /note="tRNA Asp anticodon GTC, Cove score 80.06"
FT   CDS_pept        complement(254140..257151)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02111"
FT                   /product="putative adhesin autotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02111"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86991"
FT                   /db_xref="GOA:D2TI93"
FT                   /db_xref="InterPro:IPR004899"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI93"
FT                   /protein_id="CBG86991.1"
FT                   /translation="MNASFKPTKIALFISALISSAAFAATPASVIIDSSTAAAGRIVNL
FT                   PSGSNVSFINVSVDDALVTMGDNTTITSGGDYPDDSRTFNPGYYIKATAGTVDFGKNFS
FT                   LNYTFDYNVNSNYRGAAAYIYGTGVLKAENLTINAANSVVEDYDLVNSILMMDDARVDL
FT                   KGTTNLFTGNIETNEDSILNVENINLTYIDSDPLSNRGHHAALSLEGKESNFTGTVNIK
FT                   SVLASDGSLQGIDITGNTATFSGATNLDLDTAQGSISGVEMIDTIYHLSGNFSNSTPEY
FT                   LTNIVKFNELNIKGINHGPDGQAAYVRGFTSHSQKGTTDVAINKLTIDIASNYSATGIN
FT                   LGDSDAMGSAKYRINDANIKVSGGEQATLTGYLSSRGEWADTDTIIGNINIQSLGGKDT
FT                   ILLRQNGTNDIFTGDVTLGSQTSYDSVNGTLYSIFGRSYDSTGSIGTTNIINNNKLVAW
FT                   GKMYSGEGHTINIISGDNSYIHGDTEITDSGAINMRLKGGNSRWDMTGNSTITNLMLEN
FT                   STLNFMPPAAQTRSLTRAASTFKTLTINGDYIGNNGNVVMNTQLGDDASPTDRLVVSGN
FT                   TSGTTNVKVVNAGGAGALTTNGIELITVAGTSGGEFKQDGRIVAGAYDYTLARGEGANE
FT                   KNWYLTSGLSTEPQPDPASPVDPTEPVIPQAPAKPEPQTPREHAVRPEAGLYGMNLQAA
FT                   NTMFNTRLHDRLGETHYVDALTGEQAVTSLWLRNVGGHTRQHDGSGQLDMQANRYVMQL
FT                   GGDIAQWSSDNTDRFHLGLMAGYANQKARAENQRNGNRADSRISGYSVGLYGTWLQDNA
FT                   THEGAYVDTWAQYSWFDNSVNGRGIDEATKEYDSSGFTVSVESGYTWKLADISERNALY
FT                   IQPKAQVTWMGVKADEHKEANGTRVEGKGDGNIQTRLGVRLYGQGHNPMDDKTGRTFQP
FT                   FVEANWIHNTRDFGVSLNDQNVELTGTRNIGELKAGVEGQLTKNVALWGNIAQQVGDKG
FT                   YSDTSAMVGIKASF"
FT   misc_feature    complement(254170..255000)
FT                   /locus_tag="ROD_02111"
FT                   /note="HMMPfam hit to PF03797, Autotransporter
FT                   beta-domain,score 2.3e-42"
FT                   /inference="protein motif:PFAM:PF03797"
FT   misc_feature    complement(255226..255624)
FT                   /locus_tag="ROD_02111"
FT                   /note="HMMPfam hit to PF03212, Pertactin, score 2.3e-07"
FT                   /inference="protein motif:PFAM:PF03212"
FT   sig_peptide     complement(257080..257151)
FT                   /locus_tag="ROD_02111"
FT                   /note="Signal peptide predicted for ROD02111 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 24 and 25"
FT   CDS_pept        258055..258858
FT                   /transl_table=11
FT                   /gene="dkgA"
FT                   /locus_tag="ROD_02121"
FT                   /product="2,5-diketo-D-gluconic acid reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02121"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86992"
FT                   /db_xref="GOA:D2TI94"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI94"
FT                   /protein_id="CBG86992.1"
FT                   /translation="MTVPAFGLGTFRLKDDVVIASVKTALELGYRAVDTAQIYDNEAAV
FT                   GQAIAESSVPRGDLYITTKIWTENLSKEKLIPSLKESLNKLRTDYVDLTLIHWPSPGDA
FT                   VSLEETMQALLEAKAQGLTREIGISNFTIPLMEKAIAAAGVENIATNQIELSPYLQNGK
FT                   VVEWAKQHGIHITSYMTLAYGKALKDDVIARIAAKHNATPAQVILAWAMGEGYSVIPSS
FT                   TKRENLASNLLAQELQLDAEDKEAIAALDCNDRLVSPEGLAPQWD"
FT   misc_feature    258055..258810
FT                   /gene="dkgA"
FT                   /locus_tag="ROD_02121"
FT                   /note="HMMPfam hit to PF00248, Aldo/keto reductase, score
FT                   4.8e-88"
FT                   /inference="protein motif:PFAM:PF00248"
FT   misc_feature    258139..258192
FT                   /note="PS00798 Aldo/keto reductase family signature 1."
FT                   /inference="protein motif:Prosite:PS00798"
FT   misc_feature    258394..258447
FT                   /note="PS00062 Aldo/keto reductase family signature 2."
FT                   /inference="protein motif:Prosite:PS00062"
FT   CDS_pept        complement(258863..259780)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02131"
FT                   /product="LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02131"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86993"
FT                   /db_xref="GOA:D2TI95"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI95"
FT                   /protein_id="CBG86993.1"
FT                   /translation="MKATSEELAIFVSVVESGSFSRAAEQLGQANSAVSRAVKKLEMKL
FT                   GVSLLNRTTRQLSLTEEGERYFRRVQSVLQEMAAAETEIMETRTTPRGLLRIDAATPVV
FT                   LHFLMPLIKPFRERYPDITLSLVSSETFINLIERKVDVAIRAGKLTDSSLRARPLFTSY
FT                   RKIIASPEYIARFGRPETVEDLKQHLCLGFSEPVSLNTWPVACCDGQLHEIECGISSNS
FT                   GETLKQLCLTGNGIACLSDYMIDREIARGELVELMADKRLPVEMPFSAVYYSDRAVSTR
FT                   IRAFIDFLSEHVKTAPEGAAVKKG"
FT   misc_feature    complement(258899..259519)
FT                   /locus_tag="ROD_02131"
FT                   /note="HMMPfam hit to PF03466, LysR,
FT                   substrate-binding,score 9.9e-51"
FT                   /inference="protein motif:PFAM:PF03466"
FT   misc_feature    complement(259589..259768)
FT                   /locus_tag="ROD_02131"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   protein, LysR, score 1.3e-19"
FT                   /inference="protein motif:PFAM:PF00126"
FT   misc_feature    complement(259634..259726)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    complement(259664..259729)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1503.000, SD 4.31 at aa 18-39, sequence
FT                   GSFSRAAEQLGQANSAVSRAVK"
FT   CDS_pept        260045..260845
FT                   /transl_table=11
FT                   /locus_tag="ROD_02141"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02141"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86994"
FT                   /db_xref="GOA:D2TI96"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR022958"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI96"
FT                   /protein_id="CBG86994.1"
FT                   /translation="MRKNTYAMRYVAGQPAERILPPGSFSGIGQALPAGAPLSSEDRIR
FT                   ILVWNIFKQQRAEWLSVLKNYGKDAHLVLLQEAQTTPELVQFATTNYLAADQVPAFVLP
FT                   QHPSGVMTLSAAHPVYCCPLREREPILRLAKSALVTVYPLPDTRLLMVVNIHAVNFSLG
FT                   VDVYSKQLLPIGDQIAHHSGPVIMAGDFNAWSRRRMNALYRFAREMSLRQVRFTDDQRR
FT                   RAFGRPLDFVFYRGLNVSEASVLVTRASDHNPLLVEFSPGKPDP"
FT   misc_feature    260174..260821
FT                   /locus_tag="ROD_02141"
FT                   /note="HMMPfam hit to
FT                   PF03372,Endonuclease/exonuclease/phosphatase, score
FT                   3.7e-22"
FT                   /inference="protein motif:PFAM:PF03372"
FT   CDS_pept        260921..261691
FT                   /transl_table=11
FT                   /locus_tag="ROD_02151"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02151"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86995"
FT                   /db_xref="GOA:D2TI97"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR020803"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI97"
FT                   /protein_id="CBG86995.1"
FT                   /translation="MTTHSHHDNVEKQFGSQASAYLTSAVHASGRDLTRLAERLSSSPS
FT                   ARVLDMGCGAGHASFVAAQKVNQVVAYDLSAQMLEVVAQAAQERGLTNIVTRQGYAESL
FT                   PFEAGAFDIVISRYSAHHWHDVGQALREVNRVLKPGGVLIVMDIMSPGHPVRDIWLQTV
FT                   EALRDTSHVRNYSSGEWLSLINEANLITDSVVTDRMALEFSSWVARMRTPAALVDAIRI
FT                   YQESASTEVKAYFGLQDDGSFSSDTIMVEAHKAA"
FT   misc_feature    261065..261355
FT                   /locus_tag="ROD_02151"
FT                   /note="HMMPfam hit to PF08241, Methyltransferase type
FT                   11,score 2.1e-35"
FT                   /inference="protein motif:PFAM:PF08241"
FT   CDS_pept        complement(261741..263108)
FT                   /transl_table=11
FT                   /gene="mltD"
FT                   /locus_tag="ROD_02161"
FT                   /product="membrane-bound lytic murein transglycosylase D
FT                   precursor"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02161"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86996"
FT                   /db_xref="GOA:D2TIZ4"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D2TIZ4"
FT                   /protein_id="CBG86996.1"
FT                   /translation="MKAKAILLASVLLVGCQSSQHAGNVQQHAQSLSAAGQGEAGKFTS
FT                   QARWMDDGTSLAPDQDLWAFIGDELKMGIPENDRIREQKQKYLRNKSYLHDVTLRAEPY
FT                   MYWIAGQVKKRNMPMELVLLPIVESAFDPHATSGANAAGIWQIIPSTGRNYGLKQTRSY
FT                   DARRDVVASTTAALNMMQRLNKMFDGDWLLTVAAYNSGEGRVMKAIKTNKARGKSTDFW
FT                   SLPLPRETKLYVPKMLALSDILKNSKRYGVNLPTPDESRALARVRLNSPVEMAQVADMA
FT                   GMPVSKLKTFNAGVKGSTLGLSGPQYVMVPKKHAAQLRESLASGEIAAVQSTLIADNSP
FT                   LNSRSYTVRSGDTLSGIASRLGVSTKDLQQWNKLRGSSLKVGQSLTVGAGSSAQRLANN
FT                   SDSITYRVRKGDSLSSIARRHGVNIKDVMRWNSDTANLQPGDQLTLFVKNSSAPDS"
FT   misc_feature    complement(261771..261896)
FT                   /gene="mltD"
FT                   /locus_tag="ROD_02161"
FT                   /note="HMMPfam hit to PF01476, Peptidoglycan-binding
FT                   LysM,score 2e-13"
FT                   /inference="protein motif:PFAM:PF01476"
FT   misc_feature    complement(261945..262073)
FT                   /gene="mltD"
FT                   /locus_tag="ROD_02161"
FT                   /note="HMMPfam hit to PF01476, Peptidoglycan-binding
FT                   LysM,score 2.6e-17"
FT                   /inference="protein motif:PFAM:PF01476"
FT   misc_feature    complement(261990..262055)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1013.000, SD 2.64 at aa 352-373, sequence
FT                   DTLSGIASRLGVSTKDLQQWNK"
FT   misc_feature    complement(262446..262796)
FT                   /gene="mltD"
FT                   /locus_tag="ROD_02161"
FT                   /note="HMMPfam hit to PF01464, Lytic
FT                   transglycosylase-like,catalytic, score 1.1e-39"
FT                   /inference="protein motif:PFAM:PF01464"
FT   misc_feature    complement(262653..262739)
FT                   /note="PS00922 Prokaryotic transglycosylases signature."
FT                   /inference="protein motif:Prosite:PS00922"
FT   misc_feature    complement(262824..263108)
FT                   /gene="mltD"
FT                   /locus_tag="ROD_02161"
FT                   /note="HMMPfam hit to PF06474, MLTD-N, score 4.3e-39"
FT                   /inference="protein motif:PFAM:PF06474"
FT   sig_peptide     complement(263043..263108)
FT                   /gene="mltD"
FT                   /locus_tag="ROD_02161"
FT                   /note="Signal peptide predicted for ROD02161 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.988 between residues 22 and 23"
FT   misc_feature    complement(263061..263093)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(263180..263935)
FT                   /transl_table=11
FT                   /gene="gloB"
FT                   /locus_tag="ROD_02171"
FT                   /product="probable hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02171"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86997"
FT                   /db_xref="GOA:D2TIZ5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D2TIZ5"
FT                   /protein_id="CBG86997.1"
FT                   /translation="MNLNSIPAFQDNYIWVLSDNQSRCLIVDPGDAAPVLQAIAENQWQ
FT                   PEAILLTHHHHDHVGGVKALVQKFPHLVVYGPAETQDKGATRIVNDGDSILILGHEFRI
FT                   FATPGHTSGHICYFSHPYLFCGDTLFSGGCGRLFEGTASQMYQSLKKIAALPDDTLICC
FT                   AHEYTLANMKFALSILPHDSFINDYYLKVNELRAKKQMTLPVILKNERQNNIFLRTEDA
FT                   DLIKEINKETILQQPEQRFAWLRSKKDSF"
FT   misc_feature    complement(263441..263905)
FT                   /gene="gloB"
FT                   /locus_tag="ROD_02171"
FT                   /note="HMMPfam hit to PF00753, Beta-lactamase-like, score
FT                   1.2e-37"
FT                   /inference="protein motif:PFAM:PF00753"
FT   CDS_pept        263969..264703
FT                   /transl_table=11
FT                   /locus_tag="ROD_02181"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02181"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86998"
FT                   /db_xref="GOA:D2TIZ6"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2TIZ6"
FT                   /protein_id="CBG86998.1"
FT                   /translation="MKPARNPKTVVAPERWGDMPWGEYYRQALEQQLNPWFAKMYGFHL
FT                   LKVGNLSAEINSEACAVSHQVSVSIGGSPVQVQADPLFLPFAPKSVDVCLLAHALPWCT
FT                   DPHRLLREADRVLIDDGWLVLSGFNPVSLMGLRKLVPVLRKTPPYNSRMFTLMRQLDWL
FT                   SLLNFEVLHYSRFHVLPWKKNGGKMLSAHLPALGCMQLIVARKRTIPLTLNPMKQSKAK
FT                   ARIPQAVGATRQYRKPDDQAST"
FT   misc_feature    264065..264343
FT                   /locus_tag="ROD_02181"
FT                   /note="HMMPfam hit to PF08241, Methyltransferase type
FT                   11,score 4e-06"
FT                   /inference="protein motif:PFAM:PF08241"
FT   CDS_pept        complement(264688..265155)
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="ROD_02191"
FT                   /product="ribonuclease HI"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02191"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86999"
FT                   /db_xref="GOA:D2TIZ7"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D2TIZ7"
FT                   /protein_id="CBG86999.1"
FT                   /translation="MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSEGYTLTTNN
FT                   RMELMATIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTAEKKPVKNVDLW
FT                   KRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTQEDIGYQVEA"
FT   misc_feature    complement(264730..265152)
FT                   /gene="rnhA"
FT                   /locus_tag="ROD_02191"
FT                   /note="HMMPfam hit to PF00075, Ribonuclease H, score
FT                   1.2e-70"
FT                   /inference="protein motif:PFAM:PF00075"
FT   CDS_pept        265219..265950
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="ROD_02201"
FT                   /product="DNA polymerase III epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02201"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87000"
FT                   /db_xref="GOA:D2TIZ8"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D2TIZ8"
FT                   /protein_id="CBG87000.1"
FT                   /translation="MSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTG
FT                   NNFHIYLKPDRLVDPEAFGVHGIADEFLLDKPTFADVADEFLDYIRGAELVIHNASFDI
FT                   GFMDYEFSKLNRDIPKTSSFCKVTDSLALARKMFPGKRNSLDALCSRYEIDNSKRTLHG
FT                   ALLDAQILADVYLAMTGGQTSMTFAMEGETQQQQGEETIQRLVRQARKLRVVFASDEEV
FT                   AAHEARLDLVEKKGGSCLWRA"
FT   misc_feature    265240..265743
FT                   /gene="dnaQ"
FT                   /locus_tag="ROD_02201"
FT                   /note="HMMPfam hit to PF00929, Exonuclease, RNase T and DNA
FT                   polymerase III, score 1.5e-54"
FT                   /inference="protein motif:PFAM:PF00929"
FT   tRNA            266085..266158
FT                   /locus_tag="ROD_t03"
FT                   /product="transfer RNA-Asp"
FT                   /anticodon="(pos:266119..266121,aa:Asp)"
FT                   /note="tRNA Asp anticodon GTC, Cove score 80.06"
FT   CDS_pept        complement(267608..268378)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02211"
FT                   /product="putative carbon-nitrogen hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02211"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87001"
FT                   /db_xref="GOA:D2TIZ9"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D2TIZ9"
FT                   /protein_id="CBG87001.1"
FT                   /translation="MPGLKITLLQQPLAWLDGPANLRHFDRQLELITGRDLIVLPEMFT
FT                   TGFAMEAAQNSLSQQALSGWMREKAQQCNAMIAGSAALQTSSGAVNRFLLVEPQGEIHF
FT                   YDKRHLFRMADEHRHYLPGNRRVVVEWRGWRILPQVCYDLRFPVWSRNLNDYDLALYVA
FT                   NWPAPRSLHWQTLLSARAIENQAYVAGCNRVGTDGNGHHYRGDSRVINPQGEVIATADA
FT                   HQATRIDAELSLSALKEYRENFPAWQDADGFTLR"
FT   misc_feature    complement(267881..268366)
FT                   /locus_tag="ROD_02211"
FT                   /note="HMMPfam hit to PF00795, Nitrilase/cyanide hydratase
FT                   and apolipoprotein N-acyltransferase, score 2.3e-07"
FT                   /inference="protein motif:PFAM:PF00795"
FT   CDS_pept        complement(268487..270931)
FT                   /transl_table=11
FT                   /gene="fadE"
FT                   /locus_tag="ROD_02221"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02221"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87002"
FT                   /db_xref="GOA:D2TJ00"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR015396"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ00"
FT                   /protein_id="CBG87002.1"
FT                   /translation="MMILSILATIVLLGALFYHRVSLLLSSLILLAWTAALGAAGVWNI
FT                   WLLVPLAIILLPFNLTPMRKSMISVPVFRGFRKVMPPMSRTEKEAIDAGTTWWEGDLFQ
FT                   GKPDWKKLHNYPQPRLTAEEQAFLDGPVEEACRMANDFQITHELADLPPELWAYLKEHR
FT                   FFAMIIKKEYGGLEFSAYAQSRVLQKLSGVSGILAITVGVPNSLGPGELLQHYGTQEQK
FT                   DHYLPRLARGQEIPCFALTSPEAGSDAGAIPDTGIVCMGEWQGQQVLGMRLTWNKRYIT
FT                   LAPIATVLGLAFKLSDPEKLLGGEEELGITCALIPTSTPGVEIGRRHFPLNVPFQNGPT
FT                   RGKDVFVPIDYIIGGPKMAGQGWRMLVECLSVGRGITLPSNSTGGLKSVAMATGAYAHI
FT                   RRQFKISIGKMEGIEEPLARIAGNAYVMDAAATLITYGIMLGEKPAVLSAIVKYHCTHR
FT                   GQRSIIDAMDITGGKGIMLGESNFLARAYQGAPIAITVEGANILTRSMMIFGQGAIRCH
FT                   PYVLEEMAAAQNNDVNAFDKLLFKHIGHVGSNTVRSFWLGLTRGLTSASPTGDATKRYY
FT                   QHLNRLSANLALLSDVSMAVLGGSLKRRERISARLGDVLSQLYLASAVLKRYDDEGRHE
FT                   ADLPLVHWGVQDALYQAEQAMDDLLQNFPNRLVAGLLNAALFPTGRHYLAPSDKLDHKV
FT                   AKILQVPSATRDRIGRGQYLKPSEHNPPGLLEEALRDVMAAEPVHQRICKEIGKNLPFT
FT                   RLDELAQNALAKGLIDKEEAAILVKAEESRLRSINVDDFDADALATQPVKLPEKVRKVE
FT                   AA"
FT   misc_feature    complement(268556..269392)
FT                   /gene="fadE"
FT                   /locus_tag="ROD_02221"
FT                   /note="HMMPfam hit to PF09317, Protein of unknown function
FT                   DUF1974, score 4.1e-185"
FT                   /inference="protein motif:PFAM:PF09317"
FT   misc_feature    complement(269432..269854)
FT                   /gene="fadE"
FT                   /locus_tag="ROD_02221"
FT                   /note="HMMPfam hit to PF00441, Acyl-CoA
FT                   oxidase/dehydrogenase, type 1, score 1.3e-09"
FT                   /inference="protein motif:PFAM:PF00441"
FT   misc_feature    complement(270233..270478)
FT                   /gene="fadE"
FT                   /locus_tag="ROD_02221"
FT                   /note="HMMPfam hit to PF02771, Acyl-CoA
FT                   dehydrogenase,N-terminal, score 7.5e-06"
FT                   /inference="protein motif:PFAM:PF02771"
FT   misc_feature    complement(join(270749..270817,270836..270904))
FT                   /gene="fadE"
FT                   /locus_tag="ROD_02221"
FT                   /note="2 probable transmembrane helices predicted for
FT                   ROD02221 by TMHMM2.0 at aa 10-32 and 39-61"
FT   sig_peptide     complement(270815..270931)
FT                   /gene="fadE"
FT                   /locus_tag="ROD_02221"
FT                   /note="Signal peptide predicted for ROD02221 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.988) with cleavage site
FT                   probability 0.510 between residues 39 and 40"
FT   CDS_pept        271170..271748
FT                   /transl_table=11
FT                   /gene="gmhA"
FT                   /locus_tag="ROD_02231"
FT                   /product="phosphoheptose isomerase"
FT                   /EC_number="5.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02231"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87003"
FT                   /db_xref="GOA:D2TJ01"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ01"
FT                   /protein_id="CBG87003.1"
FT                   /translation="MYQDLIRNELNEAAETLANFLKDDANIHAIQRAAVLLADSFKAGG
FT                   KVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPAIAISDVSHLSCVSNDFGYDYVFSRY
FT                   VEAVGREGDVLLGISTSGNSGNVIKAIAAAREKGMKVIALTGKDGGKMAGTADIEIRVP
FT                   HFGYADRIQEIHIKVIHILIQLIEKEMVK"
FT   misc_feature    271497..271661
FT                   /gene="gmhA"
FT                   /locus_tag="ROD_02231"
FT                   /note="HMMPfam hit to PF01380, Sugar isomerase (SIS), score
FT                   1.8e-05"
FT                   /inference="protein motif:PFAM:PF01380"
FT   CDS_pept        271848..272615
FT                   /transl_table=11
FT                   /locus_tag="ROD_02241"
FT                   /product="putative amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02241"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87004"
FT                   /db_xref="GOA:D2TJ02"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ02"
FT                   /protein_id="CBG87004.1"
FT                   /translation="MCELLGMSANVPTDICFSFTGLVQRGGGTGPHKDGWGITFYEGKG
FT                   CRTFKDPLPGFNSPIARLVQEYPIKSCSVVAHIRQANRGKVALENTHPFTRELWGRNWT
FT                   YAHNGQLSGYKSLETGNFRPVGETDSEKAFCWLLHKLTQRYPRTPGNMTAVFRYIAALA
FT                   DELREKGVFNMLLSDGRYVMAYCSTHLHWITRRAPFGVATLLDQDVEIDFSSQTTPNDV
FT                   VTVLATQPLTGNETWQKIMPGEWALFCLGERIV"
FT   misc_feature    271851..272498
FT                   /locus_tag="ROD_02241"
FT                   /note="HMMPfam hit to PF00310, Glutamine
FT                   amidotransferase,class-II, score 3.4e-37"
FT                   /inference="protein motif:PFAM:PF00310"
FT   CDS_pept        complement(272586..273326)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02251"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02251"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87005"
FT                   /db_xref="GOA:D2TJ03"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ03"
FT                   /protein_id="CBG87005.1"
FT                   /translation="MRKIALFIAMLLIPCVSFAGLLGSSSPTTPISKEYKQQLMGSPVY
FT                   IQIFKEERTLDLYVKMGEQYQLLDSYKICNYSGGLGPKQRQGDFKSPEGFYSVQRNQLK
FT                   PDSRFYKAINIGFPNAYDRAHGYEGKYLMIHGACVSVGCYAMTDSGIDEIFQFVTGALV
FT                   FGQPSVQVSIYPFRMTDANMQRHKYSYYKDFWTQLKPGYDYFEQTRKPPTVSVVDGRYV
FT                   VSKPLSHEVVQPQLASNYTLPETK"
FT   misc_feature    complement(272640..273215)
FT                   /locus_tag="ROD_02251"
FT                   /note="HMMPfam hit to PF06104, Protein of unknown function
FT                   DUF949, bacterial, score 2.1e-149"
FT                   /inference="protein motif:PFAM:PF06104"
FT   misc_feature    complement(272898..272930)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(273249..273317)
FT                   /locus_tag="ROD_02251"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD02251 by TMHMM2.0 at aa 4-26"
FT   sig_peptide     complement(273270..273326)
FT                   /locus_tag="ROD_02251"
FT                   /note="Signal peptide predicted for ROD02251 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.898 between residues 19 and 20"
FT   CDS_pept        273662..274426
FT                   /transl_table=11
FT                   /gene="yafL"
FT                   /locus_tag="ROD_02261"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02261"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87006"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ04"
FT                   /protein_id="CBG87006.1"
FT                   /translation="MKFSSFAPRLMLPGLFSLCVVFSPDCAAVIKHPASHLNQSYAAKL
FT                   RQRNRERLLGKYHALMQKKAHYIVEGDAASKRALRQHNRQLIKQHPEWFPGPLKASDSR
FT                   WRALAENSHFLSSDHLHNMTEVAIHRLEQQLGKPYLWGGASPEQGFDCSGLVFYAYNKI
FT                   LAAKLPRTANEMYHYRRATIVADRDLRRGDLLFFHVHSREIADHMGVYLGNGEFIESPR
FT                   TGETIRVSHLADPFWQAHYLGARRILTEETII"
FT   sig_peptide     273662..273742
FT                   /gene="yafL"
FT                   /locus_tag="ROD_02261"
FT                   /note="Signal peptide predicted for ROD02261 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.984) with cleavage site
FT                   probability 0.620 between residues 27 and 28"
FT   misc_feature    274067..274399
FT                   /gene="yafL"
FT                   /locus_tag="ROD_02261"
FT                   /note="HMMPfam hit to PF00877, NLP/P60, score 3.9e-50"
FT                   /inference="protein motif:PFAM:PF00877"
FT   CDS_pept        complement(274826..276919)
FT                   /transl_table=11
FT                   /gene="lfhA"
FT                   /locus_tag="ROD_02271"
FT                   /product="lateral flagellar export/assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02271"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87007"
FT                   /db_xref="GOA:D2TJ05"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ05"
FT                   /protein_id="CBG87007.1"
FT                   /translation="MPKTIKQLMALLRNGNIGVPLVILSILAMVILPLPPALLDILFTF
FT                   NIVLAVMVLLVSVSARRPLEFSLFPTILLITTLMRLTLNVASTRVVLLHGHMGAGAAGK
FT                   VIESFGQVVIGGNFVVGFVVFIILMIINFIVVTKGAERISEVSARFTLDAMPGKQMAID
FT                   ADLNAGLINQQQAQARRKDVASEADFYGAMDGASKFVRGDAIAGMMILAINLIGGVCIG
FT                   IFKYDLSAEAAFQQYVLMTIGDGLVAQIPSLLLSTAAAIIVTRVSDNGDISSDVRSQLL
FT                   ASPSVLYTATTIMLVLAVVPGMPHFPFLVFSGLLGFTAWRMSKRPAAAEAEEKSLETLS
FT                   KTIAETTEQQVSWETIPLIEPISLSLGYKLVALVDKAKGNPLTQRIRGVRQVISDTNGV
FT                   LLPEIRIRENFRLKPSQYAIFINGIKADEADIPSDKLMALPSSETYGEIDGILGHDPAY
FT                   GMPVTWIQPAQKAKALNMGYQVIDSASVIATHVNKVVRSYIPELFNYDDITQLHNRLSS
FT                   MAPRLAEDLSAALNYSQMLKVYRALLTEGVSLRDIVTIATVLVASSAVTKDPILLAADV
FT                   RLALRRSITHPFVRKGELAVYTLNNELENLLSSVVNQAQQAGKVMLDSVPVDPNMLNQF
FT                   QNNMPQVKEQMKAAGKEPVLLVAPQLRPLLARYARLFAPGLHVLSYNEVADDLQLKIMG
FT                   SLS"
FT   misc_feature    complement(274850..276847)
FT                   /gene="lfhA"
FT                   /locus_tag="ROD_02271"
FT                   /note="HMMPfam hit to PF00771, Bacterial type III secretion
FT                   FHIPEP, score 1.2e-268"
FT                   /inference="protein motif:PFAM:PF00771"
FT   misc_feature    complement(join(276002..276070,276131..276199,
FT                   276242..276310,276512..276580,276656..276724,
FT                   276743..276811,276824..276883))
FT                   /gene="lfhA"
FT                   /locus_tag="ROD_02271"
FT                   /note="7 probable transmembrane helices predicted for
FT                   ROD02271 by TMHMM2.0 at aa 13-32, 37-59, 66-88,
FT                   114-136,204-226, 241-263 and 284-306"
FT   misc_feature    complement(276425..276496)
FT                   /note="PS00994 Bacterial export FHIPEP family signature."
FT                   /inference="protein motif:Prosite:PS00994"
FT   CDS_pept        complement(276903..278042)
FT                   /transl_table=11
FT                   /gene="lfhB"
FT                   /locus_tag="ROD_02281"
FT                   /product="lateral flagellar export/assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02281"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87008"
FT                   /db_xref="GOA:D2TJ06"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ06"
FT                   /protein_id="CBG87008.1"
FT                   /translation="MADSSSEEKTEKPSAQKLRKAREEGQIPRSKDMGLAASLFAAFMV
FT                   ISSSFPWYEDFVRESFVSVHQYAQEINNPAIVGQFLQHHLLIMAKFILTLLPMPAAALA
FT                   ASLIPGGWLFLPKKMLPDFSKVNPLKGIGRLFSAEHLVETGKMMVKAVVILVMLWLSLR
FT                   NNFASFLGLQALWFKQAVSDGLALYSSVMRNFVILFVFFAVIDVPLAKKMFTKGLKMTK
FT                   QEVKEEYKNQEGKPEVKARVRRLQRQLAMGQIRKVVPKADVVITNPTHYAVALQYDQSR
FT                   AAAPFVVAKGTDEIALYIRQVAAESQVEVVEFPKLARSVYYTTQINQQIPFQLYRAIAH
FT                   VLTYVLQMKHWRDGTQPRPLLNRHISIPKEVLKLDAENN"
FT   misc_feature    complement(277005..278030)
FT                   /gene="lfhB"
FT                   /locus_tag="ROD_02281"
FT                   /note="HMMPfam hit to PF01312, Type III secretion
FT                   exporter,score 4.1e-105"
FT                   /inference="protein motif:PFAM:PF01312"
FT   misc_feature    complement(join(277413..277472,277515..277583,
FT                   277698..277766,277884..277943))
FT                   /gene="lfhB"
FT                   /locus_tag="ROD_02281"
FT                   /note="4 probable transmembrane helices predicted for
FT                   ROD02281 by TMHMM2.0 at aa 34-53, 93-115, 154-176 and
FT                   191-210"
FT   CDS_pept        complement(278032..278814)
FT                   /transl_table=11
FT                   /gene="lfiR"
FT                   /locus_tag="ROD_02291"
FT                   /product="flagellar biosynthetic protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02291"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87009"
FT                   /db_xref="GOA:D2TJ07"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ07"
FT                   /protein_id="CBG87009.1"
FT                   /translation="MRESDITQLANLVLGLWFPFVRIMAFIRYVPVFDNAALTIRVRII
FT                   LSLALAIVITPMIPHPVPDSLLSMNSLILTAEQILWGMLFGLMFQFLFLALQLAGQILS
FT                   FNMGMSMAVMNDPGSGASTTVLAELINVYAVILFFAMDGHLLLVSVLYKGFTYWPIGNA
FT                   LHPQSLRTLALAFSWVLGSAMLLALPTTFIMLIVQGCFGLLNRVAPPLNLYSLGFPINM
FT                   LAGLICFATLLYNLPDHYLHLANFILKQLDALKGHYGG"
FT   misc_feature    complement(278059..278796)
FT                   /gene="lfiR"
FT                   /locus_tag="ROD_02291"
FT                   /note="HMMPfam hit to PF01311, Type III secretion system
FT                   inner membrane R protein, score 3.9e-31"
FT                   /inference="protein motif:PFAM:PF01311"
FT   misc_feature    complement(join(278116..278184,278203..278271,
FT                   278362..278430,278515..278583,278626..278685,
FT                   278719..278787))
FT                   /gene="lfiR"
FT                   /locus_tag="ROD_02291"
FT                   /note="6 probable transmembrane helices predicted for
FT                   ROD02291 by TMHMM2.0 at aa 10-32, 44-63, 78-100,
FT                   129-151,182-204 and 211-233"
FT   misc_feature    complement(278215..278247)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(278816..279088)
FT                   /transl_table=11
FT                   /gene="lfiQ"
FT                   /locus_tag="ROD_02301"
FT                   /product="lateral flagellar export/assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02301"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87010"
FT                   /db_xref="GOA:D2TJ08"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ08"
FT                   /protein_id="CBG87010.1"
FT                   /translation="MLTIDVAADIVASGIKVVIILVSLLVVPSLLVGLLVSIFQAVTQI
FT                   NEQTLSFLPRLIVTLVVLGVCGKWMIVQLDDLCIHLFTQAATLVQ"
FT   misc_feature    complement(278849..279076)
FT                   /gene="lfiQ"
FT                   /locus_tag="ROD_02301"
FT                   /note="HMMPfam hit to PF01313, Bacterial export protein
FT                   FliQ, family 3, score 6e-13"
FT                   /inference="protein motif:PFAM:PF01313"
FT   misc_feature    complement(join(278867..278935,278972..279040))
FT                   /gene="lfiQ"
FT                   /locus_tag="ROD_02301"
FT                   /note="2 probable transmembrane helices predicted for
FT                   ROD02301 by TMHMM2.0 at aa 17-39 and 52-74"
FT   CDS_pept        complement(279100..279858)
FT                   /transl_table=11
FT                   /gene="lfiP"
FT                   /locus_tag="ROD_02311"
FT                   /product="lateral flagellar export/assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02311"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87011"
FT                   /db_xref="GOA:D2TJ09"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ09"
FT                   /protein_id="CBG87011.1"
FT                   /translation="MKRSATLTLALGIALFALSPFACAQGGEIPLLNVVTHGASQEYSV
FT                   KIQVLILMTLVGLLPTLVLMMTCFTRFIIVLSLLRQALGLQQTPPNRILIGIALCLTML
FT                   VMRPIWLNIYDRAVVPFENDQMTLSDALSTAATPLKRFMLAQTNKKAMAQIMTIADVKG
FT                   DAADQDLTIVVPAYVLSELKTAFQIGFMIYIPFLVIDLIVASVLMAMGMMMLSPLIVSL
FT                   PFKLMLFVLIDGWSLTVGTLTSSIRGLGLG"
FT   misc_feature    complement(279130..279705)
FT                   /gene="lfiP"
FT                   /locus_tag="ROD_02311"
FT                   /note="HMMPfam hit to PF00813, Type III secretion system
FT                   inner membrane P protein, score 3.9e-95"
FT                   /inference="protein motif:PFAM:PF00813"
FT   misc_feature    complement(join(279151..279219,279238..279306,
FT                   279526..279585,279622..279714,279772..279840))
FT                   /gene="lfiP"
FT                   /locus_tag="ROD_02311"
FT                   /note="5 probable transmembrane helices predicted for
FT                   ROD02311 by TMHMM2.0 at aa 7-29, 49-79, 92-111, 185-207 and
FT                   214-236"
FT   misc_feature    complement(279154..279192)
FT                   /note="PS01061 Flagella transport protein fliP family
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS01061"
FT   misc_feature    complement(279289..279336)
FT                   /note="PS01060 Flagella transport protein fliP family
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS01060"
FT   misc_feature    complement(279589..279717)
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00041"
FT   sig_peptide     complement(279787..279858)
FT                   /gene="lfiP"
FT                   /locus_tag="ROD_02311"
FT                   /note="Signal peptide predicted for ROD02311 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.869 between residues 24 and 25"
FT   CDS_pept        complement(279855..280226)
FT                   /transl_table=11
FT                   /gene="lfiN"
FT                   /locus_tag="ROD_02321"
FT                   /product="lateral flagellar C-ring switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02321"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87012"
FT                   /db_xref="GOA:D2TJ10"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ10"
FT                   /protein_id="CBG87012.1"
FT                   /translation="MSKQEDILEQGFELTTEAPAAPANSATEALVTRLEDRFSESMSLL
FT                   KRIPVTLTLEVSSVEIMLADLLNIDDDTVIELDKLAGEPLDIKVNNILLGKAEVVVVNE
FT                   KYGLRVLEFNTQEINDLAP"
FT   misc_feature    complement(279876..280106)
FT                   /gene="lfiN"
FT                   /locus_tag="ROD_02321"
FT                   /note="HMMPfam hit to PF01052, Surface presentation of
FT                   antigens (SPOA) protein, score 1.9e-16"
FT                   /inference="protein motif:PFAM:PF01052"
FT   CDS_pept        complement(280219..281085)
FT                   /transl_table=11
FT                   /gene="lfiM"
FT                   /locus_tag="ROD_02331"
FT                   /product="lateral flagellar C-ring switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02331"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87013"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ11"
FT                   /protein_id="CBG87013.1"
FT                   /translation="MLKYSQTPGIFKLEGNRLGRPYHRLPSLFTGNFDTIESHLGNYFL
FT                   KKHRTNITLKKINCEMDVINKSAELMISQMGHLAFDIDRSLLLTLLGNFYGLDASLTEI
FT                   NSQDNLPTKTETRLKSRLAMDIGALIFNKNTSGVPLALKLDSSTVQTHWAYQLTFVLGD
FT                   NEDGGFRILLDDAHTDYILNLIRRSEHNQGKPAADKAAVAVEKKKLVKEIIHTLPLKMQ
FT                   VKIAELPLSVADLATIRPGDILPFTLPDSFPVSIGKSELFTALIVEDKDKLFLSELMSK
FT                   TSEKSYE"
FT   misc_feature    complement(280240..280458)
FT                   /gene="lfiM"
FT                   /locus_tag="ROD_02331"
FT                   /note="HMMPfam hit to PF01052, Surface presentation of
FT                   antigens (SPOA) protein, score 0.041"
FT                   /inference="protein motif:PFAM:PF01052"
FT   CDS_pept        281695..282681
FT                   /transl_table=11
FT                   /gene="lafK"
FT                   /locus_tag="ROD_02351"
FT                   /product="lateral flagellar RpoN-interacting regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02351"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87014"
FT                   /db_xref="GOA:D2TJ12"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029995"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ12"
FT                   /protein_id="CBG87014.1"
FT                   /translation="MFELIAEASSSINAFSLARRVAAFNVPVLIQGETGTGKECVAKFI
FT                   HAIAFGQNENAPYIGVNCAAIPENMLEATLFGYDKGAFTGAVATVPGKMELANNGTLLL
FT                   DEIGDMPLALQAKILRVLQEQQVERLGSNRQIKLNFRLIACTNKNLEAEVAAGRFREDL
FT                   YYRLSVVPVNIPPLRERTQDIIPLAESFIKKYSTVLVKNIRLSESTRRALLNYSWPGNV
FT                   RQLENAIQRGMILNRDGVIYPDTLGLPSSKTCDSVEAEWQTPPRLPVNGNGNLGQHGRS
FT                   AQYQYIADLMRKYHGNKNKIADLLGITPRALRYRLASMRKQGIEVYS"
FT   misc_feature    281704..282372
FT                   /gene="lafK"
FT                   /locus_tag="ROD_02351"
FT                   /note="HMMPfam hit to PF00158, RNA polymerase sigma factor
FT                   54, interaction, score 6.6e-128"
FT                   /inference="protein motif:PFAM:PF00158"
FT   misc_feature    281776..281817
FT                   /note="PS00675 Sigma-54 interaction domain ATP-binding
FT                   region A signature."
FT                   /inference="protein motif:Prosite:PS00675"
FT   misc_feature    281917..281964
FT                   /note="PS00225 Crystallins beta and gamma 'Greek key' motif
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00225"
FT   misc_feature    281968..282015
FT                   /note="PS00676 Sigma-54 interaction domain ATP-binding
FT                   region B signature."
