(data stored in ACNUC8465 zone)

EMBL: FN543504

ID   FN543504; SV 1; circular; genomic DNA; STD; PRO; 39265 BP.
XX
AC   FN543504;
XX
PR   Project:PRJEA34685;
XX
DT   05-JAN-2010 (Rel. 103, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 2)
XX
DE   Citrobacter rodentium ICC168 plasmid pCROD2, complete sequence
XX
KW   .
XX
OS   Citrobacter rodentium ICC168
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Citrobacter.
OG   Plasmid pCROD2
XX
RN   [1]
RP   1-39265
RA   Petty N.K.;
RT   ;
RL   Submitted (19-AUG-2009) to the INSDC.
RL   Petty N.K., Pathogen Genomics, Sanger Institute, Wellcome Trust Genome
RL   Campus, Cambridge, CB10 1SA, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1128/JB.01144-09.
RX   PUBMED; 19897651.
RA   Petty N.K., Bulgin R., Crepin V.F., Cerdeno-Tarraga A.M., Schroeder G.N.,
RA   Quail M.A., Lennard N., Corton C., Barron A., Clark L., Toribio A.L.,
RA   Parkhill J., Dougan G., Frankel G., Thomson N.R.;
RT   "The Citrobacter rodentium genome sequence reveals convergent evolution
RT   with human pathogenic Escherichia coli";
RL   J. Bacteriol. 192(2):525-538(2010).
XX
DR   MD5; 0800ce0e442833a1b451c2622a2bf443.
DR   BioSample; SAMEA2272524.
DR   EnsemblGenomes-Gn; ROD_p2461.
DR   EnsemblGenomes-Tr; ROD_p2461.
DR   EuropePMC; PMC2805327; 19897651.
DR   EuropePMC; PMC3072379; 21490962.
DR   EuropePMC; PMC3232798; 21911569.
DR   EuropePMC; PMC3535970; 23114770.
DR   EuropePMC; PMC3789690; 24098597.
DR   EuropePMC; PMC4040988; 24732280.
DR   EuropePMC; PMC4914624; 27090180.
DR   EuropePMC; PMC4924136; 27366640.
DR   EuropePMC; PMC6588040; 31196922.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..39265
FT                   /organism="Citrobacter rodentium ICC168"
FT                   /plasmid="pCROD2"
FT                   /strain="ICC168"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:637910"
FT   CDS_pept        complement(53..400)
FT                   /transl_table=11
FT                   /gene="hicB"
FT                   /locus_tag="ROD_p2001"
FT                   /product="putative toxin-antitoxin system protein HicB"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2001"
FT                   /db_xref="EnsemblGenomes-Tr:CBA35024"
FT                   /db_xref="GOA:D2TVE5"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVE5"
FT                   /protein_id="CBA35024.1"
FT                   /translation="MKHLKYKGYLGTVEPDFENNVLYGKLAFIRDLVTYEASTLAELEQ
FT                   EFKTSVDLYLQSCVEDGKEPDTPFKGVFNVRLDPELHRRVAEMAMEEDLSLNAFVNKAL
FT                   EKEVSNHRAGA"
FT   misc_feature    complement(89..241)
FT                   /note="HMMPfam hit to PF05534, HicB, score 4.7e-24"
FT                   /inference="protein motif:PFAM:PF05534"
FT   CDS_pept        complement(397..645)
FT                   /transl_table=11
FT                   /gene="hicA"
FT                   /locus_tag="ROD_p2011"
FT                   /product="putative toxin-antitoxin system protein HicA"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2011"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91822"
FT                   /db_xref="GOA:D2TV91"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="UniProtKB/TrEMBL:D2TV91"
FT                   /protein_id="CBG91822.1"
FT                   /translation="MGKTDKLLAKFLNSKKTFEWDELVVLFSSLGYVKKEMQGSRVRFF
FT                   NAEINHTILMHRPHPESYIKGGTLKAIKQNLKEAGLL"
FT   CDS_pept        complement(951..1316)
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2021"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91823"
FT                   /db_xref="UniProtKB/TrEMBL:D2TV92"
FT                   /protein_id="CBG91823.1"
FT                   /translation="MQGKFMKTLKQAAMQFASDLRNNRCFKAAYNDALLELDREDLNAI
FT                   VQCTFLFEPKRTLAELDKLIKKIEVEEDYEFCVSLDKGNGLHEVRTFKSEREALDAYRI
FT                   LTLYGYTVTIEKKEGND"
FT   CDS_pept        complement(1393..1692)
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2031"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91824"
FT                   /db_xref="UniProtKB/TrEMBL:D2TV93"
FT                   /protein_id="CBG91824.1"
FT                   /translation="MKCSSVFTSTTNHVFTFERVTLCTIILMHKDTGQQYVVIFTDNNK
FT                   IRDYKTGIVPQFGELKQSDVDLVLFYRDEYEKYFDSLKDGDECLSFKDFIECLR"
FT   CDS_pept        complement(1694..2053)
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2041"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91825"
FT                   /db_xref="UniProtKB/TrEMBL:D2TV94"
FT                   /protein_id="CBG91825.1"
FT                   /translation="MHQGGVNSLALALTAAFCGANQHNHSLLVSWALQGEGMSCAPWYV
FT                   HQRLRRASGRCGSCAALVFSFAPSIRLRGLKNVITITYRVKKRENTCRCDLKVVLLFHR
FT                   KGNGPSHNSPAGQEI"
FT   CDS_pept        complement(2146..2373)
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2051"
FT                   /product="putative DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2051"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91826"
FT                   /db_xref="GOA:D2TV95"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D2TV95"
FT                   /protein_id="CBG91826.1"
FT                   /translation="MKPDNTPENVKKLRLKAGLTQKECSHIYGVGLRTWQKKEEVNTQN
FT                   SQSLSLVEFEFLLLLAGEHPEYVLCKRESK"
FT   misc_feature    complement(2254..2319)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1292.000, SD 3.59 at aa 19-40, sequence
FT                   LTQKECSHIYGVGLRTWQKKEE"
FT   CDS_pept        complement(2360..2611)
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2061"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91827"
FT                   /db_xref="UniProtKB/TrEMBL:D2TV96"
FT                   /protein_id="CBG91827.1"
FT                   /translation="MRKNKGDVTYFLEKEGDNYRLTKRIKARTNVKIGNKTTKITLYDA
FT                   VLNENELQHIDFTCAGLREDDETPVKNLIKEFMLNETR"
FT   CDS_pept        complement(2608..3150)
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2071"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91828"
FT                   /db_xref="UniProtKB/TrEMBL:D2TV97"
FT                   /protein_id="CBG91828.1"
FT                   /translation="MNSFFEQYHPVFEVVCRILGNGWRVNKLDDCSSRIKLTSPQFKNY
FT                   SVHIRMEKGRFSVVGSVDSRSWRSPHHVCTLSRKRNPVDIAADIERKILVNASQEVLQA
FT                   IEYEKHQVEKKDEILILKGMLSQLVQLESWYGALIGFKAENGLNGKVTEQGDSYDLQIR
FT                   GLSIDQLVKITGYLKQL"
FT   CDS_pept        complement(3255..3770)
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2081"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91829"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D2TV98"
FT                   /protein_id="CBG91829.1"
FT                   /translation="MNIQEALNVFGLSGELTEKDIKAAYRKAALKYHPDRNPLGAELMK
FT                   AVNAAFDVLMANIDKINQFQSTDEHARYNYGDDLEKVLNVLSGLSGLVFEVIGNWVWIS
FT                   GETLTHKETLKEIGCKWAAKKKQWFYRPDEHKSYWNREEHTIEEIRAKYGTTGQRRATG
FT                   WQRVETRA"
FT   misc_feature    complement(3609..3758)
FT                   /note="HMMPfam hit to PF00226, Heat shock protein DnaJ,
FT                   N-terminal, score 5.7e-16"
FT                   /inference="protein motif:PFAM:PF00226"
FT   CDS_pept        complement(3774..4133)
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2091"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91830"
FT                   /db_xref="UniProtKB/TrEMBL:D2TV94"
FT                   /protein_id="CBG91830.1"
FT                   /translation="MHQGGVNSLALALTAAFCGANQHNHSLLVSWALQGEGMSCAPWYV
FT                   HQRLRRASGRCGSCAALVFSFAPSIRLRGLKNVITITYRVKKRENTCRCDLKVVLLFHR
FT                   KGNGPSHNSPAGQEI"
FT   CDS_pept        complement(4410..4760)
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2101"
FT                   /product="putative DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2101"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91831"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVA0"
FT                   /protein_id="CBG91831.1"
FT                   /translation="MAYDENVKSQKNHYPAAVEHNAAMIEELRADPDYANAYLANALEE
FT                   INEPGGLGGFLVALRQVIEARGGISEAARKSGLARQSIYRALSPNGNPTITTLAQLTSV
FT                   AGLQFTLSKSSH"
FT   misc_feature    complement(4497..4562)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1642.000, SD 4.78 at aa 67-88, sequence
FT                   GGISEAARKSGLARQSIYRALS"
FT   CDS_pept        complement(4784..5065)
FT                   /transl_table=11
FT                   /gene="stbE"
FT                   /locus_tag="ROD_p2111"
FT                   /product="plasmid stability protein StbE (putative toxin)"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2111"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91832"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVA1"
FT                   /protein_id="CBG91832.1"
FT                   /translation="MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLH
FT                   GHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGRRESSEVYQIADMR"
FT   misc_feature    complement(4811..5053)
FT                   /note="HMMPfam hit to PF05016, Plasmid stabilization
FT                   system, score 4.7e-16"
FT                   /inference="protein motif:PFAM:PF05016"
FT   CDS_pept        complement(5055..5306)
FT                   /transl_table=11
FT                   /gene="stbD"
FT                   /locus_tag="ROD_p2121"
FT                   /product="plasmid stability protein StbD (putative
FT                   antitoxin)"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2121"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91833"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVA2"
FT                   /protein_id="CBG91833.1"
FT                   /translation="MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCV
FT                   PPKLYAYYRELAEDAELNAVADERMKNPEIVKVNLDDL"
FT   misc_feature    complement(5064..5285)
FT                   /note="HMMPfam hit to PF02604, Protein of unknown function
FT                   DUF172, score 2e-13"
FT                   /inference="protein motif:PFAM:PF02604"
FT   repeat_region   5251..5258
FT                   /note="(t)8"
FT   repeat_region   5445..5452
FT                   /note="(t)8"
FT   CDS_pept        5476..5661
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2131"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91834"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVA3"
FT                   /protein_id="CBG91834.1"
FT                   /translation="MYRTKRQSAIQGFSVSFWGGGITGSVDLCIVEMMWSHKSIGKRTY
FT                   HVDIKGILLKYEKILG"
FT   repeat_region   6225..6241
FT                   /note="putative iteron"
FT   repeat_region   6247..6263
FT                   /note="putative iteron"
FT   repeat_region   6281..6297
FT                   /note="putative iteron"
FT   repeat_region   6303..6319
FT                   /note="putative iteron"
FT   repeat_region   6325..6341
FT                   /note="putative iteron"
FT   repeat_region   6338..6354
FT                   /note="DR2"
FT   repeat_region   6364..6380
FT                   /note="DR2"
FT   repeat_region   6563..6579
FT                   /note="putative iteron"
FT   repeat_region   6598..6606
FT                   /note="(a)9"
FT   CDS_pept        6671..7678
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="ROD_p2141"
FT                   /product="plasmid replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2141"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91835"
FT                   /db_xref="GOA:D2TVA4"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVA4"
FT                   /protein_id="CBG91835.1"
FT                   /translation="MVLKNNKNSDCNDVQSLLAQGNQLLEGAYDITLIEMRLLYLALTK
FT                   IDSRKPQPANEYTLFAKEYRDTFSLDSKNCYEQLKSAASSLGSKPIVTYEWNEAKKRID
FT                   AVKRFWFSSIRYGVGNSESDITLRFSDSVSQYLYELKSEFTQMNLEHMVKLDTPFSFRL
FT                   YSWLYKYKNLNRNKKHSGVISTDPITIEWMKERTGLTGKYPVYKDFKKRVLDPAVDIIN
FT                   ANTNLSVTYEGIKSGRKIESVVFTYLVENETYDGKKIATKPLRPRLPSRPRVIKGSSAE
FT                   VAWAKKCIDVMKNYLISLREYDDKLKLSRPDLQKVKLWHEITGWDFEESFWFSD"
FT   misc_feature    6707..7411
FT                   /note="HMMPfam hit to PF01051, Initiator RepB protein,
FT                   score 2.6e-56"
FT                   /inference="protein motif:PFAM:PF01051"
FT   repeat_region   6967..6974
FT                   /note="(a)8"
FT   repeat_region   7438..7445
FT                   /note="(a)8"
FT   CDS_pept        7744..8148
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2151"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2151"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91836"
FT                   /db_xref="GOA:D2TVA5"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVA5"
FT                   /protein_id="CBG91836.1"
FT                   /translation="MKDNIVDFQRIRRDLGAHSTDVANDAVYSDKKKTSRFFYLLTPVR
FT                   YLLAAFLYLVVVIPLGILAGFRFLLQFLGGIAVMGLTIAWYMGADVSGYVVLAAWIALT
FT                   VCGCAEQIFEWWIESRFAFRLFGIGRTPEE"
FT   misc_feature    join(7852..7920,7933..8001,8014..8082)
FT                   /note="3 probable transmembrane helices predicted for
FT                   ROD_p2151 by TMHMM2.0 at aa 37-59, 64-86 and 91-113"
FT   misc_feature    8035..8067
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        8284..8811
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2161"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91837"
FT                   /db_xref="InterPro:IPR024402"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVA6"
FT                   /protein_id="CBG91837.1"
FT                   /translation="MIFNRNKKRDEQQNSSVVLPSTENVFSDFIKNNPALTTNAFTAIG
FT                   EVDCFTKVPLLSNKESEFLGILSRNIIPDYSVFPKIRLIEFVRPHGSEEAVKELIREVQ
FT                   NITCDFVLKSYDETVLAVIQFGETATVRQQKKKLIIQRVCAMTEISFFEFKNTVDMMGS
FT                   EDFCQFLRDDEE"
FT   repeat_region   8708..8715
FT                   /note="(gt)4"
FT   CDS_pept        complement(8874..9095)
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2171"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2171"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91838"
FT                   /db_xref="GOA:D2TVA7"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVA7"
FT                   /protein_id="CBG91838.1"
FT                   /translation="MINSIAFNLIALCIIYISSLFKKSNFRIFYITVSTCSLLLSCVPN
FT                   KYGMIGIAALVFTTMLGPLLIILEDNRQ"
FT   misc_feature    complement(join(8892..8951,8961..9014))
FT                   /note="2 probable transmembrane helices predicted for
FT                   ROD_p2171 by TMHMM2.0 at aa 20-37 and 41-60"
FT   misc_feature    complement(8970..9002)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   repeat_region   9044..9053
FT                   /note="(at)5"
FT   CDS_pept        complement(9118..9333)
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2181"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2181"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91839"
FT                   /db_xref="GOA:D2TV90"
FT                   /db_xref="UniProtKB/TrEMBL:D2TV90"
FT                   /protein_id="CBG91839.1"
FT                   /translation="MEHCIFDLGIINYHPVITWTVPVAFFFLVLLAGIVFNIGRKSNLI
FT                   VFILAMLLPVTTVFIFMLLGGKIDMC"
FT   misc_feature    complement(join(9136..9204,9223..9291))
FT                   /note="2 probable transmembrane helices predicted for
FT                   ROD_p2181 by TMHMM2.0 at aa 15-37 and 44-66"
FT   CDS_pept        complement(9383..9634)
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2191"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2191"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91840"
FT                   /db_xref="GOA:D2TVC1"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVC1"
FT                   /protein_id="CBG91840.1"
FT                   /translation="MLIKIIKSVFNFYMLCVQPVIGLVLAGYGAWKFSGDSISALLEPA
FT                   SYFVIGTVVLFVWYIAWQKERSKEEEFKSSIKPEDFVK"
FT   misc_feature    complement(join(9455..9514,9542..9610))
FT                   /note="2 probable transmembrane helices predicted for
FT                   ROD_p2191 by TMHMM2.0 at aa 9-31 and 41-60"
FT   CDS_pept        complement(9671..9973)
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2201"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91841"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVC2"
