(data stored in ACNUC1104 zone)

EMBL: FN554889

ID   FN554889; SV 1; linear; genomic DNA; STD; PRO; 10148695 BP.
XX
AC   FN554889;
XX
PR   Project:PRJEA40749;
XX
DT   02-OCT-2009 (Rel. 102, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 4)
XX
DE   Streptomyces scabiei 87.22 complete genome
XX
KW   complete genome.
XX
OS   Streptomyces scabiei 87.22
OC   Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae;
OC   Streptomyces.
XX
RN   [1]
RP   1-10148695
RA   Bentley S.D.;
RT   ;
RL   Submitted (30-SEP-2009) to the INSDC.
RL   Bentley S.D., Wellcome Trust Sanger Institute, Pathogen Genomics, Wellcome
RL   Trust Genome Campus, Hinxton, Cambridgeshire, CB10 1SA, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1094/MPMI-23-2-0161.
RX   PUBMED; 20064060.
RA   Bignell D.R., Seipke R.F., Huguet-Tapia J.C., Chambers A.H., Parry R.J.,
RA   Loria R.;
RT   "Streptomyces scabies 87-22 contains a coronafacic acid-like biosynthetic
RT   cluster that contributes to plant-microbe interactions";
RL   Mol. Plant Microbe Interact. 23(2):161-175(2010).
XX
DR   MD5; a1bf6215b4fbf9a35e4125ee3819af5a.
DR   BioSample; SAMEA2272773.
DR   EnsemblGenomes-Gn; EBG00000299965.
DR   EnsemblGenomes-Gn; EBG00000299966.
DR   EnsemblGenomes-Gn; EBG00000299967.
DR   EnsemblGenomes-Gn; EBG00000299968.
DR   EnsemblGenomes-Gn; EBG00000299969.
DR   EnsemblGenomes-Gn; EBG00000299970.
DR   EnsemblGenomes-Gn; EBG00000299971.
DR   EnsemblGenomes-Gn; EBG00000299972.
DR   EnsemblGenomes-Gn; EBG00000299973.
DR   EnsemblGenomes-Gn; EBG00000299974.
DR   EnsemblGenomes-Gn; EBG00000299975.
DR   EnsemblGenomes-Gn; EBG00000299976.
DR   EnsemblGenomes-Gn; EBG00000299977.
DR   EnsemblGenomes-Gn; EBG00000299978.
DR   EnsemblGenomes-Gn; EBG00000299979.
DR   EnsemblGenomes-Gn; EBG00000299980.
DR   EnsemblGenomes-Gn; EBG00000299981.
DR   EnsemblGenomes-Gn; EBG00000299982.
DR   EnsemblGenomes-Gn; EBG00000299983.
DR   EnsemblGenomes-Gn; EBG00000299984.
DR   EnsemblGenomes-Gn; EBG00000299985.
DR   EnsemblGenomes-Gn; EBG00000299986.
DR   EnsemblGenomes-Gn; EBG00000299987.
DR   EnsemblGenomes-Gn; EBG00000299988.
DR   EnsemblGenomes-Gn; EBG00000299989.
DR   EnsemblGenomes-Gn; EBG00000299990.
DR   EnsemblGenomes-Gn; EBG00000299991.
DR   EnsemblGenomes-Gn; EBG00000299992.
DR   EnsemblGenomes-Gn; EBG00000299993.
DR   EnsemblGenomes-Gn; EBG00000299994.
DR   EnsemblGenomes-Gn; EBG00000299995.
DR   EnsemblGenomes-Gn; EBG00000299996.
DR   EnsemblGenomes-Gn; EBG00000299997.
DR   EnsemblGenomes-Gn; EBG00000299998.
DR   EnsemblGenomes-Gn; EBG00000299999.
DR   EnsemblGenomes-Gn; EBG00000300000.
DR   EnsemblGenomes-Gn; EBG00000300001.
DR   EnsemblGenomes-Gn; EBG00000300002.
DR   EnsemblGenomes-Gn; EBG00000300003.
DR   EnsemblGenomes-Gn; EBG00000300004.
DR   EnsemblGenomes-Gn; EBG00000300005.
DR   EnsemblGenomes-Gn; EBG00000300006.
DR   EnsemblGenomes-Gn; EBG00000300007.
DR   EnsemblGenomes-Gn; EBG00000300008.
DR   EnsemblGenomes-Gn; EBG00000300009.
DR   EnsemblGenomes-Gn; EBG00000300010.
DR   EnsemblGenomes-Gn; EBG00000300011.
DR   EnsemblGenomes-Gn; EBG00000300012.
DR   EnsemblGenomes-Gn; EBG00000300013.
DR   EnsemblGenomes-Gn; EBG00000300014.
DR   EnsemblGenomes-Gn; EBG00000300015.
DR   EnsemblGenomes-Gn; EBG00000300016.
DR   EnsemblGenomes-Gn; EBG00000300017.
DR   EnsemblGenomes-Gn; EBG00000300018.
DR   EnsemblGenomes-Gn; EBG00000300019.
DR   EnsemblGenomes-Gn; EBG00000300020.
DR   EnsemblGenomes-Gn; EBG00000300021.
DR   EnsemblGenomes-Gn; EBG00000300022.
DR   EnsemblGenomes-Gn; EBG00000300023.
DR   EnsemblGenomes-Gn; EBG00000300024.
DR   EnsemblGenomes-Gn; EBG00000300025.
DR   EnsemblGenomes-Gn; EBG00000300026.
DR   EnsemblGenomes-Gn; EBG00000300027.
DR   EnsemblGenomes-Gn; EBG00000300028.
DR   EnsemblGenomes-Gn; EBG00000300029.
DR   EnsemblGenomes-Gn; EBG00000300030.
DR   EnsemblGenomes-Gn; EBG00000300031.
DR   EnsemblGenomes-Gn; EBG00000300032.
DR   EnsemblGenomes-Gn; EBG00000300033.
DR   EnsemblGenomes-Gn; EBG00000300034.
DR   EnsemblGenomes-Gn; EBG00000300035.