FT                   /inference="protein motif:Prosite:PS00676"
FT   misc_feature    282346..282375
FT                   /note="PS00688 Sigma-54 interaction domain C-terminal part
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00688"
FT   misc_feature    282529..282651
FT                   /gene="lafK"
FT                   /locus_tag="ROD_02351"
FT                   /note="HMMPfam hit to PF02954, Helix-turn-helix,
FT                   Fis-type,score 1.1e-07"
FT                   /inference="protein motif:PFAM:PF02954"
FT   misc_feature    282580..282645
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1653.000, SD 4.82 at aa 296-317, sequence
FT                   GNKNKIADLLGITPRALRYRLA"
FT   CDS_pept        282718..283074
FT                   /transl_table=11
FT                   /gene="lfiE"
FT                   /locus_tag="ROD_02361"
FT                   /product="lateral flagellar basal body component protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02361"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87015"
FT                   /db_xref="GOA:D2TJ13"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ13"
FT                   /protein_id="CBG87015.1"
FT                   /translation="MSITNIQPAGTMQAQMLREMQQMQAVARTPVLSSMQISAAGEASS
FT                   TVSFHRIMQGALSHVDQFQQAAEEKQTAIDMGKSDDLAGAMIASQQASLSFSALVQVRN
FT                   KIATGFNDLMSMSI"
FT   misc_feature    282784..283071
FT                   /gene="lfiE"
FT                   /locus_tag="ROD_02361"
FT                   /note="HMMPfam hit to PF02049, Flagellar hook-basal body
FT                   complex protein FliE, score 9e-12"
FT                   /inference="protein motif:PFAM:PF02049"
FT   CDS_pept        283079..284743
FT                   /transl_table=11
FT                   /gene="lfiF"
FT                   /locus_tag="ROD_02371"
FT                   /product="lateral flagellar M-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02371"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87016"
FT                   /db_xref="GOA:D2TJ14"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ14"
FT                   /protein_id="CBG87016.1"
FT                   /translation="MNELIKKLTHSFPAFAFRLDGNRRWMLLAAAAVAATAIIVSLLWN
FT                   SNHGYVSLYGRQENLPVSQIVTVLDGEKLEYRIDPQSGQILVPEEALSKTRMALAAKGV
FT                   QALLPNGYELMDKDEVLGSSQFVQNIRYKRSLEGELAQSIMTLDAVESARVHLALNEES
FT                   SFVVSDRPQNSASVVVRLHYGAKLDMDQVNAIVHLVSGSIPGLKATQVSVVDQAGNLLT
FT                   DGTGAGEAVAATTRKHDQILQDIQDKTRASVANVLDSLVGPGNYRISVMPDLDLSDIDE
FT                   TREHYGNEPKVNREENVQDSDTNQIAMGIPGSLSNRPPVAPNQVTNNASATTAESNPPQ
FT                   ALSKHSESKRDYSYDRSVQHIQYPGFTVKRLKVAVVLNQEAPALKNWTPEQTRQLTDLL
FT                   NNAAGIDTQRGDNLSLSLLRFVPPKTPVEPVIPLWKDESVLAWARMIGCGLLALLLLLF
FT                   VVRPMMKRLTAVRQSLPALEKVAASVPAIEPQFAAAEDDRKSIELPSFPGDDSLPPQSS
FT                   GLEVKLEFLQKLAMSDTDRVAEVLRQWITSNERIDNK"
FT   sig_peptide     283079..283189
FT                   /gene="lfiF"
FT                   /locus_tag="ROD_02371"
FT                   /note="Signal peptide predicted for ROD02371 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.603) with cleavage site
FT                   probability 0.241 between residues 37 and 38"
FT   misc_feature    283133..283768
FT                   /gene="lfiF"
FT                   /locus_tag="ROD_02371"
FT                   /note="HMMPfam hit to PF01514, Secretory protein
FT                   YscJ/FliF,score 2.1e-51"
FT                   /inference="protein motif:PFAM:PF01514"
FT   misc_feature    join(283151..283210,284399..284458)
FT                   /gene="lfiF"
FT                   /locus_tag="ROD_02371"
FT                   /note="2 probable transmembrane helices predicted for
FT                   ROD02371 by TMHMM2.0 at aa 25-44 and 441-460"
FT   misc_feature    283847..284338
FT                   /gene="lfiF"
FT                   /locus_tag="ROD_02371"
FT                   /note="HMMPfam hit to PF08345, Flagellar M-ring
FT                   C-terminal,score 3.8e-54"
FT                   /inference="protein motif:PFAM:PF08345"
FT   CDS_pept        284721..285572
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="lfiG"
FT                   /locus_tag="ROD_02381"
FT                   /product="lateral flagellar C-ring switch protein
FT                   (fragment)"
FT                   /note="pseudogene, C-terminus missing, truncated by
FT                   prophage CRP28 insertion"
FT   misc_feature    complement(285573..325997)
FT                   /note="prophage CRP28"
FT   CDS_pept        complement(285654..286226)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02391"
FT                   /product="putative phage tail fibre protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02391"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87018"
FT                   /db_xref="InterPro:IPR025484"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ15"
FT                   /protein_id="CBG87018.1"
FT                   /translation="MMQIKEITSPRYTESGAIDCDVLFEEMEAPVPYTATPDDTAKTGQ
FT                   QIWQELQSGKWGEITPFTASPELIAAAKDAKKREIEAWRTEQEAQPFTFEWNGHTWNAG
FT                   PDSMTRLYPVVMAAKSDTARTALAWGDADNQQVKLSMPELEELAAAMAQAQVERNDEIY
FT                   QRQREMKEELNNLDDLRSIRAMTISSS"
FT   CDS_pept        complement(286223..287839)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02401"
FT                   /product="putative phage tail fibre protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02401"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87019"
FT                   /db_xref="InterPro:IPR013609"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ16"
FT                   /protein_id="CBG87019.1"
FT                   /translation="MSVLISGALINGAGVPMAGCKIYLDALVNTSEVVTESFAVIETDA
FT                   AGQYAFEAQKGKYTVHIKQKNGPKCCVGDISVYDDSKPGTLNDFLTALDEGDLKPDVVK
FT                   RFEEMVAQAQQSAEAAAESEQQAGQHVADAQQIKSDCETLADNVQQNTNAVEENTQRVE
FT                   QLASEVGLHAGQVQQGVQNVTDAVKKAQQAAKNSADSATDSKNSADNAALSEQNAQKHA
FT                   QKAEQHEQQTKQYAQDAATAAESAENAKGEIDEILDGGYLKIKNNFQEIVDAGPSALAQ
FT                   AQWNLQISGVKNKQVIATPYTWPSRTEYEQRVHLPLAGAYGFGYTFEDKSQGRINLNEG
FT                   YTGSWWSQWVKPGRYYVTTSDKQYLTPDGGTYGVVDALWLNGSGYNDASKVLKILAFYD
FT                   NDGYLHIGRRAGQSNGSISWRKLASLSDVRAMLYSYIYNNYNREWRDPELGGLILASYQ
FT                   GTADGDTNIKVSRGQTYPGSRLAPVAIECPFTPSGTYAATPRFYITGCKSKSLPGTYIS
FT                   LSGAPTTYSDQAFVALFMRIA"
FT   misc_feature    complement(287438..287839)
FT                   /locus_tag="ROD_02401"
FT                   /note="HMMPfam hit to PF08400, Prophage tail fibre
FT                   N-terminal, score 2.5e-59"
FT                   /inference="protein motif:PFAM:PF08400"
FT   CDS_pept        complement(287885..288460)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02411"
FT                   /product="putative phage tail fibre assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02411"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87020"
FT                   /db_xref="InterPro:IPR003458"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ17"
FT                   /protein_id="CBG87020.1"
FT                   /translation="MTFKMSAEAQTIRVFNYLDGTNEFIGESDAYIPPHTGLPANSTDI
FT                   APPDIPAGFAAVFNADEMKWHLMEDHRGKTVYSTETGVAVTVSELGSLPENVTSVSPDG
FT                   EYQRWNGSQWVTDEEARRNALINQAAEKKAGLLKQMGEQIAVLQDAVDFGEATPEEQEQ
FT                   LTALRKLRIKLNRIQPENAPDIDWSDFE"
FT   misc_feature    complement(287900..288304)
FT                   /locus_tag="ROD_02411"
FT                   /note="HMMPfam hit to PF02413, Phage tail assembly
FT                   chaperone gp38, score 2.9e-41"
FT                   /inference="protein motif:PFAM:PF02413"
FT   CDS_pept        complement(288460..289443)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02421"
FT                   /product="putative phage tail fibre protein"
FT                   /note="similar to Mu protein S (tail fibre)"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02421"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87021"
FT                   /db_xref="GOA:D2TJ18"
FT                   /db_xref="InterPro:IPR005003"
FT                   /db_xref="InterPro:IPR005068"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ18"
FT                   /protein_id="CBG87021.1"
FT                   /translation="MQNLMPPVNTPDKLFHDGDPTQGIEGTIVYAEYMNNHQAATRDLQ
FT                   QEVINVLKEAGVTPDPKKQNQLVEALALYVGKKVPDASLTKKGIVQLSSATDSDSEELA
FT                   ATPKAIKALAEKIADLQGTALPVGTPIPWPSDSVPSGYALMQGQSFDKGSYPKLAVAYP
FT                   SGVIPDMRGWTIKGKPASGRAVLSQEQDGIKSHTHSASASNTDLGTKTTSSFDYGTKTV
FT                   STFNHGTKSTNNTGNHTHSVGGVYGGDSVGGKQRVQASGSNQISSTAGAHAHTVDIGQH
FT                   NHTVGIGAHAHTVALGAHGHTITVNPTGNTENTVKNIAYNYIVRLA"
FT   misc_feature    complement(288550..288591)
FT                   /locus_tag="ROD_02421"
FT                   /note="HMMPfam hit to PF03335, Phage tail fiber
FT                   repeat,score 0.31"
FT                   /inference="protein motif:PFAM:PF03335"
FT   misc_feature    complement(288604..288645)
FT                   /locus_tag="ROD_02421"
FT                   /note="HMMPfam hit to PF03335, Phage tail fiber
FT                   repeat,score 0.52"
FT                   /inference="protein motif:PFAM:PF03335"
FT   misc_feature    complement(288706..288747)
FT                   /locus_tag="ROD_02421"
FT                   /note="HMMPfam hit to PF03335, Phage tail fiber
FT                   repeat,score 1.3"
FT                   /inference="protein motif:PFAM:PF03335"
FT   misc_feature    complement(288832..288873)
FT                   /locus_tag="ROD_02421"
FT                   /note="HMMPfam hit to PF03335, Phage tail fiber
FT                   repeat,score 0.77"
FT                   /inference="protein motif:PFAM:PF03335"
FT   misc_feature    complement(288919..289062)
FT                   /locus_tag="ROD_02421"
FT                   /note="HMMPfam hit to PF07484, Phage Tail Collar, score
FT                   1.6e-19"
FT                   /inference="protein motif:PFAM:PF07484"
FT   misc_feature    complement(289066..289197)
FT                   /locus_tag="ROD_02421"
FT                   /note="HMMPfam hit to PF03406, Phage tail fiber repeat
FT                   2,score 6.6e-12"
FT                   /inference="protein motif:PFAM:PF03406"
FT   CDS_pept        complement(289443..290015)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02431"
FT                   /product="hypothetical prophage protein"
FT                   /note="similar to Mu protein gp48"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02431"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87022"
FT                   /db_xref="InterPro:IPR018755"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ19"
FT                   /protein_id="CBG87022.1"
FT                   /translation="MNMVDLFRAMLPPVSYDQNGKYISAELMAEANVMEAVKASAARVL
FT                   AQITPLQASMTLSDWERVYGVVPREGATQQERRQNILVKMAATGGLSIPYFKSLAASLG
FT                   YTITITEPRAFRVGINRCGDRLLIPEIRWVWQVNVIGTKTPVYRFRTGASATGEPLTAF
FT                   GESILENTFKDLKPAFTDCYFTYEVEE"
FT   CDS_pept        complement(290019..291098)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02441"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02441"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87023"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ20"
FT                   /protein_id="CBG87023.1"
FT                   /translation="MPFPVPGVAENTERQLRDIANALPGETIDTGADSDYRIRANAVSG
FT                   VADGLYMHQGWILRQVFPDTADPEYLELHCRTRNVFRKKATASSGPVVITGTPGKTLPA
FT                   GAEIRGEGVSVTTTADCTVGDEGSAEVTVKSTATGAQTNASATQTATLVSPPEGINSTV
FT                   TIKSLTGGTDRESDADLLARYLDILRRPPAGGNKYDYKRWALEVDGVTSAYVEPLRRGL
FT                   GTVDVAITSANDLPSQELINAVLAHIEEVRPVTARDTMVLAPTKKAVDFVVRVKTSGLT
FT                   VEQIKPQITDVITDFMNRLEPGQELIISQLETQISLISGVSDRRIITPADNVKAIINAS
FT                   TWEWLRPGNIDIQSFPREG"
FT   misc_feature    complement(290157..290900)
FT                   /locus_tag="ROD_02441"
FT                   /note="HMMPfam hit to PF04865, Phage baseplate assembly
FT                   predicted J-like, score 1.3e-62"
FT                   /inference="protein motif:PFAM:PF04865"
FT   CDS_pept        complement(291098..291448)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02451"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02451"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87024"
FT                   /db_xref="InterPro:IPR010877"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ21"
FT                   /protein_id="CBG87024.1"
FT                   /translation="MDQTISPATGDYERRRIYTLHNAVYLRLATPLGSYWADASLGSRL
FT                   HELKREKDVSRVHRLAAQYASQALQPLLDDGRAKSITVDTKAGQRGWLLLLITVTDNAG
FT                   TPQTFEHPVRIM"
FT   misc_feature    complement(291104..291397)
FT                   /locus_tag="ROD_02451"
FT                   /note="HMMPfam hit to PF07409, Phage GP46, score 2.4e-31"
FT                   /inference="protein motif:PFAM:PF07409"
FT   CDS_pept        complement(291502..292152)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02461"
FT                   /product="putative phage base plate assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02461"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87025"
FT                   /db_xref="InterPro:IPR013046"
FT                   /db_xref="InterPro:IPR014462"
FT                   /db_xref="InterPro:IPR040629"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ22"
FT                   /protein_id="CBG87025.1"
FT                   /translation="MWDKVNQRVQQALAAVRQAFRVVTGTVDSSTKVQLLQLNGLAGEQ
FT                   LDGAEYFQHYGLTTSPPPGSMGIAVPLNGNTSHTVVVATEHGAYRLTELKPGEVALYTD
FT                   EGAKIVLKRGRVIETECDVYRVKCKRYEVEAEENATFTTPLLTASDRLTVEGKITGNGG
FT                   MAISGGKGYTATFEGDINHVGGVITSVDVTINGVKIGTHKHPTPHGMSDTPVN"
FT   misc_feature    complement(291517..292095)
FT                   /locus_tag="ROD_02461"
FT                   /note="HMMPfam hit to PF06890, Bacteriophage Mu Gp45, score
FT                   5.4e-64"
FT                   /inference="protein motif:PFAM:PF06890"
FT   CDS_pept        complement(292152..293363)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02471"
FT                   /product="putative phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02471"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87026"
FT                   /db_xref="InterPro:IPR026276"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ23"
FT                   /protein_id="CBG87026.1"
FT                   /translation="MPTQNNDDKISLVIAGRSHSDWSSYRIDSDFLKAADGWQLQLGLP
FT                   EKVFPADIVRGAPVRLQVGDETVLSGRVDSVRRSVSRQSCTLTLSGRDDAAILVDCAAP
FT                   VFSANQLTLDEVIDRIVRPLGIQRIRIQASGVSRNDKVVIEPGMRAWDALAKAAAGRGL
FT                   WPWFEPDGTLVVGGPDYTTTPVDTLIMKLDGTGNNVMELDDTRSINGCFSELTVLAQSH
FT                   ARRADSKKQVAVVPLDIWNEDGSVRTLSGQDSGNTGSGQTGIHNMKAVATDPTVDYYRP
FT                   QIITQGDTSNMEQVNWRAKKMMSDARLSGLDIVALVAGHRTADGVLWQPGQRVRIVSEP
FT                   HGIDAIFFLMGREFSGGRNGQTTRLRFKEDGVWIPDAFPREKKRHHRRGKKKKEVAIVK
FT                   VWEK"
FT   misc_feature    complement(292224..293345)
FT                   /locus_tag="ROD_02471"
FT                   /note="HMMPfam hit to PF06893, Bacteriophage Mu P, score
FT                   2.1e-87"
FT                   /inference="protein motif:PFAM:PF06893"
FT   CDS_pept        complement(293347..294696)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02481"
FT                   /product="putative phage DNA circularisation protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02481"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87027"
FT                   /db_xref="InterPro:IPR009826"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ24"
FT                   /protein_id="CBG87027.1"
FT                   /translation="MGWAENLQNASFRGVQFDVLNTDEQISRDHAVYEYPFVDGADLHD
FT                   LGRKARPFRMTAFLWGEYYEYKLEKLIAALDEGGDGELIHPVYGSVPSVIVTGYSIRHD
FT                   AESPDSCTIDMSFLENRTGSALFSTPLPELFAQQLFEELDKLLAQLSELFDAVTAPLKT
FT                   INSVIKKIQTVRATLVNTLLTFKSDFLSSIDNMMSLASEPGKFIGGLAEVLEIHTSDVG
FT                   HAVPVLERTDSATTTGLTGEDSVASSATVMTCWNEVMADMDELVALPVALVSGDKTPSV
FT                   ALPPDASVEDVQDVKAAYAVLAASELASVATAILSDEAQSEQLIPADIGRLVGDVRTRL
FT                   QAAITLFRERYESERERITETVSPLGLMYPGIIQSMKNVAASVQDVGLLVLSRRPPLTQ
FT                   KQVQADSCLLLLAWQWYGDYSRAAELQRLNPQLRDPNNITAGMVINAYAK"
FT   misc_feature    complement(294412..294690)
FT                   /locus_tag="ROD_02481"
FT                   /note="HMMPfam hit to PF07157, DNA circulation,
FT                   N-terminal,score 2.7e-31"
FT                   /inference="protein motif:PFAM:PF07157"
FT   CDS_pept        complement(294696..296978)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02491"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02491"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87028"
FT                   /db_xref="InterPro:IPR010090"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ25"
FT                   /protein_id="CBG87028.1"
FT                   /translation="MAGNFKVGMTLTAKDEASQVLEKGQKQVIKATEGVTKATRKAGAE
FT                   QKRTEQESINSTKKAAKEIQRAARARETLGIRAEREIRREIYLTVASYNRLARAGFESA
FT                   QEQERAMQATREKARALKRELDGVTQAQMKMAKTPVIPEQGRFARAAAFGGNAVTTGAG
FT                   IAAGAAIMAQPVKKQMSYERQLTMMANTAFSDGGLEGRQSGREKLKNSIRAAVTYGGGT
FT                   KEDAADAMNEMLASGAFSWDTANNLLPQIMKFATASGASPRDLVTMAAKAKQTFGLTDN
FT                   DLPAMFNMAIAAGKAGNFELRDMAEHLGPQMALAGNAGMKGLDGFQKLLAFNEVAGIAA
FT                   GSSSEAGNNVVNLLAKLFSSESATRAKSITIDGKGIDLPGTLTRAMENGIDPIEAFSRL
FT                   ADKVAANNKQYQELQKRLAATKDKGQQDKILESMAKILEGFGVGELVGDMQALKAILAY
FT                   RNNPEYRKQVEAEISQQRTLPEGQRAGDVDFKFISDTNDFKTGQAKNTLEFSQMDSMKK
FT                   LADASGAVADAISWAGEEFPGLTTAVVGATTAIEAMTAAALTWAGIKILTGSKPGGKAG
FT                   EVVGDVIENTVKKGKGFKFPGIAGGLLSFGSTVTALATATSPEEDAAVEGSEERWKNIR
FT                   AKYPQWLIDAAREKYQPWWQFGEGYSTENEKWIQQYLDELKKTGVIAGDSLPTPEQVRQ
FT                   QAGMAAPEPASKPPGRINQPEYLTHWGPPASPINFTTQLVLDGQVVAEAVNKYNLQDGN
FT                   RGTGGTY"
FT   CDS_pept        complement(297141..297518)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02501"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02501"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87029"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ26"
FT                   /protein_id="CBG87029.1"
FT                   /translation="MINTQTGELSDGVVFNGTVHKNFELRLPVMRDNGQALEETEERFQ
FT                   TVDGFAADYYYRCAVMAATLVRLGDIPQEELTADLLHDNMTPDDFNILLASRNVLKVKR
FT                   NGGNPGSPDSGSQSSSSGATE"
FT   CDS_pept        complement(297521..297895)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02511"
FT                   /product="hypothetical prophage protein"
FT                   /note="similar to Mu tail tube protein M"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02511"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87030"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ27"
FT                   /protein_id="CBG87030.1"
FT                   /translation="MSIKEYVGSIVLEVDSQEIEITDFDVQINTGRKLVKTMNKTGRAK
FT                   GFARGIATYDISVSAVIPDTNEPDWENLEGVKISIYPLSNSGKRTSYLDCFTVEVGEKY
FT                   TVDSEAKIDIKMAALRKVTG"
FT   CDS_pept        complement(297908..299329)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02521"
FT                   /product="putative phage tail sheath protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02521"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87031"
FT                   /db_xref="InterPro:IPR007067"
FT                   /db_xref="InterPro:IPR020287"
FT                   /db_xref="InterPro:IPR035089"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ28"
FT                   /protein_id="CBG87031.1"
FT                   /translation="MSEIQFDTISGGIRKPGVHFEFNTRLAVNTLPGNEQRVLVIGPML
FT                   SGGTATPLNAVSVYSEDEADLYFGAGSLAAAMARAAINANSYLQLDVIGIADSGAGQAA
FT                   TGAVTVSGTAISSGTLSVWVAGEQVTVDVETGDEPSKIIPALVEAMTQTPSLLVTGEYK
FT                   SEASQLTVTTRTKGAWGNDITLSASTTAGGLTVSATPMANGEMDPDIQPALDAVFAAGH
FT                   NILICPFSTTPALAALKQHLEKTGNAMEQRGAIGCAGWTGSLGNGITLAAGVNSGRVSV
FT                   PWYRGSVKLPAVLAAIYGAVMAGEEDPARPLNSLALSGLDVVAMSQRESRNEQENALHN
FT                   GLTPVEVGPGNTVQIVRAVSTYTVNAQGVTDVSLLDITSIRTLDYTRKACRERISLRFP
FT                   REKLSIRTIAKVESELYDVLIKLEEAEILENVEANKAKLRVQRNGKDANRLDCVVPADV
FT                   VNGLHVFAGRIDMIL"
FT   misc_feature    complement(297911..299320)
FT                   /locus_tag="ROD_02521"
FT                   /note="HMMPfam hit to PF06274, Bacteriophage Mu tail
FT                   sheath, score 4.4e-151"
FT                   /inference="protein motif:PFAM:PF06274"
FT   CDS_pept        complement(299322..299555)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02522"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02522"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87032"
FT                   /db_xref="InterPro:IPR024400"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ29"
FT                   /protein_id="CBG87032.1"
FT                   /translation="MKVKAAPGMKFPMEDNARKYITTEAVTVENTAYYRRAVQDGDLIL
FT                   VKAEPETTVTAEQDAVQVKAKAKREKQVDSDE"
FT   CDS_pept        complement(299545..300198)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02531"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02531"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87033"
FT                   /db_xref="InterPro:IPR014972"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ30"
FT                   /protein_id="CBG87033.1"
FT                   /translation="MITDIERALVERLRCGLGHMVQDVRTYAGELDEDPGRIVRSLPAA
FT                   WVTFGGIVKTERYSTSRRKYIATGRFVVVVGDYNTRSEQSARQGGTVRDEVGTNQLVES
FT                   VRRLLTGQDLGLEIDYFEPGRVRTLFNTGVAERAMSVFACEFDTRWVEHALENGKWPER
FT                   GAEADRLFNRYHGRLSDPDPELLNLGIRYQMQDSDAEISGLTELREQQHEQNEG"
FT   misc_feature    complement(299749..300120)
FT                   /locus_tag="ROD_02531"
FT                   /note="HMMPfam hit to PF08873, Protein of unknown function
FT                   DUF1834, score 2.2e-54"
FT                   /inference="protein motif:PFAM:PF08873"
FT   CDS_pept        complement(300195..300626)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02541"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02541"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87034"
FT                   /db_xref="InterPro:IPR009752"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ31"
FT                   /protein_id="CBG87034.1"
FT                   /translation="MSYATPEQFIRAFSEREARTLTDEDMTGFIDEEKLASALARASAQ
FT                   IDGYLVGRYRTPWPDSPGILVGYCCDIARYHLATDYRICSEEIQMRYRDAIRFLEKVAA
FT                   GQINLGRDTSGSVIQSSSQVRIRSGSRQFGRESTRGGAF"
FT   misc_feature    complement(300216..300620)
FT                   /locus_tag="ROD_02541"
FT                   /note="HMMPfam hit to PF07030, Protein of unknown function
FT                   DUF1320, score 1.2e-34"
FT                   /inference="protein motif:PFAM:PF07030"
FT   CDS_pept        complement(300630..300962)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02551"
FT                   /product="hypothetical prophage protein"
FT                   /note="similar to Mu protein gp35"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02551"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87035"
FT                   /db_xref="InterPro:IPR041227"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ32"
FT                   /protein_id="CBG87035.1"
FT                   /translation="MEKVIEITARREGFRRCGVAHSATTKEWPVDAFTPEQLAVLKADP
FT                   MLIVVERDKASGQNDTARGDELAAQLDAERQKVSELTAQLEEERGKVRELTAALKAAQK
FT                   ADKKEK"
FT   CDS_pept        complement(300966..301874)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02561"
FT                   /product="putative phage major capsid protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02561"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87036"
FT                   /db_xref="InterPro:IPR018774"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ33"
FT                   /protein_id="CBG87036.1"
FT                   /translation="MIVNAKNLNQIFINLKTTYQKAFDQTPTDWQKVAMEVPSGSKEND
FT                   YSWLSRFPKMREWVGDKNVKSLEAFNYTIRNKDWEATVEVDRNDIEDDQIMGYALQARD
FT                   AGQSAAELPADIVASLINNGFTSPCYDGQMFFDTDHLVAGKSVSNKGTKKLKVGSLAEA
FT                   KASYGAARTAMRSLKDDEGASLRIRPNLLVVPPALEDDANYLMTAEKFPDGTPNPYRNT
FT                   AEVLVMPELTSDSAWFLFDTSRSVKPLIFQQRKKPVFVEQTDYNSDNVFMRKKFRFGAE
FT                   ARCNGGYGFWQMAFGSDGTTE"
FT   CDS_pept        complement(301885..302280)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02571"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02571"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87037"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ34"
FT                   /protein_id="CBG87037.1"
FT                   /translation="MDRNTPYRDGELNPVPVAAATEIFGGHMVAVNASGYAVPASATAS
FT                   QITLGVSDSWADNSTGSDGDVTVLVRCGKDFLMVNSTSDPVTQSQVGKLCYVEDSVTVA
FT                   KTDNSSARPVAGKVIGICGDGVWVHFS"
FT   CDS_pept        complement(302281..303450)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02581"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02581"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87038"
FT                   /db_xref="InterPro:IPR012106"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ35"
FT                   /protein_id="CBG87038.1"
FT                   /translation="MLNTLNSTPFSPSVIMPRMKMNIAALSLEITKATHSEIQLFPAGE
FT                   FSAVDGRPHTDEVESGKWVLTAELAAQLVAQVAARATPFVIDYEHQTLRAVNNGKPAPA
FT                   AGWFSQVEWREGAGLYATGVEWTENAAAMIAAGEYKFISPVFAYNKRGEVLELLHAALT
FT                   NTPALDGMDAVMLAAASRLASLSTETETTTVDEELLNDLLSSLRWMLNLPVTSTAEDIK
FT                   NELQKVVDLISNGQGTAAASVSLLALLNQKDEQIASLSANAYDPTKHIPLTAYEELQER
FT                   YAVLAQQSGEAEAGALIQAALSDGRLLPTLEDWAKDYARRDINGFKTWLDKTTPLAALS
FT                   STQTGGKPPKTPSPAPAQIKTGDDVDVDIAICSMMGVDPEDVARYAGDK"
FT   CDS_pept        complement(303606..304157)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02591"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02591"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87039"
FT                   /db_xref="InterPro:IPR006522"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ36"
FT                   /protein_id="CBG87039.1"
FT                   /translation="MSTGKLDIKIDLSAYNTTLGKLIRSVKDRRDLMTALAGSMLDAVE
FT                   TNLEQQGRPKWMGWSPAYAKRRGPGQILQKSGRLAASIRSAVNNNEATVGTNVRYARIH
FT                   NEGGEIRHQARTQNLYFKQYKNGSVSTRFVKKRNSNFVQSATVGAYTVNMPARPFLQLV
FT                   QDDIDELENTANRYFARVID"
FT   misc_feature    complement(303621..304130)
FT                   /locus_tag="ROD_02591"
FT                   /note="HMMPfam hit to PF05069, Phage virion morphogenesis
FT                   (putative tail completion) protein, score 2.8e-26"
FT                   /inference="protein motif:PFAM:PF05069"
FT   CDS_pept        complement(304154..305320)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02601"
FT                   /product="putative head assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02601"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87040"
FT                   /db_xref="InterPro:IPR006528"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ37"
FT                   /protein_id="CBG87040.1"
FT                   /translation="MPTADDVDLGYAYTLKPEEAITYFESKGYVIGFRWHDVKDIAHAR
FT                   AFTVAGVLKLDVLKDIRDGLTAAIADGGTFREFAAQLEPLLESKGWLGKRLIVDEDTGE
FT                   LHGRQLTPRRLRTIFDTNIQSSYNAGRYQQQMANVADRPYFERVAVMDLHTRPKHAALN
FT                   GFTARADDPVWAFLYPPDGYHCRCRIRARSASDVEKYGLTVQSSEGRLVEVEQEYGQPG
FT                   QTIRTMGLKMPDGSVYTADPGFGFNPGKVAWQPELEKYDYRSARQYVTGTLTGPDFARG
FT                   LANVSELDARQRYPLAIRSPEQVAATGAARQTVNLTADVMKRLSATDTPPTAADYVLMQ
FT                   QTIERAEHVTQDGNAWRYALQSGDRWSVATVEDDVLTDWVMQDTPEAS"
FT   misc_feature    complement(304751..305146)
FT                   /locus_tag="ROD_02601"
FT                   /note="HMMPfam hit to PF04233, Phage putative head
FT                   morphogenesis protein, SPP1 gp7, score 2e-43"
FT                   /inference="protein motif:PFAM:PF04233"
FT   CDS_pept        complement(305307..306902)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02611"
FT                   /product="putative phage portal protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02611"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87041"
FT                   /db_xref="InterPro:IPR009279"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ38"
FT                   /protein_id="CBG87041.1"
FT                   /translation="MAQLVDIYGRPLKREALKTTQSVRVAERLRIYPDHPSRGLNIRKL
FT                   PRILEAAERGYLPAQAMLFADMEERDGHLFAEMEKRKKALLTLDWSVEPPRNASKAEKE
FT                   LAAAVDEWLHGIPDMEDIILNGMSSVGYGFSCQEISWAFVDKTWLPDAVTLRPHNWFIT
FT                   LPEHNDELRLDDGNRGEDGKDGSALWPFGWLVHRYNARSGFLGSSGLFRVLVWPYLFKN
FT                   FALRDMAEFLEIYGLPARIAYYAQGTSDEDRDNILEALVNLGHEAVAALPQGNEIEFKE
FT                   AASGGPEAFMSMVEWAERTTSKVILGSTLTSQADGKTSTNALGNVHNEVRHDILAADAR
FT                   QLSGMFSSLIQMMASLNGWQDIPPRRLPRLVFDVQQEADIKGVADAVNVLVNNVGMKDI
FT                   PVSWVRKKTGIPTPKDGEEVLVPVAQRLPVQAGLSQLRERLNVAALSQQDNGEDDPAQR
FT                   AIDRAELPAEAIAQGMNELVAPLVQAIQEGRDADEAMNVLAEAWPELPDETLRQLLTQA
FT                   FFVADIWGRLNADS"
FT   misc_feature    complement(305316..306902)
FT                   /locus_tag="ROD_02611"
FT                   /note="HMMPfam hit to PF06074, Protein of unknown function
FT                   DUF935, score 8.9e-182"
FT                   /inference="protein motif:PFAM:PF06074"
FT   CDS_pept        complement(306902..308542)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02621"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02621"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87042"
FT                   /db_xref="InterPro:IPR006517"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ39"
FT                   /protein_id="CBG87042.1"
FT                   /translation="MAKRKLSIKEFQRSLQEYIANLRQTIEAECLGFDVNPQATQARRA
FT                   AVCDPVTGYDYFVENYFPHYVRNPAKSELHKYLFSRLPQVVASPAPENDAIAAPRGEAK
FT                   STLVTQLFTLWTIIRAIKHYPVIIMDSIDQAYPMLEAIKAELEFNPRLKNDFPEVCGQG
FT                   RVWRMGTIVTANNIKVTVAGSGKKLRGLRHGPYRPDLIILDDIENDEMVRNPEQRDKLH
FT                   DWLTKTVMPLGEAGGKTDIIYIGTILHYDSVLSRTLNNPMWKTARFKAVIQWPANMKLW
FT                   DEWEELIRNKQPEAAEALYRQNEAEMLAGSVVSWAARPLLALMKIRVRDGHDTFDSEYQ
FT                   NDPVSGEDALFAGCIKFWVNRLDEWVFYGAVDPSLGKKNKNRDPSAILVGGFNRFTGIL
FT                   DVVEADIRRRLPNKLIEDVIKYQREYHCLCWSFESVQFQEFLRTVLVERSAALGVPVPA
FT                   LPVIPLEDKALRIESLQPHMANGLIRISHTHQTLIDQLRHYPKADHDDGPDCLHMLWTL
FT                   AVSRSAKFQIHTPRSTGRDRGGRFGSGGW"
FT   CDS_pept        complement(308544..309284)
FT                   /transl_table=11
FT                   /gene="dam"
FT                   /locus_tag="ROD_02631"
FT                   /product="putative prophage DNA adenine methylase"
FT                   /note="Note the prosite PS00092 N-6 Adenine-specific DNA
FT                   methylases signature"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02631"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87043"
FT                   /db_xref="GOA:D2TJ40"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ40"
FT                   /protein_id="CBG87043.1"
FT                   /translation="MQKQIIGNATLYCGDVLDVLPALSERFDAVITDPPYSSGGTHKSD
FT                   RSMAPSDKYVGHTQYAEFTGDNRDQRSWAFWCSMWISHALHRLNPGGYFMVFSDWRQLP
FT                   ALTDAFQAGGVLWRGLVVWDKTQASRAPHTGYFRHQAEYVVWGSNGKLDKCPHGGPFPG
FT                   VITQRVVPSEKLHMTAKPVQLMAELVKPLAPDAHVLDPFMGSGTTAIPVLARGGRFTGI
FT                   EMTNQYFDIACARIEKAQAEAAQV"
FT   misc_feature    complement(308583..308774)
FT                   /gene="dam"
FT                   /locus_tag="ROD_02631"
FT                   /note="HMMPfam hit to PF01555, DNA methylase N-4/N-6, score
FT                   1.6e-09"
FT                   /inference="protein motif:PFAM:PF01555"
FT   misc_feature    complement(309177..309197)
FT                   /note="PS00092 N-6 Adenine-specific DNA methylases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00092"
FT   CDS_pept        complement(309331..309831)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02641"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02641"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87044"
FT                   /db_xref="InterPro:IPR014926"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ41"
FT                   /protein_id="CBG87044.1"
FT                   /translation="MAWSQDIRDKVRNGYIFDQLPLDIVAMKYAVPHDTARRWKTQAMK
FT                   NGDDWDKLRAAHALAGDGLESVARTVLISLVVKCQTTLERLNQNPDIPPQESVELLASL
FT                   SDSLSKAVASSKKILPETDRLATALEVVQRLGAFIKERHPAQYAAFLEVLEGFAKELED
FT                   NFS"
FT   misc_feature    complement(309337..309831)
FT                   /locus_tag="ROD_02641"
FT                   /note="HMMPfam hit to PF08822, Protein of unknown function
FT                   DUF1804, score 1.3e-71"
FT                   /inference="protein motif:PFAM:PF08822"
FT   CDS_pept        complement(309831..310151)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02651"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02651"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87045"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ42"
FT                   /protein_id="CBG87045.1"
FT                   /translation="MKQKENTAIALVEAAVPGRPFKFGLTQVVALHVSGECGEIKARTQ
FT                   YADGENRYLVYYQDARKAAQLKWFGESMLEMIEDVRHPGMPVFAVTELPDDATVSDTRK
FT                   GV"
FT   CDS_pept        complement(310172..310354)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02661"
FT                   /product="putative prophage exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02661"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87046"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ43"
FT                   /protein_id="CBG87046.1"
FT                   /translation="MTRQHWTHRTPRKAARCVLALFLMMLLPLGCTDINRAGQLFDAAA
FT                   QVCRIIDGIRQCSQN"
FT   sig_peptide     complement(310265..310354)
FT                   /locus_tag="ROD_02661"
FT                   /note="Signal peptide predicted for ROD02661 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.913) with cleavage site
FT                   probability 0.863 between residues 30 and 31"
FT   CDS_pept        complement(310351..310896)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02671"
FT                   /product="putative phage lysozyme"
FT                   /note="86% ID to ROD36701"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02671"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87047"
FT                   /db_xref="InterPro:IPR008565"
FT                   /db_xref="InterPro:IPR018537"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ44"
FT                   /protein_id="CBG87047.1"
FT                   /translation="MKSKDDIFDEVLGKEGGYVNHPDDKGGPTKWGITEKVARAHGYRG
FT                   DMRDLTREQALDILEADYWYGPRFDQVAALSPDIAAELCDTGVNMGPSVASKMLQRWLN
FT                   VFNLRGRLYPDMDADGRIGPRTISALRAFLNNRGQDGERVMLTALNCTQGDRYLELAEK
FT                   REANESFVYGWLEERVAV"
FT   misc_feature    complement(310360..310881)
FT                   /locus_tag="ROD_02671"
FT                   /note="HMMPfam hit to PF05838, Protein of unknown function
FT                   DUF847, score 5.4e-97"
FT                   /inference="protein motif:PFAM:PF05838"
FT   CDS_pept        complement(310880..311176)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02681"
FT                   /product="putative prophage membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02681"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87048"
FT                   /db_xref="GOA:D2TJ45"
FT                   /db_xref="InterPro:IPR008473"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ45"
FT                   /protein_id="CBG87048.1"
FT                   /translation="MESSLAGIVNVWLCLAIVLGLFVYRRHGAAHKPMITWLAYWLMLG
FT                   YIIIPFRWLSGTYTHSSWLVVALNLVFCALIVWAHGNLSKILSLLRHPHEIKR"
FT   misc_feature    complement(310907..311161)
FT                   /locus_tag="ROD_02681"
FT                   /note="HMMPfam hit to PF05449, Protein of unknown function
FT                   DUF754, score 1.3e-19"
FT                   /inference="protein motif:PFAM:PF05449"
FT   misc_feature    complement(join(310934..311002,311015..311068,
FT                   311105..311164))
FT                   /locus_tag="ROD_02681"
FT                   /note="3 probable transmembrane helices predicted for
FT                   ROD02681 by TMHMM2.0 at aa 5-24, 37-54 and 59-81"
FT   CDS_pept        complement(311166..311558)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02691"
FT                   /product="putative prophage membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02691"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87049"
FT                   /db_xref="GOA:D2TJ46"
FT                   /db_xref="InterPro:IPR032637"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ46"
FT                   /protein_id="CBG87049.1"
FT                   /translation="MSEPLSGGGAVAVTIGGASVFGLLTNTDFGVVVGAFAGALFVVTQ
FT                   QKEIPVWRMAIHLLVAFVVGVLGAGVAASLMQWLTHYNDKPLDALCAVGVSALSIKILT
FT                   FLYQQEISSLFGLFSRLRGGGGGNGK"
FT   misc_feature    complement(join(311328..311396,311433..311501))
FT                   /locus_tag="ROD_02691"
FT                   /note="2 probable transmembrane helices predicted for
FT                   ROD02691 by TMHMM2.0 at aa 20-42 and 55-77"
FT   CDS_pept        complement(311741..312046)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02701"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02701"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87050"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ47"
FT                   /protein_id="CBG87050.1"
FT                   /translation="MGLRKKETLMTNYTALGEYTAYSEQARDAAGRRFAYMKNLASQLN
FT                   RMAEQPDMVVQEEALQCAIADIIASENEMRAALEKANASAPLCNKPLITPDSLSRF"
FT   CDS_pept        complement(join(312049..312060,313502..313954))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ROD_02721"
FT                   /product="hypothetical prophage protein (pseudogene)"
FT                   /note="pseudogene, disrupted by ISCro3 insertion. Last 4 aa
FT                   at C-terminus separated from N-terminus by IS element.
FT                   Intact gene found in EPEC E2348/69 prophage PP9"
FT   repeat_region   312060..312070
FT                   /note="11 bp direct repeat flanking ISCro3"
FT   repeat_region   312071..313500
FT                   /note="Insertion sequence ISCro3. 1 of 11 intact ISCro3
FT                   elements in CR chromosome, all have 18 bp inverted repeats
FT                   containing 2 bp mismatches, and are flanked by direct
FT                   repeats of varying length. This element has 11 bp direct
FT                   repeats"
FT   repeat_region   312071..312088
FT                   /note="18 bp terminal inverted repeat of ISCro3, contains 2
FT                   mismatches"
FT   CDS_pept        312154..313491
FT                   /transl_table=11
FT                   /locus_tag="ROD_02711"
FT                   /product="ISCro3 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02711"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87052"
FT                   /db_xref="GOA:D2THB0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024473"
FT                   /db_xref="UniProtKB/TrEMBL:D2THB0"
FT                   /protein_id="CBG87052.1"
FT                   /translation="MPLLNDLLDFSDHPLMPPPSAQLFAQHLPVEWIQHCLTLSAHATV
FT                   RRRRLPGDMVIWMVVAMAFFRNESITDVVRRLNLSADGEAGMNLLARSAVTQARQRVGA
FT                   APVEWLFRQTAQTWGTERYQKDDWHGLQLFAIDGAQFRTPDEPELREHYGSANTSTERQ
FT                   SAYPVMRLVALMNLGSHILLDAATAPYRRSETLLAHSMLVTIPDNSITLFDKLFYSADL
FT                   LLSLNRQGCNRHWLLPAWKNIAAETEESYGPGDRLLKLKVSPQARKKNPSLPEYWYARA
FT                   VTYELNGVEKTVLTSLQADRYKAREVAELYHSRWEIEVGFRNLKSSLLNNALVLRSRKV
FT                   ELLEQEVWGMLLAYNLIRREATKATEKHKKAASEISFKFAFQFIATEMIVLGNTVSPGT
FT                   IPKRLEHLRGALEAVFITKRPRPSRPRAVKISKTRYPVKRNAAPLK"
FT   misc_feature    312550..313221
FT                   /locus_tag="ROD_02711"
FT                   /note="HMMPfam hit to PF01609, Transposase, IS4-like, score
FT                   3.6e-29"
FT                   /inference="protein motif:PFAM:PF01609"
FT   repeat_region   complement(313483..313500)
FT                   /note="18 bp terminal inverted repeat of ISCro3, contains 2
FT                   mismatches"
FT   repeat_region   313501..313511
FT                   /note="11 bp direct repeat flanking ISCro3"
FT   CDS_pept        complement(314050..314463)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02731"
FT                   /product="hypothetical prophage protein"
FT                   /note="similar to Mu protein gp16"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02731"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87053"
FT                   /db_xref="InterPro:IPR009363"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ49"
FT                   /protein_id="CBG87053.1"
FT                   /translation="MLKKMIGAIKAGQAYLGWDDALYRQTLARLTGKTSTTRCNLDELR
FT                   IIREYMHEQGFPRKAPAGKGRRPRVAMSRKSVLSKIEALLADAGRSWAYAEGLASHMYK
FT                   QHVIEWLTDDQLFGVMVALTKDARKRARAARKQ"
FT   misc_feature    complement(314062..314463)
FT                   /locus_tag="ROD_02731"
FT                   /note="HMMPfam hit to PF06252, Protein of unknown function
FT                   DUF1018, score 9.3e-20"
FT                   /inference="protein motif:PFAM:PF06252"
FT   CDS_pept        complement(314435..314713)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02732"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02732"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87054"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ50"
FT                   /protein_id="CBG87054.1"
FT                   /translation="MKIEQIGMAAFRQQAESGGVDEFVVQRFGGVYHLFAVNRRAGVSY
FT                   FLQERRGDYKTWLSLDRAAAFLSGIGVSRFTVRFEDNKHAEKDDRGH"
FT   CDS_pept        complement(314794..315057)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02733"
FT                   /product="putative prophage membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02733"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87055"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ51"
FT                   /protein_id="CBG87055.1"
FT                   /translation="MNNGCLVAVVFIVFGACFFLVDNTTHTTTNEQESPHCVVRKNFSQ
FT                   RTITHCDDGSATVTDGDKFIYCSTGKNGSPSCHEVTLGDGDK"
FT   misc_feature    complement(314995..315048)
FT                   /locus_tag="ROD_02733"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD02733 by TMHMM2.0 at aa 4-21"
FT   misc_feature    complement(315007..315039)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(315054..315173)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02751"
FT                   /product="putative prophage exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02751"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87056"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ52"
FT                   /protein_id="CBG87056.1"
FT                   /translation="MKFSESRSNNTMKTIKVLILVIASIVSFVFGAMTERGAL"
FT   misc_feature    complement(315072..315125)
FT                   /locus_tag="ROD_02751"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD02751 by TMHMM2.0 at aa 17-34"
FT   sig_peptide     complement(315081..315173)
FT                   /locus_tag="ROD_02751"
FT                   /note="Signal peptide predicted for ROD02751 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.998 between residues 31 and 32"
FT   CDS_pept        complement(315182..315592)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02761"
FT                   /product="putative prophage exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02761"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87057"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ53"
FT                   /protein_id="CBG87057.1"
FT                   /translation="MKKMVFVAALLTVTQQAQASAVIVASAAATTAAVAAANSANIASQ
FT                   QERDAANASASALPISVKGSKQHLGFITCGKRSYEAVGSLGCTVYGDSESREIPWKTWP
FT                   GYVLGSKLPASYEVNAVSFDHYNGVATVYFTY"
FT   sig_peptide     complement(315536..315592)
FT                   /locus_tag="ROD_02761"
FT                   /note="Signal peptide predicted for ROD02761 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.944 between residues 19 and 20"
FT   CDS_pept        complement(315605..315781)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02762"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02762"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87058"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ54"
FT                   /protein_id="CBG87058.1"
FT                   /translation="MKNRKAKILLARRNGVGVWRWLRISNRRVRLTGCCGVMLHSCCKK
FT                   PSAAQNRRKNHGM"
FT   CDS_pept        complement(315778..315954)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02763"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02763"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87059"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ55"
FT                   /protein_id="CBG87059.1"
FT                   /translation="MKNRKAIRLLLQRPVCVVELVISNHKIAVLHPFGQVAFTVNRKPT
FT                   ASQNRRKKGYAVR"
FT   CDS_pept        complement(315959..316147)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02771"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02771"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87060"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ56"
FT                   /protein_id="CBG87060.1"
FT                   /translation="MNQQTRISDKSLTRLIADADKVLERNTPVADEEWWQDFRAAMLEL
FT                   QERRRADSTESVVNTGE"
FT   CDS_pept        complement(316144..316434)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02781"
FT                   /product="putative prophage membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02781"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87061"
FT                   /db_xref="GOA:D2TJ57"
FT                   /db_xref="InterPro:IPR031858"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ57"
FT                   /protein_id="CBG87061.1"
FT                   /translation="MVIDKTITIDVAMNTGLALIGYGYITFMSFRWLISSVFKQCERRR
FT                   CKDKRVKALNAFNDAFDIDRMQQGDPARVITRGDVVILVYRSEKNEQEAAQ"
FT   misc_feature    complement(316324..316392)
FT                   /locus_tag="ROD_02781"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD02781 by TMHMM2.0 at aa 15-37"
FT   CDS_pept        complement(316424..316654)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02791"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02791"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87062"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ58"
FT                   /protein_id="CBG87062.1"
FT                   /translation="MNIEFYNYGTKAKIIVTCWLWEFRRYNRVVDAALFVAPEVHHESG
FT                   GGLLMRTVITGKTVPMLRAFKVAKQEAGNGH"
FT   CDS_pept        complement(316651..316878)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02801"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02801"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87063"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ59"
FT                   /protein_id="CBG87063.1"
FT                   /translation="MAFKLLSVTEAIYQPPGERHEYRMNDGSAAVEFPKYPGASRWRFY
FT                   DSAGHRIIKRTVHNAMKAAVERHKRRFNCK"
FT   CDS_pept        complement(316881..317591)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02811"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02811"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87064"
FT                   /db_xref="InterPro:IPR016868"
FT                   /db_xref="InterPro:IPR024498"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ60"
FT                   /protein_id="CBG87064.1"
FT                   /translation="MKDKYIAKIKKLLRLARGTSSPEEAANAIAKAQAYMRQHGISEND
FT                   AELFDIQEAASAGAPSDASTPPRYMHILCDLVCKAFGVECYISGEYRASGSLKRYVRFY
FT                   GHDSRPEIAAYAFDVLSRQMMAERKKYQDKHCKRCGPSTRVARGDQFCEGWVFGTRDVI
FT                   AVYDVSPEEKSRLELYRKNLHNTKGLRDGDMRTAKACRGAEFAATAGFIAGKNARLHQG
FT                   VNGQSNRPLALGRA"
FT   CDS_pept        complement(317774..317905)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02821"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02821"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87065"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ61"
FT                   /protein_id="CBG87065.1"
FT                   /translation="MTAITGKLNVVVNKSVFNFICIWRKPAGAGLRLNQREFIYEYR"
FT   repeat_region   317930..317938
FT                   /note="9 bp direct repeat flanking IS102"
FT   repeat_region   317939..318995
FT                   /note="Insertion sequence IS102 first identified in
FT                   Escherichia coli pSC101 (IS5 family). 100% ID at DNA level
FT                   (blastn), 100% ID at protein level (tblastx). Has 18 bp
FT                   perfect inverted repeats and is flanked by 9 bp direct
FT                   repeats. 1 of 12 identical IS102 elements in CR chromosome"
FT   repeat_region   317939..317956
FT                   /note="18 bp terminal inverted repeat of IS102"
FT   CDS_pept        317971..318939
FT                   /transl_table=11
FT                   /locus_tag="ROD_02831"
FT                   /product="IS102 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02831"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87066"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D2TIM3"
FT                   /protein_id="CBG87066.1"
FT                   /translation="MKDQITHPPDNTDHSVAKQKFRITNWSTYNKALINRGSLTFWLDD
FT                   EAIQAWYESATPSSRGRPQRYSDLAITTVLVIKRVFRLTLRAAQGFIDSIFALMNVPLR
FT                   CPDYTSVSKRAKSVNVSFKTSTRGEIAHLVIDSTGLKVFGEGEWKVRKHGKERRRIWRK
FT                   LHLAVDSNTHEVVCADLSLNNVTDSEAFPGLIRQTHRKIRAAAADGAYDTRLCHDELRR
FT                   KKISALIPPRKGAGYWPGEYADRNRAVANQRMTGSNARWKWTTDYNRRSIAETAMYRVK
FT                   QLFGGSLTLRDYDGQVAEAMALVRALNKMTKAGMPESVRIA"
FT   misc_feature    318364..318903
FT                   /locus_tag="ROD_02831"
FT                   /note="HMMPfam hit to PF01609, Transposase, IS4-like, score
FT                   9.3e-30"
FT                   /inference="protein motif:PFAM:PF01609"
FT   repeat_region   complement(318978..318995)
FT                   /note="18 bp terminal inverted repeat of IS102"
FT   repeat_region   318996..319004
FT                   /note="9 bp direct repeat flanking IS102"
FT   CDS_pept        complement(318997..319485)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ROD_02841"
FT                   /product="hypothetical prophage protein (fragment)"
FT                   /note="pseudogene, C-terminus missing, truncated by IS102
FT                   insertion"
FT   CDS_pept        complement(319561..319752)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02842"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02842"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87068"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ63"
FT                   /protein_id="CBG87068.1"
FT                   /translation="MNAKNFNQLYPVGTRFTHTDSAVFGCGRVVKTVAPARDFKCGCVV
FT                   EINVEPYFVKVETLKAPH"
FT   CDS_pept        complement(319733..319966)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02851"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02851"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87069"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ64"
FT                   /protein_id="CBG87069.1"
FT                   /translation="MHQDIKEYRAGNSCAAYSLGASRAEQRGDYAEAEKLWRKAAQSPC
FT                   STLRRIWAEHRAEFCANAHLKGWRPRHECEEL"
FT   CDS_pept        complement(319968..320612)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02861"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02861"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87070"
FT                   /db_xref="InterPro:IPR021505"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ65"
FT                   /protein_id="CBG87070.1"
FT                   /translation="MTTENKVKQYTKTQAPEGYWVDARGVMTPESLIKDIDRDREQLVG
FT                   ELVEMVIAASASLRELKLRAFGDIQAFIDLSAEKYGAVKGGKKGNITLYSFDGRYKIQR
FT                   AMQDRIAFDERIQTAKSLIDDCLADWTEGARPEIKAIISEAFSTDKEGNINTGRVLALR
FT                   RLEIEDERWNNAMTLIGEAVQVIGSKSYIRVYERVGDSDEYRAIPLDIAGV"
FT   CDS_pept        complement(320642..320857)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02871"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02871"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87071"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ66"
FT                   /protein_id="CBG87071.1"
FT                   /translation="MAVKLEVIIYTNEKGCVLTQTTGSYSKDGASEKEFQVATRLHDVI
FT                   KETLRNDYNGVNLFSENVAPCAHNTN"
FT   CDS_pept        complement(320847..321038)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02881"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02881"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87072"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ67"
FT                   /protein_id="CBG87072.1"
FT                   /translation="MSLELELTFSLDRPGKPEKTVATYQLPPDVTGEQVSDIIIKTHCF
FT                   MNEIIFKSFDFKGEKHGG"
FT   CDS_pept        complement(321054..321320)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02891"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02891"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87073"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ68"
FT                   /protein_id="CBG87073.1"
FT                   /translation="MQRRNVNSLMENKTMDKQTINAVRSRARVAIHTTGGRVTGQHHRL
FT                   PVVYACPPVGGPVWPVTEIIQTFSGLRRVVKTSCIDGCTVVWQ"
FT   CDS_pept        complement(321320..321670)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02901"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02901"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87074"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ69"
FT                   /protein_id="CBG87074.1"
FT                   /translation="MTGVLRMEKMALRNEIRALQSIGRNGCVYSNGTPGEIIPFVDCFV
FT                   PGELRIDLYSREREINGTGNTSDDWDVDECCARLMIIPFEQTLQGFRRAYRLARMCARL
FT                   PRYQSRLAFALR"
FT   CDS_pept        complement(321667..322560)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02911"
FT                   /product="putative phage transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02911"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87075"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ70"
FT                   /protein_id="CBG87075.1"
FT                   /translation="MSLITQLNDVMARCGYTQTHVGRAIGRSSAVINQYLQGKYVGDVT
FT                   DVEERISSFVSRELEKQSNRRVKAQFVSTKIADNGLEMLSYAHAYCEICVLHGEAGLGK
FT                   TMILREYAARNRDAILIEADTGYTARALLGELCRQLGVKVRGNIHELIDVCVRELRDSG
FT                   RLLMVDEAELLPYRALEVLRRLHDKAGIGIVLAGMPRLVTNLKGNRGEFAQLYSRVGVA
FT                   LDMGNTLSPEDFTPIATELMPEAETPEIGEALYTYSRGNARRLFKLVRGVYRMSDVTKV
FT                   PVSVEAIEKFSKMLIK"
FT   misc_feature    complement(322246..322269)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(322450..322515)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1173.000, SD 3.18 at aa 16-37, sequence
FT                   YTQTHVGRAIGRSSAVINQYLQ"
FT   CDS_pept        complement(322578..324620)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02921"
FT                   /product="putative phage transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02921"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87076"
FT                   /db_xref="GOA:D2TJ71"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR003314"
FT                   /db_xref="InterPro:IPR009004"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ71"
FT                   /protein_id="CBG87076.1"
FT                   /translation="MFYSANELAGLPGLPGTVQGVRWTLNRITETHPEWKRKREGTKAF
FT                   EYHIDCLPAEAQKVLRKRLTHQVLEDTQLPAVVEQKAVKNVTVRDELEVMVKCPELALR
FT                   EVQALTDKQKAIADARILLATEVHKLREYAGMSRTAAVKHIVDGIRQGALPERIIEAAG
FT                   TANARQGKRTGVSWGSLQEWYSAWLMARGDANQLLALLAPGHHKGTPWEQVWWLSDFFM
FT                   FYRSWKRPTVEYAYREFSAWWHEKHANDAGMLAALPSVHAVRRVLSSVPVIVKERFRST
FT                   GSAWRSLNPFVRRDWTSLPVNAVWVGDGHCMKMTAFNPLTGNIFRPEVTLVMDAGQRFV
FT                   VGWSLSLSENVIAVADALRYGMAQHGIPLIYYSDNGGGEKNRVLDADITGILPRLGVEH
FT                   HTGIPGNPQGRGVIERLNKEIPRDVALSFRTYCSKGADKETVMMQQRIMQSAIKATHKG
FT                   KELTKRQVKARDEIPTFEQLMAAIELEVRRYNNRPHSSLPRKEDGEHYSPAAYRRKLIK
FT                   EQNVEIDFLSPEELHEMFRPEVTRKTFRGEIQLFNNIYYSYDLAAEHGNEVRVSYDIHD
FT                   ANSVIVRRADGSYICDAIWNGNKVDAFAKPVIEQKLEKRVRGRIARATQKIEEAKRELT
FT                   PAITQKPDFNFGFGLERKEEKKKEELYFFASERDRNLKKDGTNNR"
FT   misc_feature    complement(322842..323030)
FT                   /locus_tag="ROD_02921"
FT                   /note="HMMPfam hit to PF09299, Transposase-like,
FT                   Mu,C-terminal, score 4e-23"
FT                   /inference="protein motif:PFAM:PF09299"
FT   misc_feature    complement(323361..323609)
FT                   /locus_tag="ROD_02921"
FT                   /note="HMMPfam hit to PF00665, Integrase, catalytic
FT                   core,score 2.5e-10"
FT                   /inference="protein motif:PFAM:PF00665"
FT   misc_feature    complement(324441..324605)
FT                   /locus_tag="ROD_02921"
FT                   /note="HMMPfam hit to PF02316, Transposase MuA/Repressor
FT                   CI, DNA-binding, score 3.6e-07"
FT                   /inference="protein motif:PFAM:PF02316"
FT   CDS_pept        complement(324620..324856)
FT                   /transl_table=11
FT                   /gene="ner"
FT                   /locus_tag="ROD_02931"
FT                   /product="putative prophage transcriptional regulator"
FT                   /note="similar to Mu DNA-binding protein Ner"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02931"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87077"
FT                   /db_xref="GOA:D2TJ72"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR038722"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ72"
FT                   /protein_id="CBG87077.1"
FT                   /translation="MMVRNEVMNKDWHREYIVAAVHTKGFTLRELSERAGLKKDSLKNA
FT                   LYRSCPKYERIIADAIGVEPAEIWPSRYASKAA"
FT   misc_feature    complement(324716..324781)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1039.000, SD 2.73 at aa 26-47, sequence
FT                   FTLRELSERAGLKKDSLKNALY"
FT   CDS_pept        325039..325686
FT                   /transl_table=11
FT                   /gene="cI"
FT                   /locus_tag="ROD_02941"
FT                   /product="putative phage repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02941"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87078"
FT                   /db_xref="GOA:D2TJ73"
FT                   /db_xref="InterPro:IPR010744"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ73"
FT                   /protein_id="CBG87078.1"
FT                   /translation="MTRNDDAFSFVDRGKESFRERLVKLIGNRSVRTAASDWGIPPSTL
FT                   NNYIHKGTEPSFKIACLISDKEQVSLNWLAYGEEPTAKEGSLSNQTAQPSPDITNELVN
FT                   ELLKRASTEVKEQLISAICDMGIKGILERLQQPTKQTKQADSDLDELENAIRRLNIRES
FT                   LKDTICMALAGNEETDKEILRRIESRIRAGSPGGHTVATPEQETKPVSKKSA"
FT   misc_feature    325087..325284
FT                   /gene="cI"
FT                   /locus_tag="ROD_02941"
FT                   /note="HMMPfam hit to PF07022, Bacteriophage CI
FT                   repressor,score 0.002"
FT                   /inference="protein motif:PFAM:PF07022"
FT   misc_feature    325123..325188
FT                   /note="Predicted helix-turn-helix motif with score
FT                   999.000,SD 2.59 at aa 29-50, sequence
FT                   RSVRTAASDWGIPPSTLNNYIH"
FT   CDS_pept        325998..327251
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="lfiI"
FT                   /locus_tag="ROD_02951"
FT                   /product="lateral flagellar export/assembly protein
FT                   (fragment)"
FT                   /note="pseudogene, N-terminus missing, truncated by
FT                   prophage CRP28 insertion"
FT   misc_feature    326349..326984
FT                   /gene="lfiI"
FT                   /locus_tag="ROD_02951"
FT                   /note="HMMPfam hit to PF00006, ATPase, F1/V1/A1
FT                   complex,alpha/beta subunit, nucleotide-binding, score
FT                   2.6e-117"
FT                   /inference="protein motif:PFAM:PF00006"
FT   CDS_pept        327257..327700
FT                   /transl_table=11
FT                   /gene="lfiJ"
FT                   /locus_tag="ROD_02961"
FT                   /product="lateral flagellar export/assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02961"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87080"
FT                   /db_xref="GOA:D2TJ74"
FT                   /db_xref="InterPro:IPR012823"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ74"
FT                   /protein_id="CBG87080.1"
FT                   /translation="MRQIIDTLAQLQRLRDKAVKDMTAQLAKQQQLCAGYENNIKALGY
FT                   LIQKTSAGAGAPCVESLKNVTDYKGTLRKVIAWQEQEKTLAKIKEGRIQKNLVAAACQE
FT                   KVVAMTLDEKRNELRDEAFAKEQKAVDEIAGQCWLRNKQLGQR"
FT   CDS_pept        327697..328095
FT                   /transl_table=11
FT                   /gene="tagD"
FT                   /locus_tag="ROD_02971"
FT                   /product="glycerol-3-phosphate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02971"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87081"
FT                   /db_xref="GOA:D2TJ75"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ75"
FT                   /protein_id="CBG87081.1"
FT                   /translation="MKTVITFGTFDVFHVGHLKILQRASALGERLVVGVSSDALNIRKK
FT                   GRAPVYSQSDRMDILAGIKGVDEVFLEESLEQKADYIRRFQADILVMGDDWRGKFDNLS
FT                   WLCKVVYFPRTPSVSTTSIIEVIRIQQD"
FT   misc_feature    327709..328074
FT                   /gene="tagD"
FT                   /locus_tag="ROD_02971"
FT                   /note="HMMPfam hit to PF01467, Cytidylyltransferase, score
FT                   8.7e-21"
FT                   /inference="protein motif:PFAM:PF01467"
FT   CDS_pept        complement(328076..328849)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02981"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02981"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87082"
FT                   /db_xref="InterPro:IPR008441"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ76"
FT                   /protein_id="CBG87082.1"
FT                   /translation="MHIYTYWVNQPGSSMPDYLKLCMQTWIKAIPGVKIVIINHDNIRQ
FT                   YLPGTLLSEAFFNLPLAMQSDVVSVWVLLSRGGMFIDVDTIMTANPFATGAFNEATLYA
FT                   FGYQQRQQIHLAILFCQRRQNPLLYQWITEIGKRLAQPLPSPLPWDWVGNSIINPLLRK
FT                   DEMKPHYEILEAQAFGNILELSVADENPWNRYIKFWFTPPAQPLNELLARVKGGMISLH
FT                   NSWTPEIYRTATLQDIIKSKDSLMLSHLLVNLAGF"
FT   CDS_pept        complement(join(328900..330585,330589..331428))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ROD_03001"
FT                   /product="putative glysosyltransferase (pseudogene)"
FT                   /note="pseudogene, truncated by premature stop codon"
FT   misc_feature    complement(330889..331374)
FT                   /locus_tag="ROD_03001"
FT                   /note="HMMPfam hit to PF00535, Glycosyl transferase, family
FT                   2, score 1.5e-17"
FT                   /inference="protein motif:PFAM:PF00535"
FT   CDS_pept        complement(331504..332448)
FT                   /transl_table=11
FT                   /gene="lafV"
FT                   /locus_tag="ROD_03011"
FT                   /product="lateral flagellar associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03011"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87084"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ77"
FT                   /protein_id="CBG87084.1"
FT                   /translation="MKMIECYEPDFVRTFLSRHPGSPLHTRQVWQDEIRHSLTLTDAAS
FT                   CEAAFGNPHAFALHTSQCEAMPDGQPLSLREQTLNQAALNAVTLPALQPELRLYALGIL
FT                   LSYSEKLPGNSEETLAQIASLPTSLANLARSGKLQQQFALLPSVPQLQCRLITLLGGQE
FT                   FDWQTLPDGARKISLPLQVSLLALQDANSEALLQQQLQAQWQETHERYFAHEAWIFSNY
FT                   LIYRLYHDMFPQHDGEGVAGRYFALACDFFLIRTLFSLWTLDGSSLSHADIFALFALFE
FT                   RWRHSESAAFLRRQAESRLPTDHLLSAFSLLIC"
FT   CDS_pept        complement(332585..333013)
FT                   /transl_table=11
FT                   /gene="lfgN"
FT                   /locus_tag="ROD_03021"
FT                   /product="lateral flagellar chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03021"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87085"
FT                   /db_xref="GOA:D2TJ78"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ78"
FT                   /protein_id="CBG87085.1"
FT                   /translation="MSTRLQQVKMLLQGIREDDTLYDGLRNLLEQQRLCMIRRASEELL
FT                   AVNETIHSHYELLKENSRQRRTLLQLLGVSASRAGMEEVFSWLPAPQKSAARSGWQRLE
FT                   HKAERCKAYNEKNGDLLIRQYVFIQSFLGTEADFIYQP"
FT   CDS_pept        complement(333029..333316)
FT                   /transl_table=11
FT                   /gene="lfgM"
FT                   /locus_tag="ROD_03031"
FT                   /product="lateral flagellar anti-sigma factor 28 protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03031"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87086"
FT                   /db_xref="GOA:D2TJ79"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ79"
FT                   /protein_id="CBG87086.1"
FT                   /translation="MKITPTLSGNRPTPAAADAGNSSKNSAARGAVSATSLSADDITQA
FT                   GLQSAQQALNDDGQGDIDYDKVAQMQAALAAGELSVDTDQLAGDMLNFFR"
FT   misc_feature    complement(333032..333316)
FT                   /gene="lfgM"
FT                   /locus_tag="ROD_03031"
FT                   /note="HMMPfam hit to PF04316, Anti-sigma-28 factor,
FT                   FlgM,score 9.5e-08"
FT                   /inference="protein motif:PFAM:PF04316"
FT   CDS_pept        complement(333412..334182)
FT                   /transl_table=11
FT                   /gene="lfgA"
FT                   /locus_tag="ROD_03041"
FT                   /product="lateral flagellar P-ring addition protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03041"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87087"
FT                   /db_xref="GOA:D2TJ80"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="InterPro:IPR041231"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ80"
FT                   /protein_id="CBG87087.1"
FT                   /translation="MTIQSRRRKTIFRLMTETLLALMLVSPLHAAIRPVQHSAREQINA
FT                   LVLSASGQEIDALARRQQWHDYRYTFNVFIPSAIATAALCPGTPHVTPTSAAEMALSRM
FT                   NFTVSCPGKGGWKVNVAVRPDVYVPVVMPKSLIARDTVITADDVLLKRYNVSGQRSGLL
FT                   MDLNEAIGMTSKRPLQPGKPLNRAQLVAPVLVKRDQPVMIVSRLGGITAAMPGVALKNG
FT                   RKGEVIKIRNAASQRIISGVVDDAGVVSPLNTSG"
FT   misc_feature    complement(333613..333801)
FT                   /gene="lfgA"
FT                   /locus_tag="ROD_03041"
FT                   /note="HMMPfam hit to PF08666, SAF domain, score 1.5e-06"
FT                   /inference="protein motif:PFAM:PF08666"
FT   misc_feature    complement(333910..333978)
FT                   /gene="lfgA"
FT                   /locus_tag="ROD_03041"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD03041 by TMHMM2.0 at aa 69-91"
FT   sig_peptide     complement(334093..334182)
FT                   /gene="lfgA"
FT                   /locus_tag="ROD_03041"
FT                   /note="Signal peptide predicted for ROD03041 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.999 between residues 30 and 31"
FT   CDS_pept        334265..334612
FT                   /transl_table=11
FT                   /gene="lfgB"
FT                   /locus_tag="ROD_03051"
FT                   /product="lateral flagellar rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03051"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87088"
FT                   /db_xref="GOA:D2TJ81"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ81"
FT                   /protein_id="CBG87088.1"
FT                   /translation="MGISFQQALGVHPQAVKLRLERTELLTANLANVDTPNFKAKDIDF
FT                   AAEMQRASRTNVMPEVDVKYRVPMQPSEDGNTVELNTEQARFSQNSMDYQSSLTFLNLQ
FT                   ISGIKEAIEGK"
FT   misc_feature    334307..334369
FT                   /note="PS00588 Flagella basal body rod proteins signature."