FT                   /protein_id="CBG91841.1"
FT                   /translation="MAKIPKKIDQEIKPLDLRQFVSSAAQKPASASAVTRINLTMTDDD
FT                   LDTAQEFQNKYGASRAEVIRAALAALRLVSAEERRRLFDDIRKNSPKAGRPTVNK"
FT   CDS_pept        complement(10139..10798)
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="ROD_p2211"
FT                   /product="putative plasmid partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2211"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91842"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVC3"
FT                   /protein_id="CBG91842.1"
FT                   /translation="MGKIITVAGHKGGIGKSTVLCSLCVCVIKKGKTACFLETDSQGSI
FT                   KDFIEDRKTNARLSEIPYFECYTDIPAMAQKLAARFDYVFVDTPGMKSPAFVKALSCAH
FT                   ILFTFIEPGSGIEINTLGRLVFDIKTAQAGVNPSMKAWIVLNKCSTNPSDSEASELRRQ
FT                   LNDDPDWLPVPRQRIYMRTAHKKAYNNGMGVHEYDDKRGNKARGEIELLLKETDIL"
FT   CDS_pept        complement(10903..11727)
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2221"
FT                   /product="resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2221"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91843"
FT                   /db_xref="GOA:D2TVC4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR016423"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVC4"
FT                   /protein_id="CBG91843.1"
FT                   /translation="MSHLPAKIFQISRSDAWNLTISPDAARNMRDLAAQIGAGMPKYLI
FT                   APEVSLLLSYIDDLSIRMYFETLWNTGARLNEALALKPADFMLTPTRQYPQPVVILKTL
FT                   KQRIKEAERRPGRPTTRHPPLHPDPRYRKPPEPAVRLVPVLDAGYALRMREYLATWKKR
FT                   IKHQPVWDITSRQTPLNWINTAVARAERDGVTFSVPVTPHTFRHSYAMHLTMSGVPPRV
FT                   LQSLLGHRYARSTEIYTRVFSLDVLTGSGLSFTCDPQLAKQLLGYPERINNE"
FT   misc_feature    complement(10984..11598)
FT                   /note="HMMPfam hit to PF00589, Integrase, catalytic core,
FT                   phage, score 2.8e-20"
FT                   /inference="protein motif:PFAM:PF00589"
FT   CDS_pept        complement(11770..12054)
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2231"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91844"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVC5"
FT                   /protein_id="CBG91844.1"
FT                   /translation="MMIMVASIIPAQTGHTAFSVQTLLVTTYTKFISFIWCSAPAYAPI
FT                   SWVIQDNFQISSCPAVHIRLDKNALSEKMSKIFFGDRNFYCRTHLCSRS"
FT   repeat_region   11818..11825
FT                   /note="(a)8"
FT   CDS_pept        12073..12552
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2241"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2241"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91845"
FT                   /db_xref="GOA:D2TVC6"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVC6"
FT                   /protein_id="CBG91845.1"
FT                   /translation="MATEWVDVADNAVKIGLGSLLTILGGWLTLKLTQKHELKKEAAVQ
FT                   GLKDKEIKTKRYVEFLALSQSLMQKYLYEQCEANNDDYLAYLRIHNEITITSGLAIRKA
FT                   AFKLQFDVSTFIFYNKIHDTELINALRDKARNSVSMFQAIVNEEICNGKFGTASQ"
FT   misc_feature    12109..12162
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD_p2241 by TMHMM2.0 at aa 13-30"
FT   CDS_pept        12991..13782
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2251"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2251"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91846"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVC7"
FT                   /protein_id="CBG91846.1"
FT                   /translation="MTKKTLAERFEVLEQEYNSVMSTKYMGTSAFSHRSQEYIDSAKGN
FT                   NWIARAKKLLEDSYGKESDYYKDFNDTQRIAWSSNYQGLVRHYKPIFDAARDDLTYSGT
FT                   ASTIATKHAELDLIINILNKFPAFCRQLKQRYNDRTPLEINDEYDVQDLVHALLLLHFN
FT                   DVRPEENSPSFAGSSSRQDFLLKKEKIVIEVKKTRRSLGANKIGEELLIDMARYRAHPD
FT                   CETLVCFVYDPEGWVTNPKGVIDDLEGKDTEGKTRVVIAQF"
FT   misc_feature    13735..13758
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(14086..14742)
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2261"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2261"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91847"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVC8"
FT                   /protein_id="CBG91847.1"
FT                   /translation="MMIKSKKVVVIFVALSSFLLAGCDSPKDANKQNFEKAINTRLEKE
FT                   CITISPLGIFDSKPYPVQVAVAQANRYTSQERADEINSRQFSALDVLVKADLLTVKDTL
FT                   VDDVIGFTKTGKKVPGREYALTDEGKKYLKSPERPDFCVGHYKVDEIVDFTEPGDAMGM
FT                   KITQVNYTFSPTSIAEWAKRDDVRAAFLGLESDLKEKQTKRITLVLKNDGWSAER"
FT   misc_feature    complement(14674..14706)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   sig_peptide     complement(14677..14742)
FT                   /note="Signal peptide predicted for ROD_p2261 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.995) with cleavage
FT                   site probability 0.921 between residues 22 and 23"
FT   CDS_pept        complement(14846..15310)
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2271"
FT                   /product="DNA-binding protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2271"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91848"
FT                   /db_xref="GOA:D2TVC9"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR027454"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVC9"
FT                   /protein_id="CBG91848.1"
FT                   /translation="MSELTKEDEYGIISRTMMNIRSLRVFAREIDFEQLLEMQEKLNVV
FT                   IEERREDAEREAAERQELEAKRQQAIEYIISLGLDPESLLAPVTADTVKTRRKAKGGVR
FT                   KAKYRFKDENGEIREWSGNGKRPLALQKLLDEGHFMEDFLIDKLQPGQVE"
FT   misc_feature    complement(14891..15223)
FT                   /note="HMMPfam hit to PF00816, Histone-like
FT                   nucleoid-structuring protein H-NS, score 6.7e-17"
FT                   /inference="protein motif:PFAM:PF00816"
FT   CDS_pept        complement(15326..15532)
FT                   /transl_table=11
FT                   /gene="hha"
FT                   /locus_tag="ROD_p2281"
FT                   /product="haemolysin expression modulating protein"
FT                   /note="67% ID to ROD49801 and 60% ID to ROD05151 in CR
FT                   chromosome"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2281"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91849"
FT                   /db_xref="InterPro:IPR007985"
FT                   /db_xref="InterPro:IPR036666"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVD0"
FT                   /protein_id="CBG91849.1"
FT                   /translation="MKTKQEWLFQLRKCTSRDTLEKVIEINRYKLPLSESEAFYSAADH
FT                   RRAELVMNKLYDKVPSGVWKYVH"
FT   misc_feature    complement(15338..15508)
FT                   /note="HMMPfam hit to PF05321, Haemolysin expression
FT                   modulating, score 7.1e-34"
FT                   /inference="protein motif:PFAM:PF05321"
FT   CDS_pept        complement(15529..17682)
FT                   /transl_table=11
FT                   /gene="topB2"
FT                   /locus_tag="ROD_p2291"
FT                   /product="DNA topoisomerase III"
FT                   /note="30-76% ID to ROD12951 in CR chromosome"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2291"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91850"
FT                   /db_xref="GOA:D2TVD1"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVD1"
FT                   /protein_id="CBG91850.1"
FT                   /translation="MRLFIAEKPAVANDIVKALGGNFTRHDGWFESDNAIVTNCFGHII
FT                   ESQPPENYNPEYKAWKVETLPLRLYPVKYQPVESAAKQVKTILELIRRGDVTEIVHAGD
FT                   PDDEGQLLVDEVLEYAGNTKPVKRVLINDNTLPAVKKALANLKDNRDFKGLYLKALARS
FT                   VADAVYGFSMTRAYTIPAQARGYQGVLSVGRVQTPVLGLIVNRTRANQNHKSSFYYTMT
FT                   GVFQRGADVIRANWKPGEFAPLTDRKLLDKAWADGTAASLAGKPATVEAAATDDKKTAA
FT                   PLPFNLVRLQQYMNKKFKMTAQKTLDITQQLREKYKAITYNRSDCSYLSDEQFSEAPQV
FT                   IDALKSVFPQSLDIDSARKSKAFNSAKVTAHTAIIPTASVPDVNALSTDERNVYLAIAQ
FT                   HYLVQFMPEKAYQEVSVAIQCGDESFCARARKTTDSGFEAFLGAETTDEGESEDNDDSA
FT                   FELLCKIRTGETVTTKEVVVNEKKTTPPPLFTEATLLAALVRVADFVTDPVIKKLLKDK
FT                   DRDKKDEHGGIGTPATRAAILETLKKRNYITLEKGKLIPTDTGYALIDALPGIAVNPDM
FT                   TALWSEKQTAIENGDLTVEEFINELYGELTGMISDVDLGEMKIEPAAPAGQFQRLDSPC
FT                   PSCGKHIVIRPKGYFCTGCEFKIWSEFSGKKITQAQAEKLVKSGKTDLINGFKKKNSGT
FT                   YDTVLVLEDKKTGKLGFPARAKK"
FT   misc_feature    complement(15694..15789)
FT                   /note="HMMPfam hit to PF01396, DNA topoisomerase, type IA,
FT                   zn finger, score 0.0092"
FT                   /inference="protein motif:PFAM:PF01396"
FT   misc_feature    complement(15973..17241)
FT                   /note="HMMPfam hit to PF01131, DNA topoisomerase, type IA,
FT                   central, score 3.4e-99"
FT                   /inference="protein motif:PFAM:PF01131"
FT   misc_feature    complement(17287..17682)
FT                   /note="HMMPfam hit to PF01751, TOPRIM, score 5.7e-12"
FT                   /inference="protein motif:PFAM:PF01751"
FT   CDS_pept        complement(17687..18262)
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2301"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2301"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91851"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVD2"
FT                   /protein_id="CBG91851.1"
FT                   /translation="MQYALFDGFERKFLLDALEFGVLKDWKENPVKELPDIDESAHPFH
FT                   VCYGGYLLNPGVSDSDISRKIKDQTGFWLAAIDDTRMDCHSIAYYDIHTLPVISCGHQK
FT                   IVPFAALIKADECIISKIASYSGFAVTAFLRIKDQDIATNILNREGIFAFNGCERRFRH
FT                   PVSEDNWQQAVSEERAIRCAKRLIQCKG"
FT   CDS_pept        complement(18273..18602)
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2311"
FT                   /product="conserved hypothetical plasmid protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2311"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91852"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVD3"
FT                   /protein_id="CBG91852.1"
FT                   /translation="MVTIIIGVSRVIDYKTAEMSVDIPPFPEWNSGHYIEIPGEGIVFT
FT                   GEKSDDGSRCYSGVIESHYSTDDWPFILSEYKNWLKDKERKFSYLFVLRNGELVHHEVN
FT                   KSELL"
FT   CDS_pept        complement(18623..19420)
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2321"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91853"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVD4"
FT                   /protein_id="CBG91853.1"
FT                   /translation="MCNFKGFSLNQRIKTMMTKHDKERFNKRIGGEVQISADIRVNDLM
FT                   TEGAAYVTVTESSLYERVCLYALQHGEDLQGMFKDEKYEYMSCFVRDVAAFRSNFESEE
FT                   PLKPLFNHDKGDTVEFVISVPEKRVEDYGDIVRKEFVDIIQKHVITINNKLWKKFVKQA
FT                   MTGTTLYIGFDINTGAMVDPEDERDTILKSSRQEFVRTTTFDSFQPYYYVERLYSGAKE
FT                   IGNINGFNVWFNERGFYFYWNEETEFLIESWLTFPAYPYGWFK"
FT   CDS_pept        complement(19654..20166)
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2331"
FT                   /product="putative partition-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2331"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91854"
FT                   /db_xref="GOA:D2TVD5"
FT                   /db_xref="InterPro:IPR002071"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVD5"
FT                   /protein_id="CBG91854.1"
FT                   /translation="MRILLSVILFLFTAFQSANAGGIPDALAGILSTFNQEIQGKVIRV
FT                   LDGDTIEVLQDKKPVRIRLANIDAPEKKQAFGRWSANQLKALLAGQSVTVSYTQTDRYG
FT                   RIIGRVFTTNGTDASRFMVQSGAAWVYERYNADESLPALQREAQEQKRGLWADTNPVPP
FT                   WEWRIRN"
FT   misc_feature    complement(19696..20061)
FT                   /note="HMMPfam hit to PF00565, Staphylococcus nuclease
FT                   (SNase-like), score 1.3e-47"
FT                   /inference="protein motif:PFAM:PF00565"
FT   misc_feature    complement(19954..20028)
FT                   /note="PS01123 Thermonuclease family signature 1."
FT                   /inference="protein motif:Prosite:PS01123"
FT   sig_peptide     complement(20107..20166)
FT                   /note="Signal peptide predicted for ROD_p2331 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.988 between residues 20 and 21"
FT   CDS_pept        complement(20163..20597)
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2341"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2341"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91855"
FT                   /db_xref="GOA:D2TVD6"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVD6"
FT                   /protein_id="CBG91855.1"
FT                   /translation="MMNKFSCVNRMLRQVFVFSFITTPSIALFVVFMFFLFNNSIAGSF
FT                   LKEARGLITDTPSDKVNVCLFEKGVPQDMELTNSTTEHVLKNKCITTLVDAADWQESVD
FT                   GSIRYFYWSSVVVGFVVWFTFNFSALEELFYRRNRKGDVE"
FT   misc_feature    complement(join(20208..20276,20484..20552))
FT                   /note="2 probable transmembrane helices predicted for
FT                   ROD_p2341 by TMHMM2.0 at aa 16-38 and 108-130"
FT   sig_peptide     complement(20472..20597)
FT                   /note="Signal peptide predicted for ROD_p2341 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.907) with cleavage
FT                   site probability 0.829 between residues 42 and 43"
FT   repeat_region   20491..20498
FT                   /note="(a)8"
FT   CDS_pept        complement(20669..21010)
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2351"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91856"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVD7"
FT                   /protein_id="CBG91856.1"
FT                   /translation="MSFLQAPDLIWSLQSATISLCQTFICRTIIMNVTRFVTAPSDINK
FT                   VKETHSDDELNRLLEAVNQNCPTRIVLGSVEKGKETPLMASCLRTTPERISVEEIDEIK
FT                   FIQNPSEQR"
FT   CDS_pept        complement(21272..22687)
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2361"
FT                   /product="putative exported protein"
FT                   /note="some similarity at C-terminus to STEC
FT                   autoagglutinating adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2361"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91857"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVD8"
FT                   /protein_id="CBG91857.1"
FT                   /translation="MKVTKSIIAILLCLSAGSAYADCEYHLTGNKETLNISDCVDGVKG
FT                   IANSALSNSQNAQNVANGAASTAQNAQSVANTAASTAQNAQTAANKAQTTANEANSAAQ
FT                   NAQNTANTAQNTANSANTVAQNAQSTANQAIKDAAEKAEAAEKNANNYTDNKITDAKNE
FT                   LNTNIDSAKNDAINSSNSYTDSKISDTKTELNASIDKAKNDAISSSNSYTDSKISDAKT
FT                   ELNANIDKAKNDAISSSNSYTDNKISDTKTELNASIDKAKNDAVSSSNSYTDSKISDTK
FT                   TELNASIDKAKNDAVSSSNSYTDSKISDTKTELNTNINNAKNEAISTSNNYTDKKYQQG
FT                   ISYTNEKYEQSIQYAQNAADKAELNANNYTDNRFSQLSNQSNQRFEQLNSKIERAEKRL
FT                   NAGIAGVTAISSIPYVAENSFSYGIGVGNYQNGNAIAAGIQYKTSLNTNVRLNVSWDSS
FT                   HNTVLGAGFAGGW"
FT   misc_feature    complement(21485..21517)
FT                   /note="HMMPfam hit to PF02524, RepA / Rep+ protein KID,
FT                   score 4.8"
FT                   /inference="protein motif:PFAM:PF02524"
FT   sig_peptide     complement(22625..22687)
FT                   /note="Signal peptide predicted for ROD_p2361 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 1.000 between residues 21 and 22"
FT   CDS_pept        complement(22788..23093)
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2371"
FT                   /product="putative conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2371"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91858"
FT                   /db_xref="InterPro:IPR009989"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVD9"
FT                   /protein_id="CBG91858.1"
FT                   /translation="MTGKNRVVLPALLALGLISTNANASDPCASVLCLYGKAVGQGGGS
FT                   ECRSAEKDFFNILKKKKGSIRWSKTFDARKAFLNQCSTADPAAISKIMSKFGRVRG"
FT   misc_feature    complement(22788..38447)
FT                   /note="Conjugative plasmid transfer locus. Similar to
FT                   region on Y. Enteriticola p29930 except Y. Ent is missing
FT                   taxB and taxC. also similar to E. coli IncX plasmid R6K
FT                   region. eex is found in a different location from these
FT                   plasmids."