DR   EnsemblGenomes-Gn; EBG00000300036.
DR   EnsemblGenomes-Gn; EBG00000300037.
DR   EnsemblGenomes-Gn; EBG00000300038.
DR   EnsemblGenomes-Gn; EBG00000300039.
DR   EnsemblGenomes-Gn; EBG00000300040.
DR   EnsemblGenomes-Gn; EBG00000300041.
DR   EnsemblGenomes-Gn; EBG00000300042.
DR   EnsemblGenomes-Gn; EBG00000300043.
DR   EnsemblGenomes-Gn; EBG00000300044.
DR   EnsemblGenomes-Gn; EBG00000300045.
DR   EnsemblGenomes-Gn; EBG00000300046.
DR   EnsemblGenomes-Gn; EBG00000300047.
DR   EnsemblGenomes-Gn; EBG00000300048.
DR   EnsemblGenomes-Gn; EBG00000300049.
DR   EnsemblGenomes-Gn; EBG00000300050.
DR   EnsemblGenomes-Gn; EBG00000300051.
DR   EnsemblGenomes-Gn; EBG00000300052.
DR   EnsemblGenomes-Gn; EBG00000300053.
DR   EnsemblGenomes-Gn; EBG00000300054.
DR   EnsemblGenomes-Gn; EBG00000300055.
DR   EnsemblGenomes-Gn; EBG00000300056.
DR   EnsemblGenomes-Gn; EBG00000300057.
DR   EnsemblGenomes-Gn; EBG00001146893.
DR   EnsemblGenomes-Gn; EBG00001146894.
DR   EnsemblGenomes-Gn; EBG00001146895.
DR   EnsemblGenomes-Gn; EBG00001146896.
DR   EnsemblGenomes-Gn; EBG00001146897.
DR   EnsemblGenomes-Gn; EBG00001146898.
DR   EnsemblGenomes-Gn; EBG00001146899.
DR   EnsemblGenomes-Gn; EBG00001146900.
DR   EnsemblGenomes-Gn; EBG00001146901.
DR   EnsemblGenomes-Gn; EBG00001146902.
DR   EnsemblGenomes-Gn; EBG00001146903.
DR   EnsemblGenomes-Gn; EBG00001146904.
DR   EnsemblGenomes-Gn; EBG00001146905.
DR   EnsemblGenomes-Gn; EBG00001146906.
DR   EnsemblGenomes-Gn; EBG00001146907.
DR   EnsemblGenomes-Gn; EBG00001146908.
DR   EnsemblGenomes-Gn; EBG00001146909.
DR   EnsemblGenomes-Gn; EBG00001146910.
DR   EnsemblGenomes-Gn; EBG00001146911.
DR   EnsemblGenomes-Gn; EBG00001146912.
DR   EnsemblGenomes-Gn; EBG00001146913.
DR   EnsemblGenomes-Gn; EBG00001146914.
DR   EnsemblGenomes-Gn; EBG00001146915.
DR   EnsemblGenomes-Gn; EBG00001146916.
DR   EnsemblGenomes-Gn; EBG00001146917.
DR   EnsemblGenomes-Gn; EBG00001146918.
DR   EnsemblGenomes-Gn; EBG00001146919.
DR   EnsemblGenomes-Gn; EBG00001146920.
DR   EnsemblGenomes-Gn; EBG00001146921.
DR   EnsemblGenomes-Gn; EBG00001146922.
DR   EnsemblGenomes-Gn; EBG00001146923.
DR   EnsemblGenomes-Gn; EBG00001146924.
DR   EnsemblGenomes-Gn; EBG00001146925.
DR   EnsemblGenomes-Gn; EBG00001146926.
DR   EnsemblGenomes-Gn; EBG00001146927.
DR   EnsemblGenomes-Gn; EBG00001146928.
DR   EnsemblGenomes-Gn; EBG00001146929.
DR   EnsemblGenomes-Gn; EBG00001146930.
DR   EnsemblGenomes-Gn; EBG00001146931.
DR   EnsemblGenomes-Gn; EBG00001146932.
DR   EnsemblGenomes-Gn; EBG00001146933.
DR   EnsemblGenomes-Gn; EBG00001146934.
DR   EnsemblGenomes-Gn; EBG00001146935.
DR   EnsemblGenomes-Gn; EBG00001146936.
DR   EnsemblGenomes-Gn; EBG00001146937.
DR   EnsemblGenomes-Gn; EBG00001146938.
DR   EnsemblGenomes-Gn; EBG00001146939.
DR   EnsemblGenomes-Gn; EBG00001146940.
DR   EnsemblGenomes-Gn; EBG00001146941.
DR   EnsemblGenomes-Gn; EBG00001146942.
DR   EnsemblGenomes-Gn; EBG00001146943.
DR   EnsemblGenomes-Gn; EBG00001146944.
DR   EnsemblGenomes-Gn; EBG00001146945.
DR   EnsemblGenomes-Gn; EBG00001146946.
DR   EnsemblGenomes-Gn; EBG00001146947.
DR   EnsemblGenomes-Gn; EBG00001146948.
DR   EnsemblGenomes-Gn; EBG00001146949.
DR   EnsemblGenomes-Gn; EBG00001146950.
DR   EnsemblGenomes-Gn; EBG00001146951.
DR   EnsemblGenomes-Gn; EBG00001146952.
DR   EnsemblGenomes-Gn; EBG00001146953.
DR   EnsemblGenomes-Gn; EBG00001146954.
DR   EnsemblGenomes-Gn; EBG00001146955.
DR   EnsemblGenomes-Gn; EBG00001146956.
DR   EnsemblGenomes-Gn; EBG00001146957.
DR   EnsemblGenomes-Gn; EBG00001146958.
DR   EnsemblGenomes-Gn; EBG00001146959.
DR   EnsemblGenomes-Gn; EBG00001146960.
DR   EnsemblGenomes-Gn; EBG00001146961.
DR   EnsemblGenomes-Gn; EBG00001146962.
DR   EnsemblGenomes-Gn; EBG00001146963.
DR   EnsemblGenomes-Gn; EBG00001146964.