FT                   /inference="protein motif:Prosite:PS00588"
FT   CDS_pept        334615..335046
FT                   /transl_table=11
FT                   /gene="lfgC"
FT                   /locus_tag="ROD_03061"
FT                   /product="lateral flagellar basal-body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03061"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87089"
FT                   /db_xref="GOA:D2TJ82"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ82"
FT                   /protein_id="CBG87089.1"
FT                   /translation="MSFTDIYQISGSAMTAQTIRLNTVASNLANAEAPASSEAQAYKAR
FT                   SPVFAAVYNNSLTGAHHRHAIDGASVQVQDVLQSGGAVKRYEPHHPMADNNGYVWYPDV
FT                   NVVEQMADMMSASRDFETNVDVLNNVKSMQQSLLKLGEA"
FT   misc_feature    334918..335034
FT                   /gene="lfgC"
FT                   /locus_tag="ROD_03061"
FT                   /note="HMMPfam hit to PF06429, Protein of unknown function
FT                   DUF1078, C-terminal, score 0.00019"
FT                   /inference="protein motif:PFAM:PF06429"
FT   CDS_pept        335046..335858
FT                   /transl_table=11
FT                   /gene="lfgD"
FT                   /locus_tag="ROD_03071"
FT                   /product="lateral flagellar rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03071"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87090"
FT                   /db_xref="GOA:D2TJ83"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR025963"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ83"
FT                   /protein_id="CBG87090.1"
FT                   /translation="MNALALYTRSQALSAAQEPTAVADNHVDAATSDASSASSTTVTSD
FT                   NSSTTGTATTTTSTESSGVETFLTLFVAEIQNQDPTDPADPTDYIDQLSSMAQVAMMEE
FT                   MSVQANTNAVLMSNIQVMALGNLVGDDIMVQTTTLQVSDSAIEGRVTLDDACTTVDLHF
FT                   IDAAGDDYTVSLLPEGGTSVGPGQVDFDINPADYGIPPGDYDLSVVTNTGEEEVPVEVS
FT                   GEVKDVRIPLDGSTPVLNIDGVGEVPFTMISQFGVPDADNGSDSSDAI"
FT   misc_feature    335160..335606
FT                   /gene="lfgD"
FT                   /locus_tag="ROD_03071"
FT                   /note="HMMPfam hit to PF03963, Flagellar hook capping
FT                   protein, score 2e-11"
FT                   /inference="protein motif:PFAM:PF03963"
FT   CDS_pept        335884..337086
FT                   /transl_table=11
FT                   /gene="lfgE"
FT                   /locus_tag="ROD_03081"
FT                   /product="lateral flagellar hook protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03081"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87091"
FT                   /db_xref="GOA:D2TJ84"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ84"
FT                   /protein_id="CBG87091.1"
FT                   /translation="MSYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTDFSAMYAD
FT                   SQAMGVSVAGTAQSIARGGSMVSTGNALDLAINNGGFFVMCDSAGNITYTRAGSFETDK
FT                   NGYIVNASGACLQGYPVDGSGTLQTGTVTDLQIQTGNIPAQATSNMTFTANFDASDETV
FT                   DRSTMPFDLSNSDSYTDSYTTTVYDSLGNEHSVCQYFTKTDDNSWEVQYSFDGQMESGV
FT                   EPVTLTFDPNTGKLTSPTSPVSVEFETGAAAPIDMTFDYSSCTQYGSDFSVTTNSANGY
FT                   ASATQNGVQVDDDGKVYATYSNGERMLQGQIVLATFPNENGLEAVSGTAWVQTGESGSA
FT                   LIGVPGSGSCGTLSSGMLESSNVDITTELVELMTAQRNYQANTKVISTSTQLDDALFQA
FT                   M"
FT   misc_feature    335890..335982
FT                   /gene="lfgE"
FT                   /locus_tag="ROD_03081"
FT                   /note="HMMPfam hit to PF00460, Flagellar basal body rod
FT                   protein, score 1.4e-06"
FT                   /inference="protein motif:PFAM:PF00460"
FT   misc_feature    336196..336228
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    336391..336726
FT                   /gene="lfgE"
FT                   /locus_tag="ROD_03081"
FT                   /note="HMMPfam hit to PF07559, Flagellar basal body
FT                   FlaE,score 1.2e-24"
FT                   /inference="protein motif:PFAM:PF07559"
FT   misc_feature    336901..336933
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    336964..337080
FT                   /gene="lfgE"
FT                   /locus_tag="ROD_03081"
FT                   /note="HMMPfam hit to PF06429, Protein of unknown function
FT                   DUF1078, C-terminal, score 1.7e-15"
FT                   /inference="protein motif:PFAM:PF06429"
FT   CDS_pept        join(337098..337622,337626..337832)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="lfgF"
FT                   /locus_tag="ROD_03091"
FT                   /product="lateral flagellar rod protein (pseudogene)"
FT                   /note="pseudogene, truncated by premature stop codon"
FT   misc_feature    337110..337202
FT                   /gene="lfgF"
FT                   /locus_tag="ROD_03091"
FT                   /note="HMMPfam hit to PF00460, Flagellar basal body rod
FT                   protein, score 1.9e-07"
FT                   /inference="protein motif:PFAM:PF00460"
FT   CDS_pept        337866..338651
FT                   /transl_table=11
FT                   /gene="lfgG"
FT                   /locus_tag="ROD_03111"
FT                   /product="lateral flagellar rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03111"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87093"
FT                   /db_xref="GOA:D2TJ85"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ85"
FT                   /protein_id="CBG87093.1"
FT                   /translation="MNAALWISKTGLSAQDAEMSAIANNIANVNTTGFKRDRVMFQDLF
FT                   YQTQEAPGAMLDQNNIMPTGMQFGSGVRIVGTQKTFTEGNVETTDNAMNVAIMGQGFLQ
FT                   VQKANGDIAYTRDGNLQINADGVLTNSQGLPLQPEIDVPAGATSVAFGEDGTVTAILPG
FT                   DSDPTELGQLTLVNFANPAGLSAEGDNLYLETAASGQPTEGIPGEDGLGTLQGNALEGS
FT                   NVDIVNEMVAMITVQRAYEMNAKMVSAADDMLQFISQTL"
FT   misc_feature    337878..337970
FT                   /gene="lfgG"
FT                   /locus_tag="ROD_03111"
FT                   /note="HMMPfam hit to PF00460, Flagellar basal body rod
FT                   protein, score 4.2e-13"
FT                   /inference="protein motif:PFAM:PF00460"
FT   misc_feature    337896..337958
FT                   /note="PS00588 Flagella basal body rod proteins signature."
FT                   /inference="protein motif:Prosite:PS00588"
FT   misc_feature    338529..338645
FT                   /gene="lfgG"
FT                   /locus_tag="ROD_03111"
FT                   /note="HMMPfam hit to PF06429, Protein of unknown function
FT                   DUF1078, C-terminal, score 7.8e-17"
FT                   /inference="protein motif:PFAM:PF06429"
FT   CDS_pept        338708..339373
FT                   /transl_table=11
FT                   /gene="lfgH"
FT                   /locus_tag="ROD_03121"
FT                   /product="lateral flagellar L-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03121"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87094"
FT                   /db_xref="GOA:D2TJ86"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ86"
FT                   /protein_id="CBG87094.1"
FT                   /translation="MKNYLWLIALLPLLSGCESQTLLVKKNDEFFAPPKAEAPPPAAGR
FT                   AGGVFETGYNWSLTADRRAYRVGDILTVLLEESTQSSKQAKTNFGKNNTVDIGAPTFFG
FT                   HTKKNLSGSIDANRDFDGSATSQQQNSLRGEITVSVHSVQPNGILEIRGEKWLTLNQGD
FT                   EYIRLSGLVRADDIQNDNSVSSQRIADARISYAGRGALSDANAAGWLTRLFNHPLFPI"
FT   sig_peptide     338708..338764
FT                   /gene="lfgH"
FT                   /locus_tag="ROD_03121"
FT                   /note="Signal peptide predicted for ROD03121 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.640) with cleavage site
FT                   probability 0.484 between residues 19 and 20"
FT   misc_feature    338726..338758
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    338762..339367
FT                   /gene="lfgH"
FT                   /locus_tag="ROD_03121"
FT                   /note="HMMPfam hit to PF02107, Flagellar L-ring
FT                   protein,score 1.2e-40"
FT                   /inference="protein motif:PFAM:PF02107"
FT   CDS_pept        339373..340509
FT                   /transl_table=11
FT                   /gene="lfgI"
FT                   /locus_tag="ROD_03131"
FT                   /product="lateral flagellar P-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03131"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87095"
FT                   /db_xref="GOA:D2TJ87"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ87"
FT                   /protein_id="CBG87095.1"
FT                   /translation="MQESEMQHTSGRWMQALYGVAIALTLALPGMAQAQSLESLVNVQG
FT                   VRENQLVGYSLVVGLDGTGDKNQVKFTNQTITNMLRQFGVQLPNKIDPKVKNVAAVAVS
FT                   AVLPPMYSRGQTIDVTVSSIGDAKSLRGGTLLLTQLHGADGEVYALAQGSVVVGGMNAT
FT                   GASGSSVTVNTPTAGLIPNGATVEREIPSDFQMGDTITLNLKRPSFKDANNIAGAINAV
FT                   FGGIATAQSSTNVVVRAPTSPGARVAFMSQLDDVQVQAEKVRARVVFNSRTGTVVMGDG
FT                   IALHAAAVSHGSLTVSINETSNVSQPNALAGGRTAVTPQSNIAVNHARPGMISLPESSS
FT                   LKTLVNALNSLGATPDDIMSILQALHEAGALDADLEVI"
FT   sig_peptide     339373..339474
FT                   /gene="lfgI"
FT                   /locus_tag="ROD_03131"
FT                   /note="Signal peptide predicted for ROD03131 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.972) with cleavage site
FT                   probability 0.958 between residues 34 and 35"
FT   misc_feature    339409..339468
FT                   /gene="lfgI"
FT                   /locus_tag="ROD_03131"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD03131 by TMHMM2.0 at aa 13-32"
FT   misc_feature    339490..340506
FT                   /gene="lfgI"
FT                   /locus_tag="ROD_03131"
FT                   /note="HMMPfam hit to PF02119, Flagellar P-ring
FT                   protein,score 8.4e-163"
FT                   /inference="protein motif:PFAM:PF02119"
FT   CDS_pept        340509..340823
FT                   /transl_table=11
FT                   /gene="lfgJ"
FT                   /locus_tag="ROD_03141"
FT                   /product="lateral flagellar peptidoglycan hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03141"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87096"
FT                   /db_xref="GOA:D2TJ88"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ88"
FT                   /protein_id="CBG87096.1"
FT                   /translation="MSQFKVDHGGGVSGHDALMGPQIRNHDMQKAAEQFEAIFLRNMLK
FT                   EMRKTNEIFDSKDNPFNSDSVRMMQGFYDDQLCNTLAQQHGIGIAAMIVKQLSGHHSKG
FT                   "
FT   CDS_pept        340923..342290
FT                   /transl_table=11
FT                   /gene="lfgK"
FT                   /locus_tag="ROD_03151"
FT                   /product="lateral flagellar hook associated protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03151"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87097"
FT                   /db_xref="GOA:D2TJ89"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ89"
FT                   /protein_id="CBG87097.1"
FT                   /translation="MDMINIGYSGASTAQVELNVTAQNTANAMTDGYTRQVAVVSSIGA
FT                   SAGSPNSAGNGVQVDSIRRVSNQYQVNQVWYAASDYGYYSTRQEYLTQLETVLSDENSS
FT                   LSGGFDNFFAALNEATTSPDDAALREQVLSESGALALRIDNTLAYIDSQSDEIVSQEQA
FT                   MVTQINTLTSGIANYNKQIAQAEANGDNASALYDARDQMVEQLSGIMDVQVNIDDKGNY
FT                   NVTLTNGQPLVSGQQSSTIALETSADGSRSMSLTFAGTTASMTTDTGGSLGALFDYQNQ
FT                   VLTPLSDTINSMAAQFADAVNSQLAQGYDLNGNPGEPLFIYDAASSDGPLVVNPDITAD
FT                   KLAFSSSPDESGNSDNLQALIAISTRPLEIANLGEVSVGEACSAIISNIGIFSQQNQTE
FT                   AQAAANVYSEAQNQQSSVSMDEEAVNLITYQQIYEANLKVISAGAEIFDSVLEMCN"
FT   misc_feature    340932..341024
FT                   /gene="lfgK"
FT                   /locus_tag="ROD_03151"
FT                   /note="HMMPfam hit to PF00460, Flagellar basal body rod
FT                   protein, score 0.00016"
FT                   /inference="protein motif:PFAM:PF00460"
FT   misc_feature    342165..342281
FT                   /gene="lfgK"
FT                   /locus_tag="ROD_03151"
FT                   /note="HMMPfam hit to PF06429, Protein of unknown function
FT                   DUF1078, C-terminal, score 2.1e-13"
FT                   /inference="protein motif:PFAM:PF06429"
FT   CDS_pept        342305..343234
FT                   /transl_table=11
FT                   /gene="lfgL"
FT                   /locus_tag="ROD_03161"
FT                   /product="lateral flagellar hook associated protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03161"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87098"
FT                   /db_xref="GOA:D2TJ90"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ90"
FT                   /protein_id="CBG87098.1"
FT                   /translation="MRVTAQQSYVSMTRNFNDLSGDLAHVVTQMATGKSILLPSDDPIA
FT                   STRITQLNRQQSAIEQYQNNIDSASAGMSQQESILDGVNNALLSVRDDLLEAANGTNTA
FT                   DSLASLGQDIASLTESMVAALNYQDEDGHYVFGGTVNDKPPILAVDDDGDGVTDSYSYQ
FT                   GNGDHRQTTVSNGVEVDTNVAVSDFFGSSLDVLNTLNALSQELQDPSLDPADPQIQSDI
FT                   ASAIDVVDQAADSLNASVASLGETQNTMTMLSGAQTDIATSNDQLIGSLSDLDYGPASI
FT                   TFTGLEMAMEATLKTYSKVSELNLFSVL"
FT   misc_feature    342383..342796
FT                   /gene="lfgL"
FT                   /locus_tag="ROD_03161"
FT                   /note="HMMPfam hit to PF00669, Flagellin, N-terminal, score
FT                   2.5e-05"
FT                   /inference="protein motif:PFAM:PF00669"
FT   CDS_pept        343303..344304
FT                   /transl_table=11
FT                   /gene="lafW"
FT                   /locus_tag="ROD_03171"
FT                   /product="lateral flagellar putative hook associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03171"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87099"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ91"
FT                   /protein_id="CBG87099.1"
FT                   /translation="MQVGLNTSSLSAGGALSSPVGQHAVAQNTPVRQKPSVVASDYPAS
FT                   PLIATRPQRYSVQLNDQITTLQQADHYLGQLEQQLLDYRHTTRRGGQGPQQKGTEIARL
FT                   LEQRVTLAGGAVDRQLKPVLQGEARVVFHAPELVQMVQERAPGGKMFRISDGRQTQLAA
FT                   VAVGEENDGGQYRVMMNNALRRVGIQLHERHGSVAFSTAEAKWPQIAQTLSVHQEGETP
FT                   SSFTPLNAFAEPSLADDLLQSVRQGGSRSGDAVQQALDTIGEQRAQMAVQQEKARQLID
FT                   KMARFPQAESAVQASTTLGGVLDNASHNYQILAQAVNGQARLSSQTVRNLLR"
FT   sig_peptide     343303..343380
FT                   /gene="lafW"
FT                   /locus_tag="ROD_03171"
FT                   /note="Signal peptide predicted for ROD03171 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.977) with cleavage site
FT                   probability 0.542 between residues 26 and 27"
FT   CDS_pept        complement(344301..344774)
FT                   /transl_table=11
FT                   /locus_tag="ROD_03181"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03181"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87100"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ92"
FT                   /protein_id="CBG87100.1"
FT                   /translation="MKCLNAIKPLFPVLLLSALPVSFCAMANIENTVIANYDLATGKSS
FT                   HYDLLISQNGAESTVTVLPFGMSDNSPSIFKVSTCINRFAGTTKQGEFRFSAAETNKND
FT                   VRLSNIGYFVNEHNLRTWWIRLNDKQNLMFNEDVGGMMIANAGLFNNQLCPLD"
FT   misc_feature    complement(344304..344315)
FT                   /note="PS00294 Prenyl group binding site (CAAX box)."
FT                   /inference="protein motif:Prosite:PS00294"
FT   sig_peptide     complement(344694..344774)
FT                   /locus_tag="ROD_03181"
FT                   /note="Signal peptide predicted for ROD03181 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 27 and 28"
FT   CDS_pept        complement(344752..345729)
FT                   /transl_table=11
FT                   /gene="lafZ"
FT                   /locus_tag="ROD_03191"
FT                   /product="lateral flagellar transmembrane regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03191"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87101"
FT                   /db_xref="GOA:D2TJ93"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ93"
FT                   /protein_id="CBG87101.1"
FT                   /translation="MNIAQVDKTMSIVVNNWRMDSSLNALIHCETGETRRLGEYHFILL
FT                   ETLAKNADSVLSRSYLMAEVWKNRIVGGNSLPTAIHALRVAIDDDGKQQEIIKTIPKKG
FT                   YLFNKDYLTIEYSSEAAEHVVLSENKNKENLTTTDFTAAEATAPWPLTADEAADQQLPS
FT                   TAVVPPPAEPSRRRNTLFIGAGIAVIALFLLSLIYYFQAPTTPVSPDSPRLVKETFDHA
FT                   DNMEIYHLYTSTTNKKSTSLLAQHISPAIARINELLKARNAKLTLYYKFALNKFTLDMV
FT                   LDNQCDSKWQLALNFENWQNKDNETNTVMYQEVEKMLNEMPECN"
FT   misc_feature    complement(345124..345192)
FT                   /gene="lafZ"
FT                   /locus_tag="ROD_03191"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD03191 by TMHMM2.0 at aa 180-202"
FT   misc_feature    complement(345409..345636)
FT                   /gene="lafZ"
FT                   /locus_tag="ROD_03191"
FT                   /note="HMMPfam hit to PF00486, Transcriptional regulatory
FT                   protein, C-terminal, score 8.4e-12"
FT                   /inference="protein motif:PFAM:PF00486"
FT   CDS_pept        346129..346272
FT                   /transl_table=11
FT                   /locus_tag="ROD_03201"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03201"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87102"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ94"
FT                   /protein_id="CBG87102.1"
FT                   /translation="MGNMKSRPFVALARFSLAIRAVANGENFFCADFKFSAGEVVFTGY
FT                   RS"
FT   sig_peptide     346129..346197
FT                   /locus_tag="ROD_03201"
FT                   /note="Signal peptide predicted for ROD03201 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.855) with cleavage site
FT                   probability 0.565 between residues 23 and 24"
FT   CDS_pept        346300..347205
FT                   /transl_table=11
FT                   /gene="lafA"
FT                   /locus_tag="ROD_03211"
FT                   /product="lateral flagellar flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03211"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87103"
FT                   /db_xref="GOA:D2TJ95"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ95"
FT                   /protein_id="CBG87103.1"
FT                   /translation="MLSINTNNASMAAVNAINKSNSSLSTSMERLATGNRINSSADDAA
FT                   GKQIANRLTAQSSGMGVALSNINDATAMLQTADSMFDEMSDVLGRMKDLATQAANGTYN
FT                   DDDLQAMQDEFDELGQQMSDMLQNTTYGGTNLFGVSGTSNTGEAGLFQSAVTFQVGAES
FT                   SDTMTVDISSQLGTLVDDLSAVSASFVADQAGGTTISGGTELTASGSANSMISTISTAM
FT                   DDVSKIQSKLGASINRLNDTANNLTSMQDNTEVAIGNIMDTDYATEASNMTKQQVLMQT
FT                   GITMLKQSNSMSSMVSSLLQ"
FT   misc_feature    346381..346824
FT                   /gene="lafA"
FT                   /locus_tag="ROD_03211"
FT                   /note="HMMPfam hit to PF00669, Flagellin, N-terminal, score
FT                   1.5e-42"
FT                   /inference="protein motif:PFAM:PF00669"
FT   misc_feature    346921..347136
FT                   /gene="lafA"
FT                   /locus_tag="ROD_03211"
FT                   /note="HMMPfam hit to PF00700, Flagellin, C-terminal, score
FT                   5.6e-23"
FT                   /inference="protein motif:PFAM:PF00700"
FT   CDS_pept        347410..348729
FT                   /transl_table=11
FT                   /gene="lafB"
FT                   /locus_tag="ROD_03221"
FT                   /product="lateral flagellar hook associated protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03221"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87104"
FT                   /db_xref="GOA:D2TJ96"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ96"
FT                   /protein_id="CBG87104.1"
FT                   /translation="MINPRTIAQEIAYADVATQAANLQKQQSELDAESNGLDTLSSALN
FT                   DFQTAIDALNSDTDGPVTFSATANNDSATITANSQAQAGTYSFYVEQLAQAQQSTFDLS
FT                   DDTFSATGTFELTMGDSTMDIDLAAADQNGDGDGYIDASELVSAINHSDDNPGVSAALV
FT                   KTDGATTIMLTSETTGAQSAFSVSISGHDASGDTSATAPTLTEMTAAQDAIIHLGSATG
FT                   PAITNSTNTFNDVIPGVSMTFSEVTGENDDLTTFTVAEDSSGTQAKVQTFVDAYNTLVD
FT                   TVDSLTSSGSDSTSAGIFAGDSGLKSLTSQLDDLAHASYGGVSIVDYGITLDAHGHLQI
FT                   DSDAFNEAMEENPEGLTAIFVGDDSMVAQMDELMESYLDSSNGILTLRQQNIDDQQDKI
FT                   QSEADRLTETYNNNYERYVEEYTNTLIEVYTMQTSMAAFM"
FT   misc_feature    347413..347703
FT                   /gene="lafB"
FT                   /locus_tag="ROD_03221"
FT                   /note="HMMPfam hit to PF02465, Flagellar hook-associated
FT                   protein 2, N-terminal, score 5.7e-09"
FT                   /inference="protein motif:PFAM:PF02465"
FT   misc_feature    348037..348681
FT                   /gene="lafB"
FT                   /locus_tag="ROD_03221"
FT                   /note="HMMPfam hit to PF07195, Flagellar hook-associated
FT                   2,C-terminal, score 8.8e-54"
FT                   /inference="protein motif:PFAM:PF07195"
FT   CDS_pept        348763..349155
FT                   /transl_table=11
FT                   /gene="lafC"
FT                   /locus_tag="ROD_03231"
FT                   /product="lateral flagellar chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03231"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87105"
FT                   /db_xref="GOA:D2TJ97"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ97"
FT                   /protein_id="CBG87105.1"
FT                   /translation="MYDTQDGYSQYKEIDLAARTAAASPLELVLVLFSGLMDELERAKS
FT                   HIENKRFEKKAQSINKCIDILNALTSSLEFETGGELVVNLSRLYDHCVFRLYEASGELS
FT                   LEKIDEVILILSNLREGWDGLSEKLG"
FT   misc_feature    348772..349149
FT                   /gene="lafC"
FT                   /locus_tag="ROD_03231"
FT                   /note="HMMPfam hit to PF02561, Flagellar protein FliS,score
FT                   1.1e-20"
FT                   /inference="protein motif:PFAM:PF02561"
FT   CDS_pept        349160..349477
FT                   /transl_table=11
FT                   /gene="lafD"
FT                   /locus_tag="ROD_03241"
FT                   /product="lateral flagellar chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03241"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87106"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ98"
FT                   /protein_id="CBG87106.1"
FT                   /translation="MDRESQQRQLFALIDAMNEALDKQRWRRLPALRQQLMRQFAQYQA
FT                   QESSETELRAVKERLRAAFADLIERRSERAALLKARMDKHQQLQEGVLAYSMMTLISEK
FT                   A"
FT   CDS_pept        349474..350625
FT                   /transl_table=11
FT                   /gene="lafE"
FT                   /locus_tag="ROD_03251"
FT                   /product="lateral flagellar hook length control protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03251"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87107"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ99"
FT                   /protein_id="CBG87107.1"
FT                   /translation="MNPVLLAASGALADTVPEKGATPAPNGAQRAGTFSLSPTATGEAA
FT                   ERLRGAKINQQRAHNGEREQVNDPAAMQVLMALLLTPPTQPAEQMPLPGGEIVKMLAAG
FT                   QTQAGVATAGLRQLADALTQKGSDGQQNPRDLASLLPTLQEVLATLSQQTPQAGATPEQ
FT                   QAALATFSAQNLRAIAPGQPSTSQQFAARAKQTDGSVAPRPLAMKKNDDVTLHAPAAQN
FT                   LLNVAVQNPQPLNATVSHSITVAHVSLPTAISGDELGEKLTALLKDRIQFQIGQQQQIS
FT                   TIRLDPPSLGKLEIAVQLDAGKLMVHIGASQSDVCRSLQQFSNDLRQHLTAQNFMEVNV
FT                   QVSSEGQSQQQQQPGHQQEEVLSALSLSDEPQFQQNESVLIKV"
FT   misc_feature    350239..350505
FT                   /gene="lafE"
FT                   /locus_tag="ROD_03251"
FT                   /note="HMMPfam hit to PF02120, Flagellar hook-length
FT                   control protein, score 8.3e-13"
FT                   /inference="protein motif:PFAM:PF02120"
FT   CDS_pept        350633..351097
FT                   /transl_table=11
FT                   /gene="lafF"
FT                   /locus_tag="ROD_03261"
FT                   /product="lateral flagellar associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03261"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87108"
FT                   /db_xref="GOA:D2TJA0"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJA0"
FT                   /protein_id="CBG87108.1"
FT                   /translation="MKRIVMASVISSIMALVVGGGAGWGVYHFAGNGKTATAAHAEAVE
FT                   KMDESKSIFVSLQETIVTLHDNDGADHYMSAELVMVVASEKESEQIKQQEPLYQSIAVE
FT                   RLSEMKYEEIRALKISEIRKLIAEALQKELKDRKIAAPYKDILVKKVVFQ"
FT   sig_peptide     350633..350692
FT                   /gene="lafF"
FT                   /locus_tag="ROD_03261"
FT                   /note="Signal peptide predicted for ROD03261 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.979) with cleavage site
FT                   probability 0.449 between residues 20 and 21"
FT   misc_feature    350645..350713
FT                   /gene="lafF"
FT                   /locus_tag="ROD_03261"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD03261 by TMHMM2.0 at aa 5-27"
FT   misc_feature    350648..351094
FT                   /gene="lafF"
FT                   /locus_tag="ROD_03261"
FT                   /note="HMMPfam hit to PF03748, Flagellar basal
FT                   body-associated protein FliL, score 2.6e-05"
FT                   /inference="protein motif:PFAM:PF03748"
FT   CDS_pept        351118..351834
FT                   /transl_table=11
FT                   /gene="lafS"
FT                   /locus_tag="ROD_03271"
FT                   /product="lateral flagellar sigma factor 28 protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03271"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87109"
FT                   /db_xref="GOA:D2TJY1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012845"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJY1"
FT                   /protein_id="CBG87109.1"
FT                   /translation="MLQDAYESEEFSATPVLTPQQESHYLQAYLPLVRKVVRQLAPQCT
FT                   CVIDRQDMEQTALLGLLNAIRRYGMPDEGFAGYAIHRIRGAILDELRSLDWRPRLLRQK
FT                   YHQIKDLIRDMRKQLGREPEWQELSQTGLTPEDYLEFQQLEGAETLASLDELLSGEGHG
FT                   ALPEGRGLEEQFVNQEMLSYALGQLSEKEGLVLSMYYQHDMNLKEIALVLGLTEARICQ
FT                   MNKKITQKIRDCLYPD"
FT   misc_feature    351190..351408
FT                   /gene="lafS"
FT                   /locus_tag="ROD_03271"
FT                   /note="HMMPfam hit to PF04542, RNA polymerase sigma-70
FT                   region 2, score 1.1e-12"
FT                   /inference="protein motif:PFAM:PF04542"
FT   misc_feature    351667..351816
FT                   /gene="lafS"
FT                   /locus_tag="ROD_03271"
FT                   /note="HMMPfam hit to PF04545, RNA polymerase sigma-70
FT                   region 4, score 2e-12"
FT                   /inference="protein motif:PFAM:PF04545"
FT   misc_feature    351727..351792
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1465.000, SD 4.18 at aa 204-225, sequence
FT                   MNLKEIALVLGLTEARICQMNK"
FT   CDS_pept        351863..352726
FT                   /transl_table=11
FT                   /gene="lafT"
FT                   /locus_tag="ROD_03281"
FT                   /product="lateral flagellar motor protein A"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03281"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87110"
FT                   /db_xref="GOA:D2TJY2"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJY2"
FT                   /protein_id="CBG87110.1"
FT                   /translation="MQKVLGLLVVLGCVFGGYFEAGGQLIAIWQPAEIVIILGAGFGAM
FT                   IIGNPKHVLKEIAHQIKGVIGKKQLGPEFQRQLLMCLYELLEMVQNGGLRMLDQHIEQP
FT                   EESTVFQKYPQVLTQKRLVTFIADNFRLMAMGKIDAHELEGILDQELDTVEEELLAPSR
FT                   SLQRTAEAMPGFGICAAVLGIIITMQSIDGSIALIGLKVAAALVGTFLGVFFCYCLMDP
FT                   LANSMEQQARAEHSLLECVRTVLVAQAGGKPTLLAVDAGRKLLHLASKPTFANLDAWVN
FT                   AMLEQE"
FT   sig_peptide     351863..351922
FT                   /gene="lafT"
FT                   /locus_tag="ROD_03281"
FT                   /note="Signal peptide predicted for ROD03281 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.603) with cleavage site
FT                   probability 0.481 between residues 20 and 21"
FT   misc_feature    join(351875..351928,351938..352006,352376..352435,
FT                   352445..352513)
FT                   /gene="lafT"
FT                   /locus_tag="ROD_03281"
FT                   /note="4 probable transmembrane helices predicted for
FT                   ROD03281 by TMHMM2.0 at aa 5-22, 26-48, 172-191 and
FT                   195-217"
FT   misc_feature    352205..352591
FT                   /gene="lafT"
FT                   /locus_tag="ROD_03281"
FT                   /note="HMMPfam hit to PF01618, MotA/TolQ/ExbB proton
FT                   channel, score 0.001"
FT                   /inference="protein motif:PFAM:PF01618"
FT   misc_feature    352475..352528
FT                   /note="PS01307 Flagellar motor protein motA family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01307"
FT   CDS_pept        352729..353724
FT                   /transl_table=11
FT                   /gene="lafU"
FT                   /locus_tag="ROD_03291"
FT                   /product="lateral flagellar motor protein B"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03291"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87111"
FT                   /db_xref="GOA:D2TJY3"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJY3"
FT                   /protein_id="CBG87111.1"
FT                   /translation="MRKAANRRDRGAKTTIIRRQIKKNHGGHHGGAWKVAFADFTLAMM
FT                   ALFMTLWIVNSVSKTERENIVAALHGQSIFNGGGLAPLNKIGKQTIVPGASSKSVTRSR
FT                   PDKASPAKEEVKVSEEVAKKAKDVNEKTALLKKKSATELGELATSIQSIARKAHMETNL
FT                   EMEIVPQGLRVLIKDDKNRNMFERGSARIMPFFQSLLTELAPVFDSLDNKIIITGHTDA
FT                   MAYKSDIYNNWNLSGDRALSARRVLEQAGMPEDKVMQVSAMADQMLLDAKNPESAGNRR
FT                   IEIMVLTKSASDTLYQYFGQHGEKVVQPLVDKLDKQQQVTSLRHRPPTAQ"
FT   misc_feature    352822..352890
FT                   /gene="lafU"
FT                   /locus_tag="ROD_03291"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD03291 by TMHMM2.0 at aa 32-54"
FT   misc_feature    353278..353568
FT                   /gene="lafU"
FT                   /locus_tag="ROD_03291"
FT                   /note="HMMPfam hit to PF00691, Outer membrane
FT                   protein,OmpA/MotB, C-terminal, score 5.3e-21"
FT                   /inference="protein motif:PFAM:PF00691"
FT   CDS_pept        353776..354417
FT                   /transl_table=11
FT                   /locus_tag="ROD_03301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03301"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87112"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJY4"
FT                   /protein_id="CBG87112.1"
FT                   /translation="MIDASEIIPLDIHDGQIADAVCQGAHYDAHSGVWYVEPHELTDAL
FT                   RNFAYDAVDFNIVAPYYLVITSKVQCSSCRQPTDIIAVMFTRYLKKSQDGRRWLSVTGN
FT                   SFLFHINQLPEAIRKNIKAKNYYPDKSKTSGLRYWMNHCEVCGERLSDYALFCVEEDLF
FT                   KRMPVERLLKADIRKVKRMFVCQAGNPADDSRPCPVNFTCEARFRLRGPR"
FT   CDS_pept        354499..355554
FT                   /transl_table=11
FT                   /gene="dbh"
FT                   /locus_tag="ROD_03311"
FT                   /product="DNA polymerase IV"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03311"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87113"
FT                   /db_xref="GOA:D2TJY5"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJY5"
FT                   /protein_id="CBG87113.1"
FT                   /translation="MRKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTAN
FT                   YPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASEHIREIFSRYTSRIEPLSLDE
FT                   AYLDVTDSTHCHGSATLIAREIRQTIFNELQLTASAGVAPVKFLAKIASDLNKPNGQYV
FT                   ITPEDVSDFLRTLPLAKIPGVGKVSAAKLEEMGLRTCGDVQQCDLALLLKRFGKFGRII
FT                   RERSQGIDERDVNSERLRKSVGVERTMAEDIHHWPECEAIIERLYPELERRLAKVKPDL
FT                   LIARQGVKLKFNDFQQTTQEHVWPQLNKADLIATARKTWDERRGGRGVRLVGLHVTLLD
FT                   PQLERQLLLGL"
FT   misc_feature    354517..355521
FT                   /gene="dbh"
FT                   /locus_tag="ROD_03311"
FT                   /note="HMMPfam hit to PF00817, UMUC-like DNA-repair
FT                   protein, score 1.5e-137"
FT                   /inference="protein motif:PFAM:PF00817"
FT   CDS_pept        complement(355648..357105)
FT                   /transl_table=11
FT                   /gene="pepD"
FT                   /locus_tag="ROD_03321"
FT                   /product="aminoacyl-histidine dipeptidase"
FT                   /EC_number="3.4.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03321"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87114"
FT                   /db_xref="GOA:D2TJY6"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJY6"
FT                   /protein_id="CBG87114.1"
FT                   /translation="MSELSQLSPQPLWDIFAKICSIPHPSYHEEQLAEYIVGWAKEKGF
FT                   HVERDQVGNILIRKPATAGMEDRKPVVLQAHLDMVPQKNNDTVHDFTKDPIQPYIDGEW
FT                   VKARGTTLGADNGIGMASALAVLTDDSVVHGPLEVLLTMTEEAGMDGAFGLQANWLQAD
FT                   ILINTDSEEEGEIYMGCAGGIDFTSNLKLAREAVPAGFQSFKLTLKGLKGGHSGGEIHV
FT                   GLGNANKLLVRFLAGHAEELDLRLVDFNGGTLRNAIPREAFATVAVAADKVDTLKARVS
FT                   AYQDILKNELAEKEKNLALLLDAAVNDKAALTAQSRDSFIRLLNATPNGVIRNSDVAKG
FT                   VVETSLNVGVVTMTDDNVEIHCLIRSLIDSGKDYVVSMLDSLGKLAGAKTEAKGGYPGW
FT                   QPDASSPVMHLVRETYQRLFNKTPNIQIIHAGLECGLFKKPYPEMDMVSIGPTITGPHS
FT                   PDEQVHIESVAHYWTLLTELLKAIPAK"
FT   misc_feature    complement(355663..356892)
FT                   /gene="pepD"
FT                   /locus_tag="ROD_03321"
FT                   /note="HMMPfam hit to PF01546, Peptidase M20, score
FT                   1.4e-09"
FT                   /inference="protein motif:PFAM:PF01546"
FT   misc_feature    complement(356221..356490)
FT                   /gene="pepD"
FT                   /locus_tag="ROD_03321"
FT                   /note="HMMPfam hit to PF07687, Peptidase M20,
FT                   dimerisation,score 1.2e-15"
FT                   /inference="protein motif:PFAM:PF07687"
FT   CDS_pept        357370..357828
FT                   /transl_table=11
FT                   /gene="gpt"
FT                   /locus_tag="ROD_03331"
FT                   /product="xanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.22"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03331"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87115"
FT                   /db_xref="GOA:D2TJY7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023747"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJY7"
FT                   /protein_id="CBG87115.1"
FT                   /translation="MSEKYVVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGAL
FT                   LARELGIRHVDTVCISSYDHDNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMY
FT                   PKAHFVTIFAKPAGRPLVDDYVIDIPQDTWIEQPWDMGVVFVPPISGR"
FT   misc_feature    357370..357759
FT                   /gene="gpt"
FT                   /locus_tag="ROD_03331"
FT                   /note="HMMPfam hit to PF00156,
FT                   Phosphoribosyltransferase,score 3.1e-19"
FT                   /inference="protein motif:PFAM:PF00156"
FT   misc_feature    357619..357657
FT                   /note="PS00103 Purine/pyrimidine phosphoribosyl
FT                   transferases signature."
FT                   /inference="protein motif:Prosite:PS00103"
FT   CDS_pept        357928..359172
FT                   /transl_table=11
FT                   /gene="frsA"
FT                   /locus_tag="ROD_03341"
FT                   /product="esterase"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03341"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87116"
FT                   /db_xref="GOA:D2TJY8"
FT                   /db_xref="InterPro:IPR010520"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJY8"
FT                   /protein_id="CBG87116.1"
FT                   /translation="MTQANLSETLFKPRFKHPETSTLVRRFNAGTQPPVQSTLDGKNVP
FT                   HWYRMINRLMWIWRGVDPREILDVQARIVMSQAERTDDDLYDTVVGYRGGNWIYEWSKQ
FT                   AMEWQQKAGQEEDAGRSGRYWLHASTLYNIAAYPHLKGDELAEQAQALANRAYEEAAQR
FT                   LPGALREMTFTVPGGAPVSGFLHMPKGDGPFPTVLMCGGLDALQTDYYTLYERYFAPRG
FT                   IAMLTLDMPSVGFSSKWKLTQDSSLLHQHVLKALPDVPWVDHTRVAAFGFRFGANVAVR
FT                   LAYLESPRLKAVACLGPVVHALLSDAQRQRAVPEMYLDVLASRLGMHDASDEALCVELN
FT                   RYSLKVQGLLGRRCPTPMLSGFWKNDPFSPEEESRLITSSSADGKLLEIPFNPVYRNFD
FT                   KALQEITHWIEKRLC"
FT   misc_feature    357928..359169
FT                   /gene="frsA"
FT                   /locus_tag="ROD_03341"
FT                   /note="HMMPfam hit to PF06500, Protein of unknown function
FT                   DUF1100, hydrolase-like, score 4e-303"
FT                   /inference="protein motif:PFAM:PF06500"
FT   CDS_pept        359230..359631
FT                   /transl_table=11
FT                   /gene="crl"
FT                   /locus_tag="ROD_03351"
FT                   /product="sigma factor-binding protein crl (curlin genes
FT                   transcriptional activator)"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03351"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87117"
FT                   /db_xref="GOA:D2TJY9"
FT                   /db_xref="InterPro:IPR009986"
FT                   /db_xref="InterPro:IPR038208"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJY9"
FT                   /protein_id="CBG87117.1"
FT                   /translation="MTLPCGHPRSRLIKKFTALGPYIREGKCEDNRFFFDCLAVCVNVK
FT                   PAPELREFWGWWMELEAQENRFTYSYKFGLFDKAGDWTAVPIKDAEVVERLEHTLREFH
FT                   EKLRELLNSLELSLEPADDFTDEPVKLSA"
FT   misc_feature    359233..359628
FT                   /gene="crl"
FT                   /locus_tag="ROD_03351"
FT                   /note="HMMPfam hit to PF07417, Transcriptional regulator
FT                   Crl, score 3.7e-92"
FT                   /inference="protein motif:PFAM:PF07417"
FT   CDS_pept        complement(359682..360734)
FT                   /transl_table=11
FT                   /gene="phoE"
FT                   /locus_tag="ROD_03361"
FT                   /product="outer membrane pore protein E"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03361"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87118"
FT                   /db_xref="GOA:D2TJZ0"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR001897"
FT                   /db_xref="InterPro:IPR013793"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJZ0"
FT                   /protein_id="CBG87118.1"
FT                   /translation="MKKSTLALVVMGMAASASVQAAEVYNKNGNKLDVYGKVKAMHYFS
FT                   DDNAKDGDQTYVRFGFKGETQINDQLTGYGRWEAEFAGNKPESESGQKTRLAFAGLKFG
FT                   EYGSFDYGRNLGALYDVAAWTDMFPEFGGDGMAQTDNFMTKRASGLATYRNTDFFGLVD
FT                   GLNLTLQYQGKNENRDVKKQNGDGFGTSLSYDFGGSDFAIIGAYANFDRTNEQNLQARG
FT                   QGQNAEGWATGLKYDANNVYLATIYSETRNMAPISGGFANKAQNFEAVAQYQFDFGLRP
FT                   SVGYVQSKGKDIEGIGDEDIVKYIDVGMTYYFNKNMSAFVDYKINQIDDDNQLGVSSDD
FT                   IVALGMTYQF"
FT   misc_feature    complement(359685..360656)
FT                   /gene="phoE"
FT                   /locus_tag="ROD_03361"
FT                   /note="HMMPfam hit to PF00267, Porin, Gram-negative
FT                   type,score 8.9e-200"
FT                   /inference="protein motif:PFAM:PF00267"
FT   misc_feature    complement(359772..359822)
FT                   /note="PS00576 General diffusion Gram-negative porins
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00576"
FT   sig_peptide     complement(360672..360734)
FT                   /gene="phoE"
FT                   /locus_tag="ROD_03361"
FT                   /note="Signal peptide predicted for ROD03361 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.999 between residues 21 and 22"
FT   CDS_pept        361020..362123
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="ROD_03371"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03371"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87119"
FT                   /db_xref="GOA:D2TJZ1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJZ1"
FT                   /protein_id="CBG87119.1"
FT                   /translation="MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRI
FT                   VIVTSGAIAAGREHLGYPELPATIATKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLT
FT                   RADMEDRERFLNARDTLRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGAD
FT                   KLLLLTDQQGLFTADPRTNPQAELIQDVYGIDDALRSIAGDSVSGLGTGGMGTKLQAAD
FT                   VACRAGIDTIIAAGSRPGVIGDVMDGISVGTRFHAQASPLENRKRWIFGAPPAGEITVD
FT                   EGATAAILQRGSSLLPKGIKSVTGNFSRGEVIRICNLEGRDIAHGVSRYNSDALRRIAG
FT                   HHSQQIDAILGYEYGPVAVHRDDMITR"
FT   misc_feature    361032..361724
FT                   /gene="proB"
FT                   /locus_tag="ROD_03371"
FT                   /note="HMMPfam hit to PF00696,Aspartate/glutamate/uridylate
FT                   kinase, score 4.3e-59"
FT                   /inference="protein motif:PFAM:PF00696"
FT   misc_feature    361638..361703
FT                   /note="PS00902 Glutamate 5-kinase signature."