FT   sig_peptide     complement(23022..23093)
FT                   /note="Signal peptide predicted for ROD_p2371 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.996 between residues 24 and 25"
FT   CDS_pept        complement(23077..23499)
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2381"
FT                   /product="putative conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2381"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91859"
FT                   /db_xref="InterPro:IPR025264"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVE0"
FT                   /protein_id="CBG91859.1"
FT                   /translation="MMKKLVFLLISILAGCSSPPEPTPVQFEKANEVINPSLPYVPDFH
FT                   GVIKSDVSGKGWVYEITSLSGVQARTPTFYYALAHADRIVVTTHDAGLWFRIRDLLKME
FT                   GATAVVEWRNEKSFLPEQGKIVFIKAQNEVKNDWKK"
FT   misc_feature    complement(23452..23484)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(23508..25370)
FT                   /transl_table=11
FT                   /gene="taxB"
FT                   /locus_tag="ROD_p2391"
FT                   /product="putative conjugal transfer coupling protein TaxB"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2391"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91860"
FT                   /db_xref="GOA:D2TVE1"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVE1"
FT                   /protein_id="CBG91860.1"
FT                   /translation="MKTFNKSQSVFIFAVMLVAAWFAGSFIFFVLYFSQIKNLKPLKAV
FT                   FRSIDAYRMDIFTDSLTLSVVTTDIRVLAFVALGAGFVVSLIIPVAALIKLNEKKDNIF
FT                   GDARFATTNDIRESNSFTLDGDEKDGIIVGIKDKKIIRYVGAAFSAMGAGTRAGKGAGI
FT                   VITNLMKYWWSVIILDPKRECFNITSLIRKVILGHEVYKFDPFSPVTHRFNPLYYVSMG
FT                   TSEGFNQLENLALIIYPYKTDGADAGSYLNKTAGGVFKSYAVALWFMIKNDKAGLKTLD
FT                   IEPVFSMSKINQLFERAEPEHLLSFMNDIRSELRGKDKTLADIGVAGLKAFIEMEDKTK
FT                   AQLKSNFLNGLSPFANPNVANATDGNDFDLRQVRKKRMTIYFCISGDNARLAEKITNIF
FT                   FQLAIQVNLEKMPTDDPEIKHDCLFLLDEFPSIGAVDYIKSKSGLIAGYKLKLLIVYQV
FT                   GSQLEEIYSYAGSKTLLASAPCKIVYSASDVKDARELSEAMGTRTVTIGSKSKSRSRGG
FT                   TSRSESESLIERPLVTTNELLTLKFSEEILAMKGENPIRCEKAFYYLHEYFFGDFVKVA
FT                   PELANIFPRKKGKLVMPPQKVFENEIVAKGYLAVKEVPDLDKAA"
FT   misc_feature    complement(23601..25049)
FT                   /note="HMMPfam hit to PF02534, TRAG protein, score 2.6e-92"
FT                   /inference="protein motif:PFAM:PF02534"
FT   misc_feature    complement(join(25089..25157,25275..25343))
FT                   /note="2 probable transmembrane helices predicted for
FT                   ROD_p2391 by TMHMM2.0 at aa 10-32 and 72-94"
FT   sig_peptide     complement(25269..25370)
FT                   /note="Signal peptide predicted for ROD_p2391 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.918) with cleavage
FT                   site probability 0.715 between residues 34 and 35"
FT   CDS_pept        complement(25357..26385)
FT                   /transl_table=11
FT                   /gene="triJ"
FT                   /locus_tag="ROD_p2401"
FT                   /product="putative conjugal transfer protein TriJ"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2401"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91861"
FT                   /db_xref="GOA:D2TVE2"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014155"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVE2"
FT                   /protein_id="CBG91861.1"
FT                   /translation="MSGVIPVSISNKSLDFYKNQVFQSFLDIEGLTEIAVNRPGEIWTE
FT                   INGDWTFHNNDGVTFDFCKRFSQTLASFRGDEIGDTKPLLSATLESGERVQVVFPPACE
FT                   RNTISITIRKPSTRQITHKEYVANGFYDYVQSGKKHRTYDDELLDLFRARNIAAFMELA
FT                   VAAGKTIVFAGATGSGKTTYMKSLIDFIPLNTRLITIEDAEEIKFFIHKNYVHLFYPSE
FT                   SGSDSGSIITAAKLIKSCLRMKPDRILLAEIKGGDAWDFVKVAGSGHSGSMTSIHAASA
FT                   KDAIIQMVTKCYQNRECQNLPFDVLRKIIMDSIDIVVHVGRDGVVRHMSDIYYKGAECE
FT                   NF"
FT   misc_feature    complement(25414..26364)
FT                   /note="HMMPfam hit to PF00437, Bacterial type II secretion
FT                   system protein E, score 1.1e-56"
FT                   /inference="protein motif:PFAM:PF00437"
FT   misc_feature    complement(25843..25866)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(26387..27505)
FT                   /transl_table=11
FT                   /gene="triI"
FT                   /locus_tag="ROD_p2411"
FT                   /product="putative conjugal transfer protein TriI"
FT                   /note="Note the different N-terminal compared to Y.ent
FT                   cryptic plasmid TriI"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2411"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91862"
FT                   /db_xref="GOA:D2TVE3"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVE3"
FT                   /protein_id="CBG91862.1"
FT                   /translation="MTDMKKTDDLVDDANQSKLESKPVHDIGDIRNKNNRMRSGFLFGL
FT                   MAVLVIGIFALKTYKNYFADDQQKASELTGDTSISQVSKIRTGLGQNFDPVENKAIINP
FT                   GATGSGNTVSDGHKEVPQEGFRKYLSIPVAGQGGSQTGASGSSRTSQTSEPQEERKESK
FT                   ENVPGKSGMKVTAINLDPDLYIEENRLIPCALTTRFVSDVAGRISCVFTEDVWSANHHT
FT                   KLLEQGTKAFGRYQTGTLNHGQGRMFVMWEQLRTPDNKRIDMVNTAAAGPLGEAGIDGW
FT                   IDSHFWERFGGSLMLSMVQDVAAAAADNAPGKDRNVDYTENSRQAMAEMAKVALENSIN
FT                   IPPTMYKNQGDIITIMVGEDIDFSDIYELKVK"
FT   misc_feature    complement(26402..26953)
FT                   /note="HMMPfam hit to PF03743, Bacterial conjugation
FT                   TrbI-like protein, score 5.7e-80"
FT                   /inference="protein motif:PFAM:PF03743"
FT   repeat_region   26584..26598
FT                   /note="(ccg)5"
FT   misc_feature    complement(27338..27391)
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD_p2411 by TMHMM2.0 at aa 39-56"
FT   CDS_pept        complement(27498..28406)
FT                   /transl_table=11
FT                   /gene="triH"
FT                   /locus_tag="ROD_p2421"
FT                   /product="putative conjugal transfer protein TriH"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2421"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91863"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR014148"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVE4"
FT                   /protein_id="CBG91863.1"
FT                   /translation="MMKKLFIATCLLLPGLVYSAATPLPSGFDARMQTVSYNGANTTVI
FT                   RSKTGFLTSVVFDEGEAVISAKAGFPAGWEITTDDNVVYINPRPVVQEQEGDEGEKLKK
FT                   VFQPTEKEWDTNLFVRTTKRIYSLDLILLSEEKQAQPAYVVQFRYPSEIAKKNAEEVRL
FT                   AKEKQEKLRQKKLISESFEKADAPKNWDYFMRVNEKYDSRRIAPDFAYDNGIFTFLGFN
FT                   SGKVFPAPFAVRDGQEQTLAFNVETKGKYKIMVIHNVNDKFVLRYGNSVVGVVNKSFGK
FT                   VLTDQRNTSSPAVERVEVNND"
FT   misc_feature    complement(27573..28322)
FT                   /note="HMMPfam hit to PF03524, Conjugal transfer protein
FT                   TrbG/VirB9/CagX, score 3.8e-26"
FT                   /inference="protein motif:PFAM:PF03524"
FT   misc_feature    complement(28326..28394)
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD_p2421 by TMHMM2.0 at aa 5-27"
FT   sig_peptide     complement(28350..28406)
FT                   /note="Signal peptide predicted for ROD_p2421 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.779 between residues 19 and 20"
FT   CDS_pept        complement(28403..29089)
FT                   /transl_table=11
FT                   /gene="triG"
FT                   /locus_tag="ROD_p2431"
FT                   /product="putative conjugal transfer protein TriG"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2431"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91864"
FT                   /db_xref="GOA:D2TVA8"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR026264"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVA8"
FT                   /protein_id="CBG91864.1"
FT                   /translation="MSEKIEKKIETAKSFERQLYAENERSKKNAWRVAVAASLLSLCLG
FT                   AAICVLVPLKEKELAIVAVGEKTGRTELITQVKQEKILQSEALGRYFVNTYITLREGYN
FT                   YPSLQYDYETVQLYSSNTVKDDYLRLYNSDMAPDKIYHNNGSYVAVEVISNIISDATAP
FT                   DKLASVRFKKTTRNFTTGQVSVSYWTARVTYRFEPEKSVKSSSRELNPLGFTVTSYQTD
FT                   REVRGE"
FT   misc_feature    complement(28424..28948)
FT                   /note="HMMPfam hit to PF04335, VirB8, score 1.8e-48"
FT                   /inference="protein motif:PFAM:PF04335"
FT   misc_feature    complement(28934..29002)
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD_p2431 by TMHMM2.0 at aa 30-52"
FT   CDS_pept        complement(29082..29210)
FT                   /transl_table=11
FT                   /gene="triF"
FT                   /locus_tag="ROD_p2441"
FT                   /product="putative conjugal transfer protein TriF"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2441"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91865"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVA9"
FT                   /protein_id="CBG91865.1"
FT                   /translation="MRCVILLFFLFQISGCTTRNTLPSDVSGELEPINHSQVISYE"
FT   repeat_region   29583..29590
FT                   /note="(a)8"
FT   CDS_pept        complement(29604..30683)
FT                   /transl_table=11
FT                   /gene="triE"
FT                   /locus_tag="ROD_p2451"
FT                   /product="putative conjugal transfer protein TriE"
FT                   /note="Note the different C-terminal from Y.ent cryptic
FT                   plasmid TriE"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2451"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91866"
FT                   /db_xref="GOA:D2TVB0"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVB0"
FT                   /protein_id="CBG91866.1"
FT                   /translation="MSFFVKYNTTVMEAIDKVGSTYQSQFTQDIMSLVTASVTLYVLWK
FT                   GYQILASKTQTPMQDLVWDLSKFAIIIMFITNADGYLTAATNALQGMKDGLSGGVSAWQ
FT                   TLDNLWEKTQNLAEKVYQKDTDFIPLAGALGMTLVWAGSLILMTISAVVFLTADITMKF
FT                   LIITAPIFIFCLMFGFIRVMFNNWLQSLFSSILTVLFASLVIRIAMDFQGDILQQVSNA
FT                   TPNSNVMTVSAMGFLAGLLGALLVLIAKSFAVQLAGAGVEGAVQGAAMMGLGAAGMATG
FT                   KSLMLGGRAGLGFGLGMAGRTGMNSLSGKAGNLMGRGARTAAEWAGEKGYQALAPTGAL
FT                   GMKARRLASLEKARARNAA"
FT   misc_feature    complement(29835..29858)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(29889..30590)
FT                   /note="HMMPfam hit to PF04610, TrbL/VirB6 plasmid conjugal
FT                   transfer protein, score 1.3e-55"
FT                   /inference="protein motif:PFAM:PF04610"
FT   misc_feature    complement(join(29940..29999,30057..30125,30144..30209,
FT                   30237..30305))
FT                   /note="4 probable transmembrane helices predicted for
FT                   ROD_p2451 by TMHMM2.0 at aa 127-149, 159-180, 187-209 and
FT                   229-248"
FT   CDS_pept        complement(join(30694..31047,32114..32461))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="triD"
FT                   /locus_tag="ROD_p2461"
FT                   /product="putative conjugal transfer protein TriD
FT                   (pseudogene)"
FT                   /note="pseudogene, disrupted by IS102 insertion"
FT                   /db_xref="PSEUDO:CBG91867.1"
FT   misc_feature    complement(join(30715..31047,32114..32461))
FT                   /note="HMMPfam hit to PF07996, Type IV secretion system,
FT                   score 0.00035"
FT                   /inference="protein motif:PFAM:PF07996"
FT   repeat_region   31048..31056
FT                   /note="9 bp direct repeat flanking IS102"
FT   repeat_region   31057..31074
FT                   /note="18 bp inverted repeat of IS102"
FT   repeat_region   31057..32113
FT                   /note="Insertion sequence IS102. 100% ID to IS102 from E.