DR   EnsemblGenomes-Gn; EBG00001146965.
DR   EnsemblGenomes-Gn; EBG00001146966.
DR   EnsemblGenomes-Gn; EBG00001146967.
DR   EnsemblGenomes-Gn; EBG00001146968.
DR   EnsemblGenomes-Gn; EBG00001146969.
DR   EnsemblGenomes-Gn; EBG00001146970.
DR   EnsemblGenomes-Gn; EBG00001146971.
DR   EnsemblGenomes-Gn; EBG00001146972.
DR   EnsemblGenomes-Gn; EBG00001146973.
DR   EnsemblGenomes-Gn; EBG00001146974.
DR   EnsemblGenomes-Gn; EBG00001146975.
DR   EnsemblGenomes-Gn; EBG00001146976.
DR   EnsemblGenomes-Gn; EBG00001146977.
DR   EnsemblGenomes-Gn; EBG00001146978.
DR   EnsemblGenomes-Gn; EBG00001146979.
DR   EnsemblGenomes-Gn; EBG00001146980.
DR   EnsemblGenomes-Gn; EBG00001146981.
DR   EnsemblGenomes-Gn; EBG00001146982.
DR   EnsemblGenomes-Gn; EBG00001146983.
DR   EnsemblGenomes-Gn; EBG00001146984.
DR   EnsemblGenomes-Gn; EBG00001146985.
DR   EnsemblGenomes-Gn; EBG00001146986.
DR   EnsemblGenomes-Gn; EBG00001146987.
DR   EnsemblGenomes-Gn; EBG00001146988.
DR   EnsemblGenomes-Gn; EBG00001146989.
DR   EnsemblGenomes-Gn; EBG00001146990.
DR   EnsemblGenomes-Gn; EBG00001146991.
DR   EnsemblGenomes-Gn; EBG00001146992.
DR   EnsemblGenomes-Gn; EBG00001146993.
DR   EnsemblGenomes-Gn; EBG00001146994.
DR   EnsemblGenomes-Gn; EBG00001146995.
DR   EnsemblGenomes-Gn; EBG00001146996.
DR   EnsemblGenomes-Gn; EBG00001146997.
DR   EnsemblGenomes-Gn; EBG00001146998.
DR   EnsemblGenomes-Gn; EBG00001146999.
DR   EnsemblGenomes-Gn; EBG00001147000.
DR   EnsemblGenomes-Gn; EBG00001147001.
DR   EnsemblGenomes-Gn; EBG00001147002.
DR   EnsemblGenomes-Gn; EBG00001147003.
DR   EnsemblGenomes-Gn; EBG00001147004.
DR   EnsemblGenomes-Gn; EBG00001147005.
DR   EnsemblGenomes-Gn; EBG00001147006.
DR   EnsemblGenomes-Gn; EBG00001147007.
DR   EnsemblGenomes-Gn; EBG00001147008.
DR   EnsemblGenomes-Gn; EBG00001147009.
DR   EnsemblGenomes-Gn; EBG00001147010.
DR   EnsemblGenomes-Gn; EBG00001147011.
DR   EnsemblGenomes-Gn; EBG00001147012.
DR   EnsemblGenomes-Gn; EBG00001147013.
DR   EnsemblGenomes-Gn; EBG00001147014.
DR   EnsemblGenomes-Gn; EBG00001147015.
DR   EnsemblGenomes-Gn; EBG00001147016.
DR   EnsemblGenomes-Gn; SCAB_0001.
DR   EnsemblGenomes-Gn; SCAB_0332.
DR   EnsemblGenomes-Gn; SCAB_0342.
DR   EnsemblGenomes-Gn; SCAB_0411.
DR   EnsemblGenomes-Gn; SCAB_0632.
DR   EnsemblGenomes-Gn; SCAB_0652.
DR   EnsemblGenomes-Gn; SCAB_0791.
DR   EnsemblGenomes-Gn; SCAB_0891.
DR   EnsemblGenomes-Gn; SCAB_0912.
DR   EnsemblGenomes-Gn; SCAB_1201.
DR   EnsemblGenomes-Gn; SCAB_1261.
DR   EnsemblGenomes-Gn; SCAB_14151.
DR   EnsemblGenomes-Gn; SCAB_14152.
DR   EnsemblGenomes-Gn; SCAB_14511.
DR   EnsemblGenomes-Gn; SCAB_14562.
DR   EnsemblGenomes-Gn; SCAB_14761.
DR   EnsemblGenomes-Gn; SCAB_1781.
DR   EnsemblGenomes-Gn; SCAB_1822.
DR   EnsemblGenomes-Gn; SCAB_20341.
DR   EnsemblGenomes-Gn; SCAB_20371.
DR   EnsemblGenomes-Gn; SCAB_21621.
DR   EnsemblGenomes-Gn; SCAB_22141.
DR   EnsemblGenomes-Gn; SCAB_23711.
DR   EnsemblGenomes-Gn; SCAB_24161.
DR   EnsemblGenomes-Gn; SCAB_29001.
DR   EnsemblGenomes-Gn; SCAB_29094.
DR   EnsemblGenomes-Gn; SCAB_31762.
DR   EnsemblGenomes-Gn; SCAB_31763.
DR   EnsemblGenomes-Gn; SCAB_31811.
DR   EnsemblGenomes-Gn; SCAB_31812.
DR   EnsemblGenomes-Gn; SCAB_32003.
DR   EnsemblGenomes-Gn; SCAB_32571.
DR   EnsemblGenomes-Gn; SCAB_40171.
DR   EnsemblGenomes-Gn; SCAB_40201.
DR   EnsemblGenomes-Gn; SCAB_40471.
DR   EnsemblGenomes-Gn; SCAB_42751.
DR   EnsemblGenomes-Gn; SCAB_42831.
DR   EnsemblGenomes-Gn; SCAB_43002.
DR   EnsemblGenomes-Gn; SCAB_46961.
DR   EnsemblGenomes-Gn; SCAB_47072.
DR   EnsemblGenomes-Gn; SCAB_48652.
DR   EnsemblGenomes-Gn; SCAB_53481.