FT                   /inference="protein motif:Prosite:PS00902"
FT   misc_feature    361845..362069
FT                   /gene="proB"
FT                   /locus_tag="ROD_03371"
FT                   /note="HMMPfam hit to PF01472, PUA, score 8.5e-30"
FT                   /inference="protein motif:PFAM:PF01472"
FT   CDS_pept        362134..363384
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="ROD_03381"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03381"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87120"
FT                   /db_xref="GOA:D2TJZ2"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJZ2"
FT                   /protein_id="CBG87120.1"
FT                   /translation="MLEQMGKAAKAASYKLALLSSREKNRVLEKIADELEAQTDTILRA
FT                   NAQDVADARENGLSDAMLDRLALTSARLKAIADDVRQVCHLADPVGQVMDGGLLDSGLR
FT                   LERRRVPLGVIGVIYEARPNVTVDVASLCLKTGNAAILRGGKETCRTNAATVRVIQQAL
FT                   TACGLPEAAVQAIESPDRALVNEMLRMDKYIDMLIPRGGAGLHKLCREQSTIPVITGGI
FT                   GVCHIFVDDSAEIAPALNIIVNAKTQRPSTCNTVETLLVHQEIAGRFLPALSEKMAGCG
FT                   VTLHADDVAMPILQGPAKRVPLQPEELDNEFLSLDLNVVIVQDIDDAIAHIREHGTQHS
FT                   DAILTRTIHNASRFVNEVDSSAVYVNASTRFTDGGQFGLGAEVAVSTQKLHARGPMGLE
FT                   ALTTYKWIGIGDDTIRA"
FT   misc_feature    362137..363354
FT                   /gene="proA"
FT                   /locus_tag="ROD_03381"
FT                   /note="HMMPfam hit to PF00171, Aldehyde dehydrogenase,score
FT                   5.1e-07"
FT                   /inference="protein motif:PFAM:PF00171"
FT   misc_feature    363097..363162
FT                   /note="PS01223 Gamma-glutamyl phosphate reductase
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01223"
FT   tRNA            363498..363570
FT                   /locus_tag="ROD_t04"
FT                   /product="transfer RNA-Thr"
FT                   /anticodon="(pos:363531..363533,aa:Thr)"
FT                   /note="tRNA Thr anticodon CGT, Cove score 73.64"
FT   misc_feature    363963..378377
FT                   /note="CR_GI1"
FT   repeat_region   complement(363963..364002)
FT                   /note="40 bp inverted repeat flanking GI1. This is an
FT                   imperfect repeat (last 2 bp mismatch) of the 40 bp at 5'
FT                   terminus of ISEc14 which is also repeated 0-2 times in
FT                   tandem adjacent to each copy of this IS element in the CR
FT                   genome, immediately upstream and/or inverted downstream."
FT   CDS_pept        complement(364176..365051)
FT                   /transl_table=11
FT                   /gene="espS"
FT                   /locus_tag="ROD_03391"
FT                   /product="T3SS effector protein EspS"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03391"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87121"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJZ3"
FT                   /protein_id="CBG87121.1"
FT                   /translation="MFSIKGYLPISASVSVPAENHSNTLGILGKRTIETTPEKKGLLVF
FT                   LGEKSVGQQTLNIIGQNICRAITGKPLYDLLFLKKDTRDDFQEKKMEYIYPDINKEHLK
FT                   SSDQDVAVTAAAHIVITEMNVLLPENLTPGDYRKIYIPGIGLSGLPVLQCGDEMLSPSN
FT                   IVNRLHENNLHKIKDIRLTSCHSADIYANKDFSPEEIKKALTPNSGWLARALFGEQCSL
FT                   ATKVYKEFECRGIDVSVSGYNGKGVFYVREHGKPTTHLRSTTVPATPDHTVRRSDFRVS
FT                   LGRTQPTDID"
FT   CDS_pept        complement(365395..366687)
FT                   /transl_table=11
FT                   /gene="espI"
FT                   /gene_synonym="nleA"
FT                   /locus_tag="ROD_03401"
FT                   /product="T3SS effector protein NleA/EspI"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03401"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87122"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJZ4"
FT                   /protein_id="CBG87122.1"
FT                   /translation="MNIQPNIHSGITTQNNQQHHHAEQVPVSSSIPRSDLPPNCEAGFV
FT                   VHIPEDIQQHVPECGETTALLSLIKDEGLLSGLDKYLAPHLEEGSLGKKALDTFGLFNV
FT                   TQMALEIPSSVPGISGKYGVQMNIVKPDIHPTTGNYFLQLFPLHDEIGFNFKDLPGPLK
FT                   NALTNSSISATASTVAPTPNDPMPWFGLTAQVVRNHGVELPIVKTENGWKLVGETPLTP
FT                   DGPKANYTEEWVIRPGEADFKYGTSPLQATLGLEFGAHFKWDLDNPNTKYAILTNAAAN
FT                   AIGAAGGFAVSKVPGIDPMLSPHVGAMLGQAAGHAVQCNTPGLKPDTILWWAGATFGAA
FT                   DLNKAEFDKVRFTDYPRIWFHAREGALFPNKQDIARVTGADIKAMEEGVPVGHQHPKPE
FT                   DVVIDIEGGNSPHHNPSNYVDTFEIIQETRV"
FT   tRNA            367188..367261
FT                   /locus_tag="ROD_t05"
FT                   /product="transfer RNA-Thr"
FT                   /anticodon="(pos:367220..367222,aa:Thr)"
FT                   /note="tRNA Thr anticodon GGT, Cove score 22.17"
FT   CDS_pept        join(367524..367910,367914..368174)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ROD_03411"
FT                   /product="IS3 family transposase B (pseudogene)"
FT                   /note="pseudogene, N-terminus missing, C-terminal part
FT                   truncated by premature stop codon"
FT   repeat_region   367524..368174
FT                   /note="IS3 family insertion sequence fragment. 85% DNA ID
FT                   to IS911"
FT   misc_feature    join(367653..367910,367914..368135)
FT                   /locus_tag="ROD_03411"
FT                   /note="HMMPfam hit to PF00665, Integrase, catalytic
FT                   core,score 3.6e-30"
FT                   /inference="protein motif:PFAM:PF00665"
FT   CDS_pept        369350..369718
FT                   /transl_table=11
FT                   /locus_tag="ROD_03421"
FT                   /product="putative exported virulence protein"
FT                   /note="similar to dispersin Aap in EAEC and virulence
FT                   factor CexE in ETEC"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03421"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87124"
FT                   /db_xref="GOA:D2TJZ5"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJZ5"
FT                   /protein_id="CBG87124.1"
FT                   /translation="MKLIGKFIGFAIMTISFYSFAGGGASSWIPNVAPSACVNIDESRI
FT                   SFTWNNNPECEKAISSGYASGVRIMGSASYVPDTTIAQFNKVLKRNMSLTIIDLDIYGS
FT                   VNGYPAKLATMPIFRWES"
FT   sig_peptide     369350..369412
FT                   /locus_tag="ROD_03421"
FT                   /note="Signal peptide predicted for ROD03421 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.967 between residues 21 and 22"
FT   misc_feature    369368..369436
FT                   /locus_tag="ROD_03421"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD03421 by TMHMM2.0 at aa 7-29"
FT   CDS_pept        370190..371410
FT                   /transl_table=11
FT                   /gene="aatD"
FT                   /locus_tag="ROD_03431"
FT                   /product="putative membrane-spanning transport protein"
FT                   /note="Similar to AatD, part of the Aat transporter in
FT                   EAEC, note the different genomic location in relation to
FT                   the rest of the aat cluster homologues compared to p042"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03431"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87125"
FT                   /db_xref="GOA:D2TJZ6"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJZ6"
FT                   /protein_id="CBG87125.1"
FT                   /translation="MIEAFIPTLSLILLLKCAMKKRLFVIVLYLIIFNIIFFIFVFGKG
FT                   SWGVIKTSYMLAPFALSLIINMQVVLAIYFREKGAGYVLLSSFFPPLFFSFWSFDLIMP
FT                   SHPLMIFYQFDELYKILPRFNKNIINIIIIYALPFFFLLPLRKSMLLIIIMLLMFFIRW
FT                   GLIEYEKLGIKVLVVQTGMFLSKHEEIVELRNEIFKYNNADIVIFSESPAIGFKEGSRT
FT                   AFTRELLDEIKGKNDGKLYILNNYGFVDDKKYNYNLSLYIMNGSMRIKAKNKLVPLWEV
FT                   PGLFYSKSDWDSPFFSVPSEKMIEQYKFRGLYINSYICYEAMFTKHNSDVNDLTIIQSN
FT                   YESFKKGYDRIVKNGNVLAYVNKSSSFKNFISVQNMGGTIFVDNTGKFHWDVYKKSLKQ
FT                   AIFLLEI"
FT   misc_feature    join(370250..370318,370346..370414,370433..370501,
FT                   370568..370621,370634..370687)
FT                   /gene="aatD"
FT                   /locus_tag="ROD_03431"
FT                   /note="5 probable transmembrane helices predicted for
FT                   ROD03431 by TMHMM2.0 at aa 21-43, 53-75, 82-104, 127-144
FT                   and 149-166"
FT   misc_feature    370421..370444
FT                   /note="PS00030 Eukaryotic putative RNA-binding region RNP-1
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00030"
FT   CDS_pept        join(371820..371936,371936..371941,371941..371958,
FT                   371962..372081,372081..372218)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ROD_03432"
FT                   /product="putative transposase (fragment)"
FT                   /note="pseudogene, N-terminus missing, C-terminal part
FT                   truncated by frameshift mutations"
FT   CDS_pept        374038..375177
FT                   /transl_table=11
FT                   /gene="aatP"
FT                   /locus_tag="ROD_03451"
FT                   /product="AatP, permease"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03451"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87127"
FT                   /db_xref="GOA:D2TJZ7"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJZ7"
FT                   /protein_id="CBG87127.1"
FT                   /translation="MLSMSIYILEAIISLKENIRYALTFILFLSLSFLGVIITDSLIYS
FT                   VSMQAEKELKSRGDNIISIELYQHEKKDNIDKVLNKYYTKLSYSQRSFLTGGNSPYSDE
FT                   AISVIAIDKAGINLLMGGEFDDSLFEGNVAVYNNNNLDISNKPQEIFFNGVPFQIIGVK
FT                   NKSKAEFLDSLGLSPGNSNEKYYIPLDTLFRFNLDNEIDNIQIIFDKDVTTEMSTSIKN
FT                   QLKKNNIDKYMITTSLDARAIVERVLNRFSLLTNSIYLLLTITAIISCIVVCKRNFQSR
FT                   STEFALKIIHGISYKEIQIVVVIETIFTVIVSLLLSIAISILSIMLLSSILNISVKIRW
FT                   LMILMSLSAVLILCFIANLLYGNKTFKINPIELIKARTK"
FT   misc_feature    join(374098..374166,374788..374856,374938..375006,
FT                   375049..375117)
FT                   /gene="aatP"
FT                   /locus_tag="ROD_03451"
FT                   /note="4 probable transmembrane helices predicted for
FT                   ROD03451 by TMHMM2.0 at aa 21-43, 251-273, 301-323 and
FT                   338-360"
FT   misc_feature    374638..375147
FT                   /gene="aatP"
FT                   /locus_tag="ROD_03451"
FT                   /note="HMMPfam hit to PF02687, Protein of unknown function
FT                   DUF214, permase predicted, score 5.5e-05"
FT                   /inference="protein motif:PFAM:PF02687"
FT   misc_feature    374815..374847
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        375174..376382
FT                   /transl_table=11
FT                   /gene="aatA"
FT                   /locus_tag="ROD_03461"
FT                   /product="AatA, outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03461"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87128"
FT                   /db_xref="GOA:D2TJZ8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJZ8"
FT                   /protein_id="CBG87128.1"
FT                   /translation="MRFNKKYMVIILANLLVGKDVFSCSLNMYLSKLESYELFKLEQED
FT                   SLLQNKSVASSFLPNVSIGMGQYINNNTGLVDIGRSSFYIAASQLIFSGESLGKNSEKE
FT                   ENDNKRRIISFEKDKNEQLLKLYADILQYKYLKENISLILRRLDKLKLEYNKTVLDLKS
FT                   GIIPSLEVDVKSLNVLKMESSLNRLKADYELLENKINKNYSIPPQNISKITENDILSCK
FT                   TISYRELIDKNKHNKLQQADIELDINNASLLPSIYLSIGLTPKNEGALRDINLREMNYN
FT                   GGISVNFPINNIFSAIDNQKKYAISVTKARLESERDHEQLLIANRNILNEYLAIKRNIP
FT                   ILKKEVQLKNRRMEYKLWLVKEKKENILSYLDSQDELYEAEINLKKNERDLKYYQMYLN
FT                   FIN"
FT   CDS_pept        376306..377118
FT                   /transl_table=11
FT                   /gene="aatB"
FT                   /locus_tag="ROD_03471"
FT                   /product="AatB, putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03471"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87129"
FT                   /db_xref="GOA:D2TJZ9"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJZ9"
FT                   /protein_id="CBG87129.1"
FT                   /translation="MKQKLILKKMNVILNIIRCILILLINSFSLSSYADTYYGVLRGSE
FT                   SLTFKSPYSGFITLNSLREGDIGKAGKLFTIHNYEYNNNKRILSLKIKNAEKQKKRIQR
FT                   EYQDGLSAYQKGFLSKHDLYSYEDKLDNMELSIISLRSEINSLNDILHLGDVNMEKPFI
FT                   IRNINVNNQQYVNSGDLLMNIELLDRFYVDIKIDPVVFQGNIKDKNINYISLVGNMKGK
FT                   ASVRRISGIVDRTSSKTSGMRMVTLLIHGDSASLQALLDTAFEIRIND"
FT   sig_peptide     376306..376407
FT                   /gene="aatB"
FT                   /locus_tag="ROD_03471"
FT                   /note="Signal peptide predicted for ROD03471 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 34 and 35"
FT   misc_feature    376339..376407
FT                   /gene="aatB"
FT                   /locus_tag="ROD_03471"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD03471 by TMHMM2.0 at aa 12-34"
FT   CDS_pept        377111..377740
FT                   /transl_table=11
FT                   /gene="aatC"
FT                   /locus_tag="ROD_03481"
FT                   /product="AatC, ATP binding protein of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03481"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87130"
FT                   /db_xref="GOA:D2TK00"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK00"
FT                   /protein_id="CBG87130.1"
FT                   /translation="MINLYIHKKKFRDKTILIDTSLKIMEGGFYIITGPSGVGKSSLLN
FT                   IIGLLDGDFYGDYMFYDEKIYFYDCNKTQELRRSYFGYIFQDSLINERQDLIRNILCSV
FT                   EYSKQKEKKKTVDHFLSMVGLHFKNGCSSVLSGGEKQRLALARALIKQPKILLADEPTA
FT                   SLDKENKKIIMSILNSFNNEGGTIIMVTHDLELINNNMEVITLSNC"
FT   misc_feature    377189..377737
FT                   /gene="aatC"
FT                   /locus_tag="ROD_03481"
FT                   /note="HMMPfam hit to PF00005, ABC transporter
FT                   related,score 4.9e-35"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    377210..377233
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    377513..377557
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   repeat_region   378338..378377
FT                   /note="40 bp inverted repeat flanking GI1. This is a
FT                   perfect repeat of the 40 bp at 5' terminus of ISEc14 which
FT                   is also repeated 0-2 times in tandem adjacent to each copy
FT                   of this IS element in the CR genome, immediately upstream
FT                   and/or inverted downstream."
FT   CDS_pept        complement(378404..379753)
FT                   /transl_table=11
FT                   /locus_tag="ROD_03491"
FT                   /product="putative porin"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03491"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87131"
FT                   /db_xref="GOA:D2TK01"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="InterPro:IPR038673"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK01"
FT                   /protein_id="CBG87131.1"
FT                   /translation="MKNMNKLIKSGMMLLALLHPFLALANETLFSPTAKNMTGEWGGVR
FT                   TDLRRHGYDFTLEYSAMTATNMSGGYDRDKTLRYSDQYILGIDMDLEKIFGIQDGEFKA
FT                   SVNNRNGRDLTQDRLQDPRAPVIGSGVQSNYGREQTWHATQFWFKKIGGDKKLDLKVGL
FT                   MPPGEDFDNSGCFFQNLSLCGSLAGHGSGVWYNTPIGQWGGRIKYSPIPALYVQAGAFQ
FT                   YNPDYATRHGSFKLDGTGHLGYMYLFELGYLPAFDTAKLAGVWKIGGWYNTADANDVLD
FT                   DDNGDPYVLTHQAARRHGGRYGGYLYIGQQITHSRNQHQNGLSLFGHLAINDKKTATMD
FT                   YQIQAGAIYKGPFASRPQDFISFGVSKMHANDRVARRAQFLNQLRGIDDYDNPLYVPVR
FT                   KAEYAAELHYSFRITPWLTVRPNLQLLAHPGGSEEIKNAWVVGNQVTVKF"
FT   misc_feature    complement(378407..379534)
FT                   /locus_tag="ROD_03491"
FT                   /note="HMMPfam hit to PF04966, Carbohydrate-selective porin
FT                   OprB, score 2e-113"
FT                   /inference="protein motif:PFAM:PF04966"
FT   sig_peptide     complement(379679..379753)
FT                   /locus_tag="ROD_03491"
FT                   /note="Signal peptide predicted for ROD03491 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 25 and 26"
FT   CDS_pept        complement(379868..381265)
FT                   /transl_table=11
FT                   /locus_tag="ROD_03501"
FT                   /product="putative MSF transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03501"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87132"
FT                   /db_xref="GOA:D2TK02"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK02"
FT                   /protein_id="CBG87132.1"
FT                   /translation="MSTQVITSDYAVASGTASTPDALLARLERLPITRRLKAIRVIVGL
FT                   STFFDAYTIIAIAFALPQLTQEWGLTPTFVGLIIAASYVGQLCGALFFGSLAEKIGRIG
FT                   VLRITIIMFVLMDAACLFAWNGWSILIIRFLQGVGIGAEVPVASAYINEFVGAKKRGRF
FT                   FLLYEVIFPIGMMFAGLVGYFLVPIYGWKVMFLIGLVPSALTVPLRWLMPESPRWLTAK
FT                   GRLKEAENVVSTLESEVIRRGMTLPEPEIKAPTVHKAAPEGAKALFSGIYKSRTFMLWG
FT                   LWLTVYSVNNGMITWFPTLYKTWFNLSLDTSLAYGWITSSCGVVASVICALMIDRVGRK
FT                   RWYTWAFLLAIVPLIALSVLGAKSAVEILILGSLTYAILQTIAFSLYLYAAELYPTRLR
FT                   AIGTAYSSAWLRAGSSIGPLMVGFIVSGFGIRFVFITFTVIALIGGLITWLFAIETKGK
FT                   SLEELSP"
FT   misc_feature    complement(379889..379912)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(join(379907..379966,379976..380044,
FT                   380102..380170,380183..380242,380261..380329,
FT                   380372..380440,380630..380698,380708..380776,
FT                   380813..380881,380891..380959,380978..381046,
FT                   381074..381142))
FT                   /locus_tag="ROD_03501"
FT                   /note="12 probable transmembrane helices predicted for
FT                   ROD03501 by TMHMM2.0 at aa 42-64, 74-96, 103-125,
FT                   129-151,164-186, 190-212, 276-298, 313-335, 342-361,
FT                   366-388,408-430 and 434-453"
FT   misc_feature    complement(379988..381139)
FT                   /locus_tag="ROD_03501"
FT                   /note="HMMPfam hit to PF07690, Major facilitator
FT                   superfamily MFS-1, score 5.2e-49"
FT                   /inference="protein motif:PFAM:PF07690"
FT   misc_feature    complement(380300..380332)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(380786..380863)
FT                   /note="PS00217 Sugar transport proteins signature 2."
FT                   /inference="protein motif:Prosite:PS00217"
FT   misc_feature    complement(381011..381046)
FT                   /note="PS00962 Ribosomal protein S2 signature 1."
FT                   /inference="protein motif:Prosite:PS00962"
FT   CDS_pept        381691..382722
FT                   /transl_table=11
FT                   /locus_tag="ROD_03511"
FT                   /product="LacI-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03511"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87133"
FT                   /db_xref="GOA:D2TK03"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK03"
FT                   /protein_id="CBG87133.1"
FT                   /translation="MDQESELNDLPEKKLATMRDVARAAGVSVSTVSRVLDERLPTSRS
FT                   TSADKIRQVARELGYRRDYVASSLRRGDTGTLGVLVPRLTDAVTAMLFEEIARAAARRG
FT                   YFAIVATCGDSKEQEKNAVESLLDRRVDGLIMSTCRLDDPLPQTLRERDVPHVLALRTD
FT                   GFSPSSVGDDELGGYLATRHLIDLGHRDIGLIGGPDFASNARNRRKGFERAMQEAGLRI
FT                   EAEWCCHSDFNIASGEQQGVKILSQPHRPSALFAVNDELAIGVLAAAHQQGLVIGEDLS
FT                   LVGYNDIPLVSRLPVALTSVRTPLEHIASNAVDMLLNPEINNNMRVTTPSLIPRKSTSS
FT                   PRK"
FT   misc_feature    381736..381801
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1987.000, SD 5.95 at aa 16-37, sequence
FT                   ATMRDVARAAGVSVSTVSRVLD"
FT   misc_feature    381736..381798
FT                   /locus_tag="ROD_03511"
FT                   /note="HMMPfam hit to PF00356, Bacterial regulatory
FT                   protein, LacI, score 9.8e-10"
FT                   /inference="protein motif:PFAM:PF00356"
FT   misc_feature    381742..381798
FT                   /note="PS00356 Bacterial regulatory proteins, lacI family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00356"
FT   misc_feature    381910..382545
FT                   /locus_tag="ROD_03511"
FT                   /note="HMMPfam hit to PF00532, Periplasmic binding
FT                   protein/LacI transcriptional regulator, score 4.3e-17"
FT                   /inference="protein motif:PFAM:PF00532"
FT   CDS_pept        382975..383904
FT                   /transl_table=11
FT                   /locus_tag="ROD_03521"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03521"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87134"
FT                   /db_xref="GOA:D2TK04"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK04"
FT                   /protein_id="CBG87134.1"
FT                   /translation="MINIDLRGLTPAPVTPFTRDGRVDYDAIQRLGNWLGSIDGVKGLV
FT                   VLGHAGEGTFLTQEEQANVIRAFVKSVDDKLPIIAGITGEGTEVAALEAKRAVAAGASA
FT                   GLLYPSHGWLRFGYQDGAPQDRYRVVYEESGLPLILFQYPDVTKATYNLKTLLDISAQP
FT                   GVFAMKNGVRNMRRWDTEIPVIRCERPDLQILSCHDEYLLHTAFDVDGFLVGYGNIAPE
FT                   PLIEMIKAGKAGDYVKARQLHDRLLPVTKSVYHRGSHMEGTVALKHALVARGILEHATV
FT                   RSPLLPLEKGAEKEIHDAMRAAELGRVR"
FT   misc_feature    382987..383886
FT                   /locus_tag="ROD_03521"
FT                   /note="HMMPfam hit to PF00701, Dihydrodipicolinate
FT                   synthetase, score 1.2e-18"
FT                   /inference="protein motif:PFAM:PF00701"
FT   CDS_pept        383956..384216
FT                   /transl_table=11
FT                   /locus_tag="ROD_03531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03531"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87135"
FT                   /db_xref="GOA:D2TK05"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK05"
FT                   /protein_id="CBG87135.1"
FT                   /translation="MRIIGYFARLSFAVLHHNVGAFTSVSSLGDVILTGTPGGIGKKRT
FT                   PPLFMQPGDRVEVEIEHIGCLINTVCSDELSFTGRLHPKIW"
FT   CDS_pept        384289..385578
FT                   /transl_table=11
FT                   /gene="dcuA"
FT                   /locus_tag="ROD_03541"
FT                   /product="anaerobic C4-dicarboxylate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03541"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87136"
FT                   /db_xref="GOA:D2TK06"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK06"
FT                   /protein_id="CBG87136.1"
FT                   /translation="MILVQFLVVLLFLYIGMRVGGIGVGFAGGAGVIVLSALGATPGDM
FT                   PMLVIVFIMVVIVAIAAMQEAGGIEYLVDLTERLLRRYPRLLVITAPLSTWLLTMMAST
FT                   GQVSFACMPVIVGVAKENNIKPTRALALSVSASLLGIVASPISAAVIFFSGILEKGHSG
FT                   WGYIELIAVSIPSTFLALLVTSVSYLCWDRIRQQDRLYDNPVQVKARNERTIPPYAGRS
FT                   VLIFIIGLVVVLVYAIVTSPKLGLIAHPVMSSGQARVEMMLGVALLIVVCCRVNVHKVP
FT                   SGSVFKTGMTSCICILGVAWLGSTFMDSNQQWLQSAVSSHLLDSPIMLAIIIMAASCFL
FT                   YSQAASTKILFPAALSMGIAPAILVACFPATSSLFILPNYPTLLAAVEMDDTGYTRLGR
FT                   HIIDHPFLLPGLASVLLSMLFATGLAYLIQ"
FT   misc_feature    384301..385371
FT                   /gene="dcuA"
FT                   /locus_tag="ROD_03541"
FT                   /note="HMMPfam hit to PF03605, Anaerobic c4-dicarboxylate
FT                   membrane transporter, score 2.3e-118"
FT                   /inference="protein motif:PFAM:PF03605"
FT   misc_feature    join(384331..384399,384424..384477,384574..384642,
FT                   384676..384744,384787..384855,384937..385005,
FT                   385063..385122,385141..385209,385252..385311,
FT                   385348..385416,385504..385572)
FT                   /gene="dcuA"
FT                   /locus_tag="ROD_03541"
FT                   /note="11 probable transmembrane helices predicted for
FT                   ROD03541 by TMHMM2.0 at aa 15-37, 46-63, 96-118,
FT                   130-152,167-189, 217-239, 259-278, 285-307, 322-341,
FT                   354-376 and 406-428"
FT   misc_feature    384589..384621
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    385270..385302
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    385357..385389
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(385707..387098)
FT                   /transl_table=11
FT                   /gene="puuP"
FT                   /locus_tag="ROD_03551"
FT                   /product="putrescine importer"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03551"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87137"
FT                   /db_xref="GOA:D2TK07"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK07"
FT                   /protein_id="CBG87137.1"
FT                   /translation="MATNTSLNIPAQAGKTSLRKSLKLWQVVMMGLAYLTPMTVFDTFG
FT                   IVSGISNGHVPASYLLALAGVLFTAISYGKLVRQFPEAGSAYTYAQKSINPHVGFMVGW
FT                   SSLLDYLFLPMINVLLAKIYLSALFPEVPPWVWVATFVTILTAANLKSVNLVANFNTLF
FT                   ILVQIAIMVVFIVLVVHGLHKGEGTGTVWSLQPFISQNAHLIPIITGATIVCFSFLGFD
FT                   AVTTLSEETPDAARVIPKAIFLTAIYGGIIFIVASFFMQLFFPDISRFKDPDAALPEIA
FT                   LYVGGKLFQSIFLCTTFVNTLASGLASHASVSRLLYVMGRDNVFPERVFGYVHPKWRTP
FT                   ALNVIMVGIVSLSALFFDLVTATALINFGALVAFTFVNLSVFNHFWRRKGYNKSWKDHF
FT                   HYLLMPLIGALTVGVLWINLEITSLTLGIIWAMLGGMYLCYLVRRYRKVPLYNAEQKII
FT                   AESEG"
FT   misc_feature    complement(join(385770..385838,385848..385904,
FT                   385941..386009,386019..386078,386163..386231,
FT                   386307..386375,386436..386495,386553..386615,
FT                   386628..386696,386739..386807,386868..386936,
FT                   386979..387038))
FT                   /gene="puuP"
FT                   /locus_tag="ROD_03551"
FT                   /note="12 probable transmembrane helices predicted for
FT                   ROD03551 by TMHMM2.0 at aa 21-40, 55-77, 98-120,
FT                   135-157,162-182, 202-221, 242-264, 290-312, 341-360,
FT                   364-386,399-417 and 421-443"
FT   misc_feature    complement(385971..387023)
FT                   /gene="puuP"
FT                   /locus_tag="ROD_03551"
FT                   /note="HMMPfam hit to PF00324, Amino acid
FT                   permease-associated region, score 5.2e-29"
FT                   /inference="protein motif:PFAM:PF00324"
FT   CDS_pept        complement(387409..388827)
FT                   /transl_table=11
FT                   /gene="puuA"
FT                   /locus_tag="ROD_03561"
FT                   /product="gamma-glutamylputrescine synthetase"
FT                   /EC_number="6.3.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03561"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87138"
FT                   /db_xref="GOA:D2TK08"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK08"
FT                   /protein_id="CBG87138.1"
FT                   /translation="METNIVEVESYVQQSEERRVSAFAQEVKCYLEQYPNTQYVDVLLT
FT                   DLNGCFRGKRIPVSGLRKLEKGCYFPASVFAMDILGNVVEEAGLGQDVGEPDRTCVPVL
FT                   GTLTPSTADPEYIGQMLLTMIDEDGAPFDVEPRNVLNRLWQQLRQRGLFPVVAVELEFY
FT                   LLDRKRDAEGYLQPPCAPGTDDRNTQSQVYSVDNLNHFADVLNDIDEIAQLQKIPADGA
FT                   VAEASPGQFEINLYHTDNVLDACDDALALKRLVRLMAEKHKMHATFMAKPYEEHAGSGM
FT                   HIHISLLNNRGDNAFSDKDGEDSALLKKALSGMIDLMPSSMALLAPNVNSYRRFQPGMY
FT                   VPTQASWGHNNRTVALRIPCGDRQNHRVEYRVAGADANPYLVMATIFAGILHGLDNDLP
FT                   LQKEVEGNGLVQEGLPFPIRQSDALWEFMQNDHLRHYLGERFCHVYHACKNDELLQFER
FT                   LITDTEIEWMLKNA"
FT   misc_feature    complement(387646..388431)
FT                   /gene="puuA"
FT                   /locus_tag="ROD_03561"
FT                   /note="HMMPfam hit to PF00120, Glutamine
FT                   synthetase,catalytic region, score 2.2e-107"
FT                   /inference="protein motif:PFAM:PF00120"
FT   misc_feature    complement(387970..388017)
FT                   /note="PS00181 Glutamine synthetase putative ATP-binding
FT                   region signature."
FT                   /inference="protein motif:Prosite:PS00181"
FT   CDS_pept        389040..389804
FT                   /transl_table=11
FT                   /gene="puuD"
FT                   /locus_tag="ROD_03571"
FT                   /product="gamma-glutamyl-gamma-aminobutyrate hydrolase"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03571"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87139"
FT                   /db_xref="GOA:D2TK09"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK09"
FT                   /protein_id="CBG87139.1"
FT                   /translation="MENIMYRPVIGIVMCRNRLKGHETQTLQEKYLNAIIRAGGLPIAL
FT                   PHALAEPELLNELLPKLDGIYLPGSPSNVQPHLYGENGDEPDADPGRDLLSMALINAAL
FT                   ERRIPIFAICRGLQEMVVATGGSLHRKLCEEPDLLEHREDPELPVEQQYAPSHEVQVIE
FT                   GGLLSRLLPDCSNFWVNSLHGQGAKVVSPRLRVEARAPDGVIEAVSVNDYPFALGVQWH
FT                   PEWNSSEYALSRILFDGFITACKNHIAEKQRL"
FT   misc_feature    389061..389711
FT                   /gene="puuD"
FT                   /locus_tag="ROD_03571"
FT                   /note="HMMPfam hit to PF07722, Peptidase C26, score
FT                   3.9e-110"
FT                   /inference="protein motif:PFAM:PF07722"
FT   CDS_pept        389831..390388
FT                   /transl_table=11
FT                   /gene="puuR"
FT                   /locus_tag="ROD_03581"
FT                   /product="transcriptional regulator of the polyamine
FT                   metabolism genes"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03581"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87140"
FT                   /db_xref="GOA:D2TK10"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK10"
FT                   /protein_id="CBG87140.1"
FT                   /translation="MSDDGLAPGKRLSEIRQKQGLSQRRAAELSGLTHSAISTIEQDKV
FT                   SPAISTLQKLLKVYGLSLSEFFSEPEKPDEPQVVINQDDLIEIGSQGVSMKLVHNGNPN
FT                   RTLAMIFETYQPGTTTGERIKHQGEEIGTVLEGEIVLTVNGQTYHLVAGQSYAINTGIP
FT                   HSFSNTSAGVCRIISAHTPTTF"
FT   misc_feature    389864..390028
FT                   /gene="puuR"
FT                   /locus_tag="ROD_03581"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix type
FT                   3,score 7.1e-16"
FT                   /inference="protein motif:PFAM:PF01381"
FT   misc_feature    389891..389956
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1738.000, SD 5.11 at aa 21-42, sequence
FT                   LSQRRAAELSGLTHSAISTIEQ"
FT   misc_feature    390158..390370
FT                   /gene="puuR"
FT                   /locus_tag="ROD_03581"
FT                   /note="HMMPfam hit to PF07883, Cupin 2, conserved
FT                   barrel,score 2.6e-22"
FT                   /inference="protein motif:PFAM:PF07883"
FT   CDS_pept        390609..392096
FT                   /transl_table=11
FT                   /gene="puuC"
FT                   /locus_tag="ROD_03591"
FT                   /product="gamma-glutamyl-gamma-aminobutyraldehyde
FT                   dehydrogenase"
FT                   /EC_number="1.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03591"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87141"
FT                   /db_xref="GOA:D2TK11"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK11"
FT                   /protein_id="CBG87141.1"
FT                   /translation="MNFHHLAYWQDKALNLALETRLFINGEYCAAADGTTFETIDPFSE
FT                   VPLANIARGKSADIDFAVKGARAVFESGVWSNAAPAKRKAALNKLADLIEANAEELALL
FT                   ETLDTGKPIRHSLRDDVPGAARAIRWYAEALDKVYGEVATTGSQELAMIVREPVGVVAA
FT                   IVPWNFPLLLTCWKLGPALAAGNSVILKPSEKSPLTALRLAGLAKEAGIPDGVLNVVSG
FT                   FGHEAGQALSRHPDIDVIAFTGSTRTGKQLLKDAGDSNMKRVWLEAGGKSANIVFADCP
FT                   DLQQAVSATASGIFYNQGQVCIAGTRLLLEDSIADEFLNLLQQQISHWQPGHPLDPSTT
FT                   MGTLIDSAHADTVHSFIRDGEQKGQLLVDGRQTAWPAAIGPTIFVDVDPEDRLSQEEIF
FT                   GPVLVVTRFTSEEQALALANNSQYGLGAAVWTRDLSRAHRLSRRLKAGSVFVNNYNDGD
FT                   MTVPFGGYKQSGNGRDKSLHALDKFTEIKTIWISLEA"
FT   misc_feature    390672..390707
FT                   /note="PS00070 Aldehyde dehydrogenases cysteine active
FT                   site."
FT                   /inference="protein motif:Prosite:PS00070"
FT   misc_feature    390690..392075
FT                   /gene="puuC"
FT                   /locus_tag="ROD_03591"
FT                   /note="HMMPfam hit to PF00171, Aldehyde dehydrogenase,score
FT                   2.9e-235"
FT                   /inference="protein motif:PFAM:PF00171"
FT   misc_feature    390753..390776
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    391404..391427
FT                   /note="PS00687 Aldehyde dehydrogenases glutamic acid active
FT                   site."
FT                   /inference="protein motif:Prosite:PS00687"
FT   misc_feature    391491..391526
FT                   /note="PS00070 Aldehyde dehydrogenases cysteine active
FT                   site."
FT                   /inference="protein motif:Prosite:PS00070"
FT   misc_feature    391764..391802
FT                   /note="PS00018 EF-hand calcium-binding domain."
FT                   /inference="protein motif:Prosite:PS00018"
FT   CDS_pept        392099..393379
FT                   /transl_table=11
FT                   /gene="puuB"
FT                   /locus_tag="ROD_03601"
FT                   /product="gamma-glutamylputrescine oxidoreductase"
FT                   /EC_number="1.4.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03601"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87142"
FT                   /db_xref="GOA:D2TK12"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK12"
FT                   /protein_id="CBG87142.1"
FT                   /translation="MTEHTTSYYAASANKYTPFPTLNESIDCDVCIVGGGYTGLSSALH
FT                   LAEAGYDVVLLEGARIGFGASGRNGGQLVNSYSRDIDVIERTYGMDTARMLGSMMFEGG
FT                   EIIRERIQRYQIECDYRPGGLFVAMNHKQLTTLEEQKENWERYGNKQLELLDEKAIRRE
FT                   VDSDRYTGALLDHSGGHIHPLNLAIGEADAIRLNSGRVYELSAVTSIQHTSPAVVTTAQ
FT                   GKVTAKYVIVAGNAYLGDQVEPALAKRSMPCGTQVITTEPLSDKLARSLIPNNYCVEDC
FT                   NYLLDYYRLTADNRLLYGGGVVYGARDPDDVERLVLPKMLKTFPQLKGVKVDYRWTGNF
FT                   LLTLSRMPQFGRLDKNIYYMQGYSGHGVTCTHLAGRLISELLRGDAERFDAFANLPHYP
FT                   FPGGRTLRVPFTAMGAAYYSLRDRLGV"
FT   misc_feature    392183..393241
FT                   /gene="puuB"
FT                   /locus_tag="ROD_03601"
FT                   /note="HMMPfam hit to PF01266, FAD dependent
FT                   oxidoreductase, score 2.7e-102"
FT                   /inference="protein motif:PFAM:PF01266"
FT   CDS_pept        complement(393564..396377)
FT                   /transl_table=11
FT                   /locus_tag="ROD_03611"
FT                   /product="putative adhesin autotransporter"
FT                   /note="Similar to TibA, but note the different N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03611"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87143"
FT                   /db_xref="GOA:D2TK13"
FT                   /db_xref="InterPro:IPR003991"
FT                   /db_xref="InterPro:IPR004899"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK13"
FT                   /protein_id="CBG87143.1"
FT                   /translation="MSVTVTDRGTIVYKALQGRCIASGLLFGDITNGYRRRTAGAVILM
FT                   RQDDRKIQEHINIFLFPFLAISLAKLTRIAYVLNTSCFLQSITRVPEMKVPKSRLAVML
FT                   TALSMVPSTEAVSVSGTSVTVTDDQSTTPYQITSNGELIVDGGSVGALSVTDSTLTIHK
FT                   GGTYAGSDVPAAIYSSNSTINLDDVTATTSNTQQSVLSVASNLTIAGSTLTQNGGSAVI
FT                   GINNANATGSPQTLISNSTLNLVNSSGNGGAVVLESTSTSTISGSVVNSASNGINYINA
FT                   SGSLLDTTVDAGGYGIQTQGIAFNYLPANVIVRNAIITGAQGGALLSDGELNIQSSSVS
FT                   GTGEGANGITAGSRGVTETPTTLELISSQVKGNNNGILITPTTPGGSDHQVNMIINNSA
FT                   VTGETGAAISVENMTADISILNGSSFSGGDNILLNNTNNGSANVSVENASLSGNIVTDN
FT                   SSTTTVSLLQNAQLTGLLTGATSLNLGENAVWNITGNDNLGVLAVNNGVVNFGTPDTGF
FT                   KTLTVSTLSGTGRFLMNTNLAANTGDLLNVTGEATGTHTLAIANTGSEPQSGGEDLRVV
FT                   HTGSGNAAFSVEGGKVDAGAWQYSLSKQGTDWYLTQDSNGVTPPDPGTPAPSENDRTTS
FT                   ASTDAMLSLASAPVAIFNEEMQSLRFRHGDIQSNTLIPGGVWGRVLGSDNRISGPYGSA
FT                   YKLGQTGMETGADTVIDVDSGRVAIGAFVSYTSNKISHARGGQSSVNSTGGGVYATWMA
FT                   DSGLYVDAVAKYNHFSTDVNARMADSTPVKGHYSQDAFGGSLETGKIFTTPSPVWLQPY
FT                   IRATAMQAGGEDVKLDNGMETNIDTTNSFQSEAGVIAGVDVSVAGNTVKPYISLAVSHE
FT                   WVDNNQVTINDTWNFDNDSSGTIGKYGAGLSAQISKNAGVWLEGKYQNGEHIESPITAN
FT                   AGFRITF"
FT   misc_feature    complement(393609..394370)
FT                   /locus_tag="ROD_03611"
FT                   /note="HMMPfam hit to PF03797, Autotransporter
FT                   beta-domain,score 4.3e-36"
FT                   /inference="protein motif:PFAM:PF03797"
FT   misc_feature    complement(394542..394886)
FT                   /locus_tag="ROD_03611"
FT                   /note="HMMPfam hit to PF03212, Pertactin, score 1e-44"
FT                   /inference="protein motif:PFAM:PF03212"
FT   misc_feature    complement(396147..396215)
FT                   /locus_tag="ROD_03611"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD03611 by TMHMM2.0 at aa 55-77"
FT   CDS_pept        complement(396481..397071)
FT                   /transl_table=11
FT                   /locus_tag="ROD_03621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03621"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87144"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK14"
FT                   /protein_id="CBG87144.1"
FT                   /translation="MNTYVISDNKFFLLGIANQENYAEGSEGSVIPVFSKNVSSTFKPC
FT                   ERGAVVVLFISSSDERHRITSIRALHECRVLMLVKSTGKQEYYSHSGRQFPWIVPHDIG
FT                   LADLRQHIVKARLTPFYRRYFTCTEVLLFRYLTQGISIQNMANLNLSCKYLYTLKRKII
FT                   LKNNIDGHDAAAIMICRDIIAMSNITLSAERAA"
FT   CDS_pept        complement(397903..398328)
FT                   /transl_table=11
FT                   /locus_tag="ROD_03631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03631"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87145"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK15"
FT                   /protein_id="CBG87145.1"
FT                   /translation="MTLNCICNEGIIHFPDNAKCQTINVISLASGQAINITRDRPADGE
FT                   NFEGYLQGQLRILVEKCNNYKQLSLQHCDSTAVFSKISKLTFSFKPAEGITYWQYIILA
FT                   EREPGNIMLFTSVFNDRSTLDQGCREVDKLFKAFRPH"
FT   CDS_pept        complement(398345..399391)
FT                   /transl_table=11
FT                   /locus_tag="ROD_03641"
FT                   /product="putative fimbrial adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03641"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87146"
FT                   /db_xref="GOA:D2TK16"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK16"
FT                   /protein_id="CBG87146.1"
FT                   /translation="MYKLNVSLFIFVTALLLIAVPARADLRCGTDSTMLSNAGIDFAKD
FT                   VPTQINSNTPIGTILYRKEMKLSIWCGKDINSTNSWDTSPEEIVIRRENLANMLGSNSG
FT                   LELYVTINGERGTNAKIFHTGIETNIPWVSNSIDNSYLPRANVDITIELVKTGENNVLS
FT                   VKSNTMKIFSVQSSLGTDTEMIFYLKNGKSTINFTTQTCDVNGSGNFTATIEELNISTI
FT                   RSVGPVETPTRDFDVSIKCNADLWSTQNILMKITGNNIADMTDKGLFYWRDLSTGANAE
FT                   GIALQLLQGVNGTTYIPVVPGENFVIGNFDKRLSTVTIPLRARYYATGNNFTAGDVQSV
FT                   LFYNIDYE"
FT   misc_feature    complement(398348..398815)
FT                   /locus_tag="ROD_03641"
FT                   /note="HMMPfam hit to PF00419, Fimbrial protein,C-terminal,
FT                   score 8.6e-06"
FT                   /inference="protein motif:PFAM:PF00419"
FT   sig_peptide     complement(399320..399391)
FT                   /locus_tag="ROD_03641"
FT                   /note="Signal peptide predicted for ROD03641 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.997 between residues 24 and 25"
FT   misc_feature    complement(399320..399373)
FT                   /locus_tag="ROD_03641"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD03641 by TMHMM2.0 at aa 7-24"
FT   CDS_pept        complement(399412..402000)
FT                   /transl_table=11
FT                   /locus_tag="ROD_03651"
FT                   /product="putative fimbrial usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03651"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87147"
FT                   /db_xref="GOA:D2TK17"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK17"
FT                   /protein_id="CBG87147.1"
FT                   /translation="MDVIMYNSKINGFKLSLVCTSIIIGLSTTHALADVYFNPDFLKDI
FT                   SGQTTVDVSRFNGDFHILPGDYTPDIYLNGQLIDRARVTVRGDNEASQLCFNSALLTRL
FT                   NLNTTRLSEESMAALEGRSECPHLETLIPGSRAYLNVSDMRLDVSIPQAYLNQAARGYV
FT                   PPSIWSYGEKALYLSYNSTYFEQRSQGDTHQSFYGDMRGKFNLGAWMLHHSGAYSWDDR
FT                   SGDRYNVFATNLQRDIPAWESRVLLGDATTSGDLFDSFSFRGIRLATAEQMLPDSLRGY
FT                   APVVRGIARTNAKVTIKQRDRVIYETSVPPGEFAIEDLYPTGYSGDLQVMVTEADGSRS
FT                   VFSVPFSSVAELLRPGRTNYSLTMGRLRNLNVSDEPYVFQGTWKRGISNTVTAYAGVMA
FT                   TDFYYSGVLGSALGTPVGAFALDITGASFGKSMYEKNGVSVRASYSKHIATTNSNISLA
FT                   AYRFSSSGYLDLHNAVYLADKIEHNNFDAGFDVFDRPRNRISLTLSQDLGNKSGQFYVS
FT                   GYRENYWNNTNSNTQYQAGYNNTYKWLGYGLAVSRTETRNRDKETQYLLNFSIPLGSGR
FT                   GLHTPNLNSYTTINKRGTSSQLEVSGVAGKHDLLNYNVSAGRDADNSYSGNLSGAYKFD
FT                   DATLSGSFSKGKDYHSYSAGLSGSVVAFSDGIVTSPYEGLNTMAIISSKNAAGARVEGY
FT                   AGVKLDSRGYALVPYLTPYRINNVAIDPKGLPFDVELDTTSQQIAPAQGAIVKLNYASH
FT                   KGRMVLIRATTQEGDALPFGASVKDSKGEDVGVVAQGGQIYARLNVGKDRLNINWGNKQ
FT                   QFSCTFDIDLKESSPEKNIERLNTVCDGDDPSLQQTLALTQYVSPDTDLM"
FT   misc_feature    complement(399532..401898)
FT                   /locus_tag="ROD_03651"
FT                   /note="HMMPfam hit to PF00577, Fimbrial biogenesis outer
FT                   membrane usher protein, score 4.4e-273"
FT                   /inference="protein motif:PFAM:PF00577"
FT   sig_peptide     complement(401902..402000)
FT                   /locus_tag="ROD_03651"
FT                   /note="Signal peptide predicted for ROD03651 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.941) with cleavage site
FT                   probability 0.892 between residues 33 and 34"
FT   CDS_pept        complement(402017..402736)
FT                   /transl_table=11
FT                   /locus_tag="ROD_03661"
FT                   /product="putative fimbrial chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03661"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87148"
FT                   /db_xref="GOA:D2TK18"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK18"
FT                   /protein_id="CBG87148.1"
FT                   /translation="MNSAARFFLIFSLALTSFQSFSGVIINGTRVIYPSDEKEITLRLE
FT                   NKGEKPSLVQVWIDKGDSKAKVSLIESPFIILPPVFRIEPTQGQTLRISYTGSNLPQDR
FT                   ESVFWLNVLDIPARQQKLPSNSIEMAFRSRIKLFYRPSSLNIASSSEQVEKLHWSTAPC
FT                   QNKQCIVIKNPTPVFVTISTIKVMSGDKVLTSLTGSMLAPFGSDSYPVKVNPGNNSLFI
FT                   EYVNDYGSSVKRQIKHE"
FT   misc_feature    complement(402029..402289)
FT                   /locus_tag="ROD_03661"
FT                   /note="HMMPfam hit to PF02753, Bacterial pili assembly
FT                   chaperone, score 4.1e-09"
FT                   /inference="protein motif:PFAM:PF02753"
FT   misc_feature    complement(402302..402670)
FT                   /locus_tag="ROD_03661"
FT                   /note="HMMPfam hit to PF00345, Bacterial pili assembly
FT                   chaperone, score 3.3e-59"
FT                   /inference="protein motif:PFAM:PF00345"
FT   misc_feature    complement(402386..402439)
FT                   /note="PS00635 Gram-negative pili assembly chaperone
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00635"
FT   misc_feature    complement(402650..402718)
FT                   /locus_tag="ROD_03661"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD03661 by TMHMM2.0 at aa 7-29"
FT   sig_peptide     complement(402671..402736)
FT                   /locus_tag="ROD_03661"
FT                   /note="Signal peptide predicted for ROD03661 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.997) with cleavage site
FT                   probability 0.995 between residues 22 and 23"
FT   CDS_pept        complement(402955..403491)
FT                   /transl_table=11
FT                   /locus_tag="ROD_03671"
FT                   /product="putative major fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03671"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87149"
FT                   /db_xref="GOA:D2TK19"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="InterPro:IPR039458"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK19"
FT                   /protein_id="CBG87149.1"
FT                   /translation="MKKVLLSSLVVLALGSTSAMAIDGTITINGKLTNATCKVTVDKST
FT                   TGDATVTLPTLSVAKLAVAEATAGATNFTMKLTGCSGASKVRAFFEAGADVDASTGRLN
FT                   NSSESSEVAKNVQIQLRDEADNILAAGNTSQRSNAATPLASGAANLNYSARYYATAAAE
FT                   AGDVQSSVTYSIDYE"
FT   misc_feature    complement(402958..403422)
FT                   /locus_tag="ROD_03671"
FT                   /note="HMMPfam hit to PF00419, Fimbrial protein,C-terminal,
FT                   score 1.5e-26"
FT                   /inference="protein motif:PFAM:PF00419"
FT   sig_peptide     complement(403429..403491)
FT                   /locus_tag="ROD_03671"
FT                   /note="Signal peptide predicted for ROD03671 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.800 between residues 21 and 22"
FT   CDS_pept        complement(403585..403848)
FT                   /transl_table=11
FT                   /locus_tag="ROD_03681"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03681"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87150"
FT                   /db_xref="GOA:D2TK20"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK20"
FT                   /protein_id="CBG87150.1"
FT                   /translation="MTAMHNLNKEEVHQVSGGGLTSDIINYFRNLNTDSETGKQEWQSV
FT                   VTTPSPALQKGDQYGAAIVTGLAAIALFSVRVVGGALSGIFR"
FT   misc_feature    complement(403609..403677)
FT                   /locus_tag="ROD_03681"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD03681 by TMHMM2.0 at aa 58-80"
FT   CDS_pept        complement(403860..404174)
FT                   /transl_table=11
FT                   /locus_tag="ROD_03691"
FT                   /product="putative membrane protein"
FT                   /note="Note the similarity with Colicin V in Xylella but no
FT                   apparent biological evidence to support this"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03691"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87151"
FT                   /db_xref="GOA:D2TK21"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK21"
FT                   /protein_id="CBG87151.1"
FT                   /translation="MRELHVQEINEVSGAGLFSSLGAAVLGGVMGITSGLYKGGVGGGN
FT                   TGGIVGAGIIAALVGMCVGGIVYGVQGALYGLVNDWDTTLQVFNNYSEQFFDFSQNVPK
FT                   "
FT   misc_feature    complement(join(403965..404033,404076..404141))
FT                   /locus_tag="ROD_03691"
FT                   /note="2 probable transmembrane helices predicted for
FT                   ROD03691 by TMHMM2.0 at aa 12-33 and 48-70"
FT   misc_feature    complement(404163..404174)
FT                   /note="PS00228 Tubulin-beta mRNA autoregulation signal."