FT                   coli pSC101 (IS5 family). Has 18 bp perfect inverted
FT                   repeats and is flanked by 9 bp direct repeats. CR
FT                   chromosome contains an additional 12 identical IS102
FT                   elements"
FT   CDS_pept        31089..32057
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2471"
FT                   /product="IS102 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2471"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91868"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D2TIM3"
FT                   /protein_id="CBG91868.1"
FT                   /translation="MKDQITHPPDNTDHSVAKQKFRITNWSTYNKALINRGSLTFWLDD
FT                   EAIQAWYESATPSSRGRPQRYSDLAITTVLVIKRVFRLTLRAAQGFIDSIFALMNVPLR
FT                   CPDYTSVSKRAKSVNVSFKTSTRGEIAHLVIDSTGLKVFGEGEWKVRKHGKERRRIWRK
FT                   LHLAVDSNTHEVVCADLSLNNVTDSEAFPGLIRQTHRKIRAAAADGAYDTRLCHDELRR
FT                   KKISALIPPRKGAGYWPGEYADRNRAVANQRMTGSNARWKWTTDYNRRSIAETAMYRVK
FT                   QLFGGSLTLRDYDGQVAEAMALVRALNKMTKAGMPESVRIA"
FT   misc_feature    31482..32021
FT                   /note="HMMPfam hit to PF01609, Transposase, IS4-like, score
FT                   9.3e-30"
FT                   /inference="protein motif:PFAM:PF01609"
FT   repeat_region   complement(32096..32113)
FT                   /note="18 bp inverted repeat of IS102"
FT   repeat_region   32114..32122
FT                   /note="9 bp direct repeat flanking IS102"
FT   CDS_pept        complement(32473..35220)
FT                   /transl_table=11
FT                   /gene="triC"
FT                   /locus_tag="ROD_p2481"
FT                   /product="putative conjugal transfer protein TriC"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2481"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91869"
FT                   /db_xref="GOA:D2TVB3"
FT                   /db_xref="InterPro:IPR004346"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVB3"
FT                   /protein_id="CBG91869.1"
FT                   /translation="MSTLYKAMTRPAMYVGVPVVPLTVVAGALFLAGVYISKLIWLAIP
FT                   VAVFILRMITKQDDHIFNLYFLKLKMLGNSVCNRFFGARAFLSGQYEAVEIDEFINAMK
FT                   LNERITTGKYIPYSSHVDKNIVKTKNGDYVATWQLMGINFESISAEMLETIDSQVATLV
FT                   RSFSGLPVSFYNHSCRASFYDAFTTKSGNKYADIISDCYYGSMKKNKFKGNTLYFTLIY
FT                   RPDGRVEKLEKRKKSIKEKKDDINIHVKRMNEMINTFSGALDKFTCKLLGMYEENGKVF
FT                   SSQLSFYNYLLTGKLQKIRVTDSPVYNVLGGVDVFFNHDTGQICRIDGNKFFRSIEIKD
FT                   FCSETASGVFDVLQYSDADYIITHSYTSMSKSEALSTIKRAEKQLKSTEDDAVTQLQEL
FT                   EKAKNDIVSGDISFGYYHFTLMVMADSIRELDESVSKITADFTDLGIIPALSTMSLPAA
FT                   YFAQLPAVFHLRPRLSPVSNVNFVELASFHNFYQGKRDKNCWTEAVAILKTPSKQAYYL
FT                   NLHNSVLFKDERGEKNLANTKVIGTAGSGKTMFLSYLACSLQKYNNPETFADSAKNKKL
FT                   TCVFLDKDRGAELCIRMLGGEYYTVKSGEPTGWNPFALEATKRNRIFVKQLMEILCTRN
FT                   GERLSTRERLLISESVDAVMDFPPGEMREYGITRMLEHLMQRDDRDEQENGIILRLSQW
FT                   ANGQAHGWVFDNAKDTFNIQHVNNFGIDGTEFLDDPMVCAPITFYLLYRITQLLDGRRL
FT                   VIFLDEFWKWLQDEAFSDFVYNKLKTIRKLNGLVIPATQSPDEILKNKISRAVVEVCST
FT                   SIYLANPDADYNDYVEGLKLTPEEFNIVKNLDPMSRQFLIKKSSLKKGDGKSFSALATL
FT                   DLSGLGGYLKILSASADNLEIFESIYHEGMEPDDWVPEYLERAI"
FT   misc_feature    complement(33577..33600)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(33805..34416)
FT                   /note="HMMPfam hit to PF03135, CagE, TrbE, VirB component
FT                   of type IV transporter system, score 4e-54"
FT                   /inference="protein motif:PFAM:PF03135"
FT   misc_feature    complement(34957..35214)
FT                   /note="HMMPfam hit to PF05101, Type IV secretory pathway,
FT                   VirB3-like, score 9.1e-19"
FT                   /inference="protein motif:PFAM:PF05101"
FT   misc_feature    complement(35116..35184)
FT                   /note="1 probable transmembrane helix predicted for
FT                   ROD_p2481 by TMHMM2.0 at aa 13-35"
FT   CDS_pept        complement(35239..35565)
FT                   /transl_table=11
FT                   /gene="triB"
FT                   /locus_tag="ROD_p2491"
FT                   /product="putative conjugal transfer protein TriB"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2491"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91870"
FT                   /db_xref="GOA:D2TVB4"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVB4"
FT                   /protein_id="CBG91870.1"
FT                   /translation="MSFKKSVCNRISSSVTAVMQRKNKVVMAVAGATVASPAFADGFSK
FT                   AETLLEKVKTGLSGLSLVTVTIACLWVGYKVLFGGSTIRECSPIIIGAIVIASAAEVAS
FT                   MMVN"
FT   misc_feature    complement(join(35245..35304,35323..35391,35434..35493))
FT                   /note="3 probable transmembrane helices predicted for
FT                   ROD_p2491 by TMHMM2.0 at aa 19-38, 53-75 and 82-101"
FT   misc_feature    complement(35359..35391)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   sig_peptide     complement(35446..35547)
FT                   /note="Signal peptide predicted for ROD_p2491 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 1.000 between residues 34 and 35"
FT   CDS_pept        complement(35579..36199)
FT                   /transl_table=11
FT                   /gene="triA"
FT                   /locus_tag="ROD_p2501"
FT                   /product="putative conjugal transfer protein TriA"
FT                   /note="Note the differnt C-terminal from Y.ent cryptic
FT                   plasmid TriA"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2501"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91871"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVB5"
FT                   /protein_id="CBG91871.1"
FT                   /translation="MASLFPALLLCAASVHPDTINDIARVESGFNPYAVAEIIPERERG
FT                   SYGKSFISHMPKSKEEALTVIREIENRKRRYSVGLMQITSSNFSFYSTSAEKLLDPCEN
FT                   LSVFEKIIVDCYKRGRSLENALSCYYTGNFSNGKRKEKEFNNTSYVERIGYTGNEKKYV
FT                   VPGTRSNGGEQRKNRSHNASVIWPETILKSAFVDNSHPTKVIN"
FT   repeat_region   35717..35724
FT                   /note="(t)8"
FT   misc_feature    complement(35744..36190)
FT                   /note="HMMPfam hit to PF01464, Lytic transglycosylase-like,
FT                   catalytic, score 1.6e-05"
FT                   /inference="protein motif:PFAM:PF01464"
FT   CDS_pept        complement(36637..36870)
FT                   /transl_table=11
FT                   /gene="eex"
FT                   /locus_tag="ROD_p2511"
FT                   /product="putative surface exclusion lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2511"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91872"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVB6"
FT                   /protein_id="CBG91872.1"
FT                   /translation="MSYMKKTRILSLVLFSIALSGCGEEIKTVDWWRNHPEEAISKVEE
FT                   CKKSGDVSDNCKNAKTALYKNQQQDAPVPQIN"
FT   sig_peptide     complement(36802..36870)
FT                   /note="Signal peptide predicted for ROD_p2511 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.974) with cleavage
FT                   site probability 0.888 between residues 23 and 24"
FT   misc_feature    complement(36805..36837)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(36875..37141)
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2521"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91873"
FT                   /db_xref="GOA:D2TVB7"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVB7"
FT                   /protein_id="CBG91873.1"
FT                   /translation="MTKHDAIRISQLHQIFPEVQLTERQKDIAVMYVIGCTVEEIASEK
FT                   GITTDGVMYHLNLVKRAVGSATLVGVRTTAFLRMMAILLTRES"
FT   CDS_pept        complement(37218..38447)
FT                   /transl_table=11
FT                   /gene="taxC"
FT                   /locus_tag="ROD_p2531"
FT                   /product="putative DNA relaxase/nickase TaxC"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2531"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91874"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVB8"
FT                   /protein_id="CBG91874.1"
FT                   /translation="MGVYVEQEYRIKRAKGTGRDPKSPKLSGRHIHASKSAFNHKVRHG
FT                   TDKKAYTWTPTKEVTFKITGSGKTAAGIKNGIDYITRNGELEAYCYDGKGSEQTGKGED
FT                   FNREFTSTLSKGNDYSRTYRGENIDHVKNMVFSPPPEAGVSREDALKATIEFLKETYPN
FT                   HAFVAVYHDDKEDHPHVHVNIKLRDEETGRRLRLTKSETRKFRNGFHRKLKGMGYDVTA
FT                   TWKKDPERKREIERLQAENPKRLRNVYKVVDFGETSYQNKAGEKRTPFLTYETLKGGKQ
FT                   VTIWGKDLKNHFESEKLQPGTLIKVKKLAPTLVRSPMFNDDGTVAGYRETHRNNWQIEN
FT                   IALERNRERQVHERETRQPEESDVKKQLSRKHEQGHNIGFALEHGFTKDSEEHKKLRIQ
FT                   QERNWKGLGF"
FT   misc_feature    complement(37467..38252)
FT                   /note="HMMPfam hit to PF03432, Endonuclease relaxase,
FT                   MobA/VirD2, score 0.00069"
FT                   /inference="protein motif:PFAM:PF03432"
FT   CDS_pept        complement(38451..38954)
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2541"
FT                   /product="conserved hypothetical plasmid protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2541"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91875"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVB9"
FT                   /protein_id="CBG91875.1"
FT                   /translation="MKMIAFRLSDDELKLAEHNAISSGFTSINTFARHNVLNVDVQPSN
FT                   IPVSNESSKAVKTCLYPHEIELVKRNAALHGMSMSREIAIRVRQSLLKNEVCLYPDEVK
FT                   ELKKLSTAVDRVGRNIHFIIKGERFCTVNDPDFRKDVVEVIELCKQIDSKLETLTKSVV
FT                   NRFG"
FT   CDS_pept        complement(38958..39158)
FT                   /transl_table=11
FT                   /locus_tag="ROD_p2551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_p2551"
FT                   /db_xref="EnsemblGenomes-Tr:CBG91876"
FT                   /db_xref="UniProtKB/TrEMBL:D2TVC0"
FT                   /protein_id="CBG91876.1"
FT                   /translation="MPDGRRRKNLSATKSGHMQRRFYSQAQCHIWYNQCRIDNHGQNVN
FT                   ILSMIVQKRCFCLCLPQALLG"
XX
SQ   Sequence 39265 BP; 10952 A; 8835 C; 7558 G; 11920 T; 0 other;
     ccggcgcaaa gcgcctccca tgcccttaca gggcataaaa aaacaagggc aattaagccc        60
     ctgcgcgatg attgctgact tctttttcca gagccttatt aacaaaggca ttcaacgata       120
     agtcttcttc catcgccatt tctgctaccc gacgatgcag ttctggatca agcctgacgt       180
     taaacacgcc tttaaacggg gtatcaggtt cctttccatc ctccacacaa gactgtaaat       240
     acagatcaac agatgtttta aactcctgtt ccagttcagc taatgtagaa gcctcataag       300
     ttaccaggtc ccgaataaac gccagttttc catacaggac attattttca aaatcgggtt       360
     caaccgtgcc taaatatcct ttatatttta aatgtttcat aataatccag cctctttcag       420
     attctgttta attgctttca gcgtaccacc tttgatataa ctttccggat gtggacgatg       480
     cattaatatg gtgtgattga tttcagcatt gaaaaaccgc actcttgacc cctgcatttc       540
     ctttttgaca tatcccaaag aggaaaacaa aacgaccagt tcatcccatt caaacgtttt       600
     tttactgttt aaaaactttg ccagtagctt atctgttttc cccataaatc catcccctat       660
     agatatgcaa ctaattatag ttacacatag catttttgtc aaaaaataca aagggggcag       720
     aaagcccctt tttttattta aaacatttca tacccttgca ggtagtttaa ccaccaccgg       780
     aattgatccc attcactaaa tttcattgcc gggattctgg tttcccagcc tttgacaagg       840
     gaatcagcaa gctgtacgat ctgctgcgtt gacatttaaa aacctcattc agttttgatt       900
     gtcgataacg tgatcaggtt ggtggaacaa cctgatcaca ccttgaatag tcagtcatta       960
     ccctccttct tttctatagt tactgtgtat ccgtaaaggg tcaaaatgcg ataagcatcc      1020
     aacgcctcac gctcactttt aaatgttctg acttcgtgta atccattccc tttatcaagg      1080
     gatacacaaa actcataatc ttcttctact tctatctttt taattaattt atcaagttcg      1140
     gctaatgttc gttttggctc aaaaagaaat gtgcattgta caatggcgtt taaatcttcc      1200
     cgatcaagct ctaacagagc atcattataa gcagctttaa aacagcgatt attacgcaga      1260
     tcagatgcaa actgcattgc ggcttgtttt aacgttttca tgaatttccc ttgcattgat      1320
     gttaatagac aatttcagaa tcaatattga aatttccaga aaatgcaggg ttcccccctg      1380
     catttataat gcttaacgaa ggcactcaat aaaatcttta aaactcaagc attcatcgcc      1440
     atcttttagc gaatcaaaat atttttcata ttcgtccctg tagaaaagga ctaaatcaac      1500
     atcactctgc ttaagttcgc caaactgagg aacaattccg gttttatagt cacgaatttt      1560
     attgttatca gtaaatatga caacatactg ttgtcccgta tccttatgca taaggataat      1620
     agtgcaaagc gttactcgtt cgaatgtgaa aacatgatta gtggttgaag taaaaacaga      1680
     tgagcatttc attttaaatc tcctgccctg ctgggctatt gtgagagggg ccattcccct      1740
     ttcgatgaaa caataatacg actttcaagt cgcacctgca agtgttctcc cgttttttta      1800