DR   EnsemblGenomes-Gn; SCAB_58182.
DR   EnsemblGenomes-Gn; SCAB_68821.
DR   EnsemblGenomes-Gn; SCAB_70612.
DR   EnsemblGenomes-Gn; SCAB_71603.
DR   EnsemblGenomes-Gn; SCAB_71961.
DR   EnsemblGenomes-Gn; SCAB_71971.
DR   EnsemblGenomes-Gn; SCAB_73462.
DR   EnsemblGenomes-Gn; SCAB_7381.
DR   EnsemblGenomes-Gn; SCAB_76711.
DR   EnsemblGenomes-Gn; SCAB_77041.
DR   EnsemblGenomes-Gn; SCAB_77962.
DR   EnsemblGenomes-Gn; SCAB_78901.
DR   EnsemblGenomes-Gn; SCAB_79992.
DR   EnsemblGenomes-Gn; SCAB_80172.
DR   EnsemblGenomes-Gn; SCAB_80173.
DR   EnsemblGenomes-Gn; SCAB_80221.
DR   EnsemblGenomes-Gn; SCAB_81361.
DR   EnsemblGenomes-Gn; SCAB_81371.
DR   EnsemblGenomes-Gn; SCAB_83851.
DR   EnsemblGenomes-Gn; SCAB_90132.
DR   EnsemblGenomes-Gn; SCAB_90251.
DR   EnsemblGenomes-Tr; EBG00000299965-1.
DR   EnsemblGenomes-Tr; EBG00000299966-1.
DR   EnsemblGenomes-Tr; EBG00000299967-1.
DR   EnsemblGenomes-Tr; EBG00000299968-1.
DR   EnsemblGenomes-Tr; EBG00000299969-1.
DR   EnsemblGenomes-Tr; EBG00000299970-1.
DR   EnsemblGenomes-Tr; EBG00000299971-1.
DR   EnsemblGenomes-Tr; EBG00000299972-1.
DR   EnsemblGenomes-Tr; EBG00000299973-1.
DR   EnsemblGenomes-Tr; EBG00000299974-1.
DR   EnsemblGenomes-Tr; EBG00000299975-1.
DR   EnsemblGenomes-Tr; EBG00000299976-1.
DR   EnsemblGenomes-Tr; EBG00000299977-1.
DR   EnsemblGenomes-Tr; EBG00000299978-1.
DR   EnsemblGenomes-Tr; EBG00000299979-1.
DR   EnsemblGenomes-Tr; EBG00000299980-1.
DR   EnsemblGenomes-Tr; EBG00000299981-1.
DR   EnsemblGenomes-Tr; EBG00000299982-1.
DR   EnsemblGenomes-Tr; EBG00000299983-1.
DR   EnsemblGenomes-Tr; EBG00000299984-1.
DR   EnsemblGenomes-Tr; EBG00000299985-1.
DR   EnsemblGenomes-Tr; EBG00000299986-1.
DR   EnsemblGenomes-Tr; EBG00000299987-1.
DR   EnsemblGenomes-Tr; EBG00000299988-1.
DR   EnsemblGenomes-Tr; EBG00000299989-1.
DR   EnsemblGenomes-Tr; EBG00000299990-1.
DR   EnsemblGenomes-Tr; EBG00000299991-1.
DR   EnsemblGenomes-Tr; EBG00000299992-1.
DR   EnsemblGenomes-Tr; EBG00000299993-1.
DR   EnsemblGenomes-Tr; EBG00000299994-1.
DR   EnsemblGenomes-Tr; EBG00000299995-1.
DR   EnsemblGenomes-Tr; EBG00000299996-1.
DR   EnsemblGenomes-Tr; EBG00000299997-1.
DR   EnsemblGenomes-Tr; EBG00000299998-1.
DR   EnsemblGenomes-Tr; EBG00000299999-1.
DR   EnsemblGenomes-Tr; EBG00000300000-1.
DR   EnsemblGenomes-Tr; EBG00000300001-1.
DR   EnsemblGenomes-Tr; EBG00000300002-1.
DR   EnsemblGenomes-Tr; EBG00000300003-1.
DR   EnsemblGenomes-Tr; EBG00000300004-1.
DR   EnsemblGenomes-Tr; EBG00000300005-1.
DR   EnsemblGenomes-Tr; EBG00000300006-1.
DR   EnsemblGenomes-Tr; EBG00000300007-1.
DR   EnsemblGenomes-Tr; EBG00000300008-1.
DR   EnsemblGenomes-Tr; EBG00000300009-1.
DR   EnsemblGenomes-Tr; EBG00000300010-1.
DR   EnsemblGenomes-Tr; EBG00000300011-1.
DR   EnsemblGenomes-Tr; EBG00000300012-1.
DR   EnsemblGenomes-Tr; EBG00000300013-1.
DR   EnsemblGenomes-Tr; EBG00000300014-1.
DR   EnsemblGenomes-Tr; EBG00000300015-1.
DR   EnsemblGenomes-Tr; EBG00000300016-1.
DR   EnsemblGenomes-Tr; EBG00000300017-1.
DR   EnsemblGenomes-Tr; EBG00000300018-1.
DR   EnsemblGenomes-Tr; EBG00000300019-1.
DR   EnsemblGenomes-Tr; EBG00000300020-1.
DR   EnsemblGenomes-Tr; EBG00000300021-1.
DR   EnsemblGenomes-Tr; EBG00000300022-1.
DR   EnsemblGenomes-Tr; EBG00000300023-1.
DR   EnsemblGenomes-Tr; EBG00000300024-1.
DR   EnsemblGenomes-Tr; EBG00000300025-1.
DR   EnsemblGenomes-Tr; EBG00000300026-1.
DR   EnsemblGenomes-Tr; EBG00000300027-1.
DR   EnsemblGenomes-Tr; EBG00000300028-1.
DR   EnsemblGenomes-Tr; EBG00000300029-1.
DR   EnsemblGenomes-Tr; EBG00000300030-1.
DR   EnsemblGenomes-Tr; EBG00000300031-1.