FT                   /inference="protein motif:Prosite:PS00228"
FT   CDS_pept        complement(404388..406520)
FT                   /transl_table=11
FT                   /gene="mchF"
FT                   /locus_tag="ROD_03701"
FT                   /product="putative microcin secretion/processing
FT                   ATP-binding protein"
FT                   /EC_number="3.4.22.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03701"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87152"
FT                   /db_xref="GOA:D2TK22"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033838"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK22"
FT                   /protein_id="CBG87152.1"
FT                   /translation="MMNLLEKLDFSWRKRLPVIQQTQAAECGLTCTGMIANYYGYKIDM
FT                   ITLRRRFSTSLKGATLADIMQVSQQLGMSTRALRLEIDELHKLSMPCILHWDMNHFVVL
FT                   KEVTKKKIIIHDPSRGRREVALSEVSKSFTGIALELIPNADFVKKEEKESLSMLKLIGN
FT                   VSGIGSAFFQVMILSIGLEVFGLLTPFYSQWVMDQVLVSADYDLLTLLGCAFITVVVLQ
FT                   NILSAIRAWVTTWFSSMLSVQWSANVCSHLLGLPMAWFEERHVGDIVSRYGSITTIQNT
FT                   LTSRFISSILDGVMAIVTLIVLFTYNVKLTFVVLVLVLVYILIRWISFRPFRQANEEQL
FT                   IASARAQSQLLESIRGVQAVKLNNKQEMRVSTYANELVEATNKGIHIQRLSIGFNTLQG
FT                   LISGVGRIVLIWMAALEVLEGNFSAGMLIAFTSFADQFTGRTTGLIDAIIEFWMLRLHG
FT                   ERLADIVLTEKEGDMDSTIALPSSDTALPIEVKNLTFRYAATEPWIFQRCSLRIESGES
FT                   VAIVGPSGQGKSTLAKLLLGLLKPEDGCIEINGQDIRKLGMSWYREHVSSVMQDDILFA
FT                   GSIMDNISFFDSLMAPDRVEQAAKLAHIHEDIMAMPMGYNSLVGDMGSSLSGGQIQRVL
FT                   LARALYRQPKILLLDEATSHLDIAREKGINDAIKKMDITRIIIAHRPETIRSADRIILV
FT                   NGGTITELPKSALPKE"
FT   misc_feature    complement(404430..404978)
FT                   /gene="mchF"
FT                   /locus_tag="ROD_03701"
FT                   /note="HMMPfam hit to PF00005, ABC transporter
FT                   related,score 3.3e-58"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    complement(404601..404645)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(404934..404957)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(405198..406010)
FT                   /gene="mchF"
FT                   /locus_tag="ROD_03701"
FT                   /note="HMMPfam hit to PF00664, ABC
FT                   transporter,transmembrane region, score 2.4e-28"
FT                   /inference="protein motif:PFAM:PF00664"
FT   misc_feature    complement(join(405279..405347,405534..405587,
FT                   405597..405665,405834..405902,405960..406028))
FT                   /gene="mchF"
FT                   /locus_tag="ROD_03701"
FT                   /note="5 probable transmembrane helices predicted for
FT                   ROD03701 by TMHMM2.0 at aa 165-187, 207-229,
FT                   286-308,312-329 and 392-414"
FT   misc_feature    complement(406086..406466)
FT                   /gene="mchF"
FT                   /locus_tag="ROD_03701"
FT                   /note="HMMPfam hit to PF03412, Peptidase C39, bacteriocin
FT                   processing, score 1.1e-42"
FT                   /inference="protein motif:PFAM:PF03412"
FT   CDS_pept        complement(406539..407852)
FT                   /transl_table=11
FT                   /gene="mchE"
FT                   /locus_tag="ROD_03711"
FT                   /product="microcin secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03711"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87153"
FT                   /db_xref="GOA:D2TK23"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK23"
FT                   /protein_id="CBG87153.1"
FT                   /translation="MPISLNSVAQHKLFLEKVMSNSLFRKEALEANKAKSIGSVALYCP
FT                   PWRWVIISLAGLVTVATLLLVFFGSYTKRETMTGALVPVDGVIDIVAVSAGTIVELPIQ
FT                   EGQSVKKGSTIATLSSEISTRYGQTRESIARQLSLQNDALEQELKNLDILSAETLRGDE
FT                   NQKNFLEQQLKKLEGIYASRLRQVRLAEGQLKKLKLMRDEGYASNRQVEEQEVSLLEAQ
FT                   SRAQDVARQQIDLQQQLTRVLQQMREHPINKIDKINDINRRLSELKQAMMENESRRSIV
FT                   LNAPLNATIASVLVKQGQMVNAGQTVASLLPENAALQARMMVSSRAIGFIVPGQRVTLR
FT                   YQAYPWQKFGQQYGVVSDVSRVSLSPQEVSAITGNSQVNEQHYIVKVKLDKQFIHAYGQ
FT                   QVKLQPGSALEADFLIDKRRLYEWVLEPLYALRRSSTL"
FT   misc_feature    complement(407499..407588)
FT                   /gene="mchE"
FT                   /locus_tag="ROD_03711"
FT                   /note="HMMPfam hit to PF00364, Biotin/lipoyl
FT                   attachment,score 0.00021"
FT                   /inference="protein motif:PFAM:PF00364"
FT   misc_feature    complement(407640..407708)
FT                   /gene="mchE"
FT                   /locus_tag="ROD_03711"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD03711 by TMHMM2.0 at aa 49-71"
FT   CDS_pept        complement(407818..409143)
FT                   /transl_table=11
FT                   /gene="mchD"
FT                   /locus_tag="ROD_03721"
FT                   /product="putative microcin secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03721"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87154"
FT                   /db_xref="GOA:D2TK24"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK24"
FT                   /protein_id="CBG87154.1"
FT                   /translation="MQFRELHNALLALLLFFISHDAASLTLQQAILAADSYDTGIRAAR
FT                   ELNEAEQQKRLQGFSGLLPQINLTGGYSKQDQPKAAYAAGVTRHNYSINLSQPIFDIEK
FT                   YATWRRAEAMADQGQINYMLMQQQLITDVSEAWFSVAYASQALKNAERTRNAFQQQLRQ
FT                   ARRGLELGEQTRLEVDEALANYDNAAVEIIIAENDLNNARIRFTKITGLPGDTVPLNNM
FT                   ECFVSPQLPDLKKVKIHSNQNNLNVQLARFTLDQSKADVIASTSNHLPVVTLQAAYGNN
FT                   WSRGENENDFDFLFGTTSKTRNTNIGINVSIPIFAGGGHIAQSIEAAHRKEQSRELLLD
FT                   AQRKALEEAERAWYAIIANDAKIRALQKSIASAKKRLESTTYGKQIGQRTVLDMLNAES
FT                   DYYKSLKELAKARYDYITANIQLAKATGELDYAYLTKFSCST"
FT   misc_feature    complement(407863..408447)
FT                   /gene="mchD"
FT                   /locus_tag="ROD_03721"
FT                   /note="HMMPfam hit to PF02321, Outer membrane efflux
FT                   protein, score 7.9e-34"
FT                   /inference="protein motif:PFAM:PF02321"
FT   misc_feature    complement(408511..409065)
FT                   /gene="mchD"
FT                   /locus_tag="ROD_03721"
FT                   /note="HMMPfam hit to PF02321, Outer membrane efflux
FT                   protein, score 1.7e-26"
FT                   /inference="protein motif:PFAM:PF02321"
FT   sig_peptide     complement(409072..409143)
FT                   /gene="mchD"
FT                   /locus_tag="ROD_03721"
FT                   /note="Signal peptide predicted for ROD03721 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.897) with cleavage site
FT                   probability 0.631 between residues 24 and 25"
FT   CDS_pept        complement(409148..409804)
FT                   /transl_table=11
FT                   /locus_tag="ROD_03731"
FT                   /product="putative response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03731"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87155"
FT                   /db_xref="GOA:D2TK25"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK25"
FT                   /protein_id="CBG87155.1"
FT                   /translation="MYNKPKKLSVAIFYDFSLFQEEIAHYLEKETKGSNIEITFYHTMP
FT                   ALFNAIENDRVNLLFTEFAFLSNNKTWLANSKKFNRLCIERNIKRAILVANQHPYLLRH
FT                   IIDMKFEATISVDEGLAGIRRIIELIQYRENIPFISKNLMQIVDETDDRQCPLTPKEWE
FT                   VLYLVAQGCSISDIAGRKNKSNSTVATQKQNAMKKLNLSSNSELIKYMYVTGMME"
FT   misc_feature    complement(409172..409345)
FT                   /locus_tag="ROD_03731"
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   protein, LuxR, score 3.2e-12"
FT                   /inference="protein motif:PFAM:PF00196"
FT   CDS_pept        complement(410678..410809)
FT                   /transl_table=11
FT                   /locus_tag="ROD_03741"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03741"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87156"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK26"
FT                   /protein_id="CBG87156.1"
FT                   /translation="MLVNAQVISFVTSGLSPQQLSTFTGASSKFSLSNVIQAAANAS"
FT   CDS_pept        complement(410888..411373)
FT                   /transl_table=11
FT                   /locus_tag="ROD_03751"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03751"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87157"
FT                   /db_xref="GOA:D2TK27"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK27"
FT                   /protein_id="CBG87157.1"
FT                   /translation="MEAIIFIAVVGWVLFIVMKMIAGRLYPSDPMEVQDKGDGGNSKDV
FT                   WGNYYKADGHVRLFEQFQHEQQQLQREQQQRQQSAREATTFYDSSEWRRLRYQAFREYG
FT                   NTCSVCGRGPGDGMVMHVDHIKPRSLYPHLALDLSNLQIMCNECNVSKSNKDEIKWR"
FT   misc_feature    complement(410906..411061)
FT                   /locus_tag="ROD_03751"
FT                   /note="HMMPfam hit to PF01844, HNH endonuclease, score
FT                   1.7e-07"
FT                   /inference="protein motif:PFAM:PF01844"
FT   misc_feature    complement(411296..411364)
FT                   /locus_tag="ROD_03751"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD03751 by TMHMM2.0 at aa 4-26"
FT   CDS_pept        complement(411527..412489)
FT                   /transl_table=11
FT                   /locus_tag="ROD_03761"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03761"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87158"
FT                   /db_xref="GOA:D2TK28"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK28"
FT                   /protein_id="CBG87158.1"
FT                   /translation="MDKPSVSQEYELLTEIAVAYYCDEITQEEIANKFGFSRIKVGRLL
FT                   KRAKEEGIVEISVRYHPVFSTQLEKQLKERFPISRALIALDHQDEEEQRRQVASLVSAH
FT                   LNNVLKDNVVVAVGQGRNVASVAEFSGTIQGRDCRFICGIGGTHRPGDVINADHISRLL
FT                   AKKFGGSSESLYAPAYVENIQLKELLLQNGTIKETLDRARKADIALVGIGDMNEESYMV
FT                   KLGWFTPQEINDASLNQGVIGDIAGYDFFNARGEHVNTVMDNRVIGLSIDELRQIPCVI
FT                   AIASENTKAMAIMGALRTGAIDIIATSARNIRTILSMSQ"
FT   misc_feature    complement(411539..412312)
FT                   /locus_tag="ROD_03761"
FT                   /note="HMMPfam hit to PF04198, Putative sugar-binding
FT                   region, score 2.8e-94"
FT                   /inference="protein motif:PFAM:PF04198"
FT   misc_feature    complement(412352..412417)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1587.000, SD 4.59 at aa 25-46, sequence
FT                   ITQEEIANKFGFSRIKVGRLLK"
FT   CDS_pept        complement(412689..414446)
FT                   /transl_table=11
FT                   /locus_tag="ROD_03771"
FT                   /product="putative dihydroxyacetone kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03771"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87159"
FT                   /db_xref="GOA:D2TK29"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK29"
FT                   /protein_id="CBG87159.1"
FT                   /translation="MTWIFNRPADFAKEMAAGFVNAHASLVRQVPGGVVRNTQSKPGSV
FT                   AIVVGGGSGHYPAFAGLVGQGLAHGAAMGNLFASPSAQQICSVARAASNGGGVLLAFGN
FT                   YAGDVLHFGLACERLRAEGIPCETIAVTDDISSATLAEKEKRRGVAGDLVVFKVAAAAA
FT                   ERGDSLAEVLAIARRANSRTCSLGLAFGGCTLPGSDSPLFTVPDGMMGFGMGIHGEPGI
FT                   NDIPVPSADRLAAMLTDKLLQEMPPEVAGAKGARAGVIVNGLGAVKYEELFVLWHYVEP
FT                   RLREAGIVVADVQIGEFVTSFNMAGMSLTLVWFDEELESLWLAPACTPAFKRGSVIAHQ
FT                   PLTAEQCEQIAAPTLPQGSEESRQAAETAMRILNAVAEKISASAGELGRIDAIAGDGDH
FT                   GIGMERGVSAARRAAEAALQKGAGVGSLLQCAADAWADEAGGTSGAIWGVILNTLGTAL
FT                   GNEKRPDAQDVARAVVQACSGVMHFGKAKPGDKTLVDVLHPFSDALQAAAGSASLAQAW
FT                   QRAADVARQSAENTAQLVPKIGRARPLAERSLGTPDAGAVSLAMIITTAGECLKDSAPT
FT                   AEAQEKVCL"
FT   misc_feature    complement(412743..413270)
FT                   /locus_tag="ROD_03771"
FT                   /note="HMMPfam hit to PF02734, Dak phosphatase, score
FT                   4.6e-55"
FT                   /inference="protein motif:PFAM:PF02734"
FT   misc_feature    complement(413442..414401)
FT                   /locus_tag="ROD_03771"
FT                   /note="HMMPfam hit to PF02733, Dak kinase, score 3.2e-128"
FT                   /inference="protein motif:PFAM:PF02733"
FT   misc_feature    complement(413868..413900)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        414766..415233
FT                   /transl_table=11
FT                   /gene="rpiB"
FT                   /locus_tag="ROD_03781"
FT                   /product="ribose 5-phosphate isomerase B"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03781"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87160"
FT                   /db_xref="GOA:D2TK30"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK30"
FT                   /protein_id="CBG87160.1"
FT                   /translation="MLKIAIGADDAATDLKNQVKAHLQKKGLDVVDFSHDVAGNEQIYP
FT                   DIAFNLASAIKEGVFGRGILLCGTGIGMAIVANKVPGIRAAQCHDVYSASRARKSNNAQ
FT                   IMTIGARVVGEELALMLVDAWLEAEFEAGRSGPKVQRIDYYETLTRSGQTA"
FT   misc_feature    414772..415194
FT                   /gene="rpiB"
FT                   /locus_tag="ROD_03781"
FT                   /note="HMMPfam hit to PF02502, Ribose/galactose
FT                   isomerase,score 8.2e-75"
FT                   /inference="protein motif:PFAM:PF02502"
FT   CDS_pept        415434..416729
FT                   /transl_table=11
FT                   /locus_tag="ROD_03791"
FT                   /product="Major Facilitator Superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03791"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87161"
FT                   /db_xref="GOA:D2TK31"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK31"
FT                   /protein_id="CBG87161.1"
FT                   /translation="MNMMKNKSTKILALFCALSFLMYVDRVNLSASAALIKEEIGLDNT
FT                   ELGIVFSAFAYTYLVFQIIGGWFCDRFGAKRTIIICGSIWVVATICTGFVGGFASLFFS
FT                   RLLLGIGEGAALPSQARAISFWFKKEKRGFVQGLTHSFSRFGNAVTPSLVALLVLAHSW
FT                   RFSFIALGVLTAIWLLMWIAWFRDTPHQFTQLSKEELAQYPQADPDVSEKVKEPTPWGA
FT                   LLKRMGPTMGVYFCYGWTGWLFFTWLPTFFMSGRGMDIKSSALFTSGVFLSGVVGNTVG
FT                   GVLSDYIYKRSGNVVAARRNVIIFSFLSALLLLIPVILSSSMTVITLCLAVAFFCLELT
FT                   IGPIWAVPMDITPKHVGIASGLMNAGSAVAGIISPILFGVIIDRTGNWSLPFYGSVVLL
FT                   MVGIILTFFMRPDIPLQEKRGRTDAHPQVSHP"
FT   sig_peptide     415434..415532
FT                   /locus_tag="ROD_03791"
FT                   /note="Signal peptide predicted for ROD03791 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.938) with cleavage site
FT                   probability 0.514 between residues 33 and 34"
FT   misc_feature    join(415467..415535,415572..415640,415674..415742,
FT                   415920..415988,416124..416192,416220..416288,
FT                   416325..416393,416406..416474,416511..416579,
FT                   416607..416660)
FT                   /locus_tag="ROD_03791"
FT                   /note="10 probable transmembrane helices predicted for
FT                   ROD03791 by TMHMM2.0 at aa 12-34, 47-69, 81-103,
FT                   163-185,231-253, 263-285, 298-320, 325-347, 360-382 and
FT                   392-409"
FT   misc_feature    415476..416582
FT                   /locus_tag="ROD_03791"
FT                   /note="HMMPfam hit to PF07690, Major facilitator
FT                   superfamily MFS-1, score 6.5e-63"
FT                   /inference="protein motif:PFAM:PF07690"
FT   CDS_pept        416752..417798
FT                   /transl_table=11
FT                   /locus_tag="ROD_03801"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03801"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87162"
FT                   /db_xref="GOA:D2TK32"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK32"
FT                   /protein_id="CBG87162.1"
FT                   /translation="MSLPVIAMVLGDPAGVGPELVAKVLSDRALLQKAHFILIADRDEM
FT                   KKGMAIAGREFPWRDVAAPTTADLTVGEALLIHHRCSHPAPFEYGKATAQSGVYILETL
FT                   KKALELTQSGLAQAICFAPLNKQAMHMGGLAFRDELHWFAHQLDWTPFCCEVNVVDNVW
FT                   AGRATSHIPFRDIVSNLSIDGVLDTITLMHNTLRQAGFATPRIAVQALNPHGGENGLFG
FT                   DEEQTIIRPAMEKARQQGINVFGPYPADTTWKAMQTEKLDAVVSMYHDQFATALKMLGF
FT                   ERGVTVQGGLPVPITTANHGTAYNLYGQNAATPSAFEQAVLLAIRMAKGSQQTRQIAPA
FT                   PVAEEEKQ"
FT   misc_feature    416827..417726
FT                   /locus_tag="ROD_03801"
FT                   /note="HMMPfam hit to PF04166, Pyridoxal phosphate (active
FT                   vitamin B6) biosynthesis PdxA, score 5.3e-120"
FT                   /inference="protein motif:PFAM:PF04166"
FT   CDS_pept        417795..418628
FT                   /transl_table=11
FT                   /locus_tag="ROD_03811"
FT                   /product="putative hydroxypyruvate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03811"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87163"
FT                   /db_xref="GOA:D2TK33"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK33"
FT                   /protein_id="CBG87163.1"
FT                   /translation="MSLRIGVNTAMFDGLDPDIAFATIAEAGFHSVELAYNQGYVGGLS
FT                   PELFSARHADRILALLEKHRLTTHTLGATMNLAADDAIADFSQRIRFAEMIGARRLTVC
FT                   LGRRADRELIIERLKVLADVALAHQCVICIENGGDPGFDLFALAEDGFAILEAVNSPAL
FT                   AFNIDAGNMVSLCPQVDAIAQALAMMPAAAHCHIKDVSVRQGEFFFPAIGEGDLNYPPL
FT                   LDALAEQGIPCSFEIPLRMHRRGDSYPERASRPVPPATSLAVLQRSRQTLLPWLE"
FT   misc_feature    417855..418445
FT                   /locus_tag="ROD_03811"
FT                   /note="HMMPfam hit to PF01261, Xylose isomerase-type TIM
FT                   barrel, score 1.4e-27"
FT                   /inference="protein motif:PFAM:PF01261"
FT   CDS_pept        418847..419896
FT                   /transl_table=11
FT                   /locus_tag="ROD_03821"
FT                   /product="putative zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03821"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87164"
FT                   /db_xref="GOA:D2TK34"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK34"
FT                   /protein_id="CBG87164.1"
FT                   /translation="MKVKAIGAYSATQPLESMDISRREPGPHDVQIEIAYCGVCHSDIH
FT                   QVRSEWAGTLYPCVPGHEIVGRVTATGEQVEKYQTGDLVGVGCIVDSCKHCGDCDDGLE
FT                   NYCDHMVGTYNGPTPDAPGHTLGGYSQQIVVDERYVLRITHPESQLAAVAPLLCAGITT
FT                   YSPLRHWQVGPGKKVGVVGIGGLGHMGIKLAHAMGAHVVAFTTSESKRDAAKALGADEV
FT                   VVSRNAEEMKAHLKSFDFILNTVAAPHNLDAFTTLLKRDGTMTLVGAPATPHDSPEVFN
FT                   LIMKRRAIAGSMIGGIPETQEMLDFCAEHGIVADIEMIRAEQINDAYERMLKGDVHYRF
FT                   VIDNATLTA"
FT   misc_feature    418925..419275
FT                   /locus_tag="ROD_03821"
FT                   /note="HMMPfam hit to PF08240, Alcohol dehydrogenase
FT                   GroES-like, score 1.5e-34"
FT                   /inference="protein motif:PFAM:PF08240"
FT   misc_feature    418955..418972
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   misc_feature    419027..419071
FT                   /note="PS00059 Zinc-containing alcohol dehydrogenases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00059"
FT   misc_feature    419366..419773
FT                   /locus_tag="ROD_03821"
FT                   /note="HMMPfam hit to PF00107, Alcohol
FT                   dehydrogenase,zinc-binding, score 5.2e-38"
FT                   /inference="protein motif:PFAM:PF00107"
FT   misc_feature    419378..419464
FT                   /note="PS00065 D-isomer specific 2-hydroxyacid
FT                   dehydrogenases NAD-binding signature."
FT                   /inference="protein motif:Prosite:PS00065"
FT   CDS_pept        complement(419908..420477)
FT                   /transl_table=11
FT                   /locus_tag="ROD_03831"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03831"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87165"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK35"
FT                   /protein_id="CBG87165.1"
FT                   /translation="MNPPVVIILAAGKGERFLASGATTHKLDTPLGAYSVLEHVIRAVA
FT                   EAGLRGHLVRPAGGTRGMGESVSLGVRATADADGWLILPGDLPLIRPASLRAVAQALCQ
FT                   KSVVLPRYRQLSGHPVGFSRRWFPLLAALDGDVGARTVVKAARACGEVLDLALADPGVT
FT                   HDIDTVADLLAASRLHDAAAPCRMRR"
FT   CDS_pept        complement(420474..421409)
FT                   /transl_table=11
FT                   /locus_tag="ROD_03841"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03841"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87166"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK36"
FT                   /protein_id="CBG87166.1"
FT                   /translation="MQQSLTGLTAEAVRDPQVAFLTDDGRDVLRFAREALAAGMEAALV
FT                   TLVEITGGAARPLGAQMAVREDGHYCGFVSGGCVESAVAFEALEVIRSGQDRTVRYGAG
FT                   SPWFDIVLPCGGGITLRIHKLRSAQPLLAVLKALEQRQSASLRYNSATQTLHMQPGYAR
FT                   ARWRDDEFVQGFRPCVRVMIFGRSVEAQSTALLAEAAGYDVQLCADASLPQMPDADTAV
FT                   ILLWHDLDRELPVLQAALAAKPFYIGALGSCRTHRKRVAKLVEQGWREADIARIKAPVG
FT                   IFPQARDARSLALSVLADVAAARLQGEESG"
FT   misc_feature    complement(421098..421313)
FT                   /locus_tag="ROD_03841"
FT                   /note="HMMPfam hit to PF02625, XdhC- CoxI, score 2e-26"
FT                   /inference="protein motif:PFAM:PF02625"
FT   misc_feature    complement(421176..421208)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(421419..423617)
FT                   /transl_table=11
FT                   /locus_tag="ROD_03851"
FT                   /product="putative xanthine
FT                   dehydrogenase,molybdenum-binding subunit"
FT                   /EC_number="1.17.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03851"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87167"
FT                   /db_xref="GOA:D2TK37"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK37"
FT                   /protein_id="CBG87167.1"
FT                   /translation="MKFEEPAGTNPIDQMKVVGRPHDRIDGPRKTTGTAPYAYEWHDIA
FT                   PDATYGYIVDSAIAKGRIVSMNIQPALNAPGVLAVVTAENAGPLGKGERNAATLLGGPE
FT                   IEHYQQAVALVVAETFEQARAAASLVQVEYQREPGAYDLAQEKPSVTTPPEDQPDQNVG
FT                   DFASAWAAAEVKLDAIYTTPDQSHMAMEPHASMAIQEGDKLTLWTSNQMINWARTDLAA
FT                   TLKMPEENIRVISPYIGGGFGGKLFLRSDALLSALGARAVNRPVKVMVPRPVIPNNTTH
FT                   RPATIQHIRIGTDREGRITAIAHDSWSGNLPGGSPETAVNQSKFLYAGANRHTGLRLAH
FT                   LDLPEGNSMRAPGETPGLMALEIAIDEMAIRAGVDPVEFRILNDTQVDPANPERPFSRR
FT                   QLIECLRTGAERFGWQHRHATPGQVRDGNWLIGMGMAAGYRDNVVVPSGARVQFHANGT
FT                   LTVETDMTDIGTGSYTIIAQTAAEMLGLPLEKVEVRLGDSAFPVSAGSGGQWGANTSTA
FT                   GVYAACVKLRETIAATLGFDPATATFAEEKIHADGRSVALREAAANGTLSAEDTIEFGD
FT                   LAKKYQQSTFAGHFVEVGVDVATGEIRVRRMLAVCAAGRILNPKTARSQVIGAMTMGIG
FT                   AALMEELAVDTRQGYFVNHDLAAYEVPVHADIPQQEVIFLEDTDPISSPMKAKGVGELG
FT                   LCGVSAAIANAVYNATGVRVRDYPIRLDKLLSALPDAV"
FT   misc_feature    complement(421614..423188)
FT                   /locus_tag="ROD_03851"
FT                   /note="HMMPfam hit to PF02738, Aldehyde oxidase and
FT                   xanthine dehydrogenase, molybdopterin binding, score
FT                   2.9e-153"
FT                   /inference="protein motif:PFAM:PF02738"
FT   misc_feature    complement(423204..423518)
FT                   /locus_tag="ROD_03851"
FT                   /note="HMMPfam hit to PF01315, Aldehyde oxidase and
FT                   xanthine dehydrogenase, a/b hammerhead, score 1.3e-31"
FT                   /inference="protein motif:PFAM:PF01315"
FT   CDS_pept        complement(423621..424553)
FT                   /transl_table=11
FT                   /locus_tag="ROD_03861"
FT                   /product="putative xanthine dehydrogenase, FAD-binding
FT                   subunit"
FT                   /EC_number="1.17.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03861"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87168"
FT                   /db_xref="GOA:D2TK38"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK38"
FT                   /protein_id="CBG87168.1"
FT                   /translation="MKAFSYEKVNTPAEAALGAQRHANAKFIAGGTNLLDLMKLEIETP
FT                   EHLIDVNGLGLDQIEATADGGVRIGALVRNTDLAADERIRRDYAVLSRALLAGASGQLR
FT                   NQATTAGNLLQRTRCPYFYDTHQPCNKRSPGSGCAARDGYSRQLAIVGVSDACIATHPS
FT                   RLLDAVVETVNPDGSERRIPLADFYRVPGDTPHLETVLQAGELIVAVTLPPPPGGTHIY
FT                   RKVRDRASYAFALVSVAAIMQPDGTGRVAFGGVAHKPWRLTEADAQLPHGAQAVCNVLF
FT                   ADAHITADNAYKLELAKRTLASVLSEARR"
FT   misc_feature    complement(423909..424550)
FT                   /locus_tag="ROD_03861"
FT                   /note="HMMPfam hit to PF00941, Molybdopterin
FT                   dehydrogenase,FAD-binding, score 1.6e-91"
FT                   /inference="protein motif:PFAM:PF00941"
FT   CDS_pept        complement(424550..425122)
FT                   /transl_table=11
FT                   /locus_tag="ROD_03871"
FT                   /product="putative xanthine dehydrogenase
FT                   iron-sulfur-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03871"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87169"
FT                   /db_xref="GOA:D2TK39"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK39"
FT                   /protein_id="CBG87169.1"
FT                   /translation="MSNQGNTQGENHLPVTPPPETLSLTLNVNGEPQQLTVDTRTTLLD
FT                   ALREHLHLTGSKKGCDHGQCGACTVLLNGRRINACLTLAVMHEGAEITTIEGLGTPDDL
FT                   HPMQAAFVRHDGYQCGYCTPGQICSSVAMLKEIEEGIPSHVTLDLVSPPEMSADEIRER
FT                   MSGNICRCGAYSNILAAIEDAAGELKS"
FT   misc_feature    complement(424574..424843)
FT                   /locus_tag="ROD_03871"
FT                   /note="HMMPfam hit to PF01799, [2Fe-2S]-binding, score
FT                   9.9e-44"
FT                   /inference="protein motif:PFAM:PF01799"
FT   misc_feature    complement(424865..425047)
FT                   /locus_tag="ROD_03871"
FT                   /note="HMMPfam hit to PF00111, Ferredoxin, score 3.9e-13"
FT                   /inference="protein motif:PFAM:PF00111"
FT   misc_feature    complement(424919..424945)
FT                   /note="PS00197 2Fe-2S ferredoxins, iron-sulfur binding
FT                   region signature."
FT                   /inference="protein motif:Prosite:PS00197"
FT   CDS_pept        425495..427048
FT                   /transl_table=11
FT                   /locus_tag="ROD_03881"
FT                   /product="putative peptide transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03881"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87170"
FT                   /db_xref="GOA:D2TK40"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK40"
FT                   /protein_id="CBG87170.1"
FT                   /translation="MHSSVNKNESRTFFGHPYPLGSLFFTEMWERFSFYGIRPLLILFM
FT                   AATVYDGGMGLARENASAIVGIFAGTMYLAALPGGWLADNWLGQQRAVWYGSILIALGH
FT                   LSIALSAWMGDNLFFIGLMFIVLGSGLFKTCISVMVGTLYKKGDARRDGGFSLFYMGIN
FT                   IGSFIAPLISGWLIKSHGWHWGFGIGGIGMLVALIIFRLFAVPAMKRYDSEVGLDSTWN
FT                   SPVAKKNGVGAWLLALAVGITILVTLIAQGVIVINPVAVASMLVYVIAASVALYFIYLF
FT                   AFAGLTRKERARLLVCFILLVSAAFFWSAFEQKPTSFNLFANDYTNRMVGDFEIPAVWF
FT                   QSINALFIILLAPVFSWAWPALARKNVRPGSISKFVIGILCAAAGFGLMMLAAQNVLSN
FT                   GGAGVSPFWLVGSILMLTLGELCLSPIGLATMTLLAPERMRGQMMGLWFCASALGNLAA
FT                   GLIGGHVKADQLDMLPDLFARCSVALLICAAVLMVLIVPVRRMLENAQQKTEQKPITHA
FT                   "
FT   misc_feature    join(425594..425662,425675..425743,425768..425836,
FT                   425849..425917,425954..426022,426035..426103,
FT                   426191..426259,426287..426355,426374..426427,
FT                   426503..426571,426605..426673,426716..426784,
FT                   426821..426889,426920..426988)
FT                   /locus_tag="ROD_03881"
FT                   /note="14 probable transmembrane helices predicted for
FT                   ROD03881 by TMHMM2.0 at aa 34-56, 61-83, 92-114,
FT                   119-141,154-176, 181-203, 233-255, 265-287, 294-311,
FT                   337-359,371-393, 408-430, 443-465 and 476-498"
FT   misc_feature    425729..425803
FT                   /note="PS01022 PTR2 family proton/oligopeptide symporters
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS01022"
FT   misc_feature    425762..426859
FT                   /locus_tag="ROD_03881"
FT                   /note="HMMPfam hit to PF00854, TGF-beta receptor, type I/II
FT                   extracellular region, score 4.3e-39"
FT                   /inference="protein motif:PFAM:PF00854"
FT   misc_feature    425957..425995
FT                   /note="PS01023 PTR2 family proton/oligopeptide symporters
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS01023"
FT   CDS_pept        427452..430523
FT                   /transl_table=11
FT                   /locus_tag="ROD_03891"
FT                   /product="putative adhesin autotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03891"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87171"
FT                   /db_xref="GOA:D2TK41"
FT                   /db_xref="InterPro:IPR004899"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK41"
FT                   /protein_id="CBG87171.1"
FT                   /translation="MSRQVSEYFLIMKPVTSFYLFKPSKIALLLSSILSAASLPVYAEG
FT                   ERIVIDSRTPVAERTLTIADGAAMEYIGVSASDASVTVNGKIDMVSPEGNTGASVYVSS
FT                   GLLDFGKGSTIGYQTLSSSVADALRVYGGTFKAEDLSITQTGVPTIGISADNSGNVVLT
FT                   GDTRIDMTITDPVTVSSSIMASAITSYRDSTIALDNLTVNYADSKTPGDVGTTTVEALE
FT                   FRGLSTKVTGDINVDLQSTSAIYLEGMNVGSNGDFEGDTNIRINTATASNGVKGLVLED
FT                   HYVTTARPGRENKINFNDVNIDVTNNEDAYTFALNTGLSFLGEVSDLTMNNLNIKVAAP
FT                   GDTSVIGALFHGSEESSVRINNVDISLTGGESTNMYGLQGVSAEDIVLNTLNVQTQGGD
FT                   RVELLRSTNARILGDVTLGSQQGLASAKGNLLAIYGSVDISNNNKFMAWGDIHSESGHV
FT                   VNIKTGDNSYLYGSTKRVSDGVIDLAFNGSSSRWDMTNSSSVTNLTLNDATLNFAPAMA
FT                   SSRNLTRETTPFKTLTVGGDYAGNNGTIIMRTQLGDDSSQTDRMIVNGNTSGTTNVTVV
FT                   NAGGAGGLTTDGIELISVAGNSDGEFRQSGRIVAGAYDYTLARGEGQNEKNWYLTSGLT
FT                   PEPQPEPVDPVDPVDPVDPVDPVDPVDPSEPQPDPASPVDPTEPVIPQAPTKPEPQKPS
FT                   PAPRENAVRPEAGLYGMNLQAANTMFNTRLHDRLGETHYIDALTGEQAVTSLWLRNVGG
FT                   HTRQQDGSGQLDMQANRYVMQLGGDIAQWSSDNTDRFHLGLMAGYANQKARAENQRNGN
FT                   RADSRISGYSVGLYGTWLQDNATQEGAYVDTWAQYSWFDNTVSGRGVESEEYDSKGFTA
FT                   SVESGYTWKLADINERNALYIQPKAQVTWMGVKADEHREANGTRVTGHGDGNVQTRVGV
FT                   RLFGKGHNRLDDGKGRTFQPFVEANWIHNSKEFGTALNGENVTLDGTRNIGELKAGVEG
FT                   QLTKNVSLWGNVGQQVGDKGYSDTSAMIGIKASF"
FT   sig_peptide     427452..427580
FT                   /locus_tag="ROD_03891"
FT                   /note="Signal peptide predicted for ROD03891 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 43 and 44"
FT   misc_feature    428949..429347
FT                   /locus_tag="ROD_03891"
FT                   /note="HMMPfam hit to PF03212, Pertactin, score 7.2e-07"
FT                   /inference="protein motif:PFAM:PF03212"
FT   misc_feature    429669..430493
FT                   /locus_tag="ROD_03891"
FT                   /note="HMMPfam hit to PF03797, Autotransporter
FT                   beta-domain,score 2e-42"
FT                   /inference="protein motif:PFAM:PF03797"
FT   CDS_pept        431335..432735
FT                   /transl_table=11
FT                   /locus_tag="ROD_03901"
FT                   /product="putative terminal oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03901"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87172"
FT                   /db_xref="GOA:D2TK42"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK42"
FT                   /protein_id="CBG87172.1"
FT                   /translation="MDIDAFLLARIQFAFTVSFHIIFPAITIGLASYLAVLEGLWLKTN
FT                   NPVWRSLYQFWVKVFAVNFGMGVVSGLVMAYQFGTNWSGFSQFAGSITGPLLTYEVLTA
FT                   FFLEAGFLGVMLFGWNKVGPGLHFLSTCMVALGTLMSTFWILASNSWMHTPQGFEVVNG
FT                   QVVPVDWFAVIFNPSFPYRLLHMSVAAFLSSAMFVGASAAWHLLKGNDTPAIRKMFSMA
FT                   LWMAMLVAPVQALIGDMHGLNTLEHQPVKIAAIEGHWENRPDEPTPLTLVGWPDMEAEE
FT                   TRYALEIPALGSLILTHSLDKQVPALKDYPKDERPNSTIVFWSFRLMVGMGVLMILLGL
FT                   ASLWLRYKNRLYQSRPFMHFALWMGPSGLIAILAGWVTTEVGRQPWVVYGLQRTRDAVS
FT                   AHSTLQMSISLLAFFVVYSLVFGVGYLYMIRLIQKGPQPFEPPTSETDGRPARPISAVG
FT                   EPLDQEKR"
FT   misc_feature    431356..432663
FT                   /locus_tag="ROD_03901"
FT                   /note="HMMPfam hit to PF01654, Cytochrome bd ubiquinol
FT                   oxidase, subunit I, score 1.1e-238"
FT                   /inference="protein motif:PFAM:PF01654"
FT   misc_feature    join(431392..431460,431497..431565,431623..431691,
FT                   431710..431778,431887..431955,431992..432045,
FT                   432298..432366,432403..432471,432553..432621)
FT                   /locus_tag="ROD_03901"
FT                   /note="9 probable transmembrane helices predicted for
FT                   ROD03901 by TMHMM2.0 at aa 20-42, 55-77, 97-119,
FT                   126-148,185-207, 220-237, 322-344, 357-379 and 407-429"
FT   CDS_pept        432735..433745
FT                   /transl_table=11
FT                   /locus_tag="ROD_03911"
FT                   /product="putative terminal oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03911"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87173"
FT                   /db_xref="GOA:D2TK43"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK43"
FT                   /protein_id="CBG87173.1"
FT                   /translation="MTLDLSVIWFAIIVFATLMYIVMDGFDLGIGILFPFIRDKHDRDV
FT                   MVNSVAPVWDGNETWLVMGGAGLFGAFPLAYAVIADALTIPLLLMLLGLIFRGVAFEFR
FT                   FKATESHRDFWDKSFIVGSILATFCQGVVVGAVVSGFQVSGRAFSGTQLDWLTPFNLFC
FT                   GLGLVITYALLGATWLIIKSEDPLQSRMRQLSRPLLIVLLLVMAVVSLWTPLTQSAIAE
FT                   RWFSLPNLYYFLPVPLLVIVFSLWLWRSLQRPDTHTRAFVLTLGLIFLGFSGLGISIWP
FT                   HIIPPDITLHEAAAPPQSQGFMLVGALIIIPIILAYTFWSYYVFRGKVRHGEGYH"
FT   misc_feature    432741..433724
FT                   /locus_tag="ROD_03911"
FT                   /note="HMMPfam hit to PF02322, Cytochrome bd ubiquinol
FT                   oxidase, subunit II, score 7.1e-148"
FT                   /inference="protein motif:PFAM:PF02322"
FT   misc_feature    join(432753..432812,432954..433022,433083..433151,
FT                   433209..433277,433314..433382,433425..433478,
FT                   433515..433583,433641..433709)
FT                   /locus_tag="ROD_03911"
FT                   /note="8 probable transmembrane helices predicted for
FT                   ROD03911 by TMHMM2.0 at aa 7-26, 74-96, 117-139,
FT                   159-181,194-216, 231-248, 261-283 and 303-325"
FT   CDS_pept        complement(433930..436584)
FT                   /transl_table=11
FT                   /locus_tag="ROD_03921"
FT                   /product="putative adhesin autotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03921"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87174"
FT                   /db_xref="GOA:D2TK44"
FT                   /db_xref="InterPro:IPR004899"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR013425"
FT                   /db_xref="InterPro:IPR030895"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK44"
FT                   /protein_id="CBG87174.1"
FT                   /translation="MKSQLISFRSSLLAIAISAALSAGAAANNGNLLSFSPPASITDTV
FT                   TINEDVTLSEHENTDAKWNEFSSLRVGYNGNGTLLIDNRSITTRAGIIGNAASGNVTLV
FT                   NGASWTLKGLNLVLGTDNGSGKLFVNSGSHISGIDELRIGEHAAGAEGEVIIEGTGSSV
FT                   SSNWSVVGDQGHGKLTITNGGALYLNEHMNIGYVGVTELSNYKGYGETLVAGENALLDV
FT                   TQGIYLGGFATTKNDATGILTVSNGATINSGNLIWLAVGAGSTGILNVGAAQGETEQAA
FT                   GTINAPRIHLGNTDGVSTAVLNFNHSSDDFLLGANITGTGEVNHIGSGTTTLTGASNYR
FT                   GTTHVANGTLRAGVNNTLSANSDYQVDSGAHLDLNGYSQTINSLSLAGTATLSGDTQDG
FT                   SPFTPTTLTINGDYSGDNALLAMRTVLDDDASATDKLVVKGDTAGVTRVSVANAGGGGA
FT                   QTVEGIRIIDVEGASNGSFVKEGRIVAGAYDYDIKKSDNQNWYLSSLKTVVPPTEPEQP
FT                   HGPVKPEEPLPPEEPVQPEPLQPEPLPPEEPDTPLPPSADDTHQYRPETGSYLANTLVA
FT                   NTLFTTRLHDRLGETQYTDMLTGEKKVTSLWMRHTGGHNRFKGGSGQVSTQSNRYVMQL
FT                   GGDIAQWSLDGLDRWHLGLMAGYANGKSRSRASLTGYTSRGEISGYSVGVYGTWYANDA
FT                   DKSGAYVDSWMLYNWFKNTVSGEALASEKYDSDGITASVETGYTFSLGASSDGRTRYWL
FT                   QPKVQLTWMDVKADNHTEKNGTRVVDDTHGNLQTRLGVKAYMQGHNAIDDGKQRTFQPF
FT                   VEANWIYNSHNYSVKMDDIHEEVKGLRNVGELKVGVEGQINPRLQLWGNVAQQIGDEGY
FT                   SDTLGMLGVKYTF"
FT   misc_feature    complement(433960..434787)
FT                   /locus_tag="ROD_03921"
FT                   /note="HMMPfam hit to PF03797, Autotransporter
FT                   beta-domain,score 2e-41"
FT                   /inference="protein motif:PFAM:PF03797"
FT   misc_feature    complement(434596..434619)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(435073..435444)
FT                   /locus_tag="ROD_03921"
FT                   /note="HMMPfam hit to PF03212, Pertactin, score 2.1e-06"
FT                   /inference="protein motif:PFAM:PF03212"
FT   sig_peptide     complement(436504..436584)
FT                   /locus_tag="ROD_03921"
FT                   /note="Signal peptide predicted for ROD03921 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.628 between residues 27 and 28"
FT   misc_feature    complement(436504..436572)
FT                   /locus_tag="ROD_03921"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD03921 by TMHMM2.0 at aa 5-27"
FT   CDS_pept        complement(437090..438757)
FT                   /transl_table=11
FT                   /gene="prpR"
FT                   /locus_tag="ROD_03931"
FT                   /product="propionate catabolism operon regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03931"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87175"
FT                   /db_xref="GOA:D2TK45"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010524"
FT                   /db_xref="InterPro:IPR012704"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK45"
FT                   /protein_id="CBG87175.1"
FT                   /translation="MAFHCNIFETRLNPLFSLFTCGDVMAASQLPPRGSDDKPVIWTVS
FT                   VTRLFDLFRDISLEFDHLATITPIQLGFEKAVTYIRKKLATERCDAIIAAGSNGAYLKS
FT                   RLSIPVILIKPSGFDVLHALAKAGKLTASIGVITYQETLPALVAFQKTFGLRLEQRSYV
FT                   TEEDARGQINELKANGIEAVVGAGLITGLAEEAGMKGIFIYSAASVRQGFIDALDISRL
FT                   TQRRHGAFAPTQALRTRYGLGDIAGQSAQMEQIRHTIMLYARSRAAVLIQGETGTGKEL
FT                   AAQAIHRECAPRSQPRSDQTSPPFVAVNCGAITESLLEAELFGYEEGAFTGSRRGGRAG
FT                   LFEIAHGGTLFLDEIGEMPLPLQTRLLRVLEEKEVTRVGGHHPVAVDVRVISATHCNLE
FT                   EAVSQGQFRRDLFYRLSVLRLNLPALRERPGDIASLAEGYLKQSLALLNVPFTESVRLG
FT                   LAQNISLLLRYRWPGNIRELRNMMERLALFLSVEPMPPLDADLLRQLLPELAAVETAPA
FT                   LASSATPQEVLAQFNGDKRAAARYLGISRTTFWRRLKQ"
FT   misc_feature    complement(437093..437185)
FT                   /gene="prpR"
FT                   /locus_tag="ROD_03931"
FT                   /note="HMMPfam hit to PF02954, Helix-turn-helix,
FT                   Fis-type,score 1.6e-08"
FT                   /inference="protein motif:PFAM:PF02954"
FT   misc_feature    complement(437096..437161)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1370.000, SD 3.85 at aa 533-554, sequence
FT                   GDKRAAARYLGISRTTFWRRLK"
FT   misc_feature    complement(437318..437347)
FT                   /note="PS00688 Sigma-54 interaction domain C-terminal part
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00688"
FT   misc_feature    complement(437321..438025)
FT                   /gene="prpR"
FT                   /locus_tag="ROD_03931"
FT                   /note="HMMPfam hit to PF00158, RNA polymerase sigma factor
FT                   54, interaction, score 1.3e-126"
FT                   /inference="protein motif:PFAM:PF00158"
FT   misc_feature    complement(437570..437587)
FT                   /note="PS00134 Serine proteases, trypsin family, histidine
FT                   active site."
FT                   /inference="protein motif:Prosite:PS00134"
FT   misc_feature    complement(437693..437740)
FT                   /note="PS00676 Sigma-54 interaction domain ATP-binding
FT                   region B signature."