     ctcgataagt gattgttatc acgtttttta atccgcgtaa gcggatggaa ggggcgaacg      1860
     aaaataccag ggcagcacag gagccacatc gccccgaagc gcggcgcagc cgctgatgaa      1920
     cgtaccaggg cgcacaggac atcccttcac cctgcaaagc ccaactgacc agcaggctat      1980
     gattatgctg atttgcgccg cagaatgccg cagttagcgc gagcgcaagc gagtttaccc      2040
     cgccctggtg cattgcagca tggcggggcg ctgtactgcg cgtgtgagcg tcagcgagct      2100
     acgggcgcaa ctccaggtac taatataaaa ccatcacagg tcattttatt ttgactccct      2160
     tttgcagagc acgtattcag gatgttctcc tgcaagtaac aaaagaaact caaactcaac      2220
     cagtgacaga ctttgactgt tttgagtatt aacctcctct tttttctgcc aggttcttag      2280
     cccaacacca taaatatgac tgcattcttt ctgtgttaat cctgctttta aacgtaattt      2340
     ttttacattt tcaggtgtat tatcgggttt catttaacat aaactcctta attaaattct      2400
     taactggcgt ctcatcgtct tcccttaatc cggcacacgt aaaatcaata tgttgtaatt      2460
     cattctcatt cagtacggca tcatacaatg taattttcgt agttttgttc ccgattttaa      2520
     catttgttct ggcttttatc ctttttgtaa gcctgtaatt gtcaccttct ttttcaagaa      2580
     aataagtcac atcaccttta ttttttctca taactgtttc aaataccctg taattttaac      2640
     aagttgatct atactcaagc cccgaatctg taaatcataa ctgtcgccct gttcggtgac      2700
     tttaccgttc aatccgtttt cagctttaaa gcctatcaat gccccatacc agctttcaag      2760
     ctggacaagt tgcgataaca tacctttcag gatcagaatt tcgtcctttt tttccacctg      2820
     gtgtttctca tactcaatcg cctgtaacac ctcctgcgaa gcatttacca gaatttttcg      2880
     ctcgatatcg gctgcaatat caacgggatt ccgttttctg gataacgtgc aaacatgatg      2940
     cggactacgc caggagcgac tatccacact ccccacaaca gaaaaccggc ctttttccat      3000
     ccgaatatgc acagagtaat ttttaaactg cggtgacgtc agttttatac gagacgaaca      3060
     atcatcaagt ttgttcacgc gccagccgtt ccccaggata cggcagacaa cttcaaagac      3120
     agggtgatat tgttcaaaaa aagagttcat ctgtttccct ttttgctacg tggctgctgt      3180
     tcccgtcttt ttgggttcga tgccccaaaa gacgggctgg ctataatatc gggggcttct      3240
     cgcccccgtt ctggttacgc tctggtttcc acgcgttgcc accctgtcgc cctgcgctgt      3300
     ccggttgtac cgtattttgc gcggatttct tctatcgtgt gttcttcacg attccagtaa      3360
     cttttatgtt cgtctggacg ataaaaccat tgttttttct ttgccgccca tttacacccg      3420
     atttctttca aagtttcctt atgtgtaagg gtttctccac taatccagac ccagttacct      3480
     atcacttcaa ataccagacc agataaacca gaaagaacat ttaatacttt ttccaggtca      3540
     tcaccgtaat tatatcgtgc atgttcatca gtgctctgga actgatttat tttatcaata      3600
     tttgccatca atacatcaaa agctgcattt accgctttca tcagttcagc ccctaacggg      3660
     ttacgatctg gatgatattt taaagcggct tttctgtatg ctgctttgat atctttttca      3720
     gttaattcgc cggataatcc aaaaacgttt aatgcttcct ggatattcat tttttaaatc      3780
     tcctgccctg ctgggctatt gtgagagggg ccattcccct ttcgatgaaa caataatacg      3840
     actttcaagt cgcacctgca agtgttctcc cgttttttta ctcgataagt gattgttatc      3900
     acgtttttta atccgcgtaa gcggatggaa ggggcgaacg aaaataccag ggcagcacag      3960
     gagccacatc gccccgaagc gcggcgcagc cgctgatgaa cgtaccaggg cgcacaggac      4020
     atcccttcac cctgcaaagc ccaactgacc agcaggctat gattatgctg atttgcgccg      4080
     cagaatgccg cagttagcgc gagcgcaagc gagtttaccc cgccctggtg cattgcagca      4140
     tggcggggcg ctgtactgcg cgtgtgagcg tcagcgagct acgggcgcaa cgcgccagaa      4200
     tctgctctat gttaatgcta atgtatgcat acattagcat taacacacgc atctatcgca      4260
     tcgcctttgg atgtgtatta atacacacca ttaaactatt accagtacgc aattgtacga      4320
     tttgccgatt aaatacaggt gaacgtcggg cgggataact gcggttttga tggcatggaa      4380
     attcccccgc ttagggggaa ctggagagat tagtggctgg atttactgag agtgaactgt      4440
     aatccggcta ccgatgtaag ttgtgcaagc gttgtgatgg tcgggttacc gttgggggat      4500
     aatgcgcggt aaatactctg acgggcaagg ccagatttcc tggcagcttc ggaaatcccc      4560
     cctcgcgcct cgattacctg acgtagcgca acaagaaaac cacctaaacc accaggctcg      4620
     tttatttctt ccagggcatt agcaagataa gcatttgcat aatcaggatc tgcacgtagt      4680
     tcttcaatca tggcggcgtt gtgctcaacg gctgccggat aatgattttt ctgcgacttc      4740
     acattttcgt catatgccat ttccacaaca ctctctaaaa aattcagcgc atatctgcga      4800
     tctgatagac ttcgctgctt tcccttcttc caacggcaat aacaagtaaa acgactttct      4860
     catcaatgac ttgatataca agtctgtagc cagatgcacg aagtttgatt ttatagcgat      4920
     cagcatgacc atgtaaccgg gctgcgggta cgcgtggatt ttccagccgt tctgccagtt      4980
     tctttttgaa ttgttcacgg atggtgtggc cgagtttctg ccattccttc agtgctctgc      5040
     ggtcaaaagc cagttcatag gtcatccagg ttaaccttca caatttccgg gtttttcatg      5100
     cgctcatcag caacagcgtt taactcagca tcttcagcga gttcccgata gtaggcgtaa      5160
     agttttggtg gaacgcaata gaacgccggt tcgtttcggt tcaggatcgc aacagcgtcc      5220
     ccttcacctt cagctacggt tcccatagga ttttttttca ggtcagtaat actggccgct      5280
     gtggttgtca gaatttgata gctcataagc cctccgcttg tctcattggc ataatagcat      5340
     ctttaaaagc actcttaaaa gtgcttatta aaaaacatca gaacaggtga gatatggctc      5400
     tttccgacat cgccttaaaa cgctctgtaa cgcgttctaa gtgatttttt ttattttgca      5460
     tggtttccct catggttgta ccgaacgaag cggcagagcg cgattcaggg cttctctgtg      5520
     tcattttggg gagggggcat tactggatct gttgatttat gtatcgttga aatgatgtgg      5580
     tcacataaat caattggcaa aagaacatat catgttgata ttaaaggtat tttattgaaa      5640
     tatgagaaga tcctcggtta gcaaaatgag gatcataatt aaaagaactc tttcatagta      5700
     ttcaataaaa tcagttagtt atattaaacc gccctcggaa tgaaatattc aggttgtgac      5760
     taaacatgag aactttctcg gtcttcacag gatcagattc tgatgaacag aaagcctctg      5820
     taagcgtttt tcgcgcctct catgcctgaa gggcatttaa accccgtttc gtgcgtctga      5880
     gcgtgtttta gaggctatca agcgactcat caccgaagga acaacaacag aattaccagc      5940
     gatatgtgag aaatgactcc gctcgccgca gtcgaacgac cgagcgtagc gagttagtga      6000
     gcgaggaagc ggaatgtctt cgatgcagca tatgaatccg tacgctctgg tctgacctca      6060
     tcttgtgatt ttgctgattt caactcaaaa aattcacaat gcgctctatt ctttttttct      6120
     aatttctttt ttctaaaaga tagatcactc ctatgttaca tataatattt cctttttcag      6180
     ggccgttttt tcttttgttt ttcaattaat tgtaatgcta actagggaca gatttatggt      6240
     taaaagggga cagatttatg gttatttgcg tttttatcag gggacagatt tatggttaaa      6300
     aggggacaga tttatggtca actagggaca gatttagtgt ggataacttt tttatccaca      6360
     ggctgtggat aactttttta gattcaactc ggattcgtta tggattctct atgaatctga      6420
     attggattag tgacttagat cacatttaag atgtttggct cgatgggttt ttgatgatgc      6480
     attcccttct ggtttgctgt attgactgcc tctgactgag ggtgaaaatg cgccgttcag      6540
     ccaggtttga ctcttcaaac aggggacaga tttatggttt attagttatg tggggacaaa      6600
     aaaaaattgc gtccctagtt tgggtgtgag aaacttcttt tgatttttaa ctcacaggaa      6660
     ggggatctgt atggtcttaa agaataataa aaatagcgac tgtaatgatg ttcaaagttt      6720
     gttggcacag ggaaatcaat tgctggaagg tgcatacgat ataacgctaa ttgaaatgcg      6780
     tcttctgtat ctggcattga ctaagattga tagccgtaaa ccgcagcctg caaatgaata      6840
     tacattgttt gcgaaggaat acagggacac tttttcttta gattcgaaaa attgttatga      6900
     acagttaaaa tctgctgcga gttctttagg ctcaaagcca attgttacgt atgaatggaa      6960
     cgaggcaaaa aaaaggatcg atgcagtcaa acgattctgg ttttcttcaa taagatatgg      7020
     tgttgggaat agtgaaagtg acataacttt gcgtttttca gattcggtca gtcaatatct      7080
     ttatgaactg aaaagcgaat ttacacaaat gaatcttgaa catatggtga aactggatac      7140
     accattttca tttcgacttt attcgtggtt atataaatat aagaatctga accgaaataa      7200
     gaaacatagt ggagtgatct cgacagatcc tataaccatt gaatggatga aggagcgaac      7260
     cggccttaca gggaaatatc cagtatataa ggattttaag aaacgggtgc ttgatcctgc      7320
     tgttgatatt atcaatgcaa atacgaatct gagtgttacc tatgaaggta tcaagtccgg      7380
     cagaaagatc gagtctgttg tgttcacata tcttgtagag aatgaaacat atgatggaaa      7440
     aaaaatagca actaaaccgt tacgtcctcg attgccatca agaccaaggg tcattaaagg      7500
     aagctctgcg gaggttgcct gggcaaaaaa atgtatcgat gttatgaaaa attaccttat      7560
     ctctttaagg gaatatgatg ataagttaaa attatcaagg ccagatcttc agaaggttaa      7620
     gttatggcat gaaataaccg gatgggattt cgaagagtcg ttctggttta gtgattaaag      7680
     aatgctgctg tttacgttac ccgttttttc tctttttata actcacttaa aagagaggat      7740
     gatatgaaag ataacatcgt ggattttcaa cgtatcagga gagacctggg cgctcattca      7800
     acagatgttg caaatgatgc cgtttattct gacaaaaaga aaacatccag gttcttttat      7860
     ctgctgacac ctgtcagata ccttctggct gctttccttt atctggttgt tgttattcca      7920
     ttggggattc ttgcgggatt tcgtttcttg ttgcagtttt taggcggtat cgcagtgatg      7980
     ggtttaacta tcgcctggta tatgggcgca gatgtcagtg gttacgttgt tcttgctgca      8040
     tggatcgcct taactgtttg tggttgcgca gagcagattt ttgaatggtg gatcgaaagc      8100
     cgttttgcgt tccgtctttt tggtatcggg agaacgccgg aagaatgagc gccgatctta      8160
     cagacagtaa agaacaatgc aggatagaca atcatggtca aaatgttaac attttatcca      8220
     tgattgtcca aaaacgatgt ttttgcctgt gcctgccgca ggctctttta aaaggaatat      8280
     gaaatgatat ttaaccgtaa taaaaaacga gatgaacaac agaattcttc tgttgttttg      8340
     ccatcaactg aaaatgtatt ctctgatttt attaagaaca atccagcttt gacaaccaat      8400
     gcttttacag ccattgggga ggttgattgt tttactaaag tacccttact ctcaaataag      8460
     gaatcagagt ttttaggcat tctttcacgt aatattatac ctgattattc cgtttttccc      8520
     aaaatacgac tcattgaatt tgttcgtcct catggtagcg aggaagctgt aaaagaatta      8580
     atccgtgaag tgcagaatat aacctgtgat tttgtcctga aatcatatga tgaaacagtc      8640
     cttgctgtta tccagtttgg tgaaactgca accgtcagac agcaaaagaa aaaactgatt      8700
     atccagcgtg tgtgtgctat gacagaaatt tcttttttcg aatttaaaaa tactgtcgat      8760
     atgatgggga gcgaagactt ttgtcagttc ctgcgggatg atgaagagta aaaatattag      8820
     aaattaaaaa taagcccaca tatttgcggg cttaacaaac gcattgtcat aatttattgt      8880
     ctgttatcct ctaaaataat taataatggt cctaacatag ttgtaaatac caatgctgct      8940
     ataccaatca taccgtactt gtttggtaca catgataata ataaagagca cgtagataca      9000
     gttatataaa atattctgaa gttacttttt ttaaatagtg atgatatata tattatacat      9060
     aacgctataa gattaaacgc gattgaattt atcattgttt aatcctcttt taattggtca      9120
     gcacatatcg atcttaccgc ccagtaacat aaaaatgaaa accgttgtta ctgggagcaa      9180
     cattgccagg atgaaaacga ttagattact tttcctgcca atattgaata ctataccagc      9240
     cagcaatact aaaaagaaaa atgcaactgg tactgtccat gtaatgacag gatgatagtt      9300
     tataatgcct aaatcaaaga tgcagtgttc catagattga gtgccctaat gtctgattat      9360
     aaactggtat tattacgtat cgtcacttca caaaatcttc tggttttata cttgatttaa      9420
     actcttcttc tttagaacgt tctttttgcc atgctatata ccatacaaac aaaacaacag      9480
     ttccaatgac aaagtacgat gctggttcca gtaatgctga gatactgtca cctgaaaatt      9540
     tccatgcacc ataacccgca agaaccagtc caataacagg ctgcacacag agcatgtaaa      9600
     aattgaatac agatttaatt atctttatga gcatattttt atccccttta atagtgtgta      9660
     ataaaacact ctatttattc acggttggtc ttcctgcttt cgggctgttt ttccttatat      9720
     catcaaacag cctccgacgt tcttctgctg ataccagacg taacgctgcc agtgctgctc      9780
     tgattacttc agcacggctt gcaccgtact tgttctggaa ctcctgcgct gtatccagat      9840
     catcatctgt catagtcaga tttatacgcg ttactgcgga tgccgatgct ggtttttgtg      9900
     cagcagaact tacaaactgg cgtaaatcca gtggtttaat ttcctgatct attttctttg      9960
     ggatctttgc cataaggtat cctttttata aggtgtgtaa ctatacacat catttatggc     10020
     agggaaagtt ccggcatcca cgtactgcaa attgccaggc ttggtcagat aagccatccc     10080
     cgccgtatat cgcatcggat atgggtatat tatcaaattt ggtgtgtaat aatacacatt     10140
     acagaatatc cgtttctttt aacaataact caatctcgcc acgggctttg tttccccgtt     10200
     tatcatcgta ttcatgtacg cccataccgt tgttataggc ttttttatgc gcagtacgca     10260
     tatagatacg ctggcgggga accggaagcc agtctggatc atcattgagt tgtcggcgca     10320
     gttctgacgc ttcactgtct gacgggttag ttgagcactt attcaggaca atccatgctt     10380
     tcattgacgg attgactccg gcctgtgctg ttttaatgtc gaaaaccagc cgtcccagtg     10440
     tgttgatctc aatgcctgat cctggctcaa tgaatgtgaa aagaatgtga gcacaactca     10500
     gagctttaac gaacgccgga gatttcatgc ctggtgtatc aacaaacaca taatcaaagc     10560
     gggcggccag cttttgtgcc atagccggaa tatccgtgta gcattcgaaa tacggtattt     10620
     ctgacagtct ggcgttggtt ttacgatcct cgatgaaatc cttgatactt ccctgtgagt     10680
     ctgtttccag gaaacaggct gttttccctt tctttatgac acatacacat aaggaacaaa     10740
     gcacggtgct ttttcctatg ccgcctttgt gtcctgcaac tgtaatgatt tttcccatca     10800
     caaaatcctc ccggctaaat agtgtgtatt aatacacaat cttttgtggt gaaagtataa     10860
     ccgtacaatt gcgtgctggc aatagtttaa tagtgtgtat tattactcat tattaatgcg     10920
     ctcagggtat ccaagaagct gttttgcaag ctgtggatcg caggtaaagg acaggccact     10980
     tcctgtaagg acgtccagcg aaaaaacgcg ggtgtaaatc tcggtgcttc ttgcataacg     11040
     gtgtcccagc agggattgca ggacgcgcgg aggaacgcca ctcattgtca ggtgcatggc     11100
     gtagctgtgg cggaacgtgt gaggagtgac cggaaccgaa aatgttacgc cgtcacgctc     11160