DR   EnsemblGenomes-Tr; EBG00000300032-1.
DR   EnsemblGenomes-Tr; EBG00000300033-1.
DR   EnsemblGenomes-Tr; EBG00000300034-1.
DR   EnsemblGenomes-Tr; EBG00000300035-1.
DR   EnsemblGenomes-Tr; EBG00000300036-1.
DR   EnsemblGenomes-Tr; EBG00000300037-1.
DR   EnsemblGenomes-Tr; EBG00000300038-1.
DR   EnsemblGenomes-Tr; EBG00000300039-1.
DR   EnsemblGenomes-Tr; EBG00000300040-1.
DR   EnsemblGenomes-Tr; EBG00000300041-1.
DR   EnsemblGenomes-Tr; EBG00000300042-1.
DR   EnsemblGenomes-Tr; EBG00000300043-1.
DR   EnsemblGenomes-Tr; EBG00000300044-1.
DR   EnsemblGenomes-Tr; EBG00000300045-1.
DR   EnsemblGenomes-Tr; EBG00000300046-1.
DR   EnsemblGenomes-Tr; EBG00000300047-1.
DR   EnsemblGenomes-Tr; EBG00000300048-1.
DR   EnsemblGenomes-Tr; EBG00000300049-1.
DR   EnsemblGenomes-Tr; EBG00000300050-1.
DR   EnsemblGenomes-Tr; EBG00000300051-1.
DR   EnsemblGenomes-Tr; EBG00000300052-1.
DR   EnsemblGenomes-Tr; EBG00000300053-1.
DR   EnsemblGenomes-Tr; EBG00000300054-1.
DR   EnsemblGenomes-Tr; EBG00000300055-1.
DR   EnsemblGenomes-Tr; EBG00000300056-1.
DR   EnsemblGenomes-Tr; EBG00000300057-1.
DR   EnsemblGenomes-Tr; EBT00001563280.
DR   EnsemblGenomes-Tr; EBT00001563286.
DR   EnsemblGenomes-Tr; EBT00001563288.
DR   EnsemblGenomes-Tr; EBT00001563291.
DR   EnsemblGenomes-Tr; EBT00001563293.
DR   EnsemblGenomes-Tr; EBT00001563294.
DR   EnsemblGenomes-Tr; EBT00001563295.
DR   EnsemblGenomes-Tr; EBT00001563297.
DR   EnsemblGenomes-Tr; EBT00001563301.
DR   EnsemblGenomes-Tr; EBT00001563303.
DR   EnsemblGenomes-Tr; EBT00001563306.
DR   EnsemblGenomes-Tr; EBT00001563307.
DR   EnsemblGenomes-Tr; EBT00001563308.
DR   EnsemblGenomes-Tr; EBT00001563312.
DR   EnsemblGenomes-Tr; EBT00001563315.
DR   EnsemblGenomes-Tr; EBT00001563317.
DR   EnsemblGenomes-Tr; EBT00001563319.
DR   EnsemblGenomes-Tr; EBT00001563320.
DR   EnsemblGenomes-Tr; EBT00001563321.
DR   EnsemblGenomes-Tr; EBT00001563323.
DR   EnsemblGenomes-Tr; EBT00001563324.
DR   EnsemblGenomes-Tr; EBT00001563326.
DR   EnsemblGenomes-Tr; EBT00001563328.
DR   EnsemblGenomes-Tr; EBT00001563331.
DR   EnsemblGenomes-Tr; EBT00001563332.
DR   EnsemblGenomes-Tr; EBT00001563333.
DR   EnsemblGenomes-Tr; EBT00001563335.
DR   EnsemblGenomes-Tr; EBT00001563340.
DR   EnsemblGenomes-Tr; EBT00001563341.
DR   EnsemblGenomes-Tr; EBT00001563342.
DR   EnsemblGenomes-Tr; EBT00001563346.
DR   EnsemblGenomes-Tr; EBT00001563348.
DR   EnsemblGenomes-Tr; EBT00001563349.
DR   EnsemblGenomes-Tr; EBT00001563350.
DR   EnsemblGenomes-Tr; EBT00001563355.
DR   EnsemblGenomes-Tr; EBT00001563358.
DR   EnsemblGenomes-Tr; EBT00001563359.
DR   EnsemblGenomes-Tr; EBT00001563360.
DR   EnsemblGenomes-Tr; EBT00001563361.
DR   EnsemblGenomes-Tr; EBT00001563364.
DR   EnsemblGenomes-Tr; EBT00001563365.
DR   EnsemblGenomes-Tr; EBT00001563367.
DR   EnsemblGenomes-Tr; EBT00001563369.
DR   EnsemblGenomes-Tr; EBT00001563370.
DR   EnsemblGenomes-Tr; EBT00001563371.
DR   EnsemblGenomes-Tr; EBT00001563373.
DR   EnsemblGenomes-Tr; EBT00001563374.
DR   EnsemblGenomes-Tr; EBT00001563376.
DR   EnsemblGenomes-Tr; EBT00001563378.
DR   EnsemblGenomes-Tr; EBT00001563379.
DR   EnsemblGenomes-Tr; EBT00001563380.
DR   EnsemblGenomes-Tr; EBT00001563382.
DR   EnsemblGenomes-Tr; EBT00001563385.
DR   EnsemblGenomes-Tr; EBT00001563389.
DR   EnsemblGenomes-Tr; EBT00001563390.
DR   EnsemblGenomes-Tr; EBT00001563391.
DR   EnsemblGenomes-Tr; EBT00001563392.
DR   EnsemblGenomes-Tr; EBT00001563393.
DR   EnsemblGenomes-Tr; EBT00001563396.
DR   EnsemblGenomes-Tr; EBT00001563397.
DR   EnsemblGenomes-Tr; EBT00001563400.
DR   EnsemblGenomes-Tr; EBT00001563401.
DR   EnsemblGenomes-Tr; EBT00001563404.
DR   EnsemblGenomes-Tr; EBT00001563406.
DR   EnsemblGenomes-Tr; EBT00001563408.
DR   EnsemblGenomes-Tr; EBT00001563409.