FT                   /inference="protein motif:Prosite:PS00676"
FT   misc_feature    complement(438071..438595)
FT                   /gene="prpR"
FT                   /locus_tag="ROD_03931"
FT                   /note="HMMPfam hit to PF06506, Propionate catabolism
FT                   activator, N-terminal, score 4e-92"
FT                   /inference="protein motif:PFAM:PF06506"
FT   CDS_pept        438932..439816
FT                   /transl_table=11
FT                   /gene="prpB"
FT                   /locus_tag="ROD_03941"
FT                   /product="methylisocitrate lyase"
FT                   /EC_number="4.1.3.30"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03941"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87176"
FT                   /db_xref="GOA:D2TK46"
FT                   /db_xref="InterPro:IPR012695"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK46"
FT                   /protein_id="CBG87176.1"
FT                   /translation="MSLDSPGQAFRAALSKENPLQIVGTINANHALLAQRAGYQAIYLS
FT                   GGGVAAGSLGLPDLGISTLDDVLTDIRRITDVCPLPLPLLVDADIGFGASAFNVARTVR
FT                   SMIKAGAAALHIEDQIGAKRCGHRPNKAIVSKEEMVDRIRAAVDARTDPHFVIMARTDA
FT                   LAVEGLEAALDRAQAYVEAGADMLFPEAITELAMYRQFADAVNVPILANITEFGATPLF
FT                   TTDELRSAGVAMALYPLSAFRAMNRAAERVYNVLREEGTQKSVIDMMQTRNELYESINY
FT                   YQYEERLDALYKK"
FT   misc_feature    439175..439420
FT                   /gene="prpB"
FT                   /locus_tag="ROD_03941"
FT                   /note="HMMPfam hit to PF00463, Isocitrate lyase and
FT                   phosphorylmutase, score 2.7e-08"
FT                   /inference="protein motif:PFAM:PF00463"
FT   CDS_pept        439899..441068
FT                   /transl_table=11
FT                   /gene="prpC"
FT                   /locus_tag="ROD_03951"
FT                   /product="2-methylcitrate synthase"
FT                   /EC_number="2.3.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03951"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87177"
FT                   /db_xref="GOA:D2TK47"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK47"
FT                   /protein_id="CBG87177.1"
FT                   /translation="MTDTTILQNNAHVIKPKKSVALSGVPAGNTALCTVGKSGNDLHYR
FT                   GYDILDLAQHCEFEEVAYLLIHGKLPTRDELQAYKVKLKALRGLPANVRTVLEALPAAS
FT                   HPMDVIRTGVSALGCTLPEKEGHTVSGARDIADKLLASLSSILLYWYHYSHNGERIQPE
FT                   TDDDSIGGHFLHLLHGEKPSQSWEKAMHVSLVLYAEHEFNASTFTSRVIAGTGSDVYSA
FT                   IIGAIGALRGPKHGGANEVSLEIQQRYETPDEAEADIRRRVENKEVVIGFGHPVYTLAD
FT                   PRHQVIKRVAKQLSEEGGSLKMYNIADRLETVMWESKKMFPNLDWFSAVSYNMMGVPTG
FT                   MFTPLFVIARVTGWAAHIIEQRQDNKIIRPSANYTGPEDRPFVSLDERR"
FT   misc_feature    439962..441008
FT                   /gene="prpC"
FT                   /locus_tag="ROD_03951"
FT                   /note="HMMPfam hit to PF00285, Citrate synthase, score
FT                   3.5e-98"
FT                   /inference="protein motif:PFAM:PF00285"
FT   misc_feature    439989..440012
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    440709..440747
FT                   /note="PS00480 Citrate synthase signature."
FT                   /inference="protein motif:Prosite:PS00480"
FT   CDS_pept        441105..442556
FT                   /transl_table=11
FT                   /gene="prpD"
FT                   /locus_tag="ROD_03961"
FT                   /product="2-methylcitrate dehydratase"
FT                   /EC_number="4.2.1.79"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03961"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87178"
FT                   /db_xref="GOA:D2TK48"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR012705"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK48"
FT                   /protein_id="CBG87178.1"
FT                   /translation="MSVQELNIRPPFDREIVDIVDYVLNYDITSTVAYDTAHYCLLDTL
FT                   GCGLEALEYPACKKLMGPIVPGTVVPHGARVPGTQFQLDPVQAAFNIGAMIRWLDFNDT
FT                   WLAAEWGHPSDNLGGILATADWLSRNAVAAGKAPLTMKQVLTGMIKAHEIQGCIALENA
FT                   FNRVGLDHVLLVKVASTAVVAEMLGLERDEILNAVSLAWVDGQSLRTYRHAPNTGTRKS
FT                   WAAGDATSRAVRLALMAKTGEMGYPSALTAKTWGFYDVSFKGETFRFQRPYGSYVMENV
FT                   LFKISFPAEFHSQTAVEAAMTLYQQMQAAGKSAADIEKVTIRTHEACIRIIDKKGPLNN
FT                   PADRDHCIQYMVAIPLLFGRLTAADYEDGVAQDKRIDALREKIVCVEDSQFTADYHDPE
FT                   KRAIANAITVAFTDGTAFDEVVVDYPIGHARRRADGIPKLIEKFKINLARQFPIRQQQR
FT                   ILDVSLDRTRLEQMPVNEYLDLYVI"
FT   misc_feature    441141..442529
FT                   /gene="prpD"
FT                   /locus_tag="ROD_03961"
FT                   /note="HMMPfam hit to PF03972, MmgE/PrpD, score 2.6e-240"
FT                   /inference="protein motif:PFAM:PF03972"
FT   CDS_pept        442575..444461
FT                   /transl_table=11
FT                   /gene="prpE"
FT                   /locus_tag="ROD_03971"
FT                   /product="propionate--coA ligase"
FT                   /EC_number="6.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03971"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87179"
FT                   /db_xref="GOA:D2TK49"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR012694"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK49"
FT                   /protein_id="CBG87179.1"
FT                   /translation="MSFSEFYQRSITQPEAFWAEQARRIDWQKPFTRTLDHSRPPFARW
FT                   FCGGTTNLCHNAVDRWLATQPEALALIAVSSETEEERTFTFRQLHDEVNVVASMLLSLG
FT                   VRRGDRVLVYMPMIAEAHITLLACARIGAIHSVVFGGFASHSVAARIDDARPVLIVSAD
FT                   AGVRGGKVLPYKKLLDDAIAQAQHQPKHVLLVDRGLAKMARIAGRDLDFASLRQQHCGA
FT                   RTPVAWLESNETSCILYTSGTTGKPKGVQRDVGGYAVALATSMDTIFGGRAGGVFFCAS
FT                   DIGWVVGHSYIVYAPLLAGMATIVYEGLPTYPDCGVWWKIVEKYRVNRMFSAPTAIRVL
FT                   KKFPTAQIRNHDLSSLEVLYLAGEPLDEPTAAWVTQTLGVPVIDNYWQTESGWPIMALA
FT                   RQLDDRPSRLGSPGVPMYGYNVQLLNEVTGEPCGVNEKGMVVIEGPLPPGCIQTIWGDD
FT                   ERFVKTYWSLFSRQVYATFDWGIRDADGYYFILGRTDDVINVAGHRLGTREIEESISGY
FT                   PNVAEVAVVGVKDALKGQVAVAFVIPKQSDSLEDREAAHSEEEAIMALVDSQIGHFGRP
FT                   AHVWFVSQLPKTRSGKMLRRTIQAICEGRDPGDLTTLDDPAALQQIRRVIEE"
FT   misc_feature    442827..444149
FT                   /gene="prpE"
FT                   /locus_tag="ROD_03971"
FT                   /note="HMMPfam hit to PF00501, AMP-dependent synthetase and
FT                   ligase, score 5e-111"
FT                   /inference="protein motif:PFAM:PF00501"
FT   misc_feature    443283..443318
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT                   /inference="protein motif:Prosite:PS00455"
FT   CDS_pept        complement(444733..445986)
FT                   /transl_table=11
FT                   /gene="lacY"
FT                   /locus_tag="ROD_03981"
FT                   /product="lactose permease"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03981"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87180"
FT                   /db_xref="GOA:D2TK50"
FT                   /db_xref="InterPro:IPR000576"
FT                   /db_xref="InterPro:IPR018457"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK50"
FT                   /protein_id="CBG87180.1"
FT                   /translation="MHYLKNTNFWMFGFFFFFYFFIMGAYFPFFPIWLHDINHISKGDT
FT                   GIIFACISLFSLLFQPVFGLLSDKLGLRKHLLWIITGMLVMFAPFFIYVFGPLLQFNIL
FT                   LGSIVGGIYLGFIYNAGAPAIEAYIEKVSRRSNFEFGRARMFGCVGWALCASIVGIMFT
FT                   INNEFVFWLGSGCAVILALLLFFAKTDASSTATVADAVGANHSAFSLKLALELFRQPKL
FT                   WFLSLYVVGVSCTYDVFDQQFANFFTSFFTTGEQGTRVFGYVTTMGELLNASIMFFAPL
FT                   IVNRIGGKNALLLAGTIMSVRIIGSSFASSALEVVILKTLHMFEVPFLIVGCFKYITSQ
FT                   FEVRFSATIYLVCFCFFKQLAMIFMSVFAGNMYESIGFQGAYLVLGLIALGFTLISVFT
FT                   LSGPGPLAFLRRQTNEAV"
FT   misc_feature    complement(444748..445986)
FT                   /gene="lacY"
FT                   /locus_tag="ROD_03981"
FT                   /note="HMMPfam hit to PF01306, Proton/sugar symporter,LacY,
FT                   score 0"
FT                   /inference="protein motif:PFAM:PF01306"
FT   misc_feature    complement(join(444784..444852,444880..444948,
FT                   444985..445053,445141..445209,445426..445485,
FT                   445495..445554,445612..445680,445693..445761,
FT                   445786..445854,445882..445950))
FT                   /gene="lacY"
FT                   /locus_tag="ROD_03981"
FT                   /note="10 probable transmembrane helices predicted for
FT                   ROD03981 by TMHMM2.0 at aa 13-35, 45-67, 76-98,
FT                   103-125,145-164, 168-187, 260-282, 312-334, 347-369 and
FT                   379-401"
FT   misc_feature    complement(445105..445149)
FT                   /note="PS00897 LacY family proton/sugar symporters
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00897"
FT   misc_feature    complement(445285..445317)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(445753..445797)
FT                   /note="PS00896 LacY family proton/sugar symporters
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00896"
FT   CDS_pept        complement(446038..449121)
FT                   /transl_table=11
FT                   /gene="lacZ"
FT                   /locus_tag="ROD_03991"
FT                   /product="beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03991"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87181"
FT                   /db_xref="GOA:D2TK51"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR023933"
FT                   /db_xref="InterPro:IPR032312"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK51"
FT                   /protein_id="CBG87181.1"
FT                   /translation="MNLNTDSLAAVLARRDWENPGVTQLNRLEAHPPFSSWRNADDARA
FT                   CRDATHKRSLNGEWRFAWFPSPEAVPESWLTDDLQQADSVQLPSNWQMYGYDAPIYTNV
FT                   TYPIPVNPPFVPSDNPTGCYSLTFTVDDAWLREGQTRIIFDGVNSAFHLWCNGRWIGYG
FT                   QDSRLPSEFDLSAFLTSGENRLAVMVLRWCDGTYLEDQDMWRMSGIFRDVTLLHKPLTQ
FT                   ISDLRIATHFNDDFSRAELAAEVRLRGELCDELRVTVQLWDGETQVGECTAPLGSEIID
FT                   ERGAWHDRVSLRLKVDKPSLWSAETPWLYRAVALLHTADGTLIEAEACDVGFREVKIEN
FT                   GLLLLNGKPLLIRGANRHEHHPQNGQVMDEATMVQDILLMKQNNFNAVRCSHYPNHPLW
FT                   YTLCDRYGLYVVDEANIETHGMTPMNRLSDDPDWLPAMSQRVTRMVQRDRNHPAIIIWS
FT                   LGNESGHGANHDALYRWLKAEDPSRPVQYEGGGANSAATDIICPMYARVDQDQPFPAVP
FT                   KWSIKKWLSMPGEQRPLILCEYAHAMGNSLGGFAKYWQAFRQYPRLQGGFVWDWVDQSL
FT                   IKYDENGNPWSAYGGDFGDTPNDRQFCMDGLVFADRTPHPSLYEAKHAQQFFQFTLLPG
FT                   DGMRIEVASEYLFRHSDNEILHWSITLDGNPVAAGEAALDIAPQGRQLIALPDIAAPDA
FT                   AGQLWLTVRVEQPQATAWSPAGHISAWQQWPLAEKLSVTIPPRAAAAPQLKVENAAFEV
FT                   VVNQQRWQFCRQRGTLSQYWIADAAQLLTPLTDQFTRAPLDNDIGISEVTRIDPNAWVE
FT                   RWKAAGHYRAEAQLLQCEAETLSNAVLITTAHAWQYQGETLFVSRKIWRIDGQGELTIT
FT                   VDVDVASGTPHPARVGLSCQLAQVAERVNWLGLGPHENYPDRLSAACFDRWDLPLAEMY
FT                   TPYVFPSENGLRCGTRELCYGAHRWRGDFQFNISRYSQKQLMETSHRHLLREENGTWLN
FT                   IDGYHMGVGGDDSWSPSVSPEYQLSAGRYHYQIVWGQK"
FT   misc_feature    complement(446047..446868)
FT                   /gene="lacZ"
FT                   /locus_tag="ROD_03991"
FT                   /note="HMMPfam hit to PF02929, Glycoside hydrolase, family
FT                   42, domain 5, score 6.2e-140"
FT                   /inference="protein motif:PFAM:PF02929"
FT   misc_feature    complement(447232..448116)
FT                   /gene="lacZ"
FT                   /locus_tag="ROD_03991"
FT                   /note="HMMPfam hit to PF02836, Glycoside hydrolase family
FT                   2, TIM barrel, score 2.4e-188"
FT                   /inference="protein motif:PFAM:PF02836"
FT   misc_feature    complement(447736..447780)
FT                   /note="PS00608 Glycosyl hydrolases family 2 acid/base
FT                   catalyst."
FT                   /inference="protein motif:Prosite:PS00608"
FT   misc_feature    complement(447889..447966)
FT                   /note="PS00719 Glycosyl hydrolases family 2 signature 1."
FT                   /inference="protein motif:Prosite:PS00719"
FT   misc_feature    complement(448120..448461)
FT                   /gene="lacZ"
FT                   /locus_tag="ROD_03991"
FT                   /note="HMMPfam hit to PF00703, Glycoside hydrolase family
FT                   2, immunoglobulin-like beta-sandwich, score 3.2e-47"
FT                   /inference="protein motif:PFAM:PF00703"
FT   misc_feature    complement(448465..448977)
FT                   /gene="lacZ"
FT                   /locus_tag="ROD_03991"
FT                   /note="HMMPfam hit to PF02837, Glycoside hydrolase family
FT                   2, carbohydrate-binding, score 2.3e-92"
FT                   /inference="protein motif:PFAM:PF02837"
FT   CDS_pept        complement(449243..450331)
FT                   /transl_table=11
FT                   /gene="lacI"
FT                   /locus_tag="ROD_04001"
FT                   /product="lactose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04001"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87182"
FT                   /db_xref="GOA:D2TK52"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK52"
FT                   /protein_id="CBG87182.1"
FT                   /translation="MNVKPVTLYDVANHAGVSYQTVSRVVNQASHVSARTREKVEAAMA
FT                   ELNYIPNRIAQQLAGKQTPLIGVATANLALHAPSQIVAAIKSRADRSGASVVISMVERH
FT                   GAEACKAAVHNLLTQRVTGLIINYPLDENDAIAVAAACGDVPVLFLDVSDLAPVNSIIF
FT                   SHADGARLAVEHLVEHGHQRIALLAGPHSSVSARLRLAGWHKYLAHHQRQPVAEAEGDW
FT                   SAMSGFQQTMKMLTDGAQPGALLVANDQMALGAMRAISEFGLRPGVDISVIGYDDTEDS
FT                   ACYIPPLTTIRQDFPQLGEASVERLLKLAGGESAFGNQLLPVTLVKRKTVQRADAPAAS
FT                   PQALADSLLHLARQVAQLSPKM"
FT   misc_feature    complement(449330..449986)
FT                   /gene="lacI"
FT                   /locus_tag="ROD_04001"
FT                   /note="HMMPfam hit to PF00532, Periplasmic binding
FT                   protein/LacI transcriptional regulator, score 1.2e-13"
FT                   /inference="protein motif:PFAM:PF00532"
FT   misc_feature    complement(450239..450316)
FT                   /gene="lacI"
FT                   /locus_tag="ROD_04001"
FT                   /note="HMMPfam hit to PF00356, Bacterial regulatory
FT                   protein, LacI, score 1.9e-11"
FT                   /inference="protein motif:PFAM:PF00356"
FT   misc_feature    complement(450251..450316)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2026.000, SD 6.09 at aa 6-27, sequence
FT                   VTLYDVANHAGVSYQTVSRVVN"
FT   misc_feature    complement(450254..450310)
FT                   /note="PS00356 Bacterial regulatory proteins, lacI family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00356"
FT   CDS_pept        complement(450359..451315)
FT                   /transl_table=11
FT                   /locus_tag="ROD_04011"
FT                   /product="putative AraC-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04011"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87183"
FT                   /db_xref="GOA:D2TK53"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK53"
FT                   /protein_id="CBG87183.1"
FT                   /translation="MRPVTVAIVAVDNFSPFHYSVPSILFSDKVAAQKRFTVKICAEAP
FT                   GTLSSQEGFSLHAAYGYEAINDAGIVIVPYWDDTDRRPPQTLLAALRAARQNGAQIVGL
FT                   CLGAFVLGYAGLLEGKRAATHWAFEEEFQARFPAAKLDINALYVDDEGIITSAGTAAAL
FT                   DCCLYIIRQRFGSVVANQIARKMVVPPHREGGQAQYIARPVPESTRDQRINALLDYLRQ
FT                   HLHEPHDLNSLAQRVRMSRRTLSRHFMNATGCSVAEWLIRERLRLSQTLLESSQLPVER
FT                   IAGEAGFQSAVTWRQHFKSHFGVSPTEWRKTFRGVAS"
FT   misc_feature    complement(450383..450517)
FT                   /locus_tag="ROD_04011"
FT                   /note="HMMPfam hit to PF00165, Helix-turn-helix, AraC
FT                   type,score 2.3e-06"
FT                   /inference="protein motif:PFAM:PF00165"
FT   misc_feature    complement(450533..450673)
FT                   /locus_tag="ROD_04011"
FT                   /note="HMMPfam hit to PF00165, Helix-turn-helix, AraC
FT                   type,score 4.1e-05"
FT                   /inference="protein motif:PFAM:PF00165"
FT   misc_feature    complement(450569..450634)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1516.000, SD 4.35 at aa 228-249, sequence
FT                   HDLNSLAQRVRMSRRTLSRHFM"
FT   misc_feature    complement(450794..451207)
FT                   /locus_tag="ROD_04011"
FT                   /note="HMMPfam hit to PF01965, ThiJ/PfpI, score 3.7e-05"
FT                   /inference="protein motif:PFAM:PF01965"
FT   CDS_pept        complement(451327..452103)
FT                   /transl_table=11
FT                   /locus_tag="ROD_04021"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04021"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87184"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK54"
FT                   /protein_id="CBG87184.1"
FT                   /translation="MNITQIRNATQLITYGGKTFLIDPLLAPKGAYPGFPGTARAEIRN
FT                   PTVELPCDIDSLLQADALIVTHLHADHWDDVAAKVVPKDKPIYVQNARDAQTLRGQGFT
FT                   ALTVLAENTVFGEVTLRKTGGQHGSDRLYAIPKMAERLGEACGVIFTHPQEKTLYLAGD
FT                   TIWRAEVEASLTRYQPDVVVLNAGFAHVIGFGPIIMGAEDVLKTHFILPEAQIVATHME
FT                   AINHCLLTRAALREYARDNQIAEYVHVPEDGETLTF"
FT   CDS_pept        452318..452824
FT                   /transl_table=11
FT                   /locus_tag="ROD_04031"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04031"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87185"
FT                   /db_xref="GOA:D2TK55"
FT                   /db_xref="InterPro:IPR019690"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK55"
FT                   /protein_id="CBG87185.1"
FT                   /translation="MKWGCIKCGVEIPQHTEYCSECEDKQFTKIGGFLYLPLLGLFITA
FT                   LSHLVASYESFKYLVDNFYHLFFDAKLFFIGTFTISLVVFLAAAWVISVFLRKKKSLPK
FT                   LYIGLMLLLIVLTALNTWMLSVLIPGIYIGSEELVPLLRLIISACIWIPYFLKSVRVKR
FT                   TFINP"
FT   misc_feature    join(452405..452473,452531..452599,452636..452704,
FT                   452732..452785)
FT                   /locus_tag="ROD_04031"
FT                   /note="4 probable transmembrane helices predicted for
FT                   ROD04031 by TMHMM2.0 at aa 30-52, 72-94, 107-129 and
FT                   139-156"
FT   CDS_pept        complement(453123..454169)
FT                   /transl_table=11
FT                   /gene="fbpC"
FT                   /locus_tag="ROD_04041"
FT                   /product="Fe(3+) ions import ATP-binding protein FbpC (ec
FT                   3.6.3.30)"
FT                   /EC_number="3.6.3.30"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04041"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87186"
FT                   /db_xref="GOA:D2TK56"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR015853"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK56"
FT                   /protein_id="CBG87186.1"
FT                   /translation="MSQKNFVELRNVSKRFGSNTVIDNINLTIPQGQMVTLLGPSGCGK
FT                   TTILRLVAGLEKPSDGQIFIDGEDVTHRSIQQRDICMVFQSYALFPHMSLGDNVGYGLK
FT                   MLGVSRAEVKARVKEALAMVDLEGFADRYVDQISGGQQQRVALARALILKPKVLLFDEP
FT                   LSNLDANLRRSMRDKIRELQKQFNITSLYVTHDQSEAFAVSDTVLVMNKGHIMQIGSPQ
FT                   DLYRQPASRFMASFMGDANLFPATFSAQAVEIYGYRLPRPAHFVAEGSGTVGVRPEAIT
FT                   LSDRGEESQRCTIRHVAYMGPQYEVTVEWHGQEILLQVNATRLQPDVGEHYYLEIHPYG
FT                   MFVLADAA"
FT   misc_feature    complement(453138..453353)
FT                   /gene="fbpC"
FT                   /locus_tag="ROD_04041"
FT                   /note="HMMPfam hit to PF08402, Transport-associated OB,type
FT                   2, score 1.7e-15"
FT                   /inference="protein motif:PFAM:PF08402"
FT   misc_feature    complement(453531..454076)
FT                   /gene="fbpC"
FT                   /locus_tag="ROD_04041"
FT                   /note="HMMPfam hit to PF00005, ABC transporter
FT                   related,score 3e-67"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    complement(453717..453761)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(454032..454055)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(454181..456259)
FT                   /transl_table=11
FT                   /gene="afuB"
FT                   /locus_tag="ROD_04051"
FT                   /product="Ferric ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04051"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87187"
FT                   /db_xref="GOA:D2TK57"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK57"
FT                   /protein_id="CBG87187.1"
FT                   /translation="MSQTLALHPVKKRDAIFLWVLLSWLAFALLPSWSLDYGLLESTRD
FT                   EILDAYGWAGVNVSWLWYLLPGLLLARPLHEARREQRSRHYLDAGWALLCMAFVVVSAT
FT                   LEGRGLGYAAIVLFVALGAIVTLALTRLEWLGGDRFVIGSLVAIIALIGVFIVWPSIAI
FT                   FIPMFTNDAGEFAPLAFMTVLSQAHIIQVIINSVALSMAVGVGCTFFGLVLAIYTTRIA
FT                   RRGAVIGRIFSILPIVTPPFVVGLGVTLMMGRSGYVTELMVEWFGLSNTNWLYGFTGIW
FT                   LAQVLAFTPMAFMILDGAIKTIHPSLEEASYTLRASRWQTFNGVFVPLLKPALANAFLI
FT                   VIVQSLADFSNPLVLGGNFDVLATQIYFYITGSQLDYQAASTLGAFLLLFSLLVFCIQY
FT                   MWIGKRSYVTVSGKSYRGDVQPLPVTLVWGVIAILAVWIAFNALLYGSIFYGSFTVNWG
FT                   VDYTLTLDNFIKLFGQGMSDGAWPSLLDTLLYAGIAAPITAAFGLLIAWIVVRQQFKGK
FT                   KTIEFTTMLCFAVPGTVAGVSYILAFNSAPVYLTGTAAIVIISMVMRNVPVGIRAGIAG
FT                   LGQIDKSLDEASLSLRAGSLRTITHILLPLLRPAILSALIYSFVRAITTVSAIVFLVTP
FT                   DTRVATAYILNRVEDGEYGVAIAYGSILIVVMLAIIFIFDWLIGEARISRSKAKNQA"
FT   misc_feature    complement(454193..454822)
FT                   /gene="afuB"
FT                   /locus_tag="ROD_04051"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component, score 3.2e-07"
FT                   /inference="protein motif:PFAM:PF00528"
FT   misc_feature    complement(join(454226..454294,454361..454429,
FT                   454556..454624,454637..454696,454730..454798,
FT                   454922..454990,455051..455119,455219..455287,
FT                   455375..455443,455501..455569,455606..455701,
FT                   455759..455827,455864..455932,455945..456007,
FT                   456044..456112,456155..456214))
FT                   /gene="afuB"
FT                   /locus_tag="ROD_04051"
FT                   /note="16 probable transmembrane helices predicted for
FT                   ROD04051 by TMHMM2.0 at aa 16-35, 50-72, 85-105,
FT                   110-132,145-167, 187-218, 231-253, 273-295, 325-347,
FT                   381-403,424-446, 488-510, 522-541, 546-568, 611-633 and
FT                   656-678"
FT   misc_feature    complement(455039..455683)
FT                   /gene="afuB"
FT                   /locus_tag="ROD_04051"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component, score 9.3e-10"
FT                   /inference="protein motif:PFAM:PF00528"
FT   misc_feature    complement(455639..455671)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   sig_peptide     complement(456158..456259)
FT                   /gene="afuB"
FT                   /locus_tag="ROD_04051"
FT                   /note="Signal peptide predicted for ROD04051 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.671) with cleavage site
FT                   probability 0.438 between residues 34 and 35"
FT   CDS_pept        complement(456337..457368)
FT                   /transl_table=11
FT                   /gene="afuA"
FT                   /locus_tag="ROD_04061"
FT                   /product="ABC transporter periplasmic iron-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04061"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87188"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKU7"
FT                   /protein_id="CBG87188.1"
FT                   /translation="MKMTFTSTLIASAVALAALTGAAQAKGRLVVYCSATNELCEAQTK
FT                   AFGEKYDVKTSFIRNGSGSTLAKVDAEKKNPQADVWYGGTLDPQSQAGEMGLLQPYKSP
FT                   ALAQVMENFRDPAKLKGNYSSAVYVGILGFGVNTERLKEKNLPVPKCWKDLTKPEYKGE
FT                   IQIADPQSSGTAYTALATFVQLWGDDQAFDYLKQLNANVSQYTKSGIAPARNAARGETA
FT                   IGIGFLHDYSLEKEQGAPLELISPCEGTGYEIGGVSILKGARNLDNARLFVDWVLSKEA
FT                   QELAWKKGKSYQILSNTTAETSPNSLKLDGLKLIHYDMDKYGSTEVRKALINKWVSDVK
FT                   MGK"
FT   misc_feature    complement(456520..457341)
FT                   /gene="afuA"
FT                   /locus_tag="ROD_04061"
FT                   /note="HMMPfam hit to PF01547, Bacterial extracellular
FT                   solute-binding protein, family 1, score 4.8e-12"
FT                   /inference="protein motif:PFAM:PF01547"
FT   sig_peptide     complement(457294..457368)
FT                   /gene="afuA"
FT                   /locus_tag="ROD_04061"
FT                   /note="Signal peptide predicted for ROD04061 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.985 between residues 25 and 26"
FT   CDS_pept        complement(457365..458669)
FT                   /transl_table=11
FT                   /gene="uhpC"
FT                   /locus_tag="ROD_04071"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04071"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87189"
FT                   /db_xref="GOA:D2TKU8"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKU8"
FT                   /protein_id="CBG87189.1"
FT                   /translation="MHARQTTAIDQRYRALRLTLLLCMVTGYAAFYLTRKSVNYVLPAL
FT                   QTDLGLDKGDIGLLGSLFYLSYGLSKFTAGLWHDSHGQRGFMGAGLFATGVLNVAFAFG
FT                   ESLTLLLAVWTLNGFFQGWGWPPCARLLTHWYSRNERGFWWGCWNMSINIGGAIIPLIS
FT                   AFAAHWWGWQAAMLTPGIISMALGIWLTLQLKGTPREEGLPSVGAWRNDPLELRQEQLS
FT                   PPMGLWRMLRITMLRNPMIWLLGGSYVLVYLIRIALNDWGNIWLTESHGVNLLSANATV
FT                   MLFEVGGLLGALFAGWGSDLLFSGQRAPMILLFTLGLMVSVAALWLAPVHHYALLAACF
FT                   FTVGFFVFGPQMLIGLAAVECGHKAAAGSITGFLGLFAYLGAALAGWPLSLVIERYDWS
FT                   GMFSLLSIAAVLMGLLLMPLLMAGVSATLSQRIKQ"
FT   misc_feature    complement(join(457398..457466,457509..457577,
FT                   457602..457670,457680..457748,457782..457850,
FT                   457893..457952,458097..458165,458178..458246,
FT                   458283..458351,458361..458417,458436..458504,
FT                   458574..458633))
FT                   /gene="uhpC"
FT                   /locus_tag="ROD_04071"
FT                   /note="12 probable transmembrane helices predicted for
FT                   ROD04071 by TMHMM2.0 at aa 13-32, 56-78, 85-103,
FT                   107-129,142-164, 169-191, 240-259, 274-296, 308-330,
FT                   334-356,365-387 and 402-424"
FT   misc_feature    complement(457488..458600)
FT                   /gene="uhpC"
FT                   /locus_tag="ROD_04071"
FT                   /note="HMMPfam hit to PF07690, Major facilitator
FT                   superfamily MFS-1, score 1.8e-47"
FT                   /inference="protein motif:PFAM:PF07690"
FT   misc_feature    complement(457653..457685)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(458754..460301)
FT                   /transl_table=11
FT                   /gene="uhpB"
FT                   /locus_tag="ROD_04081"
FT                   /product="two-component system sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04081"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87190"
FT                   /db_xref="GOA:D2TKU9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKU9"
FT                   /protein_id="CBG87190.1"
FT                   /translation="MSHPLRYVVISLFIVLAWGTGWLMLWTLGFYLTHNGQQAALFLPH
FT                   GVYLALLILLARRYWPALVLPPMLMLLWLRSEQLLSGDLLVLLAAPLVSLLPASIAQRF
FT                   WQRFPLYWQRLTLLLTAVTVASLLNTALLSPLLKSPAMLSGLASFTGGVLLTPFVYLIF
FT                   EFLRQQHRYQLLAQDTQNPPLRTSLIIWCSLFFIIGIGTQLTLSPELERLLLIVVFLPN
FT                   VVMAWKFGWQGGVLAGLLGSMMITIARQVGVGFSNLIELEIFLATQALLGMGLGIAISR
FT                   QQHLAQNLHHYRQRLEAELAARRALTEKLIHSEEDTRKSLARELHDEIGQNITAIQIQT
FT                   QLVKRARDPAQTQAAASQINDLARRIHHSTRQLLRQLRPPALDELSFNEALHHLLNEFA
FT                   FAERGIRCRFDYRLTATPESETVRFTLYRLLQELLNNVCKHAEASEVAILLCQQGERLR
FT                   LEVQDNGTGIGDGQLPGFGIQGMRERVSALGGELSLESRHGTRVIVNLPTNLQQTHG"
FT   misc_feature    complement(458775..459041)
FT                   /gene="uhpB"
FT                   /locus_tag="ROD_04081"
FT                   /note="HMMPfam hit to PF02518, ATP-binding
FT                   region,ATPase-like, score 1.3e-20"
FT                   /inference="protein motif:PFAM:PF02518"
FT   misc_feature    complement(459156..459353)
FT                   /gene="uhpB"
FT                   /locus_tag="ROD_04081"
FT                   /note="HMMPfam hit to PF07730, Histidine
FT                   kinase,dimerisation and phosphoacceptor region, score
FT                   1e-16"
FT                   /inference="protein motif:PFAM:PF07730"
FT   misc_feature    complement(459453..460274)
FT                   /gene="uhpB"
FT                   /locus_tag="ROD_04081"
FT                   /note="HMMPfam hit to PF05231, MASE1, score 1.3e-59"
FT                   /inference="protein motif:PFAM:PF05231"
FT   misc_feature    complement(join(459462..459530,459549..459617,
FT                   459684..459752,459813..459881,459891..459959,
FT                   459996..460064,460122..460187,460206..460274))
FT                   /gene="uhpB"
FT                   /locus_tag="ROD_04081"
FT                   /note="8 probable transmembrane helices predicted for
FT                   ROD04081 by TMHMM2.0 at aa 10-32, 39-60, 80-102,
FT                   115-137,141-163, 184-206, 229-251 and 258-280"
FT   CDS_pept        complement(460301..460930)
FT                   /transl_table=11
FT                   /gene="uhpA"
FT                   /locus_tag="ROD_04091"
FT                   /product="two-component system response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04091"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87191"
FT                   /db_xref="GOA:D2TKV0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKV0"
FT                   /protein_id="CBG87191.1"
FT                   /translation="MIRVVLVDDHVVVRSGFAQLLSLEEDLEVAGQFSRAADAWPALLR
FT                   DDVSVAVMDIAMPDENGLSLLKRLRAQKPQFRAIILSIYDSPTFVQSALTAGASGYLTK
FT                   RCGPEELVQAVRSVGLGGHYLCADALRALRGGEQLPPELEALTPREREVFNLLVKGDSV
FT                   KEIAFKLDLSHKTVHVYRANVLGKLNCHSTIELVHFALDHKLLVGH"
FT   misc_feature    complement(460331..460504)
FT                   /gene="uhpA"
FT                   /locus_tag="ROD_04091"
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   protein, LuxR, score 1.3e-24"
FT                   /inference="protein motif:PFAM:PF00196"
FT   misc_feature    complement(460370..460453)
FT                   /note="PS00622 Bacterial regulatory proteins, luxR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00622"
FT   misc_feature    complement(460583..460927)
FT                   /gene="uhpA"
FT                   /locus_tag="ROD_04091"
FT                   /note="HMMPfam hit to PF00072, Response regulator
FT                   receiver,score 2e-33"
FT                   /inference="protein motif:PFAM:PF00072"
FT   CDS_pept        461184..462146
FT                   /transl_table=11
FT                   /gene="tauA"
FT                   /locus_tag="ROD_04101"
FT                   /product="taurine ABC transporter, substrate-binding
FT                   protein (sulfate starvation induced protein)"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04101"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87192"
FT                   /db_xref="GOA:D2TKV1"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKV1"
FT                   /protein_id="CBG87192.1"
FT                   /translation="MALSSRNTLLAALAFIAFQAQAVNVTVAYQTSAEPAKVAQADNTF
FT                   EKASGATVAWRKFDSGASIVRALASGDVQIGNLGSSPLAVAASQQVPIEVFLLASKLGN
FT                   SEALVVKKTIGKPQDLIGKRIAVPFISTTHYSLLAALKHWGIKPGQLEIINLQPPAIIA
FT                   AWQRGDIDGAYVWAPAVNALEKEGRVLTDLAMVGEWGSPTLDVWVVRKDFAEQHPEVVK
FT                   AFAKSALDAQQSYIANPDDWLKQPENISKLSRLSGVPEADVPGLVKGNTYLTPQQQTAE
FT                   LNGPVNKAIIDTAQFLKEQGKVPAVASDYSQYVTDRFVQ"
FT   sig_peptide     461184..461249
FT                   /gene="tauA"
FT                   /locus_tag="ROD_04101"
FT                   /note="Signal peptide predicted for ROD04101 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.998 between residues 22 and 23"
FT   misc_feature    461250..461918
FT                   /gene="tauA"
FT                   /locus_tag="ROD_04101"
FT                   /note="HMMPfam hit to PF04069, Substrate-binding region of
FT                   ABC-type glycine betaine transport system, score 2e-26"
FT                   /inference="protein motif:PFAM:PF04069"
FT   CDS_pept        462157..462924
FT                   /transl_table=11
FT                   /gene="tauB"
FT                   /locus_tag="ROD_04111"
FT                   /product="taurine ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04111"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87193"
FT                   /db_xref="GOA:D2TKV2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015859"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKV2"
FT                   /protein_id="CBG87193.1"
FT                   /translation="MLQLSHLYADYGGKPALEDINLTLDSGELLVVLGPSGCGKTTLLN
FT                   LIAGFAPYRHGTIQLAGKRVDGPGAERGVVFQHEGLLPWRNVQDNVAFGLQLAGVGKAQ
FT                   RIHVAQEMLKKVGLEGAGKRFIWQLSGGQRQRVGIARALAANPQLLLLDEPFGALDVFT
FT                   REQMQTLLLRLWHETGKQVLLITHDIEEAVFMATELVLLSPGPGRVLERLPLNFARRFV
FT                   AGESCRSIKSDPQFIDTREYVLNRVFAQREAFS"
FT   misc_feature    462235..462771
FT                   /gene="tauB"
FT                   /locus_tag="ROD_04111"
FT                   /note="HMMPfam hit to PF00005, ABC transporter
FT                   related,score 2.8e-53"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    462256..462279
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    462541..462585
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        462921..463754
FT                   /transl_table=11
FT                   /gene="tauC"
FT                   /locus_tag="ROD_04121"
FT                   /product="taurine ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04121"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87194"
FT                   /db_xref="GOA:D2TKV3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKV3"
FT                   /protein_id="CBG87194.1"
FT                   /translation="MSVAINDKPRQRALKLKWRWPLSRQLTLSLGTLAVIVSVWWAVAT
FT                   LQLVSPLFLPPPGQVLQKLWVIAGPQGFMDATLWQHLAASLTRIVLALLAAAIVGIPVG
FT                   IAMGLSPAIRGVLDPIIELYRPVPPLAYLPLMVIWFGIGETSKILLIYLAIFAPVAMSA
FT                   LAGVKSAQQVRLRAAQSLGASRSQVLWFVILPGALPEILTGLRIGLGVGWSTLVAAELI
FT                   AATRGLGFMVQSAGEFLATDVVLAGIAVIAVIAFMLELGLRALQRRLTPWHGEVQ"
FT   misc_feature    join(462981..463049,463179..463247,463281..463349,
FT                   463362..463421,463482..463550,463632..463700)
FT                   /gene="tauC"
FT                   /locus_tag="ROD_04121"
FT                   /note="6 probable transmembrane helices predicted for
FT                   ROD04121 by TMHMM2.0 at aa 21-43, 87-109, 121-143,
FT                   148-167,188-210 and 238-260"
FT   misc_feature    463164..463733
FT                   /gene="tauC"
FT                   /locus_tag="ROD_04121"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component, score 6.1e-21"
FT                   /inference="protein motif:PFAM:PF00528"
FT   misc_feature    463419..463505
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS_pept        463751..464602
FT                   /transl_table=11
FT                   /gene="tauD"
FT                   /locus_tag="ROD_04131"
FT                   /product="alpha-ketoglutarate-dependent taurine
FT                   dioxygenase"
FT                   /EC_number="1.14.11.17"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04131"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87195"
FT                   /db_xref="GOA:D2TKV4"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKV4"
FT                   /protein_id="CBG87195.1"
FT                   /translation="MSERLSITPLGPYIGALISGADLSRPLSDNQFEQLYHAVLRHQVV
FT                   FLREQVITPQQQRALALRFGDLHIHPVYPHAEGVEEIIVLDTHNDNPPDNDNWHTDVTF
FT                   IETPPAGAILAAKELPSTGGDTLWTSGIAAYEALSAPFRQLLSGLRAEHDFRKSFPEHK
FT                   YRATEEEHQRWREAVAKHPPLLHPVVRTHPVSGRQALFVNEGFTTRIVDVTEKESDALL
FT                   SFLFAHITRPEFQVRWRWQPNDVAVWDNRVTQHYANADYLPQRRIMHRATILGDKPFYR
FT                   AG"
FT   misc_feature    463766..464590
FT                   /gene="tauD"
FT                   /locus_tag="ROD_04131"
FT                   /note="HMMPfam hit to PF02668, Taurine catabolism
FT                   dioxygenase TauD/TfdA, score 1.7e-121"
FT                   /inference="protein motif:PFAM:PF02668"
FT   misc_feature    464105..464122
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT                   /inference="protein motif:Prosite:PS00343"
FT   CDS_pept        complement(464672..465646)
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="ROD_04141"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /EC_number="4.2.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04141"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87196"
FT                   /db_xref="GOA:D2TKV5"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKV5"
FT                   /protein_id="CBG87196.1"
FT                   /translation="MTDLIQRPRRLRKSAALRAMFEETTLSLNDLVLPIFVEEELDDYK
FT                   AIEAMPGIMRIPEKHLAREIERIASAGIRSVMTFGISHHTDETGSDAWKEDGLVARMSR
FT                   ICKQTVPDMIVMSDTCFCEYTSHGHCGVLCEHGVDNDATLANLGKQAVVAAAAGADFIA
FT                   PSAAMDGQVQAIRQALDAAGFTDTAIMSYSTKFASSFYGPFREAAGTALKGDRKTYQMN
FT                   PMNRREAIRESLLDEAQGADCLMVKPAGAYLDVLRDIRERTELPLGAYQVSGEYAMIKF
FT                   AAMAGAIDEEKVVLESLGAIKRAGADLIFSYFALDLAEKKILR"
FT   misc_feature    complement(464684..465640)
FT                   /gene="hemB"
FT                   /locus_tag="ROD_04141"
FT                   /note="HMMPfam hit to PF00490, Tetrapyrrole
FT                   biosynthesis,porphobilinogen synthase, score 1.2e-226"
FT                   /inference="protein motif:PFAM:PF00490"
FT   misc_feature    complement(464891..464929)
FT                   /note="PS00169 Delta-aminolevulinic acid dehydratase active
FT                   site."
FT                   /inference="protein motif:Prosite:PS00169"
FT   CDS_pept        465938..468859
FT                   /transl_table=11
FT                   /locus_tag="ROD_04151"
FT                   /product="putative outer membrane autotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04151"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87197"
FT                   /db_xref="GOA:D2TKV6"
FT                   /db_xref="InterPro:IPR003991"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKV6"
FT                   /protein_id="CBG87197.1"
FT                   /translation="MHSWKKKLVVSQLALACTLAITSQANASTDISGTTYNTFTHYDNS
FT                   THADGVYFEGYVGWNNYATNSVYNGNIYPVIKNSTVNGVISTYYLDDGLATNANDNSLT
FT                   IKNSTIHGMITSECMTTDCVNRDTGYVYDRLALTVDNSTIDDNYEHYTYNGTYTDGTAD
FT                   THIFDVYNLGVAVTLDQEVDLVIKNNSHVAGISLIQGYEWEDTDDNTVSTGVNSSKVFT
FT                   NKITVADSTVTSGSWSDEGTSGWFGNNNNASDYNGSGYSADDVALEVYANPFADNAMQT
FT                   TATFSNSTLMGDVVFASNFDENFFPNGADSYRDTDTNVDTNGWDGTDRLDLTLNNGSKW
FT                   VGAAMSVHQVDTDGDGVYDSIETGTEATSTLIDIAANSLWPWSTYGVDNSDTAYDENGH
FT                   VVGNEVYQSGLFNVTLNNGSQWDTTKSSLIDTLNINSGSIVNVADSTLISDTIDLTGGA
FT                   ALNINEDGHVATDKLTVNNSTVTIADDVSAGWGVNDAALYANTINVTNNGVLDVGNSTA
FT                   YALQADTLNLTSYTDANGHVNAGVFNVHSNSFVLDADLTNDRTWDTTKSNYGYGIIAMN
FT                   SDGHLTINGNGDAYSADLAEVDNAGDGVAAATGNYKVRIDNATGEGSVADYKGKELIYV
FT                   NDKNSTATFSAANKADLGAFTYQARQEGNTVVLQQMQLTDYANMALSIPSANSNIWNLQ
FT                   QDTVGTRLTNARHGLADNGGAWVSYFGGNFNGDNGTIKYDQDVNGIMVGVDTKIDGNNA
FT                   KWIVGAAAGFAKGDMSDRTGQVDQDSQSAYIYSSARFANDVFVDGNLSYSHFNNDLTAN
FT                   MSNGQYVDGNTSADAWGFGLKLGYDWKLGDAGYLTPYGSVSGLFQSGDDYRLSNNLRVD
FT                   GQSYDSIRYELGVDAGYTFTYSDDQAMTPYFKLAYVYDDANNDAHVNGDSIDNGTEGSA
FT                   VRVGLGTQFSFTKNFSAYTDVNYLGGGDVDQDWSANLGVKYTW"
FT   sig_peptide     465938..466018
FT                   /locus_tag="ROD_04151"
FT                   /note="Signal peptide predicted for ROD04151 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.962 between residues 27 and 28"
FT   misc_feature    468062..468799
FT                   /locus_tag="ROD_04151"
FT                   /note="HMMPfam hit to PF03797, Autotransporter
FT                   beta-domain,score 9.5e-32"
FT                   /inference="protein motif:PFAM:PF03797"
FT   CDS_pept        468906..469574
FT                   /transl_table=11
FT                   /locus_tag="ROD_04161"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04161"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87198"
FT                   /db_xref="GOA:D2TKV7"
FT                   /db_xref="InterPro:IPR034719"
FT                   /db_xref="InterPro:IPR041687"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKV7"
FT                   /protein_id="CBG87198.1"
FT                   /translation="MPIKDLMGITARKASMLSLDKPLKEFALLNKCLSKYGTRFEIPRQ
FT                   KECLFSENIAHDNTIVIQEGLISLRRQEQVLVGIGQAPVILGLDNGVMKNEVQYDIFTE
FT                   GACSGYYLPSTKTVEVIEECQLWREACYWITWLNRFLELRDRQLIGNNSYEQIRSTLIT
FT                   MNEWEEALRSRIGVMNYIHQRTRISRSVVAEVLAALRKGGYIEMNKGKLVKINRLPYEY
FT                   "
FT   CDS_pept        complement(469575..470732)
FT                   /transl_table=11
FT                   /gene="ampH"
FT                   /locus_tag="ROD_04171"
FT                   /product="penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04171"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87199"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKV8"
FT                   /protein_id="CBG87199.1"
FT                   /translation="MKRSLLFSAVLCAASLTSVQAAQPIAEPVFASDIVERYANHIFYG
FT                   SGATGMALVVIDGNQRVFRSFGETRPGNNVRPQLDSVIRIASITKLMTSEMLVKLLDQG
FT                   TVRLDDPLSKYAPPGAYVPSYQGKPITLVHLATHTSALPREQPGGAPKRPVFVWPTREQ
FT                   RWTYLSDATLKAAPGSQASYSNLAYDLLADALANAAGKPYSQLFAEKITRPLGMKDTTF
FT                   TPSPDQCKRLMVAEKGASPCNNTLAAIGSGGVYSTPGDMMRWMQQYLSSDFYHRSNQAD
FT                   RMQTLIYQRAQLTRVTGMDVPGKADALGLGWVYMAPKNGRPGIIQKTGGGGGFITYMAM
FT                   IPQQNVGAFVVVTRSPLTRFKNMSDGINDLVVELSENRPLAVPAS"
FT   misc_feature    complement(469614..470630)
FT                   /gene="ampH"
FT                   /locus_tag="ROD_04171"
FT                   /note="HMMPfam hit to PF00144, Beta-lactamase, score
FT                   3.9e-74"
FT                   /inference="protein motif:PFAM:PF00144"
FT   sig_peptide     complement(470670..470732)
FT                   /gene="ampH"
FT                   /locus_tag="ROD_04171"
FT                   /note="Signal peptide predicted for ROD04171 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.962 between residues 21 and 22"
FT   CDS_pept        471074..472294
FT                   /transl_table=11
FT                   /gene="sbmA"
FT                   /locus_tag="ROD_04181"
FT                   /product="putative microcin B17 uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04181"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87200"
FT                   /db_xref="GOA:D2TKV9"
FT                   /db_xref="InterPro:IPR009248"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKV9"
FT                   /protein_id="CBG87200.1"
FT                   /translation="MFKSFFPKPGPFFLSALIWAVIAIIFWQAGGGARLAHLSGASGDA
FT                   PISAARFWSPGYLIFYAYYALCVGAFALFWFTYSPHRWQYWSITGTALIIFVTWFLVEV
FT                   GVAVNAWYAPFYDLIQQALTSPHKVTMAQFYNGLGIFLGIALIAVVISVLNNFFVSHYV
FT                   FRWRTAMNEYYMAHWQHLRHIEGAAQRVQEDTMRFASTLENMGVSFINAIMTLVAFLPV
FT                   LITLSAHVPELPVVGHVPYSLVMAAIVWSLIGTGLLAVVGIKLPGLEFKNQRVEAAYRK
FT                   ELVYGEDDASRAAPPTVRELFSAVRQNYFRLYFHYMYFNIARILYLQADNVFGLFLLFP
FT                   SIVAGTLTLGLMTQITNVFGQVRGAFQYLINSWTTLVELMSIYKRLRSFEHTLDDKEIQ
FT                   VVTHTLG"
FT   sig_peptide     471074..471181
FT                   /gene="sbmA"
FT                   /locus_tag="ROD_04181"
FT                   /note="Signal peptide predicted for ROD04181 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.799) with cleavage site
FT                   probability 0.500 between residues 36 and 37"
FT   misc_feature    join(471107..471166,471239..471307,471326..471394,
FT                   471482..471550,471689..471757,471800..471868,
FT                   472067..472135,472163..472222)
FT                   /gene="sbmA"
FT                   /locus_tag="ROD_04181"
FT                   /note="8 probable transmembrane helices predicted for
FT                   ROD04181 by TMHMM2.0 at aa 12-31, 56-78, 85-107,
FT                   137-159,206-228, 243-265, 332-354 and 364-383"
FT   misc_feature    471311..472255
FT                   /gene="sbmA"
FT                   /locus_tag="ROD_04181"
FT                   /note="HMMPfam hit to PF05992, SbmABacA-like, score
FT                   1.5e-239"
FT                   /inference="protein motif:PFAM:PF05992"
FT   CDS_pept        472309..473403
FT                   /transl_table=11
FT                   /locus_tag="ROD_04191"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04191"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87201"
FT                   /db_xref="InterPro:IPR011673"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKW0"
FT                   /protein_id="CBG87201.1"
FT                   /translation="MAAASRLYPLSLLAGLVLVGCSTRTAQPLKQGEKPVDVASVVRQK
FT                   MPASVKDRDDWANDLAKTFESQKIAPTVENVCSVLAVAQQESGYTADPVVPGLSKIAWQ
FT                   EIDRRAERMHIPVFLVHTALKITSPNGKSYSERLDKVRTEKQLSAIFDDFINMVPMGQT
FT                   LFGSLNPVHTGGPMQVSIAFAEQHARGYPWKMEGTVRQEVFTRRGGLWFGTYHLLNYPA
FT                   NYSAPIFRFADFNAGWYASRNAAFQNAVSKASGVKLALDGDLIMYGSKDAGKTELAVRK
FT                   LADKLDLSESAIRRQLEKGDSLAFEETALYERVYALAEKKTGKKLPREMLPGIQLESPK
FT                   ITRNLTTAWFAKRVDDRRAKCMGR"
FT   sig_peptide     472309..472386
FT                   /locus_tag="ROD_04191"
FT                   /note="Signal peptide predicted for ROD04191 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.986) with cleavage site
FT                   probability 0.970 between residues 26 and 27"
FT   misc_feature    472339..472371
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    472450..473400
FT                   /locus_tag="ROD_04191"
FT                   /note="HMMPfam hit to PF07759, Protein of unknown function
FT                   DUF1615, score 7.4e-240"
FT                   /inference="protein motif:PFAM:PF07759"
FT   misc_feature    473110..473133
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    473137..473202
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1577.000, SD 4.56 at aa 277-298, sequence
FT                   LAVRKLADKLDLSESAIRRQLE"
FT   CDS_pept        complement(473443..473751)
FT                   /transl_table=11
FT                   /locus_tag="ROD_04201"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04201"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87202"
FT                   /db_xref="GOA:D2TKW1"
FT                   /db_xref="InterPro:IPR020513"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKW1"
FT                   /protein_id="CBG87202.1"
FT                   /translation="MADFTLSKSLFNGKHRETSSTPGNIAYAVFVLFCFWAGAQILNLL
FT                   VHAPGVYEHLMQVQETGRPRVEIGLGVGTIFGLVPFLVGSLIFGVIAAFLHWRHRHH"
FT   misc_feature    complement(join(473482..473550,473611..473679))
FT                   /locus_tag="ROD_04201"
FT                   /note="2 probable transmembrane helices predicted for
FT                   ROD04201 by TMHMM2.0 at aa 25-47 and 68-90"
FT   CDS_pept        473976..474224
FT                   /transl_table=11
FT                   /locus_tag="ROD_04211"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04211"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87203"
FT                   /db_xref="GOA:D2TKW2"
FT                   /db_xref="InterPro:IPR020490"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKW2"
FT                   /protein_id="CBG87203.1"
FT                   /translation="MPACFFRSGAVMNLPVKIRRDWHYYAFAIGLIFILNGIVGLLGFD
FT                   AKGWQTYAVGAVTWVISFWLAGLIIRRRVEEDETAQE"
FT   misc_feature    join(474039..474107,474117..474185)
FT                   /locus_tag="ROD_04211"
FT                   /note="2 probable transmembrane helices predicted for
FT                   ROD04211 by TMHMM2.0 at aa 22-44 and 48-70"
FT   CDS_pept        complement(474479..475573)
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /locus_tag="ROD_04231"
FT                   /product="D-alanine:D-alanine ligase A"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04231"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87204"
FT                   /db_xref="GOA:D2TKW3"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKW3"
FT                   /protein_id="CBG87204.1"
FT                   /translation="MAKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFEVVLLGIDK
FT                   QGQWHVSDAANYLLNADDPAHIALRPSATRLAQVPGQHEHQLIDARTATPLPTVDVIFP
FT                   IVHGTLGEDGSLQGMLRVANLPFVGSDVLGSAACMDKDVTKRLLRDTGLNIAPFVTLSR
FT                   ANRHTFSFADIKARLGLPLFVKPANQGSSVGVSKVTNEAQYAQAVALAFEFDHKVVVEQ
FT                   GIVGREIECAVLGNDRPQASTCGEIVLNSDFYAYDTKYIDDNGAKVVVPATIDPQINDK
FT                   IRDIAIQAYQTLGCAGMARVDVFLTAENEVVINEINTLPGFTNISMYPKLWQASGLSYT
FT                   DLISRLIELALERHAADNALKTTI"
FT   misc_feature    complement(474530..475156)
FT                   /gene="ddlA"
FT                   /locus_tag="ROD_04231"
FT                   /note="HMMPfam hit to PF07478, D-alanine--D-alanine
FT                   ligase,C-terminal, score 5.2e-123"
FT                   /inference="protein motif:PFAM:PF07478"
FT   misc_feature    complement(474611..474697)
FT                   /note="PS00844 D-alanine--D-alanine ligase signature 2."