     tgcccgtgcc actgcggtgt ttatccagtt cagcggtgtc tgtctcgatg ttatgtccca     11220
     cacaggctga tgtttgatcc gctttttcca ggtcgccagg tattcccgca tacgcaatgc     11280
     gtatccggca tccagaacag gaaccagcct tacagcaggc tctggtggtt ttctgtatcg     11340
     cggatcagga tgtaatggtg gatgcctggt ggtcgggcgt ccaggtcttc tttctgcttc     11400
     ttttatacgt tgcttgagtg ttttcaggat caccacgggt tgcgggtact ggcgcgtcgg     11460
     agtcagcata aaatcagcag gtttcagcgc cagagcttca ttcagtcgtg ctccggtatt     11520
     ccagagtgtc tcaaagtaca tgcggatgct cagatcatca atgtaggaga gaagcagtga     11580
     gacttccggt gctatcagat attttggcat tcctgcgcca atctgtgccg ccagatcccg     11640
     catattacgg gctgcatcgg gagagatggt taaattccag gcgtcgctac gtgaaatctg     11700
     gaaaattttg gcgggtaagt gactcaattt ttaaatctcc gcacctgttt ttttgggatg     11760
     tgtcagcaat tatgacctag agcagaggtg cgtccgacaa taaaaattcc gatcaccaaa     11820
     aaaaattttg gacatttttt ccgataatgc atttttgtcc aggcggatat gaacggcagg     11880
     gcaggacgaa atctggaagt tatcctgaat tacccaggat atgggcgcgt atgccggagc     11940
     agagcaccag ataaaggaaa tgaatttagt gtatgttgta actaataagg tctggacaga     12000
     aaatgctgta tgtccagtct gtgctggaat tatactggca accatgatca tcacaggaag     12060
     aacgagtaac agatggcgac tgagtgggtg gatgtggctg ataatgccgt aaaaataggt     12120
     ttggggtcgt tgctgactat tttagggggg tggctgactc ttaagctaac acaaaagcac     12180
     gaattaaaaa aagaagcggc agtacaggga ttaaaagata aagaaataaa aaccaaacga     12240
     tatgtggaat ttctggcctt gtctcaatct ctcatgcaaa aatatttata tgagcagtgt     12300
     gaagcaaata acgatgatta tcttgcctat cttcgcatac ataatgagat aacgatcacg     12360
     tcaggtttag ccataaggaa agcagcattt aaactccagt ttgatgtttc tactttcatt     12420
     ttctacaaca aaatacacga cacagaactc attaatgcac tgagggataa ggctagaaat     12480
     tctgtttcca tgtttcaggc cattgtgaat gaggaaatct gcaacggaaa gtttggcaca     12540
     gcaagccagt agcgctgggc agaattccct ggctgtccag gtgagccagg gaattaaacg     12600
     aaggtgtaaa aaagtcgctg gcgcggctag tttgatgttc tttggaggta acgtttacct     12660
     aacccataaa cagcaaccca cagcaggcat gggatcagga ttaccgattc gtacctgagg     12720
     taatcgctta aggtaaggct ggattcaaac catgagagca aaataaccgc ccatacagca     12780
     cttaccagaa tggcaccgta aaacatgttc ttgacgttca taagacacca ccgctgttga     12840
     aatggctggt taaattatac taggccagct ccagcacagc cagcagaact ggacgaaatt     12900
     acctgaatgt ccaatgtgaa cggaagaaag ccagatatgg tagaatatta aaattcacag     12960
     gtattattag catataattt ggattgcgct atgacgaaga agaccttagc tgaaagattt     13020
     gaagtgcttg aacaagagta caattctgtc atgtcgacaa aatatatggg aacaagtgca     13080
     tttagtcaca gaagccagga atatattgat tcggctaaag gtaataactg gattgcaaga     13140
     gcaaaaaagt tacttgaaga cagttatgga aaggaatctg attactacaa agattttaat     13200
     gatacacaaa ggattgcttg gtctagtaat tatcagggat tggttagaca ttacaaacct     13260
     atttttgatg cagccagaga cgatttaact tactccggca cggcatcgac tatagcaaca     13320
     aaacatgccg aactggattt gattataaat atactcaata aatttccagc tttttgtcgt     13380
     caattaaagc aacgatacaa tgacagaacg ccgcttgaaa ttaatgacga gtatgatgta     13440
     caggatcttg ttcatgctct tctgctgctg cattttaatg atgtcagacc tgaagaaaat     13500
     tcacctagct tcgcaggttc atcatccaga caggattttc ttctgaagaa agagaagatt     13560
     gtcattgaag tgaagaaaac tcgccgctct ctaggggcaa ataaaattgg agaggaactg     13620
     ctcattgata tggcccgtta ccgtgcacat ccggactgtg agacgctagt atgctttgta     13680
     tatgaccctg aaggttgggt gactaaccct aaaggtgtga tagacgatct tgaggggaaa     13740
     gataccgaag gaaagactag agtcgtgata gctcagttct gattttcact atgctggaca     13800
     gaatgacctg tatgtctaac tgcctggcga attaaaccgg agcgagggta atcttgttca     13860
     aaaatactgt agcgatcgca gctgaggatc gcgctggcca gcgcgatcga tgcgtcaccg     13920
     gcgcaaagct gatttgttgt tttacagtga gttaggttgt ttgcagtgcg aaaaatatcg     13980
     gtgagtattt ttgatagagt cattaacggc ggtgcgctac gtgaaatccg tgaaaaagca     14040
     ggggatatac gaggggtatt tttcacgtag caacaccatt acagcctacc gttcagcaga     14100
     ccatccatca tttttcaaaa ccagtgtaat acgttttgtt tgtttctctt tcaaatcaga     14160
     ctcaagtcct aaaaatgcag cccgaacatc atcgcgtttc gcccattcag cgatactggt     14220
     gggactgaat gtgtaattca cctgcgtgat cttcattccc atagcatcac caggttcggt     14280
     aaaatcaact atctcatcca ccttataatg accgacgcaa aaatcaggtc gttccggaga     14340
     cttcagatat tttttcccct catccgtcag agcatattca cgaccaggca cttttttacc     14400
     cgtcttagta aaaccaataa cgtcatcaac cagggtatct tttactgtta ataaatcggc     14460
     tttaaccagt acatccagcg cagaaaactg tcgagaattt atttcatctg cccgttcctg     14520
     agatgtatat cgattagcct gagccacagc tacctgaacc ggataaggct tactatcaaa     14580
     tattcccagc ggactaatgg taatgcattc cttctctagt cgagtattaa tagctttttc     14640
     aaagttttgc ttattagcat cttttggtga atcacaccct gccagcaaga atgaactcaa     14700
     agcaacaaaa ataaccacta ctttttttga tttgatcatc attttccctc tttatcaaac     14760
     gataaaattt cttgccagcg ccgctggctg ttctgtcccc tccatttgcc gtcgcaaact     14820
     tgtttgcgac ggcatcacga ttattttatt caacctgccc aggttgcagt ttgtcaatga     14880
     ggaaatcttc catgaaatgg ccctcatcaa gcagcttctg taaagcaagc ggacgcttgc     14940
     cattaccaga ccattctctg atctcgccat tttcatcctt aaagcggtat ttagcctttc     15000
     ttactccgcc tttggctttc cgcctggttt tcactgtatc agctgttaca ggagcaagga     15060
     gtgattcggg atcaagacct aaagatatga tgtattcaat ggcctgctga cgtttggctt     15120
     caagttcctg gcgttcagcc gcttcacgtt cagcatcttc acgacgttct tcaataacaa     15180
     cgttgagctt ttcctgcatt tcgagcaact gctcaaaatc aatctcacgg gcaaaaacac     15240
     gcaatgaacg aatattcatc atagtccggc tgataatgcc gtattcatct tctttagtca     15300
     gttcgctcat aattaatcct cttgtttagt ggacgtactt ccagacgccg gaaggaacct     15360
     tatcataaag tttattcatc accagttctg cgcggcgatg gtctgcggca gaataaaatg     15420
     cctctgattc tgataaaggc agcttgtaac ggttaatctc aataactttt tcaagagtat     15480
     ctcttgatgt acattttctt aactgaaaaa gccattcctg ctttgttttc acttcttagc     15540
     ccttgccgga aaacccagct tccctgtttt cttatcctca agaacaagaa ctgtatcata     15600
     cgttccactg tttttctttt taaatccatt aatcaaatcg gttttccctg atttaaccag     15660
     tttttctgcc tgcgcctggg tgattttctt accagaaaac tcactccaga ttttaaattc     15720
     acatccggta cagaaataac cttttggtct gataacaata tgtttaccac aggaagggca     15780
     gggagagtcc aggcgttgaa actgccctgc tggcgcagcg ggttcaatct tcatctcgcc     15840
     caggtcaaca tcagaaatca tgcctgtcag ttcaccgtac agctcattaa taaactcttc     15900
     aaccgtcagg tcgccatttt caatggctgt ctgcttttca gaccataatg ctgtcatatc     15960
     aggattaact gctataccag gcagggcatc aataagcgca tatccggtat cagtaggaat     16020
     aagtttccct ttttccagcg tgatatagtt tcttttcttc agcgtttcca gaatggctgc     16080
     gcgggtagct ggcgtaccaa tgccaccatg ttcatccttt ttatcccgat ctttatcctt     16140
     cagtaatttt ttaatcactg gatcagtgac aaaatctgcg acacgaacaa gcgcggcaag     16200
     taaagtggct tcggtgaata atggcggtgg tgttgttttc ttctcattca caaccacttc     16260
     ttttgtcgtc actgtttctc ctgtgcgaat tttacagagc agttcaaaag cggaatcatc     16320
     attatcttct gattcacctt cgtctgtggt ttccgcgcca agaaacgcct caaatccgct     16380
     gtcagttgtt tttctggcac gggcacagaa cgactcatca ccacactgaa tggcaaccga     16440
     tacttcctgg tatgcttttt caggcatgaa ctgaacaaga tagtgttgtg cgatcgccag     16500
     gtaaacattg cgctcgtcgg tgctgagtgc gttaacatca ggcacactgg cggtcgggat     16560
     tatcgcagta tgcgcagtca cctttgcact gttaaacgct ttgcttttac gtgcagaatc     16620
     aatatccagc gactgaggaa agactgattt cagggcatcg ataacctgcg gtgcttcgct     16680
     gaattgttca tcagaaagat atgagcaatc agagcggtta taagtaatcg ctttatattt     16740
     ttcacgtaat tgttgcgtaa tatccagcgt tttttgtgcc gtcattttga actttttgtt     16800
     catgtattgc tggagtctga ccaggttaaa cggcaacggc gcagccgttt ttttatcatc     16860
     agttgctgcc gcttcaactg tagccggttt tccggcaagg gatgcagccg ttccgtctgc     16920
     ccacgcttta tcaagtaatt tacggtctgt cagcggagca aattcccctg gcttccagtt     16980
     cgccctgata acatcagcac cacgctgaaa gactccggtc atggtgtagt aaaaactgga     17040
     tttatggttc tggttagcac gggtacggtt cacaatcagg ccaagaacgg gagtctggac     17100
     gcgcccgaca gacagaacac cctgatatcc tctggcctgt gccggaatgg tgtaagcacg     17160
     cgtcatggag aagccataga cggcatcagc aactgaacgc gccagcgcct taaggtaaag     17220
     ccctttgaaa tcacgattat ctttaagatt tgccagtgcc tttttcactg ccggaagcgt     17280
     gttgtcgtta atcagaacgc gctttacggg ttttgtgttt cctgcatatt ccaggacttc     17340
     atcaacaagt agctgtccct catcatcagg atcgccagcg tgaacaattt cagtcacgtc     17400
     tccacgtctg ataagttcga gaatcgtttt aacctgtttt gctgcacttt caacaggctg     17460
     atacttcacg ggataaagac gtaaaggaag cgtttcaacc ttccaggctt tgtattcagg     17520
     attatagttt tccggcggct gtgattcgat aatatgacca aaacagttag tcacaatggc     17580
     gttatcactt tcaaaccagc catcatggcg ggtaaaattg ccaccaagtg ccttaacaat     17640
     atcatttgct actgcgggtt tttctgcgat aaaaagtctc attttgttat cctttacatt     17700
     gaattaatct ttttgcacaa cggatagcac gttcttctga tactgcctgt tgccagttat     17760
     cttcacttac tggatgtctg aatctgcgtt cacagccatt aaaggcaaaa attccctcac     17820
     ggttaagtat attagttgcg atatcctggt ctttaattct caaaaaggct gttacggcaa     17880
     aaccagaata tgaagcaatt tttgaaataa tgcattcatc agcttttatt aacgctgcaa     17940
     aaggaactat cttttgatgt ccacatgaaa tcacagggag tgtgtgaata tcataataag     18000
     ctattgaatg acaatccatg cgggtatcat caatagctgc cagccagaat cctgtctggt     18060
     cttttatttt tctgctaata tctgaatctg aaacaccagg atttaataaa tatccaccat     18120
     aacagacatg gaaggggtga gcagattcat caatatcagg aagttctttt accggatttt     18180
     ctttccagtc cttcagaaca ccaaattcaa gagcatccag caaaaacttt cgttcaaatc     18240
     catcaaacaa tgcatattgc atatgaaacc tctcaaagaa gctctgattt gttgacctca     18300
     tggtgaacca gttcaccatt gcgtaagaca aacagataag aaaactttct ttccttatct     18360
     ttcagccagt ttttgtattc agaaaggata aacggccagt catcagtgct gtaatgagat     18420
     tcgatgacac cagaataaca acggctaccg tcatcactct tttcacctgt gaatacaata     18480
     ccttctcctg gaatttcgat ataatgacca ctgttccatt cagggaatgg ggggatatca     18540
     accgacattt ctgccgtttt atagtcaata actctcgaca cacctattat tatcgttacc     18600
     atctttttta gtctctacgg attcatttaa accagccata cggatatgca gggaacgtca     18660
     accaactctc aatcaagaat tccgtttctt cattccagta aaaataaaat cctctttcat     18720
     tgaaccagac attaaaacca ttgatattgc ctatttcttt tgcaccagaa tataaacgct     18780
     caacatagta ataaggctga aatgaatcga aagtcgttgt tctgacaaac tcctgacgtg     18840
     atgattttaa tatggtgtca cgttcatctt cagggtccac cattgcacct gtattaatat     18900
     caaaaccaat atataaagtt gtccccgtca tggcttgttt tacgaatttc ttccagagct     18960
     tattattaat ggttattaca tgcttctgaa ttatatctac gaactctttt ctgactatat     19020
     caccgtaatc ctcgactctt ttttcaggaa cgctgataac aaactcaaca gtatcacctt     19080
     tatcatggtt aaacagaggc tttaaaggct cttcgctttc aaaattactt ctgaatgccg     19140
     ctacatcacg aacaaaacag gacatatatt catatttttc atccttaaac atcccctgta     19200
     aatcttcacc atgttgcaag gcatacaggc aaactcgctc atacagggat gattccgtta     19260
     cagtgacgta agctgcacct tctgtcatta agtcattgac acggatatca gcactaatct     19320
     gcacttcacc accgattctt ttattgaatc gttctttatc atgttttgtc atcattgttt     19380
     ttatcctctg atttaaagag aagcctttaa aattgcacaa agataaaaag acagagtcat     19440
     tagtatccct aataaagcga tgataaccat ctcaactgtt tcagatatat taaattttct     19500
     gtgtacagtt cttaataaaa attgacccgt tgccacccag aaggcaaaga aacaaaccac     19560
     gaacactgaa ttatcgagta aatcgtataa cgaatacatc cagtgaccag ccggatatgg     19620
     caaaccaaaa gaagagtgca ttttctttgt cccttaattt ctaatacgcc attcccacgg     19680
     tggaaccgga tttgtatcag cccataaacc acgcttttgt tcctgcgctt cccgttgcaa     19740
     agccggtaat gactcatccg cgttgtaacg ttcatatacc catgcagcgc cagactgaac     19800
     cataaagcgg ctggcatccg tgccgttcgt cgtgaacaca cgaccgataa tgcgtccgta     19860
     gcggtctgtc tgcgtataag agacggtaac tgattgtcct gcgagcagag ctttaagctg     19920
     atttgctgac cagcgcccga aagcctgttt tttctccggt gcatcaatgt ttgccaggcg     19980
     aatcctgaca ggctttttat cctgcaatac ttcaatggta tcgccatcga gaacacgaat     20040
     aactttcccc tggatttcct ggttaaatgt agaaagtatt cctgctaaag catcaggtat     20100
     tccacctgca tttgcagact gaaaagcagt aaacaggaat aaaatcacgc ttaacaaaat     20160
     cctcattcaa catctccttt tctgtttcta cgataaaata gttcttccag tgcactaaaa     20220
     ttaaatgtaa accagaccac aaagccaaca acaactgacg accaataaaa atatcgaatg     20280
     gaaccgtcaa cagactcctg ccagtcagca gcatcaacta acgttgttat acatttattt     20340
     tttaatacat gttcagttgt ggagtttgtc aactccatat cctgtggtac gcccttttcg     20400
     aaaagacaga cgttaacctt atcagaagga gtatcggtta taagccccct ggcctctttt     20460
     aaaaatgaac cagcaattga gttattaaat aaaaaaaaca taaaaacaac aaataaagct     20520
     attgatggag tcgtgataaa actaaaaaca aaaacttgcc gaagcatacg attaacacaa     20580