DR   EnsemblGenomes-Tr; EBT00001563410.
DR   EnsemblGenomes-Tr; EBT00001563412.
DR   EnsemblGenomes-Tr; EBT00001563413.
DR   EnsemblGenomes-Tr; EBT00001563416.
DR   EnsemblGenomes-Tr; EBT00001563419.
DR   EnsemblGenomes-Tr; EBT00001563420.
DR   EnsemblGenomes-Tr; EBT00001563422.
DR   EnsemblGenomes-Tr; EBT00001563424.
DR   EnsemblGenomes-Tr; EBT00001563426.
DR   EnsemblGenomes-Tr; EBT00001563427.
DR   EnsemblGenomes-Tr; EBT00001563428.
DR   EnsemblGenomes-Tr; EBT00001563429.
DR   EnsemblGenomes-Tr; EBT00001563430.
DR   EnsemblGenomes-Tr; EBT00001563431.
DR   EnsemblGenomes-Tr; EBT00001563432.
DR   EnsemblGenomes-Tr; EBT00001563433.
DR   EnsemblGenomes-Tr; EBT00001563434.
DR   EnsemblGenomes-Tr; EBT00001563435.
DR   EnsemblGenomes-Tr; EBT00001563436.
DR   EnsemblGenomes-Tr; EBT00001563437.
DR   EnsemblGenomes-Tr; EBT00001563438.
DR   EnsemblGenomes-Tr; EBT00001563439.
DR   EnsemblGenomes-Tr; EBT00001563440.
DR   EnsemblGenomes-Tr; EBT00001563441.
DR   EnsemblGenomes-Tr; EBT00001563442.
DR   EnsemblGenomes-Tr; EBT00001563444.
DR   EnsemblGenomes-Tr; EBT00001563446.
DR   EnsemblGenomes-Tr; EBT00001563448.
DR   EnsemblGenomes-Tr; EBT00001563449.
DR   EnsemblGenomes-Tr; EBT00001563450.
DR   EnsemblGenomes-Tr; EBT00001563451.
DR   EnsemblGenomes-Tr; EBT00001563452.
DR   EnsemblGenomes-Tr; EBT00001563453.
DR   EnsemblGenomes-Tr; EBT00001563454.
DR   EnsemblGenomes-Tr; EBT00001563455.
DR   EnsemblGenomes-Tr; EBT00001563456.
DR   EnsemblGenomes-Tr; EBT00001563457.
DR   EnsemblGenomes-Tr; EBT00001563458.
DR   EnsemblGenomes-Tr; EBT00001563459.
DR   EnsemblGenomes-Tr; EBT00001563460.
DR   EnsemblGenomes-Tr; EBT00001563461.
DR   EnsemblGenomes-Tr; EBT00001563462.
DR   EnsemblGenomes-Tr; EBT00001563463.
DR   EnsemblGenomes-Tr; EBT00001563464.
DR   EnsemblGenomes-Tr; EBT00001563465.
DR   EnsemblGenomes-Tr; EBT00001563466.
DR   EnsemblGenomes-Tr; EBT00001563467.
DR   EnsemblGenomes-Tr; EBT00001563468.
DR   EnsemblGenomes-Tr; EBT00001563469.
DR   EnsemblGenomes-Tr; EBT00001563470.
DR   EnsemblGenomes-Tr; EBT00001563471.
DR   EnsemblGenomes-Tr; EBT00001563472.
DR   EnsemblGenomes-Tr; EBT00001563473.
DR   EnsemblGenomes-Tr; EBT00001563474.
DR   EnsemblGenomes-Tr; EBT00001563475.
DR   EnsemblGenomes-Tr; EBT00001563476.
DR   EnsemblGenomes-Tr; EBT00001563477.
DR   EnsemblGenomes-Tr; EBT00001563478.
DR   EnsemblGenomes-Tr; SCAB_0001.
DR   EnsemblGenomes-Tr; SCAB_0332.
DR   EnsemblGenomes-Tr; SCAB_0342.
DR   EnsemblGenomes-Tr; SCAB_0411.
DR   EnsemblGenomes-Tr; SCAB_0632.
DR   EnsemblGenomes-Tr; SCAB_0652.
DR   EnsemblGenomes-Tr; SCAB_0791.
DR   EnsemblGenomes-Tr; SCAB_0891.
DR   EnsemblGenomes-Tr; SCAB_0912.
DR   EnsemblGenomes-Tr; SCAB_1201.
DR   EnsemblGenomes-Tr; SCAB_1261.
DR   EnsemblGenomes-Tr; SCAB_14151.
DR   EnsemblGenomes-Tr; SCAB_14152.
DR   EnsemblGenomes-Tr; SCAB_14511.
DR   EnsemblGenomes-Tr; SCAB_14562.
DR   EnsemblGenomes-Tr; SCAB_14761.
DR   EnsemblGenomes-Tr; SCAB_1781.
DR   EnsemblGenomes-Tr; SCAB_1822.
DR   EnsemblGenomes-Tr; SCAB_20341.
DR   EnsemblGenomes-Tr; SCAB_20371.
DR   EnsemblGenomes-Tr; SCAB_21621.
DR   EnsemblGenomes-Tr; SCAB_22141.
DR   EnsemblGenomes-Tr; SCAB_23711.
DR   EnsemblGenomes-Tr; SCAB_24161.
DR   EnsemblGenomes-Tr; SCAB_29001.
DR   EnsemblGenomes-Tr; SCAB_29094.
DR   EnsemblGenomes-Tr; SCAB_31762.
DR   EnsemblGenomes-Tr; SCAB_31763.
DR   EnsemblGenomes-Tr; SCAB_31811.
DR   EnsemblGenomes-Tr; SCAB_31812.
DR   EnsemblGenomes-Tr; SCAB_32003.
DR   EnsemblGenomes-Tr; SCAB_32571.
DR   EnsemblGenomes-Tr; SCAB_40171.
DR   EnsemblGenomes-Tr; SCAB_40201.
DR   EnsemblGenomes-Tr; SCAB_40471.
DR   EnsemblGenomes-Tr; SCAB_42751.