FT                   /inference="protein motif:Prosite:PS00844"
FT   misc_feature    complement(475157..475564)
FT                   /gene="ddlA"
FT                   /locus_tag="ROD_04231"
FT                   /note="HMMPfam hit to PF01820, D-alanine--D-alanine
FT                   ligase,N-terminal, score 3e-82"
FT                   /inference="protein motif:PFAM:PF01820"
FT   misc_feature    complement(475220..475255)
FT                   /note="PS00843 D-alanine--D-alanine ligase signature 1."
FT                   /inference="protein motif:Prosite:PS00843"
FT   misc_feature    complement(475532..475555)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        475660..476364
FT                   /transl_table=11
FT                   /locus_tag="ROD_04241"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04241"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87205"
FT                   /db_xref="GOA:D2TKW4"
FT                   /db_xref="InterPro:IPR009683"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKW4"
FT                   /protein_id="CBG87205.1"
FT                   /translation="MKRKGGGVKGKGWLVIILLGAACGVGYRYLPSYYNPFAPLELADP
FT                   PGWLTQFKLRQLTPERCHALLEQANQQKLISSQPVADSAGECPLTDVVRVRDFGVVKLS
FT                   SSFLASCPLALSSALFVEQQARPLTERFMASRLVRIDHLGSFACRNIYHRPDARRSEHA
FT                   SAQALDISGFRLADGRRISVLHGWKQEVSAPWLRALLNASCQYYGNGLGPEYNAAHANH
FT                   FHLGMRGYGLCR"
FT   misc_feature    475696..475749
FT                   /locus_tag="ROD_04241"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD04241 by TMHMM2.0 at aa 13-30"
FT   misc_feature    475696..475728
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    476017..476361
FT                   /locus_tag="ROD_04241"
FT                   /note="HMMPfam hit to PF06904, Extensin-like,
FT                   C-terminal,score 8e-59"
FT                   /inference="protein motif:PFAM:PF06904"
FT   CDS_pept        476533..477738
FT                   /transl_table=11
FT                   /locus_tag="ROD_04251"
FT                   /product="putative efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04251"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87206"
FT                   /db_xref="GOA:D2TKW5"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKW5"
FT                   /protein_id="CBG87206.1"
FT                   /translation="MESWKVNLISVWFGCFFTGLAISQILPFLPLYISQLGVSSHEALS
FT                   MWSGLTFSVTFLISAIVSPLWGSLADRKGRKLMLLRASLGMAIAILLQAFATNVWQLFL
FT                   LRGIMGLTSGYIPNAMALVASQVPRERSGWALSTLATAQISGVIGGPLMGGFIADHVGL
FT                   RPVFFITAMLLVVSFLVTLFLIKEGARPTLKKSERLSGKAVFASLPYPALIISLFFTTL
FT                   VIQLCNGSISPILALFIKSMAPDSNNIAFLSGLIASVPGISALISAPRLGKLGDRIGTE
FT                   RILLATLICAVVLFFAMSWVTTPLQLGILRFLLGFADGAMLPAVQTLLVKYSSDQITGR
FT                   IFGYNQSFMYLGNVAGPLMGATVSAMAGFRWVFIATAIIVLINVLQLTLTLRRRRKRSA
FT                   TV"
FT   misc_feature    join(476551..476619,476662..476730,476764..476823,
FT                   476836..476904,476938..477006,477016..477084,
FT                   477142..477210,477277..477345,477379..477438,
FT                   477451..477519,477553..477621,477631..477699)
FT                   /locus_tag="ROD_04251"
FT                   /note="12 probable transmembrane helices predicted for
FT                   ROD04251 by TMHMM2.0 at aa 7-29, 44-66, 78-97,
FT                   102-124,136-158, 162-184, 204-226, 249-271, 283-302,
FT                   307-329,341-363 and 367-389"
FT   misc_feature    476563..477627
FT                   /locus_tag="ROD_04251"
FT                   /note="HMMPfam hit to PF07690, Major facilitator
FT                   superfamily MFS-1, score 3.2e-49"
FT                   /inference="protein motif:PFAM:PF07690"
FT   CDS_pept        477935..478252
FT                   /transl_table=11
FT                   /locus_tag="ROD_04261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04261"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87207"
FT                   /db_xref="GOA:D2TKW6"
FT                   /db_xref="InterPro:IPR019732"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKW6"
FT                   /protein_id="CBG87207.1"
FT                   /translation="MQHEFIVITSCFTGEGNRVMKNLIAELLLKLAQKEEESKELVAQV
FT                   EALEIIVTAMLRNMAQNEQDTLIQQVEGALDGVKPDASIPDDDRELLRQYVQKLLKHPR
FT                   Y"
FT   CDS_pept        478464..479879
FT                   /transl_table=11
FT                   /gene="phoA"
FT                   /locus_tag="ROD_04271"
FT                   /product="alkaline phosphatase"
FT                   /EC_number="3.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04271"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87208"
FT                   /db_xref="GOA:D2TKW7"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR018299"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKW7"
FT                   /protein_id="CBG87208.1"
FT                   /translation="MKQSAMIFALLPLLLAPASQADTTTISVLDNRAAQGDITTPGGAR
FT                   RLTGDQTAALRESLNDKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTG
FT                   QYTHYALNKKTGKPDYVTDSAASATAWSTGVKTYNGALGVDIHEKDHLTILEMAKAAGL
FT                   ATGNVSTAELQDATPAALIAHVTSRKCYGPTATSEKCPTNALEKGGKGSITEQLLNARA
FT                   DVTLGGGAKTFAETATAGEWQGKTLREQAQMRGYQLVGDAASLAAIDEANQDKPLLGLF
FT                   AEGNMPVRWEGPKASYHGNIDKPAVTCTPNPKRNDAIPTLAQMTDKAIELLSKNERGFF
FT                   LQVEGASIDKQDHAANPCGQIGETVDLDEAVQRALAFAKKDGNTLVIVTADHAHASQIV
FT                   APETKAPGLTQALNTKDGAVMVISYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQT
FT                   DLFYTMKAALGLK"
FT   sig_peptide     478464..478526
FT                   /gene="phoA"
FT                   /locus_tag="ROD_04271"
FT                   /note="Signal peptide predicted for ROD04271 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.995 between residues 21 and 22"
FT   misc_feature    478635..479717
FT                   /gene="phoA"
FT                   /locus_tag="ROD_04271"
FT                   /note="HMMPfam hit to PF00245, Alkaline phosphatase, score
FT                   1.3e-152"
FT                   /inference="protein motif:PFAM:PF00245"
FT   misc_feature    478824..478850
FT                   /note="PS00123 Alkaline phosphatase active site."
FT                   /inference="protein motif:Prosite:PS00123"
FT   misc_feature    479178..479201
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        480057..480377
FT                   /transl_table=11
FT                   /gene="psiF"
FT                   /locus_tag="ROD_04281"
FT                   /product="phosphate starvation-inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04281"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87209"
FT                   /db_xref="InterPro:IPR011690"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKW8"
FT                   /protein_id="CBG87209.1"
FT                   /translation="MKITLLVTLLFGLVFLTTVGAAEKTLTPQQQRMTTCNQQATAQTL
FT                   KGDARKTYMSDCLKNSQSAPGEKSLTPQQQKMRECNSQATQQSLKGDDRSKFMSACLKK
FT                   AA"
FT   sig_peptide     480057..480119
FT                   /gene="psiF"
FT                   /locus_tag="ROD_04281"
FT                   /note="Signal peptide predicted for ROD04281 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.958 between residues 21 and 22"
FT   misc_feature    480069..480122
FT                   /gene="psiF"
FT                   /locus_tag="ROD_04281"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD04281 by TMHMM2.0 at aa 5-22"
FT   misc_feature    480129..480233
FT                   /gene="psiF"
FT                   /locus_tag="ROD_04281"
FT                   /note="HMMPfam hit to PF07769, PsiF, score 1.6e-18"
FT                   /inference="protein motif:PFAM:PF07769"
FT   misc_feature    480261..480365
FT                   /gene="psiF"
FT                   /locus_tag="ROD_04281"
FT                   /note="HMMPfam hit to PF07769, PsiF, score 1.7e-21"
FT                   /inference="protein motif:PFAM:PF07769"
FT   CDS_pept        480516..481616
FT                   /transl_table=11
FT                   /locus_tag="ROD_04291"
FT                   /product="putative signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04291"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87210"
FT                   /db_xref="GOA:D2TKW9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR007894"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKW9"
FT                   /protein_id="CBG87210.1"
FT                   /translation="MNDENFYKRAVAVDETSSLTPPHDLQRSGLRFARRVRAPRAVALG
FT                   GMFFPIAAALVTHPVAGGWWLLLVGWAFVWPHLAWQIASRAIDPRGQEFNNLKADAILA
FT                   GMWVGLMGMNALPSAALLMIVSMNLMGAGGLRLSVIGLSMMAVACLVTLQLTGGSLILM
FT                   SIPLVGWLTLPVMVIYPLLFARLSYQIATRLAEHKRRLQIMSSRDGMTGVYNRRHWEQL
FT                   LRNEFELCRRQHRECTLLIIDIDHFKDINDTWGHDVGDEAIQALTRQLRTTLRSSDVIG
FT                   RFGGDEFAVIMCGTPAESAIAAMSRVHEGLRALRLACAPQVILHISVGVAPLTPQFGHY
FT                   REWLKSADLALYKAKNAGRNRTEVAA"
FT   misc_feature    480591..481100
FT                   /locus_tag="ROD_04291"
FT                   /note="HMMPfam hit to PF05230, MASE2, score 2.2e-89"
FT                   /inference="protein motif:PFAM:PF05230"
FT   misc_feature    join(480636..480704,480822..480890,480924..480983,
FT                   480996..481064)
FT                   /locus_tag="ROD_04291"
FT                   /note="4 probable transmembrane helices predicted for
FT                   ROD04291 by TMHMM2.0 at aa 41-63, 103-125, 137-156 and
FT                   161-183"
FT   misc_feature    480930..480962
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    481116..481598
FT                   /locus_tag="ROD_04291"
FT                   /note="HMMPfam hit to PF00990, GGDEF, score 1.6e-65"
FT                   /inference="protein motif:PFAM:PF00990"
FT   CDS_pept        complement(481632..482441)
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="ROD_04301"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04301"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87211"
FT                   /db_xref="GOA:D2TKX0"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKX0"
FT                   /protein_id="CBG87211.1"
FT                   /translation="MDKKIGFIGCGNMGKAILGGLIASGQVLPAQIWVYTPSPKKVAAL
FT                   HDQYGINAAQSAQEVAQIADIVFGAVKPAIMIKVLSDITSSLNKESLVVSIAAGVTLDQ
FT                   LARALGHDRKIVRAMPNTPSLVNAGMTSITPNALVTPEDTADVLNIFRCFGEAEVIAES
FT                   MIHPVVGVSGSAPAYVFMFIEAMADAAVLGGMPRAQAYKFAAQAVMGSAKMVLETGEHP
FT                   GALKDMVCSPGGTTIEAVRVLEERGFRAAVIEAMAKCMEKSEKLSKS"
FT   misc_feature    complement(481689..482432)
FT                   /gene="proC"
FT                   /locus_tag="ROD_04301"
FT                   /note="HMMPfam hit to PF03807, NADP oxidoreductase,coenzyme
FT                   F420-dependent, score 1.2e-97"
FT                   /inference="protein motif:PFAM:PF03807"
FT   misc_feature    complement(481710..481778)
FT                   /note="PS00521 Delta 1-pyrroline-5-carboxylate reductase
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00521"
FT   misc_feature    complement(482319..482420)
FT                   /note="PS00107 Protein kinases ATP-binding region
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00107"
FT   CDS_pept        482590..483054
FT                   /transl_table=11
FT                   /locus_tag="ROD_04311"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04311"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87212"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKX1"
FT                   /protein_id="CBG87212.1"
FT                   /translation="MTIWVDADACPNVIKEILFRAAGRMQLPLILVANQSLRVPPSPFI
FT                   RTLRVPAGFDVADNEIVRQCAAGDLVITADIPLAAEVLAKGAAALNPRGERYSEATIRE
FT                   RLTMRDFMETLRASGVQTGGPDSLSARDRQHFAAELEKWWLEAKRRKENM"
FT   misc_feature    482590..483027
FT                   /locus_tag="ROD_04311"
FT                   /note="HMMPfam hit to PF02639, Protein of unknown function
FT                   DUF188, score 3.3e-87"
FT                   /inference="protein motif:PFAM:PF02639"
FT   CDS_pept        483287..483775
FT                   /transl_table=11
FT                   /gene="aroL"
FT                   /locus_tag="ROD_04321"
FT                   /product="shikimate kinase II"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04321"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87213"
FT                   /db_xref="GOA:D2TKX2"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKX2"
FT                   /protein_id="CBG87213.1"
FT                   /translation="MALAAAIDCRFVDTDQWLQSQAQMTVAEIVEREGWQGFRARETAA
FT                   LEAVTASATVVATGGGIILTPVNRHFMREHGTVIYLRAPVSILVNRLAASPEEALRPAL
FT                   TGKPLSEEVAEVLQQRDALYREAAHFIVDATGSPDQVISEIRHALAQTVQRKQGGVYT"
FT   misc_feature    483290..483736
FT                   /gene="aroL"
FT                   /locus_tag="ROD_04321"
FT                   /note="HMMPfam hit to PF01202, Shikimate kinase, score
FT                   1e-51"
FT                   /inference="protein motif:PFAM:PF01202"
FT   misc_feature    483401..483475
FT                   /note="PS01128 Shikimate kinase signature."
FT                   /inference="protein motif:Prosite:PS01128"
FT   CDS_pept        483803..483994
FT                   /transl_table=11
FT                   /locus_tag="ROD_04331"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04331"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87214"
FT                   /db_xref="InterPro:IPR032303"
FT                   /db_xref="InterPro:IPR038462"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKX3"
FT                   /protein_id="CBG87214.1"
FT                   /translation="MPTRPPYPREAYIVTIEKGAPGQTVTWYQLRADHPKPDSLISEHP
FT                   TAEEAMDAKKRYEDPEKS"
FT   CDS_pept        484253..484930
FT                   /transl_table=11
FT                   /gene="aroM"
FT                   /locus_tag="ROD_04351"
FT                   /product="putative chorismate biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04351"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87215"
FT                   /db_xref="InterPro:IPR010843"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKX4"
FT                   /protein_id="CBG87215.1"
FT                   /translation="MSASLAILTIGVVPTSEVLPLLTEYIDEQHITHHSLLGKMSREDV
FT                   LADYALEAGEEPLLTLLNDNELAFVSKKKVERDLQSIIEVLDNQGYDVILLMSTANIQN
FT                   MTARNSILLEPRRIIPPLVASIVEGHQVGVIVPLVELMPTQAEKWQVLPSPPVYALANP
FT                   VHGSAQQLIDAGKELLEQGADVIMLDCLGFHQYHRDVLQKALDVPVLLSNVLIARLAAE
FT                   LLV"
FT   misc_feature    484262..484927
FT                   /gene="aroM"
FT                   /locus_tag="ROD_04351"
FT                   /note="HMMPfam hit to PF07302, AroM, score 2.1e-131"
FT                   /inference="protein motif:PFAM:PF07302"
FT   CDS_pept        484965..485285
FT                   /transl_table=11
FT                   /locus_tag="ROD_04361"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04361"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87216"
FT                   /db_xref="GOA:D2TKX5"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKX5"
FT                   /protein_id="CBG87216.1"
FT                   /translation="MEMNLTTRQGQFMLQSNEYFSGKVKSIGFTSSSTGRASVGVMLEG
FT                   EYTFSTAEPEEMTVVSGALNVLLPGATEWQVYAAGEVFNVPGHSEFHLQVAEPTSYLCR
FT                   YL"
FT   misc_feature    485001..485282
FT                   /locus_tag="ROD_04361"
FT                   /note="HMMPfam hit to PF06865, Protein of unknown function
FT                   DUF1255, score 5e-64"
FT                   /inference="protein motif:PFAM:PF06865"
FT   CDS_pept        complement(485339..486250)
FT                   /transl_table=11
FT                   /gene="rdgC"
FT                   /locus_tag="ROD_04371"
FT                   /product="recombination associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04371"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87217"
FT                   /db_xref="GOA:D2TKX6"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKX6"
FT                   /protein_id="CBG87217.1"
FT                   /translation="MLWFKNLMVYRLSRDISLRAEEMEKQLASMTFTPCGSQDMAKMGW
FT                   VPPMGSHSDALTHAHNGQILICARKEEKILPSPVIKQALEAKIAKLEAEQARKLKKTEK
FT                   DSLKDEVLHSLLPRAFSRFSQTMMWIDTVNGLIMVDCASAKKAEDTLALLRKSLGSLPV
FT                   VPLALENPIELTLTEWVRSGSVAQGFQLLDEAELKAMLEDGGVIRAKKQDLVSDEIAVH
FT                   IEAGKVVTKLALDWQQRIQFLVCDDGSIKRLKFSDELRDQNEDIDREDFAQRFDADFIL
FT                   MTGELAALIQNLVEGLGGEAQR"
FT   misc_feature    complement(485345..486247)
FT                   /gene="rdgC"
FT                   /locus_tag="ROD_04371"
FT                   /note="HMMPfam hit to PF04381, Putative exonuclease,
FT                   RdgC,score 6.3e-213"
FT                   /inference="protein motif:PFAM:PF04381"
FT   CDS_pept        486378..487286
FT                   /transl_table=11
FT                   /gene="mak"
FT                   /locus_tag="ROD_04381"
FT                   /product="probable manno(fructo)kinase"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04381"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87218"
FT                   /db_xref="GOA:D2TKX7"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKX7"
FT                   /protein_id="CBG87218.1"
FT                   /translation="MRIGIDLGGTKTEVIALGESGEQLFRHRLPTPRNDYRQTIETIAT
FT                   LVEMAEKATGQTGTVGMGIPGSLSPYTGVVKNANSTWLNGQPFDRDVSARLQREVRLAN
FT                   DANCLAVSEAVDGAAAGAQTVFAVIIGTGCGAGVALNGRAHAGGNGTAGEWGHNPLPWM
FT                   DDDELRYREEVPCYCGKQGCIETFISGTGFATDYQRLSGNSLTGNEIMRRVEEQDPLAE
FT                   LALGRYELRLAKSLAHVVNILDPDVIVLGGGMSNVDRLYNTLPALIGQFVFGGECETPV
FT                   RKALHGDSSGVRGAAWLWPQR"
FT   misc_feature    486387..486956
FT                   /gene="mak"
FT                   /locus_tag="ROD_04381"
FT                   /note="HMMPfam hit to PF00480, ROK, score 4.6e-93"
FT                   /inference="protein motif:PFAM:PF00480"
FT   misc_feature    486747..486779
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    486765..486848
FT                   /note="PS01125 ROK family signature."
FT                   /inference="protein motif:Prosite:PS01125"
FT   CDS_pept        complement(487320..488468)
FT                   /transl_table=11
FT                   /gene="araJ"
FT                   /locus_tag="ROD_04391"
FT                   /product="major facilitator superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04391"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87219"
FT                   /db_xref="GOA:D2TKX8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKX8"
FT                   /protein_id="CBG87219.1"
FT                   /translation="MKKVIFSLALGTFGLGMAEFGIMGVLTELARDVGITIPAAGHMIS
FT                   YYALGVVVGAPVIALLSGRFSLKRILLFLVTLCVIGNAMFTLSSSYPMLAIGRLVSGFP
FT                   HGAFFGVGAIILSKLVRPGKVTAAVAGMVAGMTVANLIGIPLGTFLSHQFSWRYTFLLI
FT                   AVFNIAVIVSILLWVPDLRDERKGKLREQFHFLKSPAPWLIFAATLTGNAGVFAWFSYI
FT                   KPYMIFVSGFPETVMTFIMMLVGLGMVLGNLLSGRLSGRFSPLAIAATTDFVIVLCLLL
FT                   LFFVGGYRVASLTVAFICCAGLFALSAPLQILLLQNARGGELLGAAGGQIAFNLGSAIG
FT                   AYCGGMMLTLGFACNYVALPAALLSFTAMASLLIYGRIQDRQ"
FT   misc_feature    complement(join(487341..487400,487410..487478,
FT                   487539..487607,487617..487685,487704..487763,
FT                   487806..487874,487935..488003,488016..488084,
FT                   488121..488189,488202..488261,488280..488345,
FT                   488388..488456))
FT                   /gene="araJ"
FT                   /locus_tag="ROD_04391"
FT                   /note="12 probable transmembrane helices predicted for
FT                   ROD04391 by TMHMM2.0 at aa 5-27, 42-63, 70-89,
FT                   94-116,129-151, 156-178, 199-221, 236-255, 262-284,
FT                   288-310,331-353 and 357-376"
FT   misc_feature    complement(487407..487439)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(487422..488447)
FT                   /gene="araJ"
FT                   /locus_tag="ROD_04391"
FT                   /note="HMMPfam hit to PF07690, Major facilitator
FT                   superfamily MFS-1, score 5.9e-49"
FT                   /inference="protein motif:PFAM:PF07690"
FT   misc_feature    complement(488334..488399)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1072.000, SD 2.84 at aa 24-45, sequence
FT                   GVLTELARDVGITIPAAGHMIS"
FT   sig_peptide     complement(488415..488468)
FT                   /gene="araJ"
FT                   /locus_tag="ROD_04391"
FT                   /note="Signal peptide predicted for ROD04391 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.864) with cleavage site
FT                   probability 0.547 between residues 18 and 19"
FT   repeat_region   complement(488674..490045)
FT                   /note="Insertion sequence ISCro5. Has 13 bp
FT                   perfect,subterminal inverted repeats but no direct repeats.
FT                   1 of 5 100% identical ISCro5 elements in CR chromosome,
FT                   ISCro5 includes 7 bp 5' and 3 bp 3' outside of the inverted
FT                   repeats, common to the IS1111 subgroup of the IS110 family.
FT                   Each IS element is flanked by the same 4 bp sequence 5' and
FT                   7 bp sequence 3' which likely represents its target
FT                   sequence"
FT   repeat_region   488677..488689
FT                   /note="13 bp subterminal inverted repeat of ISCro5"
FT   CDS_pept        complement(488951..489961)
FT                   /transl_table=11
FT                   /locus_tag="ROD_04401"
FT                   /product="ISCro5 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04401"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87220"
FT                   /db_xref="GOA:D2THE0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D2THE0"
FT                   /protein_id="CBG87220.1"
FT                   /translation="MNIKRIGLDLAKLVFQLHGVDHHERVVLRKTLRRSQMLVFFARLE
FT                   PCLIGIEACGSSHYWARELTRLGHSVRIIPPRFVKPYLKGNKNDANDAEAICEAVSRPG
FT                   MRYVAVKSEAQQSMQAEHRVRARLLRDRTALSNEIRGMLGEFGLVLPVGLAALRRALPE
FT                   ILSQQEQWDNRFIRLLCELAEELQILDDRLARYDRRLKQLAQDDDRIRRLQEISGIGPV
FT                   TASALVAAVGNARQFKNGREMAAWLGLVPGQHSSGGKNRLGHISKRGDSYLRTLLIHGA
FT                   RAVLNACGNKEDRRSQWLQSVAERRNRNVATVAMANKNARIAWAVLSREEEYRVM"
FT   misc_feature    complement(489068..489331)
FT                   /locus_tag="ROD_04401"
FT                   /note="HMMPfam hit to PF02371,
FT                   Transposase,IS116/IS110/IS902, score 2.7e-31"
FT                   /inference="protein motif:PFAM:PF02371"
FT   repeat_region   complement(490026..490038)
FT                   /note="13 bp subterminal inverted repeat of ISCro5"
FT   CDS_pept        complement(490048..493191)
FT                   /transl_table=11
FT                   /gene="sbcC"
FT                   /locus_tag="ROD_04411"
FT                   /product="exonuclease SbcC"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04411"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87221"
FT                   /db_xref="GOA:D2TKY0"
FT                   /db_xref="InterPro:IPR004592"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKY0"
FT                   /protein_id="CBG87221.1"
FT                   /translation="MKILSLRLKNLNSLKGEWKVDFTAEPFASNGLFAITGPTGAGKTT
FT                   LLDAICLALYHKTPRLNTVSQSQNDLMTRDTAECLAEVEFEVKGDAYRAFWSQNRARNQ
FT                   ADGNLQAPRVELARCADGKILADKVKDKLELTAELTGLDYGRFTRSMLLSQGQFAAFLN
FT                   AEPKERAELLEELTGTEIYGQISAMVFEQHKAARSELEKLQAQASSVALLAPEAVQALT
FT                   DSLQALTDEEKQLAARQQSAQQQLNWLTRQNELQTQAQHRQQALLAAQSALQQAQPQLA
FT                   PLSLAQPARALRPLWTRLQEQSAAVSRSQQQINEVKARLQSATTLRSRMRRDAQQQTAA
FT                   MQAARQTLAAWLHEHDRFRVWHSELGGWRALFAQQASDGIQRDRWRQRLAADTQKLAAL
FT                   PVLTLNMTPDEVAVALAQHASQRPLRQRLLALHGQIAPRLQRLAQLQEVLAQSRQALAQ
FT                   RTALLEAKRQQYKEKNQHYQDVKTLCEQEERIKDLESQRALLQSGQPCPLCGSTSHPAV
FT                   AAYQALELSVNQARRDALEKEVKTLADEGAALRGQCDALRQQLQRDESEAQALAKDEQA
FT                   LTVEWQALISNLNITLQPQDDIQPWLTAQEDHEKQLYQLSQRHDLQAQIAAHQQQVTQF
FT                   SQQIEQRQATLTAQLSHYALSLPEEGAEETWLSDRAAEAQTWQQKQDELNELQSRIAQL
FT                   APLLDTLPATDAAAEDGAPVALDNWRQVHDDCLSLQSQLQTLQQQAVLEQQRASDAQAQ
FT                   FAAALESSIFADQSAFLAALLDDEAIARLEQLSQTLESQIQQAQTLATQSAQALAAHQQ
FT                   QPPGFLDCALSVEEIAQALTLLNQQLRDNASRQGEIRQQLKQDADNRQQQQSLMRQIDS
FT                   ASQQVDDWGYLNTLIGSKEGDKFRKFAQGLTLDNLVWLANNQLTRLHGRYLLQRKVSNA
FT                   LELEVVDTWQADAVRDTRTLSGGESFLVSLALALALSDLVSHKTRIDSLFLDEGFGTLD
FT                   SETLDTALDALDALNASGKTIGVISHVEAMKERIPVQIKVKKINGLGYSKLDRIFAVA"
FT   misc_feature    complement(490078..493188)
FT                   /gene="sbcC"
FT                   /locus_tag="ROD_04411"
FT                   /note="HMMPfam hit to PF02463, SMC protein,
FT                   N-terminal,score 1e-05"
FT                   /inference="protein motif:PFAM:PF02463"
FT   misc_feature    complement(490165..490188)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(493060..493083)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(493188..494390)
FT                   /transl_table=11
FT                   /gene="sbcD"
FT                   /locus_tag="ROD_04421"
FT                   /product="exonuclease SbcD"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04421"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87222"
FT                   /db_xref="GOA:D2TKY1"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKY1"
FT                   /protein_id="CBG87222.1"
FT                   /translation="MRLLHTSDWHLGQNFYSKSRAAEHQAFLDWLLSTATEQQVDAIIV
FT                   AGDIFDTGSPPSYARELYNRFVVRLQQTGCHLVVLAGNHDSVATLNESREILAFLNTTV
FT                   VASAGCAPHILHRRDGTPGAVLCPIPFLRPRDIVTSQAGLSGQEKQQHLLSAITDYYQQ
FT                   QYHEACALRGERALPIIATGHLTTVGASKSDAVRDIYIGTLDAFPAQNFPPADYIALGH
FT                   IHRAQKIGGTEHIRYCGSPIALSFDECGKSKCVHLVSFENGRLMSVESLTVPITQPLAV
FT                   LKGDLAAISEQLEQWRDSRQSPPVWLDIEITTDEYLHDIQRKIQALTETLPVEVLLVRR
FT                   SREQRESMLSSERRETLSELSVDEVFERRLAQVELAEPQRQRLTALFHTTVQALAGEDV
FT                   A"
FT   misc_feature    complement(493713..494390)
FT                   /gene="sbcD"
FT                   /locus_tag="ROD_04421"
FT                   /note="HMMPfam hit to PF00149, Metallophosphoesterase,score
FT                   1e-19"
FT                   /inference="protein motif:PFAM:PF00149"
FT   misc_feature    complement(494061..494093)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        494580..495269
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="ROD_04431"
FT                   /product="phosphate regulon two-component system, response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04431"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87223"
FT                   /db_xref="GOA:D2TKY2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKY2"
FT                   /protein_id="CBG87223.1"
FT                   /translation="MARRILVVEDEAAIREMVCFVLEQNGFQPVEAEDYDTAVNQLNEP
FT                   WPDLILLDWMLPGGSGLQFIKHLKREAMTRDIPVVMLTARGEEEDRVRGLETGADDYIT
FT                   KPFSPKELVARIKAVMRRISPMAVEEVIEMQGLSLDPTSHRVMTGDNPLDMGPTEFKLL
FT                   HFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALETSGHDRMVQTVRGTG
FT                   YRFSTRF"
FT   misc_feature    494586..494930
FT                   /gene="phoB"
FT                   /locus_tag="ROD_04431"
FT                   /note="HMMPfam hit to PF00072, Response regulator
FT                   receiver,score 5.2e-41"
FT                   /inference="protein motif:PFAM:PF00072"
FT   misc_feature    495027..495254
FT                   /gene="phoB"
FT                   /locus_tag="ROD_04431"
FT                   /note="HMMPfam hit to PF00486, Transcriptional regulatory
FT                   protein, C-terminal, score 1e-25"
FT                   /inference="protein motif:PFAM:PF00486"
FT   CDS_pept        495321..496628
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="ROD_04441"
FT                   /product="phosphate regulon two-component system, sensor
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04441"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87224"
FT                   /db_xref="GOA:D2TKY3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKY3"
FT                   /protein_id="CBG87224.1"
FT                   /translation="MLERLSWKRLVLELILCCIPAFILSAFFGYLPWFLLASVTGLLIW
FT                   HFWNLLRLSWWLWVDRSMTPPPGRGSWEPLLYGLHQMQLRNKKRRRELGNLIKRFRSGA
FT                   ESLPDAVVLTTEEGGIFWCNGLAQQLLGLRWPDDNGQNILNLLRYPEFTQYLKTRDFSR
FT                   PLNLVLNTGRHLEIRVMPYTDKQLLMVARDVTQMHQLEGARRNFFANVSHELRTPLTVL
FT                   QGYLEMMHEQPLEGSTREKALLTMREQTFRMEGLVKQLLTLSKIEASPVLLLNEQVDVP
FT                   MMLHMVEREAQTLSQQKHTFSFDIDNQLKVLGNEEQLRSAISNLVYNAVNHTPEGTHIT
FT                   VCWRAVPHGAEFSIEDNGPGIAAEHLPRLTERFYRVDKARSRQTGGSGLGLAIVKHALN
FT                   HHESRLTIDSEPGKGTRFSFVLPERLIARKPPDRRL"
FT   misc_feature    495354..495422
FT                   /gene="phoR"
FT                   /locus_tag="ROD_04441"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD04441 by TMHMM2.0 at aa 12-34"
FT   misc_feature    495612..495902
FT                   /gene="phoR"
FT                   /locus_tag="ROD_04441"
FT                   /note="HMMPfam hit to PF00989, PAS fold, score 1.1e-18"
FT                   /inference="protein motif:PFAM:PF00989"
FT   misc_feature    495927..496127
FT                   /gene="phoR"
FT                   /locus_tag="ROD_04441"
FT                   /note="HMMPfam hit to PF00512, Histidine kinase
FT                   A,N-terminal, score 3.3e-21"
FT                   /inference="protein motif:PFAM:PF00512"
FT   misc_feature    496257..496592
FT                   /gene="phoR"
FT                   /locus_tag="ROD_04441"
FT                   /note="HMMPfam hit to PF02518, ATP-binding
FT                   region,ATPase-like, score 2.6e-43"
FT                   /inference="protein motif:PFAM:PF02518"
FT   CDS_pept        497023..498342
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="ROD_04451"
FT                   /product="branched chain amino acid transport system II
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04451"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87225"
FT                   /db_xref="GOA:D2TKY4"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKY4"
FT                   /protein_id="CBG87225.1"
FT                   /translation="MTHQLKSRDIIALGFMTFALFVGAGNIIFPPMVGLQAGEHVWTAA
FT                   FGFLITAVGLPVLTVVALAKVGGGVDSLSTPIGKVAGVLLATVCYLAVGPLFATPRTAT
FT                   VSFEVGIAPLTGDSAMPLFIYSVIYFALVILVSLYPGKLLDTVGNFLAPLKIIALIVLS
FT                   VAAIIWPAGPISHAMEAYENAAFSNGFVNGYLTMDTLGAMVFGIVIVNAARSRGVTESR
FT                   LLTRYTVWAGLMAGVGLTLLYLALFRLGSDSATLVDQSVNGAAILHAYVQHTFGGAGSL
FT                   LLAALIFIACLVTAVGLTCACAEFFAQYVPLSYRSLVFILGGFSMVVSNLGLSHLIQIS
FT                   IPVLTAIYPPCIALVVLSFTRSWWHNSSRVIAPAMFISLLFGILDGIKASAIGDVLPAW
FT                   TQRLPLAEQGLAWLIPTVVIVVLAIIWDRAAGRQVTSGAH"
FT   sig_peptide     497023..497094
FT                   /gene="brnQ"
FT                   /locus_tag="ROD_04451"
FT                   /note="Signal peptide predicted for ROD04451 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.823) with cleavage site
FT                   probability 0.742 between residues 24 and 25"
FT   misc_feature    497038..498312
FT                   /gene="brnQ"
FT                   /locus_tag="ROD_04451"
FT                   /note="HMMPfam hit to PF05525, Branched-chain amino acid
FT                   transport system II carrier protein, score 3.9e-240"
FT                   /inference="protein motif:PFAM:PF05525"
FT   misc_feature    join(497059..497127,497143..497211,497248..497316,
FT                   497374..497442,497461..497529,497587..497655,
FT                   497689..497757,497848..497916,497935..498003,
FT                   498031..498099,498133..498201,498244..498300)
FT                   /gene="brnQ"
FT                   /locus_tag="ROD_04451"
FT                   /note="12 probable transmembrane helices predicted for
FT                   ROD04451 by TMHMM2.0 at aa 13-35, 41-63, 76-98,
FT                   118-140,147-169, 189-211, 223-245, 276-298, 305-327,
FT                   337-359,371-393 and 408-426"
FT   misc_feature    497863..497895
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    497896..497928
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        498421..499788
FT                   /transl_table=11
FT                   /gene="proY"
FT                   /locus_tag="ROD_04461"
FT                   /product="proline-specific permease"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04461"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87226"
FT                   /db_xref="GOA:D2TKY5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKY5"
FT                   /protein_id="CBG87226.1"
FT                   /translation="MESNNKLKRGLSTRHIRFMALGSAIGTGLFYGSADAIKMAGPSVL
FT                   LAYIIGGVAAYIIMRALGEMSVHNPAASSFSRYAQENLGPLAGYITGWTYCFEILIVAI
FT                   ADVTAFGIYMGVWFPAVPHWIWVLSVVLLICAINLMSVKVFGELEFWFSFFKVATIIIM
FT                   IVAGFGIIIWGIGNGGQPTGIHNLWSNGGFFSNGWLGMVMSLQMVMFAYGGIEIIGITA
FT                   GEAKDPEKSIPRAINSVPMRILVFYVGTLFVIMSIYPWNQVGTNGSPFVLTFQHMGITF
FT                   AASILNFVVLTASLSAINSDVFGVGRMLHGMAEQGSAPKVFAKTSRRGIPWVTVLVMTI
FT                   ALLFAVYLNYIMPENVFLVIASLATFATVWVWIMILLSQIAFRRRLPPEEVRALKFKVP
FT                   GGVATTVVGLIFLVFIIGLIGYHPDTRISLYVGFAWIVLLLIGWMFKRRHDRQLAQ"
FT   sig_peptide     498421..498528
FT                   /gene="proY"
FT                   /locus_tag="ROD_04461"
FT                   /note="Signal peptide predicted for ROD04461 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.943) with cleavage site
FT                   probability 0.472 between residues 36 and 37"
FT   misc_feature    498463..499785
FT                   /gene="proY"
FT                   /locus_tag="ROD_04461"
FT                   /note="HMMPfam hit to PF00324, Amino acid
FT                   permease-associated region, score 6.2e-134"
FT                   /inference="protein motif:PFAM:PF00324"
FT   misc_feature    join(498466..498522,498550..498609,498667..498735,
FT                   498778..498846,498880..498948,499006..499074,
FT                   499135..499203,499246..499314,499405..499473,
FT                   499486..499554,499615..499683,499696..499755)
FT                   /gene="proY"
FT                   /locus_tag="ROD_04461"
FT                   /note="12 probable transmembrane helices predicted for
FT                   ROD04461 by TMHMM2.0 at aa 16-34, 44-63, 83-105,
FT                   120-142,154-176, 196-218, 239-261, 276-298, 329-351,
FT                   356-378,399-421 and 426-445"
FT   misc_feature    498538..498630
FT                   /note="PS00218 Amino acid permeases signature."
FT                   /inference="protein motif:Prosite:PS00218"
FT   CDS_pept        499965..501782
FT                   /transl_table=11
FT                   /gene="malZ"
FT                   /locus_tag="ROD_04481"
FT                   /product="maltodextrin glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04481"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87227"
FT                   /db_xref="GOA:D2TKY6"
FT                   /db_xref="InterPro:IPR004185"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017069"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKY6"
FT                   /protein_id="CBG87227.1"
FT                   /translation="MLNAWHLPVAPFVKQNKDKLSITLWLSGENPPQGVTLRAEHDNEE
FT                   TSLVMRKLRSQPYPGITAWRAVVDLSGGQPRRRYSFKLLWHDRQRWFTPQGFSPFPPAR
FT                   LEQFAVDVPDNGPQWVADQIFYQIFPDRFARSEPREEQQDKVYFHHAAGREVILRDWDD
FT                   PLSAQAGGSTFYGGDLDGISEKLPYLKKLGVTALYLNPVFVAPSVHKYDTEDYRHVDPQ
FT                   FGGDAALMRLRHNTRQRGMRLVLDGVFNHSGDSHAWFDRHNRGTGGACHNPESPWRDWY
FT                   SFSAEGVALDWLGYPSLPKLDYQSDGLVNEIYRGEDSIVRHWLKAPWNMDGWRLDVVHM
FT                   LGEGGGARNNLRHVAGITQAVKETQPQAYIVGEHFGDARQWLQADAEDAAMNYRGFTFP
FT                   LWGFLANTDISYDPQQIDAQSCMAWMDNYRAGLSHQQQLRMFNQLDSHDTARFKSLLGK
FT                   DVARLPLAVVWLFSWPGVPCIYYGDEVGLDGNNDPFCRKTFPWQAEKQDAALFALYQRM
FT                   AKLRQRSQELRYGGCQVIYAEDNVVVFLRVYNQQRVLVAINRGEACEVVLPASPLLNVK
FT                   TWQLKEGKADLQDGVLTLPAISAAVWFGH"
FT   misc_feature    500343..501527
FT                   /gene="malZ"
FT                   /locus_tag="ROD_04481"
FT                   /note="HMMPfam hit to PF00128, Glycosyl hydrolase, family
FT                   13, catalytic region, score 1.2e-109"
FT                   /inference="protein motif:PFAM:PF00128"
FT   CDS_pept        501889..504528
FT                   /transl_table=11
FT                   /locus_tag="ROD_04491"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04491"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87228"
FT                   /db_xref="GOA:D2TKY7"
FT                   /db_xref="InterPro:IPR014600"
FT                   /db_xref="InterPro:IPR019286"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKY7"
FT                   /protein_id="CBG87228.1"
FT                   /translation="MDDLLILGCIVLLFALVVAPALAIVAFNRSSATRAELAGLRRRVE
FT                   ELEQQGIGKPKDVPAAQMPVQSAETFVKRGSVAQATPEPTTSWEAHRPPEAAKRAPLPT
FT                   PTRAAEKQPSAFGGVITSLARWFMQGNPLAKLGILLLFLGLSFLLRYTVEHSLFPLELR
FT                   LAATALFAIVLLGVGWRLRHKQPVYALILQGGATGVLYLTVFGAFRLWQMLPMTLAFAL
FT                   LLAICAASVVLAILQKALSLAMLASLGGYLAPLLLSDGSGNYIALFSFYLLLSAGILVI
FT                   SIWQHWRELNLLGLLFTFGVGGLWGMDDYQPAYYLNCQLFLVANILIFGVLSVALSLRA
FT                   QEKNKQIIDGVLLFAPPLIGFGMQYAMTLHWAYGPALSALGYGGGYLALAWLALRRYPS
FT                   AGRPLVLAALALGGAFTTLAIPLALSARWTAMAWALEGLGILWLGVQQQQRSMSYSGTA
FT                   LLVLAFVSALWALIGDTTALSLMLIFAVLSLCWLAGAWLWRQIILRGSRVLLAGGLLFW
FT                   MVALTGASQLMFSKDAWVLSGVLALMAVSVWGWRQAGLRLAWRELDASKWLLWPMMLMV
FT                   LLQQISQQAIFTGGWQNLVWCLALPAALILLRRDDAALAPRISRLLHLSLLWMTMLALA
FT                   MELFWFVRDLPWGMTAWKSGLLMAAGGLLIMLISAMVRRRIWPFKVWPALYSVQAMVPL
FT                   AAALVCLLALTNVQDGVVYRQTFLPLVNPLEEGAAFALLGLVVLYRATQRYFPVQLSVW
FT                   QPWPAIALMALGFWWLNGALLRALACYGEVAWTTQALWHSRLVQTCFALFWTLVALVVM
FT                   LRATQRRSRPEWLGGAVLLGMVIAKLMLVDSAGGGGLARAVAFIGVAVLVLIVGYFSPL
FT                   PPKAGENK"
FT   sig_peptide     501889..501957
FT                   /locus_tag="ROD_04491"
FT                   /note="Signal peptide predicted for ROD04491 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.938) with cleavage site
FT                   probability 0.770 between residues 23 and 24"
FT   misc_feature    join(501898..501966,502285..502344,502372..502425,
FT                   502444..502512,502525..502593,502606..502659,
FT                   502672..502740,502753..502806,502834..502902,
FT                   502936..502989,503002..503070,503089..503157,
FT                   503170..503223,503242..503301,503314..503382,
FT                   503407..503475,503485..503538,503740..503808,
FT                   503851..503904,503941..504009,504037..504105,
FT                   504142..504210,504253..504321,504358..504411,
FT                   504427..504495)
FT                   /locus_tag="ROD_04491"
FT                   /note="25 probable transmembrane helices predicted for
FT                   ROD04491 by TMHMM2.0 at aa 4-26, 133-152, 162-179,
FT                   186-208,213-235, 240-257, 262-284, 289-306, 316-338,
FT                   350-367,372-394, 401-423, 428-445, 452-471, 476-498,
FT                   507-529,533-550, 618-640, 655-672, 685-707, 717-739,
FT                   752-774,789-811, 824-841 and 847-869"
FT   CDS_pept        504525..505916
FT                   /transl_table=11
FT                   /locus_tag="ROD_04501"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04501"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87229"
FT                   /db_xref="GOA:D2TKY8"
FT                   /db_xref="InterPro:IPR025060"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKY8"
FT                   /protein_id="CBG87229.1"
FT                   /translation="MKWMKALLCSALLSAAGTVAGSDEAKESPVDYATGVMLETTGASP
FT                   WYRLPLPQTVYEGSAWPDLRDVRVFNHAGETVPFALVAQKAQPVTPETMKLRLFPLDMS
FT                   PVAAREQGRQGESFVLRSKAGIEIQLNSDEVNASGQSYLLTLPEARQEPFSLAQLRLDW
FT                   RPPAGNWQGKASIYSSRDLRYWRSILEDAPLMDLTREGDRLKMDTISARLTLSTQGNRY
FT                   LLVILDAQSPALTINSVSAIADSRAPESERVVIGAQEHRVSDEEALWRWKQPQPLSSLS
FT                   IALQNEGVLPVALAWRSEENAAWQPLTKTVLYRLDGQRSQDIALSGQEVEAVRITTINA
FT                   RLPETLPAVSGARDSYQLVFNAQGKGPYMLAWGNRAAIRADIELDRLIPASLRKTHALN
FT                   DLPWAIPQQSVTPGGEARLSATSAAERQSQWQTLLVWGALILGVAVLALMAFRIWREVK
FT                   KDGGA"
FT   sig_peptide     504525..504587
FT                   /locus_tag="ROD_04501"
FT                   /note="Signal peptide predicted for ROD04501 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.514 between residues 21 and 22"
FT   misc_feature    505818..505886
FT                   /locus_tag="ROD_04501"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD04501 by TMHMM2.0 at aa 432-454"
FT   CDS_pept        complement(505966..506568)
FT                   /transl_table=11
FT                   /locus_tag="ROD_04511"
FT                   /product="probable peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04511"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87230"
FT                   /db_xref="GOA:D2TKY9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKY9"
FT                   /protein_id="CBG87230.1"
FT                   /translation="MVLVTRQAPDFTAAAVLGSGEIVENFNFKQHTNGKATVLFFWPMD
FT                   FTFVCPSELIAFDKRYEEFQKRGVEVVGVSFDSEFVHNAWRNTPVDKGGIGAVKYAMVA
FT                   DVKREIQKAYGIEHPEAGVALRGSFLIDANGIVRHQVVNDLPLGRNIDEMLRMVDALQF
FT                   HEEHGEVCPAQWEKGKEGMNASPDGVAKYLTENVSSL"
FT   misc_feature    complement(506149..506559)
FT                   /locus_tag="ROD_04511"
FT                   /note="HMMPfam hit to PF00578, Alkyl hydroperoxide
FT                   reductase/ Thiol specific antioxidant/ Mal allergen, score
FT                   7.4e-46"
FT                   /inference="protein motif:PFAM:PF00578"
FT   CDS_pept        complement(506953..507534)
FT                   /transl_table=11
FT                   /gene="acpH"
FT                   /locus_tag="ROD_04521"
FT                   /product="acyl carrier protein phosphodiesterase"
FT                   /EC_number="3.1.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04521"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87231"
FT                   /db_xref="GOA:D2TKZ0"
FT                   /db_xref="InterPro:IPR007431"
FT                   /db_xref="InterPro:IPR023491"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKZ0"
FT                   /protein_id="CBG87231.1"
FT                   /translation="MNFLAHLHLAHLADSSLSGNLLADFVRGNPETHFPPEVVEGILMH
FT                   RRIDVLTDNLPEVREAREWFRRETRRVAPITLDVMWDHFLSRHWAQISPDFPLPAFVGY
FT                   ARTQIATILPDSPPRFVNLNHHLWSEQWLERYRDMAFIQNVLNGMASRRPRLEALRDSW
FT                   HDLDRHYDALEERFWRFYPQMMDQARQKTL"
FT   misc_feature    complement(506959..507480)
FT                   /gene="acpH"
FT                   /locus_tag="ROD_04521"
FT                   /note="HMMPfam hit to PF04336, Protein of unknown function
FT                   DUF479, score 3.6e-114"
FT                   /inference="protein motif:PFAM:PF04336"
FT   CDS_pept        507627..508697
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="ROD_04531"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04531"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87232"
FT                   /db_xref="GOA:D2TKZ1"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKZ1"
FT                   /protein_id="CBG87232.1"
FT                   /translation="MRVTDFSFELPESLIAHYPQPERSSCRLLSLDGPTGALTHGTFTD
FT                   LLAKLNPGDLLVFNNTRVIPARLFGRKASGGKIEVLVERMLDDKRILAHIRASKAPKPG
FT                   AELLLGDDESINATMTARHGALFEVEFNDARPVLDILNAIGHMPLPPYIDRPDEDADRE
FT                   LYQTVYSEKPGAVAAPTAGLHFDEPLLAALREKGIEMAFVTLHVGAGTFQPVRVDSIED
FT                   HIMHSEYAEVPQEVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKSDLIEPFFGDTQ
FT                   IFIYPGYQYKVIDALVTNFHLPESTLIMLVSAFAGYQHTMNAYKAAVEQKYRFFSYGDA
FT                   MFITYNPQALHERVGE"
FT   misc_feature    507627..508277
FT                   /gene="queA"
FT                   /locus_tag="ROD_04531"
FT                   /note="HMMPfam hit to PF02547, Queuosine biosynthesis
FT                   protein, score 3.3e-150"
FT                   /inference="protein motif:PFAM:PF02547"
FT   CDS_pept        508750..509877
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="ROD_04541"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04541"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87233"
FT                   /db_xref="GOA:D2TKZ2"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKZ2"
FT                   /protein_id="CBG87233.1"
FT                   /translation="MKFELDTTDGRARRGRLVFDRGVVETPAFMPVGTYGTVKGMTPEE
FT                   VEATGAQIILGNTFHLWLRPGQEIMKLHGDLHDFMQWKGPILTDSGGFQVFSLGDIRKI
FT                   TEQGVHFRNPINGDPIFLDPEKSMEIQYDLGSDIVMIFDECTPYPADWDYAKRSMEMSL
FT                   RWAKRSRERFDSLGNKNALFGIIQGSVYEDLRDISVKALVEIGFDGYAVGGLAVGEPKE
FT                   DMHRILEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTD
FT                   GVVKIRNAKYKSDTSPLDAECDCYTCRNYSRAYLHHLDRCNEILGARLNTIHNLRYYQR
FT                   LMAGLRKAIEEGKLESFVTGFYQRQGRPVPPLNVD"
FT   misc_feature    509122..509838
FT                   /gene="tgt"
FT                   /locus_tag="ROD_04541"
FT                   /note="HMMPfam hit to PF01702, Queuine/other
FT                   tRNA-ribosyltransferase, score 5.3e-171"
FT                   /inference="protein motif:PFAM:PF01702"
FT   CDS_pept        509900..510232
FT                   /transl_table=11
FT                   /locus_tag="ROD_04551"
FT                   /product="putative preprotein translocase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04551"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87234"
FT                   /db_xref="GOA:D2TKZ3"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKZ3"
FT                   /protein_id="CBG87234.1"
FT                   /translation="MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKR
FT                   TKEHKKLMDSIAKGDEVLTNGGLVGRVTKVAETGYIAIALNDTTEVVIKRDFVAAVLPK
FT                   GTMKAL"
FT   misc_feature    509954..510205
FT                   /locus_tag="ROD_04551"
FT                   /note="HMMPfam hit to PF02699, YajC, score 1.6e-47"
FT                   /inference="protein motif:PFAM:PF02699"
FT   misc_feature    509957..510016
FT                   /locus_tag="ROD_04551"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD04551 by TMHMM2.0 at aa 20-39"
FT   CDS_pept        510260..512107
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="ROD_04561"
FT                   /product="protein-export protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04561"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87235"
FT                   /db_xref="GOA:D2TKZ4"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKZ4"
FT                   /protein_id="CBG87235.1"
FT                   /translation="MLNRYPLWKYIMLIVVIIVGLLYALPNLYGEDPAVQITGARGVAA
FT                   SEQTLIQVQNTLQQEKITAKSVALEEGAILARFDTTDTQLRAREALVGVLGDKYVVALN
FT                   LAPATPRWLAAIKAEPMKLGLDLRGGVHFLMEVDMDTALGKLQEQNIDSLRSDLREKGI
FT                   PYTTVRKEDNYGLSINFRDASARDEAIAYLSKRHQDLVISSQGSNALRAVMTDARLSEA
FT                   REYAVQQNINILRNRVNQLGVAEPVVQRQGADRIVVELPGIQDTARAKEILGATATLEF
FT                   RLVNTNVDQAAAASGRVPGDSEVKQMREGQPVVLYKRVILTGDHITDSTSSQDEYNQPQ
FT                   VNISLDSAGGNIMSNFTKDNIGKPMATLFVEYKDSGKKDANGRAVLVKQEEVINIANIQ
FT                   SRLGNSFRITGINNPNEARQLSLLLRAGALIAPIQIVEERTIGPTLGMQNIKQGLEACL
FT                   AGLAVSILFMVLFYKKFGLIATSALIANLVLIVGVMSLLPGATLSMPGIAGIVLTLAVA
FT                   VDANVLINERIKEELSNGRSIQQAINEGYAGAFSSIFDANITTLIKVIILYAVGTGAIK
FT                   GFAITTGIGVATSMFTAIVGTRAIVNLLYGGKRVKKLSI"
FT   sig_peptide     510260..510349
FT                   /gene="secD"
FT                   /locus_tag="ROD_04561"
FT                   /note="Signal peptide predicted for ROD04561 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.665) with cleavage site
FT                   probability 0.513 between residues 30 and 31"
FT   misc_feature    join(510278..510346,511613..511672,511685..511753,
FT                   511766..511834,511895..511963,512006..512074)
FT                   /gene="secD"
FT                   /locus_tag="ROD_04561"
FT                   /note="6 probable transmembrane helices predicted for
FT                   ROD04561 by TMHMM2.0 at aa 7-29, 452-471, 476-498,
FT                   503-525,546-568 and 583-605"
FT   misc_feature    510593..510688
FT                   /gene="secD"
FT                   /locus_tag="ROD_04561"
FT                   /note="HMMPfam hit to PF07549, SecD/SecF/SecDF export
FT                   membrane protein, score 6.1e-06"
FT                   /inference="protein motif:PFAM:PF07549"
FT   misc_feature    511214..511255
FT                   /note="PS00761 Signal peptidases I signature 3."