     ctgaatttat tcatcataaa actaacgccc ttcggttgtt caacgccgca aatcccagat     20640
     taaaatctgg aatctgcggc gtttaccttt atctctgttc ggaaggattc tggataaatt     20700
     ttatttcatc aatttcttca actgaaatac gctctggtgt agtccttaaa caagaagcca     20760
     taagtggcgt ttctttcccc ttctccacgc tacccaacac aattctggtc gggcaattct     20820
     gattaacagc ctccagtaaa cggtttaact cgtcatcaga atgagtctct tttaccttgt     20880
     taatatcaga tggtgcggtt acaaatctag ttacattcat aattattgtc ctgcaaataa     20940
     aagtctgaca caggctgata gtagcacttt gcaaactcca gattaaatct ggagcctgca     21000
     agaatgacat taggattact tacaaccttc tgaccagcca atacgattca tggcaggaga     21060
     acaatcagat ttaaccaatt tacctttcat ccattcagct tgttttttcc ccgcatcggt     21120
     attctcatag ctttgtcttt ccatattact tgcaccagtt ttctgactgt tagccgagtt     21180
     ctgttttgca aaagcagaaa aggtcgtcag tgacagaatc attgcataaa ctaatggttt     21240
     catttttatc tcctttcaca tagataattt attaccagcc acccgcaaaa cctgcgccaa     21300
     gaacagtgtt atgagatgaa tcccatgaaa cgttaaggcg cacgtttgtg tttaatgacg     21360
     ttttatattg aatgcctgct gcaatcgcat ttccattctg ataattacca acgccaatac     21420
     catatgagaa actattttca gcaacatacg ggattgatga tattgctgtt acacctgcaa     21480
     taccggcatt aagacgtttt tccgcacgtt caattttact gtttaattgt tcgaaccgct     21540
     gatttgattg attgcttaac tgactgaatc ggttatctgt atagttattc gcatttagtt     21600
     cagctttatc ggctgcattc tgagcatact gtatgctttg ctcgtatttt tcattggtat     21660
     aactgatacc ttgttgatat ttcttatccg tatagttgtt tgatgtgctg attgcctcat     21720
     ttttggcatt gttgatattg gtattcaact ctgttttcgt atcactgatt ttactgtcag     21780
     tataactgtt ggatgaactg accgcgtcgt tctttgcctt gtcgatactg gcgttcagtt     21840
     ctgtcttcgt gtcactgatt ttgctgtcag tgtaactatt cgacgaactg accgcgtcgt     21900
     tctttgcctt gtcgatactg gcgttcagct ccgtcttcgt gtcactgatt ttattgtcag     21960
     tataactgtt ggatgaactg atcgcgtcat tcttcgcctt atcaatattg gcgttcagtt     22020
     ccgtcttcgc atcactgatt ttgctgtcgg tgtagctgtt cgacgaactg atcgcgtcgt     22080
     tcttcgcctt gtcgatactg gcgttcagtt ctgtcttcgt gtcactgatt ttgctgtcag     22140
     tgtaactgtt cgacgaattg atcgcgtcat tcttcgcact atcaatattc gtattcagtt     22200
     catttttagc atctgtaatt ttattgtctg tatagttgtt tgcgttcttt tctgccgctt     22260
     cagctttttc tgccgcatct ttgattgcct ggttagctgt cgattgagca ttttgagcaa     22320
     ccgtattagc agagttcgct gtattttgcg ccgtattcgc tgtgttctgt gcattctgtg     22380
     ccgctgaatt agcctcattt gctgttgtct gagctttatt cgcggctgtt tgtgcgtttt     22440
     gcgcagtaga cgcagcagta ttcgcaacag actgtgcatt ttgcgctgta gaagcagcac     22500
     catttgcaac attttgtgca ttctgtgagt ttgacagtgc actattagct atgcctttta     22560
     caccatcgac acaatccgaa atgttaagag tctccttgtt acccgtaagg tgatactcac     22620
     aatctgcata tgcactacca gcagataagc acaataaaat agctataata gatttggtta     22680
     ctttcatttc tgatacctgt gattgtaact aatcatcaca tttcgttggc gcgaaatgtg     22740
     atacttgcag taccctgata cccgttggcg cgggtatcag gttttaatta acctctgaca     22800
     cgaccaaact tactcatgat tttcgatata gcagcaggat cagccgttga acactgattc     22860
     agaaatgctt tacgggcatc aaatgtttta ctccagcgaa tgcttccttt tttctttttc     22920
     agaatattaa aaaaatcctt ttcagcactt ctgcactcac tccctccacc ttgcccgact     22980
     gcttttccat ataagcaaag taccgaagcg caaggatcag atgcattagc atttgttgat     23040
     attaatccta acgccagcaa ggcaggtaaa accactctat tttttccagt catttttcac     23100
     ctcgttttgt gctttaatga aaactatttt tccctgttca ggtaaaaaac ttttctcgtt     23160
     tcgccactcc acgactgctg ttgccccttc catcttcaac agatctctga ttcgaaacca     23220
     cagcccagca tcatgtgttg tcactacaat cctgtccgca tgagccagag cgtaataaaa     23280
     cgtcggcgtt ctggcctgta ctccggataa ggaagtgatc tcataaaccc atcctttacc     23340
     gctaacgtct gactttatga caccgtgaaa atcggggaca tatggcaatg agggattgat     23400
     cacttcattt gccttttcaa actgcacggg tgttggctct ggcggtgatg aacaaccagc     23460
     aaggatagaa atcaataaaa acactaactt cttcatcatg ttctccttta tgccgcttta     23520
     tcgagatcag gaacttcttt tactgccaga tacccttttg cgacgatttc attttcaaat     23580
     actttctgtg gaggcataac cagctttcct ttcttcctgg ggaaaatgtt tgcaagttcc     23640
     ggagcaacct tcacaaaatc accaaagaaa tactcatgga gatagtagaa tgccttttca     23700
     caacgaatcg ggttttctcc cttcattgcc aggatttctt cactaaattt cagtgtaagt     23760
     agttcatttg ttgttaccag tggacgctca ataaggcttt ctgattcaga tctcgatgtt     23820
     cctccacgac tacgactttt gcttttcgaa ccgatagtta ctgttcgtgt tcccatcgct     23880
     tctgataact cccgcgcatc tttaacatca gaagcggaat aaacgatttt acagggtgca     23940
     cttgccagta atgttttact gcctgcataa ctgtagattt cctcaagctg agagccgacc     24000
     tggtaaacaa tcaacaattt cagcttgtaa ccagcaatga gtccagattt actcttgatg     24060
     taatctacag caccaattga cgggaattca tccagtagaa aaaggcagtc atgttttatt     24120
     tccggatcat ccgttggcat cttttcaaga ttcacctgta tagcaagctg aaagaaaata     24180
     tttgttattt tttcagccaa cctggcatta tcaccagaaa tacagaaata aattgtcatc     24240
     cgctttttcc gcacctgccg caaatcaaaa tcatttccat cagtagcatt tgccacattg     24300
     gggttagcaa acggtgataa tccattaaga aagttgcttt tgagttgtgc ttttgtttta     24360
     tcctccatct caatgaatgc cttaaggcca gcgacaccaa tatcagcaag cgttttgtct     24420
     ttccccctta attctgaacg aatatcattc atgaatgaaa gaagatgttc gggttctgca     24480
     cgctcaaaaa gctgattaat tttagacatt gagaagacag gctcaatatc aagcgttttt     24540
     agtccagcct tatcattctt aatcataaac cataaagcga cagcataaga tttaaaaaca     24600
     ccccccgccg tcttattaag atagctacca gcatccgcac catctgtctt ataggggtaa     24660
     ataatcaacg caagattttc aagctgatta aaaccttcac tcgttcccat gctgacataa     24720
     tacaaagggt taaagcggtg cgttaccgga ctaaagggat caaatttata aacctcatga     24780
     cctaaaatca ccttcctgat aagactggtg atattaaaac actccctttt tggatcgaga     24840
     ataataacac tccaccagta cttcataaga ttagtgatga ctatacctgc acctttacca     24900
     gcccttgttc cggctcccat cgcactgaat gctgctccca catagcgtat gattttcttg     24960
     tcttttatac caacgataat cccgtctttt tcgtcaccgt caagcgtgaa actgttagac     25020
     tcacgaatat cattagttgt cgcaaatcgc gcatcaccaa aaatattatc tttcttctcg     25080
     ttcagtttta ttaacgccgc aacagggata ataagagaca cgacaaatcc tgctccaagt     25140
     gcaacaaagg ctaaaactct gatatccgta gtcacaacag ataaagtaag gctgtctgta     25200
     aaaatatcca tcctgtacgc atcaatggat ctgaacacag ccttcaatgg tttcagattc     25260
     tttatctggc tgaagtaaag cacaaagaaa ataaatgaac ctgcaaacca tgccgcaaca     25320
     agcataacag caaatataaa aacagattgc gacttattaa aagttttcac attcagcccc     25380
     tttgtaatag atgtcgctca tatgcctgac aacaccatcc ctgcctacat gaacaacaat     25440
     atcaatactg tccataatga ttttacgaag aacatcaaaa ggaagatttt gacattctct     25500
     gttctgataa cattttgtca ccatctgaat gatggcatct tttgccgagg ccgcgtgaat     25560
     ggacgtcatg cttccactgt gaccagaacc agcaactttc acaaaatccc aggcatcgcc     25620
     acctttaatt tccgccagta aaattctgtc aggtttcatt ctcaaacagg atttgattaa     25680
     tttcgctgct gttatgatag agccggaatc actgccggat tccgaagggt aaaaaagatg     25740
     cacataattt ttatgaataa aaaatttgat ttcctccgca tcttcaatcg taatcagccg     25800
     cgtattcaat ggtatgaaat cgataagact cttcatatag gttgttttac cggaacccgt     25860
     tgctccggca aatacaatgg ttttccctgc tgctacggca agctccataa aagcagcgat     25920
     atttctcgct ctgaataaat caagaagctc atcatcgtat gtcctgtgtt tttttcctga     25980
     ctggacataa tcataaaaac cgttcgccac atattcttta tgcgttatct gccgtgtcga     26040
     tggtttacgt atagtgattg aaatagtatt tctctcacat gcaggaggaa aaacgacctg     26100
     tacacgttct cctgattcca gtgttgctga aagtaatggc ttggtatcgc cgatttcatc     26160
     tccccgaaat gatgccagcg tctgagaaaa ccgtttacaa aaatcaaagg tcacaccgtc     26220
     attattatgg aatgtccagt caccattaat ttccgtccag atttcaccag gacggttgac     26280
     agcaatttct gttagccctt caatatcaag aaaagactgg aatacttgat ttttataaaa     26340
     atcgagcgat ttattgctaa tgctgacagg aataacgcca ctcatactat tttaccttta     26400
     actcatagat atcagaaaaa tcaatgtctt ccccgaccat aatagtgatt atgtcacctt     26460
     ggtttttata cattgttgga ggaatattta tcgaattctc aagtgcgact ttagccattt     26520
     cagccattgc ctgtcgtgag ttttcggtat aatccacatt acgatcttta ccaggtgcat     26580
     tatccgccgc cgccgccgct acatcctgaa ccatactgag cataagagaa ccaccaaaac     26640
     gctcccagaa gtgagaatcg atccatccat caatgcctgc ttcccccagg ggaccagccg     26700
     ctgctgtatt taccatatcg attcgtttat tatcaggcgt ccgcaactgc tcccacataa     26760
     cgaacattct gccctgtcca tgattcagcg ttccggtctg gtaacgacca aaagccttag     26820
     ttccctgttc cagtaatttt gtgtggtgat tagcactcca tacatcttct gtaaaaacac     26880
     aactgatacg acctgcaaca tcagaaacaa agcgtgtggt taaagcacac ggtataagcc     26940
     tgttttcctc aatatagaga tcaggatcga gattaatcgc agtcactttc attcctgatt     27000
     taccaggcac attttctttt gattctttcc tttcttcctg tggctctgat gtctgcgatg     27060
     tcctgctgct gccactcgcg ccagtctgac tccctccctg accagcaaca ggtattgaca     27120
     aatatttcct gaacccctcc tgtggcactt ctttatgacc gtcagaaaca gtattaccag     27180
     aaccagtagc gcctggattg ataattgctt tgttctcaac agggtcaaaa ttctgaccaa     27240
     gaccagtacg gattttactg acctgagaaa tgctggtatc gcctgttaat tctgatgctt     27300
     tctgctggtc atctgcaaaa taatttttat atgttttcag cgcaaaaata ccaataacta     27360
     atacagccat cagaccaaac agaaagccag aacgcatacg attatttttg ttcctgatat     27420
     caccgatatc atgaacgggt ttactttcca gctttgactg attcgcatca tcaactaaat     27480
     catctgtttt tttcatatca gtcattattc acctcaacac gttctaccgc aggagaagat     27540
     gtattcctct ggtcggttaa tacttttccg aaagatttat tcacaacacc aacaacgctg     27600
     tttccatagc gtaaaacaaa tttgtcatta acgttgtgga taaccatgat tttatacttg     27660
     ccttttgttt ccacattaaa agcaagtgtc tgttcctgac catctcttac agcaaatgga     27720
     gctgggaata ctttccctga gttaaaacct aaaaaggtaa atatgccatt atcataagca     27780
     aaatcagggg cgatacgacg actgtcatat ttttcattga ctcgcatgaa ataatcccag     27840
     tttttaggcg catcggcttt ttcaaaactt tcagaaatca gtttcttctg tctgagtttt     27900
     tcctgttttt cttttgccag ccttacttct tctgcattct ttttcgctat ttctgatgga     27960
     tagcggaatt gtacaacata agcaggttgc gcttgttttt cttctgacag aaggattaga     28020
     tcaagactgt aaatccgctt tgttgttctg acaaaaagat tcgtgtccca ttccttttct     28080
     gttggctgga aaaccttttt cagtttttcg ccttcatcgc cttcctgttc ctgaacaacg     28140
     ggacgcggat tgatgtaaac aacattatca tcggttgtga tttcccatcc ggcaggaaaa     28200
     ccagcctttg cactgataac agcctcacct tcatcaaaaa caactgatgt gagaaatcct     28260
     gtctttgacc ggataacggt cgtattcgca ccgttataac tcacagtctg catccttgca     28320
     tcaaatccag aaggtaacgg agtcgctgct gaatacacaa gcccaggaag caataaacat     28380
     gtagcaataa ataatttctt catcattccc ccctgacttc ccgatctgtc tggtaactgg     28440
     ttaccgtaaa accgagagga ttaagctcac gactggaact tttaaccgac ttttctggtt     28500
     caaaacgata tgtcacacga gccgtccagt atgaaactga aacctgtccg gtcgtgaagt     28560
     ttctcgtcgt ttttttaaaa cgcacagagg ccagtttatc tggcgcggtt gcgtcagaaa     28620
     taatattgga gatgacctca accgcaacgt aagaaccgtt attatgataa attttatcag     28680
     gagccatatc gctgttatac agacgaagat aatcgtcctt tactgtattc gagctatata     28740
     gctgtacagt ctcataatca tactgaagag acggataatt ataaccttca cgtaaagtaa     28800
     tatacgtgtt tacaaaatac cgcccaagcg cttcagattg caggatcttt tcctgtttaa     28860
     cctgagtaat cagttctgta cggcctgttt tttcgccaac agccacaata gcaagctctt     28920
     tttcttttaa tggcacaaga acacaaattg cagccccaag acataaggac agtaatgatg     28980
     ctgccactgc aacacgccat gcatttttct tagaccgttc attttctgca tagagttgtc     29040
     tttcgaagga tttagctgtc tcaatcttct tttcgatttt ttcactcata actgattacc     29100
     tggctgtggt taatgggttc cagttcgccg gaaacatcag aaggaagggt attccttgtg     29160
     gtacatccgg aaatctgaaa caggaaaaac aaaagaatca cacatcgcat aaattcacct     29220
     tattaagcgt tcacgaacac ctttaagaga taaaggccaa gatgaagaaa aagaatccca     29280
     ccaataagaa gcaaaaagcg aagatccata ccctttctcc atttccccgc aagccctaaa     29340
     ccaagtctta ttcctgcgaa gcaggtaaac actcctaaaa gaaggattag gacaaaataa     29400
     agtatcatga caaaataatg aagcatgtca caaccagctc tgactgattc cacctaagac     29460
     cttaaataag gtaattcccg tgattaaaat aataagctgg gttattagct ttctcttcct     29520
     gctccatccg gaggtgatat gtttatcaac aaacgtcagt atccagttca gggacatcac     29580
     ataaaaaaaa cgtttcatta tattcatgcg gcattcctcg ctcgtgcttt ttccagggat     29640
     gcaagtcttc tcgccttcat ccccaaagca cctgtcggag ccagcgcctg atatcccttt     29700
     tcacccgccc attcagcggc tgttcgcgca ccacgcccca tcagattccc tgctttccca     29760
     gataaagaat tcatgcccgt tcttccggcc atccctaagc caaaacctaa accagcgcga     29820
     ccgccaagca tcagagactt accagtagcc ataccagcag cacccagccc catcatggct     29880
     gcgccctgaa cagcaccttc aacacctgca cctgctaact ggacagcaaa acttttagct     29940