DR   EnsemblGenomes-Tr; SCAB_42831.
DR   EnsemblGenomes-Tr; SCAB_43002.
DR   EnsemblGenomes-Tr; SCAB_46961.
DR   EnsemblGenomes-Tr; SCAB_47072.
DR   EnsemblGenomes-Tr; SCAB_48652.
DR   EnsemblGenomes-Tr; SCAB_53481.
DR   EnsemblGenomes-Tr; SCAB_58182.
DR   EnsemblGenomes-Tr; SCAB_68821.
DR   EnsemblGenomes-Tr; SCAB_70612.
DR   EnsemblGenomes-Tr; SCAB_71603.
DR   EnsemblGenomes-Tr; SCAB_71961.
DR   EnsemblGenomes-Tr; SCAB_71971.
DR   EnsemblGenomes-Tr; SCAB_73462.
DR   EnsemblGenomes-Tr; SCAB_7381.
DR   EnsemblGenomes-Tr; SCAB_76711.
DR   EnsemblGenomes-Tr; SCAB_77041.
DR   EnsemblGenomes-Tr; SCAB_77962.
DR   EnsemblGenomes-Tr; SCAB_78901.
DR   EnsemblGenomes-Tr; SCAB_79992.
DR   EnsemblGenomes-Tr; SCAB_80172.
DR   EnsemblGenomes-Tr; SCAB_80173.
DR   EnsemblGenomes-Tr; SCAB_80221.
DR   EnsemblGenomes-Tr; SCAB_81361.
DR   EnsemblGenomes-Tr; SCAB_81371.
DR   EnsemblGenomes-Tr; SCAB_83851.
DR   EnsemblGenomes-Tr; SCAB_90132.
DR   EnsemblGenomes-Tr; SCAB_90251.
DR   EuropePMC; PMC3072421; 21490938.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01782; ASpks.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; FN554889.
DR   SILVA-SSU; FN554889.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..10148695
FT                   /organism="Streptomyces scabiei 87.22"
FT                   /strain="87.22"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:680198"
FT   misc_feature    1..18486
FT                   /note="terminal inverted repeat (left)"
FT   misc_feature    17..35
FT                   /note="PMID: 16952952"
FT                   /note="PMID: 16957187"
FT                   /note="TIRr1L; predicted stem-loop; one of four perfect
FT                   repeats CACATCGCTGCGCGATGTGCA; CACATCGC Watson-Crick pairs
FT                   to GTGTAGCG; inside terminal inverted repeat region (TIR)
FT                   see also 145..165, complement(10148659..10148679),
FT                   complement(10148531..10148551)"
FT   misc_feature    join(42..52,56..66)
FT                   /note="PMID: 16952952"
FT                   /note="PMID: 16957187"
FT                   /note="TIRr2L; predicted stem-loop; AACACCCGTGC
FT                   Watson-Crick pairs to TTGTGGGCACG; inside terminal inverted
FT                   repeat region (TIR) see also
FT                   complement(join(10148630..10148640,10148644..10148654))"
FT   misc_feature    join(67..76,80..89)
FT                   /note="PMID: 16952952"
FT                   /note="PMID: 16957187"
FT                   /note="TIRr3L; predicted stem-loop; GCGCTTCCGC Watson-Crick
FT                   pairs to GCGGAAGCGC; inside terminal inverted repeat region
FT                   (TIR) see also
FT                   complement(join(10148607..10148616,10148620..10148629))"
FT   misc_feature    join(92..100,104..112)
FT                   /note="PMID: 16952952"
FT                   /note="PMID: 16957187"
FT                   /note="TIRr4L; predicted stem-loop; GCGATGGGC Watson-Crick
FT                   pairs to GCCCATCGC; inside terminal inverted repeat region
FT                   (TIR) see also
FT                   complement(join(10148584..10148592,10148596..10148604))"
FT   misc_feature    join(115..126,130..141)
FT                   /note="PMID: 16952952"
FT                   /note="PMID: 16957187"
FT                   /note="TIRr5L; predicted stem-loop; CAACTCGATTGC
FT                   Watson-Crick pairs to GCAATCGAGTTG; inside terminal
FT                   inverted repeat region (TIR) see also
FT                   complement(join(10148555..10148566,10148570..10148581))"
FT   misc_feature    145..165
FT                   /note="PMID: 16952952"
FT                   /note="PMID: 16957187"
FT                   /note="TIRr6L; predicted stem-loop; one of four perfect
FT                   repeats CACATCGCTGCGCGATGTGCA inside treminal inverted
FT                   repeat region (TIR) see also 17..35,
FT                   complement(10148659..10148679),
FT                   complement(10148533..10148551)"
FT   CDS_pept        506..1018
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0001"
FT                   /note="cluster 0305 with SCAB91071; pseudo: missing STOP"
FT   CDS_pept        1192..1650
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0021"
FT                   /product="conserved hypothetical protein"
FT                   /note="cluster 0306 with SCAB91051"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0021"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67231"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZB86"
FT                   /protein_id="CBG67231.1"
FT                   /translation="MARGRPSARDTEGSEPSAELVERVMDVCEQHYTAVTGTNSEHWDQ
FT                   EASRELVDISLRTVHLAEPERYPQTLDAYLHEHQARLKRLWHRYGPGGMFAGELVLIDL
FT                   PGCFVLCERIETTPLWLEGIWTQKGQEEIALERLQNSWLYDTGEEDGR"
FT   CDS_pept        1647..4316
FT                   /transl_table=11
FT                   /gene="ttrA1"
FT                   /locus_tag="SCAB_0031"
FT                   /product="putative helicase-like protein"
FT                   /note="PMID:12127493"
FT                   /note="PMID:10784050"
FT                   /note="many more matches amongst Streptomyces genus"
FT                   /note="cluster 0307 with SCAB91041"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0031"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67232"