FT                   /inference="protein motif:Prosite:PS00761"
FT   misc_feature    511523..512068
FT                   /gene="secD"
FT                   /locus_tag="ROD_04561"
FT                   /note="HMMPfam hit to PF02355, SecD/SecF/SecDF export
FT                   membrane protein, score 5.8e-06"
FT                   /inference="protein motif:PFAM:PF02355"
FT   CDS_pept        512118..513089
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="ROD_04571"
FT                   /product="protein-export protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04571"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87236"
FT                   /db_xref="GOA:D2TKZ5"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKZ5"
FT                   /protein_id="CBG87236.1"
FT                   /translation="MAQEYTVEQLNHGRKVWDFMRWDYWAFGISGLLLVASIVVMGVRG
FT                   FNWGLDFTGGTVIEITLEKPAEMDVMREALEKAGFVDPLLQNFGSSHDIMVRMPPTEGA
FT                   NGGQVLGSKVLSVINESTNQNAAVKRIEFVGPSVGADLAQTGAMALLAALISILVYVGF
FT                   RFEWRLAAGVVIALAHDVIITLGILSLFHIEIDLTIVASLMSVIGYSLNDSIVVSDRIR
FT                   ENFRKIRRGTPYEIFNVSLTQTLHRTLITSGTTLMVILMLFLFGGPVLEGFSLTMLIGV
FT                   SIGTASSIYVASALALKLGMKREHMLQQKVEKEGADQPSILP"
FT   misc_feature    join(512187..512255,512544..512603,512622..512690,
FT                   512700..512768,512859..512927,512940..513008)
FT                   /gene="secF"
FT                   /locus_tag="ROD_04571"
FT                   /note="6 probable transmembrane helices predicted for
FT                   ROD04571 by TMHMM2.0 at aa 24-46, 143-162, 169-191,195-217,
FT                   248-270 and 275-297"
FT   misc_feature    512235..512321
FT                   /gene="secF"
FT                   /locus_tag="ROD_04571"
FT                   /note="HMMPfam hit to PF07549, SecD/SecF/SecDF export
FT                   membrane protein, score 0.00037"
FT                   /inference="protein motif:PFAM:PF07549"
FT   misc_feature    512457..513023
FT                   /gene="secF"
FT                   /locus_tag="ROD_04571"
FT                   /note="HMMPfam hit to PF02355, SecD/SecF/SecDF export
FT                   membrane protein, score 2.8e-94"
FT                   /inference="protein motif:PFAM:PF02355"
FT   CDS_pept        513241..513606
FT                   /transl_table=11
FT                   /locus_tag="ROD_04581"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04581"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87237"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKZ6"
FT                   /protein_id="CBG87237.1"
FT                   /translation="MKSIINWFEIPVADMARAIAFYEPVLGLSLRREKMDGADLAVFPY
FT                   EDPATGGALAKIDGLLPSAQGAVIYLHTDDLAAALERVVSAGGECVFGPLDLGKEIGTV
FT                   ALFIDSEGNRVGLHQPA"
FT   misc_feature    513250..513591
FT                   /locus_tag="ROD_04581"
FT                   /note="HMMPfam hit to PF00903, Glyoxalase/bleomycin
FT                   resistance protein/dioxygenase, score 2.6e-10"
FT                   /inference="protein motif:PFAM:PF00903"
FT   CDS_pept        513622..514302
FT                   /transl_table=11
FT                   /locus_tag="ROD_04591"
FT                   /product="putative DeoR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04591"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87238"
FT                   /db_xref="GOA:D2TKZ7"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKZ7"
FT                   /protein_id="CBG87238.1"
FT                   /translation="MTRRADRLFQIVQILRGRRLTTAALLAERLGVSERTIYRDIRDLS
FT                   LSGVPVEGEAGSGYRLMAGFDLPPLMLTHRESEALIVAIRLLHTWGGKLLSRELESAQE
FT                   KVLAILPEEGRRKAEQARIFAPDLGTQPHSRSAFDRIHRAISAQQVLALHYRDEAGQLT
FT                   WREVQPLGMFFWGEHWLLVAWCERRDDYRCFRLDRCLRITLTERRFRESADRSLADFLR
FT                   KVRA"
FT   misc_feature    513640..513801
FT                   /locus_tag="ROD_04591"
FT                   /note="HMMPfam hit to PF08279, Helix-turn-helix, type
FT                   11,score 7.3e-21"
FT                   /inference="protein motif:PFAM:PF08279"
FT   misc_feature    513682..513747
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1969.000, SD 5.89 at aa 21-42, sequence
FT                   TTAALLAERLGVSERTIYRDIR"
FT   CDS_pept        complement(514360..515214)
FT                   /transl_table=11
FT                   /gene="tsx"
FT                   /locus_tag="ROD_04601"
FT                   /product="nucleoside-specific channel-forming protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04601"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87239"
FT                   /db_xref="GOA:D2TKZ8"
FT                   /db_xref="InterPro:IPR003055"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKZ8"
FT                   /protein_id="CBG87239.1"
FT                   /translation="MKKTLLAAGAVLALSSTFTVNAAENDKPQYLSDWWHQSVNVVGSY
FT                   HTRFGPTLRNDTYLEYEAFAKKDWFDFYGYVDAPRFFGGDSNSRGIWNHGSPLFMEIEP
FT                   RFSIDKLTNSDLSFGPFKEWYFANNYIYDMGRNSEGRQSTWYMGLGTDVDTGLPMSLSL
FT                   NVYAKYQWQNYGASNENEWDGYRFKVKYFVPITELWGGNLSYIGFTNFDWGSDLGDDQY
FT                   RTSNSIASSHILALNYDHWHYSVVARYFHNGGQWKDGDEPVWQAEPIKSNGFGWYLVVG
FT                   YNF"
FT   misc_feature    complement(514600..515052)
FT                   /gene="tsx"
FT                   /locus_tag="ROD_04601"
FT                   /note="HMMPfam hit to PF03502, Nucleoside-specific
FT                   channel-forming protein, Tsx, score 1.5e-109"
FT                   /inference="protein motif:PFAM:PF03502"
FT   sig_peptide     complement(515149..515214)
FT                   /gene="tsx"
FT                   /locus_tag="ROD_04601"
FT                   /note="Signal peptide predicted for ROD04601 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.999 between residues 22 and 23"
FT   CDS_pept        complement(515512..516021)
FT                   /transl_table=11
FT                   /locus_tag="ROD_04611"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04611"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87240"
FT                   /db_xref="InterPro:IPR021658"
FT                   /db_xref="InterPro:IPR037125"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKZ9"
FT                   /protein_id="CBG87240.1"
FT                   /translation="MGSLFSLTACAQQSEVRQMHQSISTLNKEMQQLNQETVKINQQNS
FT                   LNVKSDRGVYLLPGSNTPARLNSQIGMLRMSLVNITPNADGMRATLRIQGESSDPLPAF
FT                   SGTVEYGQLQGTTDNYQEVNVQNQLINAPASVLAPSDVDIPLQLNGMTAEQTGFIRIHD
FT                   IQPVTQ"
FT   CDS_pept        516204..516653
FT                   /transl_table=11
FT                   /gene="nrdR"
FT                   /locus_tag="ROD_04621"
FT                   /product="transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04621"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87241"
FT                   /db_xref="GOA:D2TL00"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL00"
FT                   /protein_id="CBG87241.1"
FT                   /translation="MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAE
FT                   LVMPRVVKSNDVREPFNEEKLRSGMLRALEKRPVSSDDVEMALNHIKSQLRATGEREVP
FT                   SKMIGNLVMEQLKKLDKVAYIRFASVYRSFEDIKEFGEEIARLQD"
FT   misc_feature    516348..516620
FT                   /gene="nrdR"
FT                   /locus_tag="ROD_04621"
FT                   /note="HMMPfam hit to PF03477, ATP-cone, score 4.2e-35"
FT                   /inference="protein motif:PFAM:PF03477"
FT   CDS_pept        516657..517760
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="ROD_04631"
FT                   /product="riboflavin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04631"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87242"
FT                   /db_xref="GOA:D2TL01"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL01"
FT                   /protein_id="CBG87242.1"
FT                   /translation="MQDELYMARALKLAARGRFTTHPNPNVGCVIVKDGEIVGEGYHYR
FT                   AGEPHAEVHALRMAGEKAKGATAYVTLEPCSHHGRTPPCCDALIAAGMARVVAAMQDPN
FT                   PQVAGRGLYRLQQAGIEVSHGLMMSEAEALNKGFLKRMRTGFPYVQLKLGASLDGRTAM
FT                   ASGESQWITSPQARRDVQRLRAQSHAILTSSETVLADDPQLTVRWSELGEATQAAYPQE
FT                   NLRQPVRIVIDSRNRVTPEHRIVSQPGETWFARTKEDDRVWPESVRTIQVPEHNGHLDL
FT                   VLLLMLLGKQQINSLWVEAGPTLAGALLQAGVVDELIMYVAPKLLGSDARGLCVLPGLE
FT                   KLADAPQFQFKEIRYTGPDVCLHLIPA"
FT   misc_feature    516657..516956
FT                   /gene="ribD"
FT                   /locus_tag="ROD_04631"
FT                   /note="HMMPfam hit to PF00383, CMP/dCMP
FT                   deaminase,zinc-binding, score 1.2e-45"
FT                   /inference="protein motif:PFAM:PF00383"
FT   misc_feature    516804..516920
FT                   /note="PS00903 Cytidine and deoxycytidylate deaminases
FT                   zinc-binding region signature."
FT                   /inference="protein motif:Prosite:PS00903"
FT   misc_feature    517095..517742
FT                   /gene="ribD"
FT                   /locus_tag="ROD_04631"
FT                   /note="HMMPfam hit to PF01872, Bacterial bifunctional
FT                   deaminase-reductase, C-terminal, score 3.8e-89"
FT                   /inference="protein motif:PFAM:PF01872"
FT   CDS_pept        517850..518320
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="ROD_04641"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase
FT                   (riboflavin synthase beta chain)"
FT                   /EC_number="2.5.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04641"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87243"
FT                   /db_xref="GOA:D2TL02"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL02"
FT                   /protein_id="CBG87243.1"
FT                   /translation="MNIIEANVATPDARVAITIARFNNFINDSLLEGAVDALKRIGQVK
FT                   DENITVVWVPGAYELPLAAGALAKTGKYDAVIALGTVIRGGTAHFEYVAGGASNGLAHV
FT                   AQDSEIPVAFGVLTTESIEQAIERAGTKAGNKGAEAALTALEMINVLKAIKA"
FT   misc_feature    517877..518311
FT                   /gene="ribH"
FT                   /locus_tag="ROD_04641"
FT                   /note="HMMPfam hit to
FT                   PF00885,6,7-dimethyl-8-ribityllumazine synthase, score
FT                   5.4e-92"
FT                   /inference="protein motif:PFAM:PF00885"
FT   CDS_pept        518340..518759
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="ROD_04651"
FT                   /product="N utilization substance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04651"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87244"
FT                   /db_xref="GOA:D2TL03"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL03"
FT                   /protein_id="CBG87244.1"
FT                   /translation="MKPAARRRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDV
FT                   MYFRELLSGVATNSAYLDGLMKPYLSRLLEELGQVEKAVLRIALFELSKRSDVPYKVAI
FT                   NEAIELAKTFGAEDSHKFVNGVLDKAAPVIRPNKK"
FT   misc_feature    518358..518741
FT                   /gene="nusB"
FT                   /locus_tag="ROD_04651"
FT                   /note="HMMPfam hit to PF01029, NusB/RsmB/TIM44, score
FT                   1.8e-49"
FT                   /inference="protein motif:PFAM:PF01029"
FT   CDS_pept        518837..519814
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="ROD_04661"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04661"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87245"
FT                   /db_xref="GOA:D2TL04"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL04"
FT                   /protein_id="CBG87245.1"
FT                   /translation="MACGEFSLIARYFDRVRSSRRDVETGIGDDCALLNIPEKQTLAIS
FT                   TDTLVAGNHFMPDIDPADLAYKALAVNLSDLAAMGADPAWLTLALTLPEVDEAWLETFS
FT                   DSLFDLLNYYDMQLIGGDTTRGPLSMTLGIHGYVPVGRALKRAGAKPGDWIYVTGTPGD
FT                   SAAGLAILQNRLQVADDVDNAYLLQRHLRPTPRILQGQALRDLASAAIDLSDGLISDLG
FT                   HIVKASACGARIDVDALPYSQAMLRHVGAEQALRWALSGGEDYELCFTVPELNRGALDV
FT                   ALAHLGVPFTCIGQMSADVEGICFIRDGEPVTFDWKGYDHFAAL"
FT   misc_feature    519284..519757
FT                   /gene="thiL"
FT                   /locus_tag="ROD_04661"
FT                   /note="HMMPfam hit to PF02769, AIR synthase related
FT                   protein, C-terminal, score 3.4e-05"
FT                   /inference="protein motif:PFAM:PF02769"
FT   CDS_pept        519792..520307
FT                   /transl_table=11
FT                   /gene="pgpA"
FT                   /locus_tag="ROD_04671"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /EC_number="3.1.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04671"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87246"
FT                   /db_xref="GOA:D2TL05"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL05"
FT                   /protein_id="CBG87246.1"
FT                   /translation="MTILPRSKDVAKSRLSLANPWHLLATGFGSGLSPVVPGTMGSLAA
FT                   IPFWYLMTFLPWQLYSLVVMLGICIGVYLCHQTAKDMGVHDHGSIVWDEFIGMWITLMA
FT                   LPTNDWQWVAAGFVIFRILDMWKPWPIRWFDRNVHGGMGIMVDDIVAGVISAGILYFIG
FT                   HHWPIGAI"
FT   misc_feature    join(519852..519920,519948..520016,520236..520295)
FT                   /gene="pgpA"
FT                   /locus_tag="ROD_04671"
FT                   /note="3 probable transmembrane helices predicted for
FT                   ROD04671 by TMHMM2.0 at aa 21-43, 53-75 and 149-168"
FT   misc_feature    519852..520280
FT                   /gene="pgpA"
FT                   /locus_tag="ROD_04671"
FT                   /note="HMMPfam hit to
FT                   PF04608,Phosphatidylglycerophosphatase A, score 4.1e-78"
FT                   /inference="protein motif:PFAM:PF04608"
FT   CDS_pept        complement(520497..521471)
FT                   /transl_table=11
FT                   /locus_tag="ROD_04681"
FT                   /product="putative aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04681"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87247"
FT                   /db_xref="GOA:D2TL06"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL06"
FT                   /protein_id="CBG87247.1"
FT                   /translation="MQYNTLGKTDLRVSRLCLGCMTFGEPNRGNHAWTLPEESSRPLIK
FT                   RALEGGINFFDTANSYSAGSSEEIVGRALRDFARRDEVVVATKVFHQVDDLPEGLSRAQ
FT                   ILRSIDDRLRRLGMDYVDILQIHRWDYNTPIEETLAALDEVVKAGKARYIGASSMHASQ
FT                   FAQALALQKQHGWAPFISMQDHYNLIYREEEREMLPLCYREGVAVIPWSPLARGRLTRP
FT                   WGETTARLVSDEVGKNLYRESDENDAQIAARLAGVSEELGATRAQVALAWLLSKPGVAA
FT                   PIIGASREEQLDELLNAVDLTLTPEQIAELETPYKQHPVVGFK"
FT   misc_feature    complement(520524..521453)
FT                   /locus_tag="ROD_04681"
FT                   /note="HMMPfam hit to PF00248, Aldo/keto reductase, score
FT                   2.4e-66"
FT                   /inference="protein motif:PFAM:PF00248"
FT   CDS_pept        complement(521528..523390)
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="ROD_04691"
FT                   /product="1-deoxyxylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04691"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87248"
FT                   /db_xref="GOA:D2TL07"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL07"
FT                   /protein_id="CBG87248.1"
FT                   /translation="MSFDIAKYPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSR
FT                   SSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGL
FT                   HPFPWRGESEYDVLSVGHSSTSVSAGIGIAVAAEKEGKNRRTVCVIGDGAITAGMAFEA
FT                   MNHAGDIKPDMLVILNDNEMSISENVGALNNHLAQLLSGKLYSTLREGGKKVFSGVPPI
FT                   KELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVLGLITTLKNMRDLKGPQFLHIM
FT                   TKKGRGYEPAEKDPITFHAVPKFDPSSGCLPKSSGGLPSYSKIFGDWLCETAAKDSKLM
FT                   AITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPVVAIYSTFLQRA
FT                   YDQVIHDVAIQKLPVMFAIDRAGIVGADGQTHQGAFDLSYLRCIPDMVIMTPSDENECR
FT                   QMLFTGYHYSEGPTAVRYPRGNALGVELTPLEKLPIGKGVVKRHGEKVAILNFGTLMPE
FT                   AAKVAEALNATLVDMRFVKPLDETLILEMAARHEMLVTLEENAIMGGAGSGVNETLMAH
FT                   RKPVPVLNIGLPDFFIPQGTQDEARAELGLDAAGIEAKIRAWLA"
FT   misc_feature    complement(521558..521908)
FT                   /gene="dxs"
FT                   /locus_tag="ROD_04691"
FT                   /note="HMMPfam hit to PF02780, Transketolase,
FT                   C-terminal,score 5e-39"
FT                   /inference="protein motif:PFAM:PF02780"
FT   misc_feature    complement(521939..522442)
FT                   /gene="dxs"
FT                   /locus_tag="ROD_04691"
FT                   /note="HMMPfam hit to PF02779, Transketolase, central
FT                   region, score 2.2e-59"
FT                   /inference="protein motif:PFAM:PF02779"
FT   misc_feature    complement(522068..522118)
FT                   /note="PS00802 Transketolase signature 2."
FT                   /inference="protein motif:Prosite:PS00802"
FT   misc_feature    complement(523226..523285)
FT                   /note="PS00801 Transketolase signature 1."
FT                   /inference="protein motif:Prosite:PS00801"
FT   CDS_pept        complement(523414..524313)
FT                   /transl_table=11
FT                   /gene="ispA"
FT                   /locus_tag="ROD_04701"
FT                   /product="geranyltranstransferase"
FT                   /EC_number="2.5.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04701"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87249"
FT                   /db_xref="GOA:D2TL08"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL08"
FT                   /protein_id="CBG87249.1"
FT                   /translation="MDFTRQLQVCVEQANQALSRFIAPLPFQNTPVVEAMQYGALLGGK
FT                   RLRPFLVYATGKMFGVSLSTLDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHVK
FT                   FGEANAILAGDALQTLAFTIISDAPMPEVTDRDRIAMISELANASGIAGMCGGQALDLD
FT                   AEGRQVPLAALEKIHRHKTGALIRAAVRLGALSAGEKGRNVLPILDKYAESIGLAFQVQ
FT                   DDILDVVGDTATLGKRQGADQQLGKSTYPALLGLEQARNKARDLIEEARQSLQQLAAQS
FT                   LDTSALEALADYIIQRDK"
FT   misc_feature    complement(523429..524220)
FT                   /gene="ispA"
FT                   /locus_tag="ROD_04701"
FT                   /note="HMMPfam hit to PF00348, Polyprenyl synthetase, score
FT                   1e-131"
FT                   /inference="protein motif:PFAM:PF00348"
FT   misc_feature    complement(523570..523593)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(523633..523671)
FT                   /note="PS00444 Polyprenyl synthetases signature 2."
FT                   /inference="protein motif:Prosite:PS00444"
FT   misc_feature    complement(524023..524073)
FT                   /note="PS00723 Polyprenyl synthetases signature 1."
FT                   /inference="protein motif:Prosite:PS00723"
FT   CDS_pept        complement(524314..524556)
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="ROD_04711"
FT                   /product="exodeoxyribonuclease 7 small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04711"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87250"
FT                   /db_xref="GOA:D2TL09"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL09"
FT                   /protein_id="CBG87250.1"
FT                   /translation="MPKKNEAPVSFETSLNELEQIVSRLESGDLPLDEALNEFERGVQL
FT                   ARQGQLKLQQAEQRVQILLSDDEDATPEPFSPDNA"
FT   misc_feature    complement(524341..524532)
FT                   /gene="xseB"
FT                   /locus_tag="ROD_04711"
FT                   /note="HMMPfam hit to PF02609, Exonuclease VII, small
FT                   subunit, score 3.4e-32"
FT                   /inference="protein motif:PFAM:PF02609"
FT   CDS_pept        524764..526212
FT                   /transl_table=11
FT                   /locus_tag="ROD_04721"
FT                   /product="thiamine biosynthesis protein ThiI"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04721"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87251"
FT                   /db_xref="GOA:D2TL10"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="InterPro:IPR026340"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL10"
FT                   /protein_id="CBG87251.1"
FT                   /translation="MKFIIKLFPEITIKSQSVRLRFIKMLTGNIRNVLKHYDETLAVVR
FT                   HWDNIEVRARDENQRLAIRDALTRIPGIHHILEVEDVPFTDMHDIFEKALAEYRDRLEG
FT                   KTFCVRVKRRGKHEFSSIEVERYVGGGLNQHIESARVKLTNPDVTVHLEVEDDRLLLIK
FT                   GRYEGIGGFPIGTQEDVLSLISGGFDSGVSSYMLMRRGCRVHYCFFNLGGAAHEIGVRQ
FT                   VAHYLWNRYGSSHRVRFVAINFEPVVGEILEKVDDGQMGVVLKRMMVRAASKVAERYGV
FT                   QALVTGEALGQVSSQTLTNLRLIDNVSDTLILRPLISYDKEHIINIAREIGTEDFARTM
FT                   PEYCGVISKSPTVKAVKSKIEAEEENFDFSILDRVVEEATNVDIRDIAQQTAQEVVEVE
FT                   TVSGFGPNDVILDIRSVDEQDDKPLRVEGVDVVTLPFYKLSTKFGDLDQSKTWLLWCER
FT                   GVMSRLQALYLREQGFENVKVYRP"
FT   misc_feature    524986..525258
FT                   /locus_tag="ROD_04721"
FT                   /note="HMMPfam hit to PF02926, THUMP, score 2.2e-28"
FT                   /inference="protein motif:PFAM:PF02926"
FT   misc_feature    525286..525870
FT                   /locus_tag="ROD_04721"
FT                   /note="HMMPfam hit to PF02568, Thiamine biosynthesis
FT                   protein, score 3.4e-112"
FT                   /inference="protein motif:PFAM:PF02568"
FT   CDS_pept        complement(526310..526900)
FT                   /transl_table=11
FT                   /gene="thiJ"
FT                   /locus_tag="ROD_04731"
FT                   /product="4-methyl-5(b-hydroxyethyl)-thiazole monophosphate
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04731"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87252"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL11"
FT                   /protein_id="CBG87252.1"
FT                   /translation="MSASALVCLAPGSEETEAVTTIDLLVRGGIDVTTASVASDGALTI
FT                   VCSRGVKLLADAPLVEVADGDYDVIVLPGGVKGAECFRDSPLLVETVRQFHRSGRIVAA
FT                   ICAAAATVLVPHDIFPIGNMTGFPALKDKIPAEQWQDKRVVWDARVKLLTSQGPGTSID
FT                   FALKIIDLLAGREKAHEVASQLVMAAGIYNYYE"
FT   misc_feature    complement(526382..526810)
FT                   /gene="thiJ"
FT                   /locus_tag="ROD_04731"
FT                   /note="HMMPfam hit to PF01965, ThiJ/PfpI, score 4.4e-46"
FT                   /inference="protein motif:PFAM:PF01965"
FT   CDS_pept        complement(526863..527774)
FT                   /transl_table=11
FT                   /gene="panE"
FT                   /locus_tag="ROD_04741"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04741"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87253"
FT                   /db_xref="GOA:D2TL12"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL12"
FT                   /protein_id="CBG87253.1"
FT                   /translation="MKVTVLGCGALGQLWLTALCKQGHEVQGWMRIPQPYCSVNLIETD
FT                   GSIFNESLTANDPEFLAASDLLLVTLKAWQVSDAVKGLAAMLPATTPVLLIHNGMGTLE
FT                   ELAALRQPLLMGTTTHAARRDGNVIIHVASGTTHIGPAREQDGDYSYLADTLQCALPDV
FT                   AWHNNIRAELWRKLAVNCVINPLTALWNCPNGELRHHPDQIAPICHEVAAVIEREGYHT
FT                   SADDLRYYVEQVIDSTAENISSMLQDVRAQRHTEIDYITGYLLKRARAHGITVAENSRL
FT                   FELVKRKESEYERIGTGMPRPW"
FT   misc_feature    complement(526908..527273)
FT                   /gene="panE"
FT                   /locus_tag="ROD_04741"
FT                   /note="HMMPfam hit to PF08546, Ketopantoate reductase
FT                   ApbA/PanE, C-terminal, score 1.5e-57"
FT                   /inference="protein motif:PFAM:PF08546"
FT   misc_feature    complement(527343..527768)
FT                   /gene="panE"
FT                   /locus_tag="ROD_04741"
FT                   /note="HMMPfam hit to PF02558, Ketopantoate reductase
FT                   ApbA/PanE, N-terminal, score 5.2e-38"
FT                   /inference="protein motif:PFAM:PF02558"
FT   CDS_pept        527881..528390
FT                   /transl_table=11
FT                   /locus_tag="ROD_04751"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04751"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87254"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL13"
FT                   /protein_id="CBG87254.1"
FT                   /translation="MKGEEKMPSFDIVSEVDLQEARNGVDNAVREVESRFDFRGVEASI
FT                   ELNDANKTIKVLSESDFQVNQLLDILRAKLLKRGIEGASLDVPEEFVHSGKTWYVEAKL
FT                   KQGIESAVQKKIVKLIKDSKLKVQAQIQGDEIRVTGKSRDDLQSVMALVRGGDLGQPFQ
FT                   FKNFRD"
FT   misc_feature    527899..528384
FT                   /locus_tag="ROD_04751"
FT                   /note="HMMPfam hit to PF04461, Protein of unknown function
FT                   DUF520, score 5.3e-114"
FT                   /inference="protein motif:PFAM:PF04461"
FT   CDS_pept        complement(528453..529817)
FT                   /transl_table=11
FT                   /locus_tag="ROD_04761"
FT                   /product="Major facilitator superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04761"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87255"
FT                   /db_xref="GOA:D2TL14"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL14"
FT                   /protein_id="CBG87255.1"
FT                   /translation="MNDYKMTPGELRATWGLGTVFSLRMLGMFMVLPVLTTYGMALQGA
FT                   SEALIGIAIGIYGLAQAIFQIPFGLLSDRIGRKPLIVGGLAVFVLGSIIAALSHSIWGI
FT                   ILGRALQGSGAIAAAVMALLSDLTREQNRTKAMAFIGVSFGITFAIAMVLGPIITHALG
FT                   LNALFWMIALLATTGIVLTIWVVPNSNNHVLNRESGMVRGSFRKVLAEPKLLKLNFGIM
FT                   CLHILLMSTFVALPGELAESGFPAAEHWKVYLVTMLISFASVVPFIIYAEVKRKMKRVF
FT                   LFCVALILIAEIVLWGAGSHFWELIIGVQLFFLAFNLMEALLPSLISKESPAGYKGTAM
FT                   GVYSTSQFLGVAIGGSLGGWVDGMFDGQTVFLVGALLTVLWLAVASTMKEPPYVSSLRV
FT                   EIPPDITIDDTLKQRLLAMDGVSEVLIAESEHSAYVKIDSKVTNRFEVEQAIRLA"
FT   misc_feature    complement(join(528663..528716,528729..528797,
FT                   528834..528902,528912..528980,528999..529067,
FT                   529110..529178,529260..529328,529341..529409,
FT                   529446..529514,529524..529583,529602..529670,
FT                   529713..529781))
FT                   /locus_tag="ROD_04761"
FT                   /note="12 probable transmembrane helices predicted for
FT                   ROD04761 by TMHMM2.0 at aa 13-35, 50-72, 79-98,
FT                   102-124,137-159, 164-186, 214-236, 251-273, 280-302,
FT                   306-328,341-363 and 368-385"
FT   misc_feature    complement(528729..529769)
FT                   /locus_tag="ROD_04761"
FT                   /note="HMMPfam hit to PF07690, Major facilitator
FT                   superfamily MFS-1, score 9.7e-48"
FT                   /inference="protein motif:PFAM:PF07690"
FT   CDS_pept        complement(530015..531379)
FT                   /transl_table=11
FT                   /locus_tag="ROD_04771"
FT                   /product="Major Facilitator Superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04771"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87256"
FT                   /db_xref="GOA:D2TL15"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL15"
FT                   /protein_id="CBG87256.1"
FT                   /translation="MSQTQRLDVRELINANPLSRYQKLVIFLGFCVIALDGFDIAIMGF
FT                   IAPTLRQEWGVSNHELGFVISTALIGLALGALFSGPLADWLGRKKIIINSVFFFGFWTI
FT                   ATAFSQNIEQMIFFRFMTGLGLGAAMPNMSTLVSEYAPERQRSFIITVIFCGFTFGAAV
FT                   GGFAASWLIPQFGWHSLMALGGIMPLLFAPILIWKLPESARFLVIKRAPAARIHAILQR
FT                   CYPGQLSENVCFTLPPQPVNSSAIGTVLSRQYLFGSLMLWLVYFMGLFLVYILGSWLPT
FT                   LVKEIGLTVSQAAIMTAIYQAGGTIGSLFTGWLMDRIEPHRALGVIFTIGGLFTMAIGY
FT                   AGVNFLLLCLLAFVSGACLNGANTGMNALSARFYPTQARATGSSWMHGVGRIGAIISAF
FT                   AGAEMLALELDFKSVFLILGIPAALTVVGLTAKGYWAAGPISGKSAVSATLRSPS"
FT   misc_feature    complement(530048..530071)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(join(530072..530140,530159..530227,
FT                   530336..530404,530438..530506,530549..530617,
FT                   530783..530851,530864..530932,530966..531034,
FT                   531044..531112,531131..531199,531242..531310))
FT                   /locus_tag="ROD_04771"
FT                   /note="11 probable transmembrane helices predicted for
FT                   ROD04771 by TMHMM2.0 at aa 24-46, 61-83, 90-112,
FT                   116-138,150-172, 177-199, 255-277, 292-314, 326-348,
FT                   385-407 and 414-436"
FT   misc_feature    complement(530162..531295)
FT                   /locus_tag="ROD_04771"
FT                   /note="HMMPfam hit to PF07690, Major facilitator
FT                   superfamily MFS-1, score 9.8e-53"
FT                   /inference="protein motif:PFAM:PF07690"
FT   misc_feature    complement(530306..530338)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(530942..531019)
FT                   /note="PS00217 Sugar transport proteins signature 2."
FT                   /inference="protein motif:Prosite:PS00217"
FT   misc_feature    complement(531095..531145)
FT                   /note="PS00216 Sugar transport proteins signature 1."
FT                   /inference="protein motif:Prosite:PS00216"
FT   CDS_pept        complement(531393..532196)
FT                   /transl_table=11
FT                   /locus_tag="ROD_04781"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04781"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87257"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL16"
FT                   /protein_id="CBG87257.1"
FT                   /translation="MNMRSLSLAALTVLDVPPPEQVRIAALAGYSHVGIRLLPSTPDDP
FT                   DYDMLGDTATVRETLAALRDTGIRVSDVEIVRLTPDFNVQALRPFLETAARLEAKQVLV
FT                   AGNDDNLARCAQNLAELAKAGEAYGLTMNLEPMPWTDIPTLAAARKLIAASGQQNVGIL
FT                   IDAIHFWRAGESLEALAALPSQQLNYMQLCDAPARIPTETRELIYQARCARLIPGEGEL
FT                   DLRGLLAALPSALPISVEVPLAGPQGALPAQQRAQLLFNAAQSFL"
FT   misc_feature    complement(531531..532133)
FT                   /locus_tag="ROD_04781"
FT                   /note="HMMPfam hit to PF01261, Xylose isomerase-type TIM
FT                   barrel, score 5.2e-30"
FT                   /inference="protein motif:PFAM:PF01261"
FT   CDS_pept        complement(532272..533966)
FT                   /transl_table=11
FT                   /locus_tag="ROD_04791"
FT                   /product="putative flavoprotein subunit of a reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04791"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87258"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL17"
FT                   /protein_id="CBG87258.1"
FT                   /translation="MSRHVEVDLLVIGSGAAGLSAAVSAALHGGRVLVAEKEPVIGGTS
FT                   AWSGGWLWIPQNPLAREEGIVEEDDAPLTYLRAEMEGRPADARLLAFLRHGPEMVEFFR
FT                   RRTAVQFLSGSKMPDFHNSEGFATGGRSVTAQPYDARELGDWVHRLRPPLETISLAGMG
FT                   IAGGQDMAHFFNATRSPRSALYAARRLATHYWQRLRYGRGLHLVNGNALVARLLRSALD
FT                   AGVSFQLNAPVYRLLQGEHGVTGALLGSDEGEIRVNARAVVLACGGFPHDKQRLAEQVT
FT                   HAREGYGHFSAAPPGNQGDGIRLGESVGGQFDASLKHPMAWAPVSRVSLSSGLQLAFPH
FT                   LVERAKPGFIAVLPDGKRFVNEADSYHDFIAALLDATPPGEKPQAWLIGDHRALRRYGM
FT                   GHARPSPFPLSAWLRTGYLYSGATLEELAEKCAIDGTALCATVKRFNDFARQGRDDDFR
FT                   RGASAYNRAQGDASHRPSPTLGTLAKAPYYAVRILPGSLGSFSGLKTDEQARVLDAGQR
FT                   PVPGLFAVGNDMSSVMQGFYPSGGITLGPAMTFGYLVGKNLFAHITT"
FT   misc_feature    complement(532335..533945)
FT                   /locus_tag="ROD_04791"
FT                   /note="HMMPfam hit to PF00890, Fumarate reductase/succinate
FT                   dehydrogenase flavoprotein, N-terminal, score 1.1e-182"
FT                   /inference="protein motif:PFAM:PF00890"
FT   sig_peptide     complement(533892..533966)
FT                   /locus_tag="ROD_04791"
FT                   /note="Signal peptide predicted for ROD04791 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.802) with cleavage site
FT                   probability 0.503 between residues 25 and 26"
FT   CDS_pept        complement(533977..534297)
FT                   /transl_table=11
FT                   /locus_tag="ROD_04801"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04801"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87259"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL18"
FT                   /protein_id="CBG87259.1"
FT                   /translation="MIYEKRTYTINPLKMAEWLALYKSDAYAVQTEHLGKLIGFFFTEI
FT                   GVVNQVVHIWAWESLDDRLMRRARMAQDKRWQTFSRKNRELAAVERLESVLMRPTDFSP
FT                   LQ"
FT   misc_feature    complement(533986..534291)
FT                   /locus_tag="ROD_04801"
FT                   /note="HMMPfam hit to PF07978, NIPSNAP, score 1.8e-39"
FT                   /inference="protein motif:PFAM:PF07978"
FT   misc_feature    complement(534013..534042)
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   CDS_pept        complement(534294..535988)
FT                   /transl_table=11
FT                   /locus_tag="ROD_04811"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04811"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87260"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL19"
FT                   /protein_id="CBG87260.1"
FT                   /translation="MKSWDVIVIGSGAAGFAAAVTACCQGLSVLMLEKASQFGGTSAIS
FT                   GGAVWINDTDQARNLGKSGPAEEMKTYLRTIIGDAHYRPEMIDAFVNAGREALAFLERE
FT                   GAVKYSLRPLSPDYYPDEPGAVDVGRALEVIEYDGRKLGQHFKALRSPPPGMLLFGGMM
FT                   VNRVDIHHFLSMRRSWRSLVHCARLLLRYGRDRLRYPRGTRLAMGNALIARMASLALRK
FT                   GLELELNVDVKTLTEQQGRVTGVEIERDGKTLTLHARRGVVLATGGFAAGRIAPQFRPA
FT                   TRQHYTMSPATNDGAAFRLGQPLGVQQGADLPSNFFWAPVSVLRRPDGSEERFPHLVTD
FT                   RAKPGVIAVNQHGMRFVNEADSYHHFVSAMQQRPENAPCFLLCDAQAMKRYGLGLARPA
FT                   PVNNDALVSAVYLYRAESLSALAQQLDIDPQQLEQTVARYNHDAQTGNDTAFHKGGNSY
FT                   NRTLGDPAHHPDACNAPLLRAPFYAIRIFTGDLGTSRGLVTTADAQVINQQGQPVGGLY
FT                   AVGNDMDSIMAGTYPGPGITLGPALTFGYLAAMHMTQTSPLNAGEAA"
FT   misc_feature    complement(534375..535976)
FT                   /locus_tag="ROD_04811"
FT                   /note="HMMPfam hit to PF00890, Fumarate reductase/succinate
FT                   dehydrogenase flavoprotein, N-terminal, score 2.5e-159"
FT                   /inference="protein motif:PFAM:PF00890"
FT   misc_feature    complement(534678..534743)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1025.000, SD 2.68 at aa 416-437, sequence
FT                   ESLSALAQQLDIDPQQLEQTVA"
FT   misc_feature    complement(535902..535970)
FT                   /locus_tag="ROD_04811"
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD04811 by TMHMM2.0 at aa 7-29"
FT   misc_feature    complement(535920..535952)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   sig_peptide     complement(535923..535988)
FT                   /locus_tag="ROD_04811"
FT                   /note="Signal peptide predicted for ROD04811 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.871) with cleavage site
FT                   probability 0.490 between residues 22 and 23"
FT   CDS_pept        complement(535985..536806)
FT                   /transl_table=11
FT                   /locus_tag="ROD_04821"
FT                   /product="quinate/shikimate dehydrogenase"
FT                   /EC_number="1.1.1.282"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04821"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87261"
FT                   /db_xref="GOA:D2TL20"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL20"
FT                   /protein_id="CBG87261.1"
FT                   /translation="MVSGFTQIVAIIGHPITQVKSPENFNHYFASQRMDKVMIPVDIAP
FT                   DAVAAYLNALRGWQNMSGILVTVPHKQRVAELLDALTPRARHLGAVNVVRKLDDGRLEG
FT                   DMLDGVGFQLAAEAHGFQPAGKRALLSGCGGVGSAIAWGLCEAGISRLALYDRDDACRQ
FT                   RLENRLITHFPNTHITALPDSLAEIDLLINGSPAGMAGFDPLPLSQTLLDTLTAATHVA
FT                   DVVTTPIITPLLAFAGERGCRTQTGPELAMAQMELMGQFIGALAPTHEATP"
FT   misc_feature    complement(536105..536503)
FT                   /locus_tag="ROD_04821"
FT                   /note="HMMPfam hit to PF01488, Quinate/shikimate
FT                   5-dehydrogenase/glutamyl-tRNA reductase, score 0.00021"
FT                   /inference="protein motif:PFAM:PF01488"
FT   misc_feature    complement(536525..536776)
FT                   /locus_tag="ROD_04821"
FT                   /note="HMMPfam hit to PF08501, Shikimate dehydrogenase
FT                   substrate binding, N-terminal, score 5.3e-23"
FT                   /inference="protein motif:PFAM:PF08501"
FT   CDS_pept        536959..537717
FT                   /transl_table=11
FT                   /locus_tag="ROD_04831"
FT                   /product="putative IclR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04831"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87262"
FT                   /db_xref="GOA:D2TL21"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL21"
FT                   /protein_id="CBG87262.1"
FT                   /translation="MQNEIHQRDLIVGLQKGLALIQLFSKEHPRLTVPQAAKMSGLTQS
FT                   AARRFFLTLVHEGYLATDGRFYWLMAKTLRLGQAYVDSAQFPRMVRPIVEYVASRTEEH
FT                   ASVGVIDDNELVYIARSRHTPFNSTSVRLGERVPIHCTAGGRLWLASLPETECEAVLRR
FT                   IPREQRTPYTVTGVDELMALIAQVRRQGYATIEQEFEIGMLVIAVPLADREGLYWGALS
FT                   LTSHQSRTTLEALCRDHLNLLYSAQAMLVS"
FT   misc_feature    536995..537255
FT                   /locus_tag="ROD_04831"
FT                   /note="HMMPfam hit to PF09339, Transcriptional regulator
FT                   IclR, N-terminal, score 2.4e-19"
FT                   /inference="protein motif:PFAM:PF09339"
FT   misc_feature    537049..537114
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1169.000, SD 3.17 at aa 31-52, sequence
FT                   LTVPQAAKMSGLTQSAARRFFL"
FT   misc_feature    537334..537714
FT                   /locus_tag="ROD_04831"
FT                   /note="HMMPfam hit to PF01614, Transcriptional regulator
FT                   IclR, C-terminal, score 2.6e-16"
FT                   /inference="protein motif:PFAM:PF01614"
FT   CDS_pept        complement(537762..538652)
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /locus_tag="ROD_04841"
FT                   /product="protoheme IX farnesyltransferase (heme O
FT                   synthase)"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04841"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87263"
FT                   /db_xref="GOA:D2TL22"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL22"
FT                   /protein_id="CBG87263.1"
FT                   /translation="MMFKQYLQVTKPGIIFGNLISVIGGFLLASKGSIDYPLFIYTLVG
FT                   VSLVVASGCVFNNYIDRDIDRKMERTKNRVLVKGLISPAVSLVYATLLGIAGFMLLWFG
FT                   ANPLACWLGVMGFVVYVGVYSLYMKRHSVYGTLIGSLSGAAPPVIGYCAVTNEFDSGAL
FT                   ILLAIFSLWQMPHSYAIAIFRFKDYQAANIPVLPVVKGISVAKNHITLYIIAFAIATLM
FT                   LSLGGYAGYKYLVVAAAVSVWWLGMALRGYKVEDDRIWARKLFGFSIIAITALSVMMSV
FT                   DFMVPDSHSLLTYVW"
FT   misc_feature    complement(join(537795..537863,537897..537950,
FT                   537960..538028,538107..538175,538188..538256,
FT                   538275..538334,538347..538415,538473..538541,
FT                   538551..538619))
FT                   /gene="cyoE"
FT                   /locus_tag="ROD_04841"
FT                   /note="9 probable transmembrane helices predicted for
FT                   ROD04841 by TMHMM2.0 at aa 12-34, 38-60, 80-102,
FT                   107-126,133-155, 160-182, 209-231, 235-252 and 264-286"
FT   misc_feature    complement(537804..538610)
FT                   /gene="cyoE"
FT                   /locus_tag="ROD_04841"
FT                   /note="HMMPfam hit to PF01040, UbiA prenyltransferase,score
FT                   5.2e-90"
FT                   /inference="protein motif:PFAM:PF01040"
FT   misc_feature    complement(538416..538484)
FT                   /note="PS00943 UbiA prenyltransferase family signature."
FT                   /inference="protein motif:Prosite:PS00943"
FT   misc_feature    com