     ataagaacca ataaagctcc caacaatccg gctaaaaatc ccattgcact tacggtcata     30000
     acattactat tgggtgtcgc attagatact tgttgcaata tatccccctg aaaatccata     30060
     gctatccgaa ttactaaact ggcaaataac acagtcagga tgctagaaaa tagcgattgc     30120
     aaccagttat taaacataac tctaataaaa ccaaacatca gacagaaaat aaatattggc     30180
     gctgttataa taaggaattt catcgtaata tcggcagtta aaaaaacaac agcactaatt     30240
     gtcattaaaa taagtgagcc agcccaaaca agcgtcatac ctaatgcgcc agccaaagga     30300
     atgaaatcag tgtctttttg atataccttt tccgcaagat tttgtgtttt ctcccataag     30360
     ttatctaagg tttgccatgc gctaactccg ccagaaagcc catctttcat gccttgcaat     30420
     gcattggttg ccgctgtcaa atatccatct gcatttgtta taaacatgat tatgatcgca     30480
     aattttgata aatcccaaac taaatcctgc atcggagtct gagttttact ggcgagtatt     30540
     tgatagcctt tccatagtac atataacgtg acagatgctg tcactaatga cattatatct     30600
     tgtgtgaatt gactttgata agtagatcca accttatcaa ttgcttccat aacggttgta     30660
     ttatatttaa caaagaatga catacctttt ccctcattga atcgtaggta ttggtgcgtt     30720
     catctgttgt tgcttatatt cagccctttg ttgttctttc aacatctccg tgtcagcctg     30780
     atttttacta ttccagacat catactgcat ttttaacgac tgtgcctgta atgcgttagc     30840
     caaatcctgg gattctttca tatcctttga agcctcaatt cgagtactta aactctgaat     30900
     ctgagacatt gcacttgata actgcttatt tatctcattt ccctgttcaa tactggcagc     30960
     ctttgacaca atccgtgctt tacagagatt atcattgcgt tcatagcctg tagtgcacat     31020
     atcgaaggct ccatacttgc tgaacagatt ttttgcggct ttgttgaata aatcgaactt     31080
     ttgctgagtt gaaggatcag atcacgcatc ctcccgacaa cacagaccat tccgtggcaa     31140
     agcaaaagtt cagaatcacc aactggtcca cctacaacaa agctctcatc aaccgtggct     31200
     ccctcacttt ctggctggat gatgaggcga ttcaggcctg gtatgagtcg gcaacacctt     31260
     catcacgagg aaggccccag cgctattctg atctcgccat caccaccgtt ctggtgatta     31320
     aacgcgtatt ccggctgacc ctgcgggctg cgcagggttt tattgattcc atttttgccc     31380
     tgatgaacgt tccgttgcgc tgcccggatt acaccagtgt cagtaagcgg gcaaagtcgg     31440
     ttaatgtcag tttcaaaacg tccacccggg gtgaaatcgc acacctggtg attgattcca     31500
     ccgggctgaa ggtctttggt gaaggcgaat ggaaagtcag aaagcacggc aaagagcgcc     31560
     gtcgtatctg gcgaaagttg catcttgctg ttgacagcaa cacacatgaa gttgtctgtg     31620
     cagacctgtc gctgaataac gtcacggact cagaagcctt cccgggcctt atccggcaga     31680
     ctcacagaaa aatcagggca gccgcggcag acggggctta cgatacccgg ctctgtcacg     31740
     atgaactgcg ccgcaaaaaa atcagcgcgc ttattcctcc ccgaaaaggt gcgggttact     31800
     ggcccggtga atatgcagac cgtaaccgtg cagtggctaa tcagcgaatg accgggagta     31860
     atgcgcggtg gaaatggaca acagattaca accgtcgctc gatagcggaa acggcgatgt     31920
     accgggtaaa acagctgttc gggggttcac tgacgctgcg tgactacgat ggtcaggttg     31980
     cggaggctat ggccctggta cgagcgctga acaaaatgac gaaagcaggt atgcctgaaa     32040
     gcgtgcgtat tgcctgaaaa cacaacccgc tacgggggag acttacccga aatctgattt     32100
     attcaacaaa gccatttttt gcctgactgc ttaatgcacc ttcgggatta ctggtaaaat     32160
     cagaaatata actgttcccc tgcttataaa tatttgtcag ttctgattgc agattactta     32220
     gttcatttgt gaatgccgca atattcctta tacctgttgc cgttgctaac tggtctttat     32280
     atgcctgaat ctgactctga taatgttgcg cagtttcaga ccattgtttg agtcgttctg     32340
     tccatcttgc ggcttcaaca gcccattccg gactggcatc tacagcaacc ggaatacctg     32400
     cgctgctata aaatgaagcc gtcaataatg atatcagcat aaatgttttt acacgtttca     32460
     taaattcacc tgtcagattg cccgttcgag atattcagga acccagtcat caggctccat     32520
     tccttcatga taaatacttt caaaaatttc cagattatct gcactggcag acaatatttt     32580
     cagatatcca ccaagtcccg ataaatcgag tgtcgcaagt gctgaaaatg atttaccatc     32640
     tcccttttta agactgcttt ttttaatcag gaattgtctc gacattggat caagattttt     32700
     aacaatatta aattcttctg gtgtcagctt aagcccttct acatagtcat tgtaatcggc     32760
     atcagggtta gccagataaa tactggtgct gcatacttca accacagccc gtgaaatctt     32820
     attcttcagt atttcatccg gagactgagt tgccggaata accagcccgt tcagcttacg     32880
     aattgttttc agcttgttat agacaaaatc gctgaatgct tcatcctgta gccatttcca     32940
     gaactcatcc aggaagataa caagacgccg accgtccaga agctgcgtaa tgcgatacag     33000
     cagatagaaa gtaattggtg cacataccat cggatcatca agaaactcgg tgccatcaat     33060
     gccaaaatta ttgacatgct gaatattgaa tgtgtcttta gcattatcaa aaacccagcc     33120
     atgagcctga ccattagccc attgggacaa acgaaggata atcccgttct cctgctcatc     33180
     ccgatcatct ctctgcataa gatgctcaag cattctggta atgccatatt cccgcatttc     33240
     gccaggagga aaatccatca cagcatcaac actttcgcta ataagcaatc tttctcttgt     33300
     cgataatctt tcaccatttc tggtacacag aatctccatc agttgcttga caaaaatacg     33360
     gttacgtttt gttgcctcca gagcaaaagg attccatcct gtcggctcac cgctttttac     33420
     ggtgtaatat tccccaccaa gcattcggat acataattca gcccctctgt ccttatcaag     33480
     aaagacacac gttaacttct tattttttgc agagtcagca aaagtttcgg ggttattgta     33540
     tttctgtaat gaacaggcaa gatatgacag aaacattgtc ttacctgaac ccgccgttcc     33600
     tataacttta gtattagcaa gattcttttc acctctttca tctttaaaca gtactgagtt     33660
     atgtaaattc agataatacg cctgtttgct tggtgttttg agaatagcaa ccgcttctgt     33720
     ccagcagttt ttatcgcgtt tcccctggta gaaattatgg aatgatgcca gttcgacaaa     33780
     atttacattc gataccggag ataaacgcgg ccttaaatga aaaaccgccg gaagctgggc     33840
     aaaatatgcc gctggcaatg acatggttga caatgccgga ataatgccca ggtcagtaaa     33900
     gtctgccgta attttactta cagattcgtc aagctccctg atactgtccg ccattaccat     33960
     tagcgtgaaa tggtagtaac caaaggatat atcaccggac acaatatcat tttttgcctt     34020
     ttccagttcc tgcaattgag taaccgcatc atcttctgta ctctttaact gtttttctgc     34080
     acgtttaatg gtactcaatg cttctgattt gctcatggat gtatatgaat gcgtaataat     34140
     atagtcagca tcagaatact ggagcacatc aaaaacaccg gatgcagtct cactacagaa     34200
     atctttaatt tcaatagaac gaaagaattt atttccatca atgcggcata tctgtccggt     34260
     atcatgatta aaaaatacat ccactccacc aagaacgtta tacaccggag aatcagtgac     34320
     tctgattttt tgcaacttcc ctgtcagaag ataattatag aatgacagtt gagaagaaaa     34380
     tacctttccg ttctcctcat acataccaag aagtttacag gtaaatttat caagagcgcc     34440
     agagaatgta ttaatcattt cattcattct cttcacatga atgttaatat catctttctt     34500
     ttctttaata ctttttttgc gtttttccag tttttctaca cgcccgtctg gtctgtagat     34560
     cagcgtaaag taaagtgtgt tccccttgaa tttatttttc ttcatcgaac cataataaca     34620
     atctgatatt atatcagcat atttattacc tgattttgtg gtaaaggcat cataaaaact     34680
     cgccctgcat gaatggttat aaaatgaaac gggcagtccg gaaaatgaac gaacaagagt     34740
     ggcaacctgt gagtcaatag tttctaacat ctccgcagag attgactcaa agttaatccc     34800
     catcagttgc catgtcgcta cataatcacc gttctttgtt ttgacaatat ttttatcaac     34860
     atggcttgaa tagggtatat atttaccagt agtaattcgc tcattcagtt tcatggcatt     34920
     aataaactca tcaatttcaa cagcttcata ttgtccggag aggaacgctc gtgcgccaaa     34980
     aaaacgatta cacactgagt ttccgagcat tttcagctta agaaagtaaa gattaaaaat     35040
     gtggtcgtcc tgcttagtta tcattctgag aataaaaact gcgacaggaa tagccagcca     35100
     gatcagcttg ctgatataaa cccccgccag aaataacgcc cctgcaacca cagtaagagg     35160
     gacgacagga acacccacat acatagcagg gcgtgtcatc gctttataaa gtgtagacat     35220
     actatcgtcc ccgctttatt agttaaccat cattgatgca acttcagccg cactggcgat     35280
     aacaattgcc ccgatgatga taggtgagca ttcacgaatc gtgcttccac caaacagaac     35340
     cttgtagccg acccacagac aggcaatagt caccgtgacc agtgaaaggc cactaagccc     35400
     tgttttgacc ttttccagca gtgtttccgc ttttgaaaat ccatccgcaa aggctggtga     35460
     tgcgactgtt gccccggcga ctgccataac taccttattt ttacgctgca taacagcagt     35520
     gacagatgaa ctgatacgat tacatactga tttcttaaat gacattttat aagtcctgtt     35580
     aattaataac ttttgttgga tgtgagttat caacaaaagc agatttcaga atggtttcgg     35640
     gccagataac tgacgcattg tgtgaacgat tttttcgctg ttctcccccg ttgcttcttg     35700
     tacctggtac aacatatttt ttttcgttcc ctgtataacc aattcgctca acataacttg     35760
     tattattaaa ttctttttct tttcgcttac cgttactaaa atttcctgta tagtaacaac     35820
     taagcgcatt ctccaggctc ctccctcgtt tataacaatc cacgataatc ttttcgaaaa     35880
     cagacaagtt ttcacacgga tcaaggagtt tttctgcgga cgtggaataa aaagaaaaat     35940
     tactgctggt aatctgcatc aatccgacag aataacgtct ttttctgttt tctatttctc     36000
     tgataactgt aagagcttcc tccttacttt tgggcatatg actgataaaa cttttgccat     36060
     agctaccgcg ttccctttca ggaataattt cagccacagc ataaggattg aagccactct     36120
     cgacccgtgc aatatcattt atcgtatccg gatgaactga cgccgcacac agcaacaagg     36180
     ctgggaataa agacgccata gctaacgctc catatatcca tcaatacgca tactctgcat     36240
     taataagtaa ataatttgct tcctcttact aagcaaagat gttttcgttt tctcttcgat     36300
     aaatgcattc aacctgggat cgagttttat cgtgacataa accccttttt ccgatgactt     36360
     atctggtttc tccttcattt aatcaatcca ctatgggcta tagcaatggc aaaaaatacc     36420
     attgacaaca caagaatctc acattccatt ttttaactaa tccactatgg acatgtttta     36480
     gattcgttct agatgcaaat aggattatca aaataaagag actacacaac tacagaaact     36540
     ttagtggaca ctcatcgcaa tttatgtgag gacacaaaaa aaccgaccat ctggtcggct     36600
     ataatttagt atcaacacct gcttgggttg tatcttttaa ttaatttgag gcacaggcgc     36660
     atcttgttgc tgattcttgt acaacgcagt cttggcgttt ttacaattat ccgatacgtc     36720
     gcctgacttc ttacactctt caaccttcga gatcgcttcc tccggatgat ttcgccacca     36780
     atcaacggtc ttgatttcct caccacaacc actcaatgca attgagaaca aaaccaacga     36840
     aagaattctt gtttttttca tataactcat aatgttatga ctcccttgtt aataagattg     36900
     ccatcatcct aagaaacgca gttgtgcgca ctcctaccag agttgcacta cctacggctc     36960
     tttttaccag attcaaatga tacataacac catcggtcgt gatccctttt tctgacgcaa     37020
     tttcctcaac tgtgcaacca attacataca tcactgcaat atctttctgt cgttcagtta     37080
     actgaacctc tggaaagatt tgatgaagtt gcgaaatgcg tatagcatca tgcttagtca     37140
     tgataacctc ccatgtaggt tgttgtgatt agcaggtgag caaagtagcc gctttgttca     37200
     cctgcgccga aatcaaatta aaatcccagg cctttccagt tcctctcttg ctgtattctt     37260
     agttttttat gttcttctga atcctttgta aacccgtgtt caagagcaaa cccgatattg     37320
     tgaccttgct catgttttct ggatagctgc tttttaacgt cgctctcttc cggctgcctg     37380
     gtttcacgct catgaacctg acgttctctg ttccgctcaa gggcaatatt ttcaatctgc     37440
     cagttattgc gatgcgtttc cctgtagcct gcaacagttc catcatcatt aaacatcggg     37500
     ctacgtacaa gcgtaggagc cagtttttta actttgataa gcgttcctgg ctggagcttt     37560
     tcagactcga aatgattttt caggtcttta ccccaaatcg taacctgctt tccacctttt     37620
     aaagtttcat aagtgaggaa aggtgttctt ttttcccctg ccttattctg atatgaagtc     37680
     tccccaaaat ccacaacctt gtaaacattc cggagtcttt tcggattttc agcctgtaat     37740
     cgctcaatct cccgtttacg ttcgggatct tttttccatg tagcggtaac atcatatccc     37800
     atacctttca gttttctatg aaaaccgttt ctgaacttcc tggtttcaga cttagtaagt     37860
     cttaatctcc ttcctgtttc ttcatcacga agtttaatat taacatgtac atgaggatga     37920
     tcttctttat catcatggta tacggcaacg aaagcatggt ttggataagt ctctttaaga     37980
     aattctatcg tagctttcag agcgtcttcc ctgcttactc cagcttctgg tggtggtgaa     38040
     aagaccatgt ttttcacatg atcgatgttt tctccacgat atgttctgga gtaatcattt     38100
     cctttagata aagttgaagt aaactccctg ttaaagtctt ctcctttccc tgtttgctcg     38160
     gaaccttttc catcataaca gtaagcctca agttcaccat tacgggtaat gtaatcaata     38220
     ccgtttttga tacctgcggc agttttccct gaacctgtga ttttaaaagt gacttctttt     38280
     gttggcgtcc aggtatatgc tttcttgtct gtgccatgtc tgactttatg attaaaagcc     38340
     gatttactgg catgtatatg tcttcccgat aacttaggag atttcggatc acgcccagtc     38400
     cctttagcgc gtttaatacg gtattcctgt tctacataca cacccataaa tcacccaaat     38460
     ctgttaacaa cactcttggt taacgtttca agttttgaat caatttgctt acatagttca     38520
     atcacttcaa caacgtcttt tctgaaatca ggatcgttaa ccgtgcaaaa tctttcacct     38580
     tttatgataa aatgaatgtt gcgaccaaca cgatctacag cagttgataa ttttttaagt     38640
     tccttaactt catcagggta aagacagact tcattcttta acaaagactg acgcacacga     38700
     atagcaattt ctctgctcat gctcatgccg tgaagggctg cattacgttt aacaagttct     38760
     atttcatgag ggtataaaca ggttttaaca gcctttgatg attcattgct gacgggtata     38820
     tttgatggtt gaacatcaac attaagtaca ttatgcctgg caaatgtatt gatgctggta     38880
     aacccacttg atatagcgtt atgctctgca agttttaact catcatcact aagtctgaac     38940
     gctatcatct tcataactca ccccaacaga gcctgcggca ggcacaggca aaaacatcgt     39000
     ttttggacaa tcatggataa aatgttaaca ttttgaccat gattgtctat cctgcattga     39060
     ttgtaccata tgtggcactg tgcctggcta taaaatcgtc gctgcatatg tccagatttc     39120
     gttgctgaaa ggttctttcg tcttcgacca tctggcaaat gtatagctga tagatttgtg     39180
     aaagaaaaaa caggcctgac agggctggga attgttacgg cttcagccgt aacgcttttt     39240
     aagtcctcgc tgcgctgcgg ggctt                                           39265
//

If you have problems or comments...

PBIL Back to PBIL home page