FT                   /db_xref="GOA:C9ZB85"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005114"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZB85"
FT                   /protein_id="CBG67232.1"
FT                   /translation="MSRIPLKKHQIDQKSSFRKWVGFSARSSVPPQGARGTIVSATGSG
FT                   KTIMAAASALECFPEGRILVTVPTLDLLVQTAQAWRAVGHRSPMVAVCSLENDPVLNEL
FT                   GVRTTTNPIQLALWAGHGPVIVFATYASLVDREDFDDPTGQGKVRGPLEAALTGGERLY
FT                   GQQMDGFALAIIDEAHSTAGDLGRPWAALHDNTRIAADFRLYLTATPRILAAPRPQKGA
FT                   DGQEFEIASMGQDSETYGPWLAELGLSEAIEREILAGFEIDVLEIRDPSPVLGESEEAQ
FT                   RGRRLALLQTALLEHAAAYNLRTVMTFHQKVEEAAAFAEKMPKTAAELYVNDASDDDLA
FT                   AADRLPKSSIDAEFYELEASRHVPPDRVWSAWLCGDHLVSERREVLRQFANGIDATNRR
FT                   VHRAFLASVRVLGEGVDITGERGVEAICFADTRGSQVEIVQNIGRALRLNRDGSTKVAR
FT                   IIVPIFLEPGEDPTDMVASASFRPLVAILQGLRSHDERLVEQLASRALSSGKRKVHIQR
FT                   DEDGQIVGTGGESDGEDQEQDGTGAAAESALLHFSSPRDAATIAAFLRTRVYRPESLVW
FT                   LEGYQALIRWRKENEITGLYAVPYGVEVEVGVTKDFPLGRWVHQQRKALRAGELEERRK
FT                   TLLDAPEAGMVWEPGEEAWETKLAALRSYRQATGHLAPRQDALWGESEAEGLVPIGQHI
FT                   ANLRRKGGLGKDPKRAEERAKQLAAVDEDWNCPWPLDWQRHYRVLADLVDADGHLPDIA
FT                   PGVLMDGDDIGRWLQRQAQPATWAQLSTEQQERLSKLGVKPVQAPSPPPAATRATKGPG
FT                   KAQQAFQRGLAALAQWVEREGAHRPVPRGHAEEIAVDGETEPVAVRLGVWVSNTKSRRD
FT                   KLTQDQLDALGKLGIDWI"
FT   misc_feature    1653..2282
FT                   /gene="ttrA1"
FT                   /locus_tag="SCAB_0031"
FT                   /note="HMMPfam hit to PF04851, Type III restriction enzyme,
FT                   res subunit, score 3.5e-07"
FT                   /inference="protein motif:PFAM:PF04851"
FT   misc_feature    1674..2291
FT                   /gene="ttrA1"
FT                   /locus_tag="SCAB_0031"
FT                   /note="HMMPfam hit to PF00270, DEAD/DEAH box helicase,
FT                   score 5.9e-05"
FT                   /inference="protein motif:PFAM:PF00270"
FT   misc_feature    2733..2993
FT                   /gene="ttrA1"
FT                   /locus_tag="SCAB_0031"
FT                   /note="HMMPfam hit to PF00271, Helicase conserved
FT                   C-terminal domain, score 0.0058"
FT                   /inference="protein motif:PFAM:PF00271"
FT   misc_feature    3351..3578
FT                   /gene="ttrA1"
FT                   /locus_tag="SCAB_0031"
FT                   /note="HMMPfam hit to PF03457, Helicase associated domain,
FT                   score 1.8e-21"
FT                   /inference="protein motif:PFAM:PF03457"
FT   misc_feature    3585..3815
FT                   /gene="ttrA1"
FT                   /locus_tag="SCAB_0031"
FT                   /note="HMMPfam hit to PF03457, Helicase associated domain,
FT                   score 1.6e-13"
FT                   /inference="protein motif:PFAM:PF03457"
FT   misc_feature    3819..4025
FT                   /gene="ttrA1"
FT                   /locus_tag="SCAB_0031"
FT                   /note="HMMPfam hit to PF03457, Helicase associated domain,
FT                   score 3.9e-24"
FT                   /inference="protein motif:PFAM:PF03457"
FT   misc_feature    4077..4307
FT                   /gene="ttrA1"
FT                   /locus_tag="SCAB_0031"
FT                   /note="HMMPfam hit to PF03457, Helicase associated domain,
FT                   score 4.8e-22"
FT                   /inference="protein motif:PFAM:PF03457"
FT   CDS_pept        complement(4364..4885)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="PMID:12618462"
FT                   /note="match to A. nicotinovorans plasmid not significant
FT                   but circumstantial evidence - SCAB0051, SCAB0061 also hit
FT                   same sequence"
FT                   /note="cluster 0308 with SCAB91031"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0041"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67233"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZB84"
FT                   /protein_id="CBG67233.1"
FT                   /translation="MLERLQTALAAAARDHTPVTVAALARTARVSRTFLYQNQQARALI
FT                   EQATRTSRPHPGVSSSASRAQSAWKERALNAEDALTQAQREIRTQRTRIAELLGKIRDL
FT                   EHDLPEGALQRIVTENTTLKQHVRQLTQDNQQIQERLTSARQNNRFMDKRIADLEAQLA
FT                   PYLTTPPPRP"
FT   misc_feature    complement(4400..4528)
FT                   /locus_tag="SCAB_0041"
FT                   /note="predicted coiled-coil region"
FT   misc_feature    complement(4562..4690)
FT                   /locus_tag="SCAB_0041"
FT                   /note="predicted coiled-coil region"
FT   CDS_pept        complement(4936..7530)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0051"
FT                   /product="conserved hypothetical protein"
FT                   /note="PMID:12618462"
FT                   /note="PMID:12923100"
FT                   /note="PMID:16547041"
FT                   /note="cluster 0309 with SCAB91021"
FT                   /note="SCAB0041 and SCAB0061 also have similarity to A.
FT                   nicotinovorans plasmid"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0051"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67234"
FT                   /db_xref="GOA:C9ZB83"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZB83"
FT                   /protein_id="CBG67234.1"
FT                   /translation="MISLTLLPGRTDTTRVGRDRLELLTALIDAPAFDPLFRDPLIFIP
FT                   PQHPVYAWQCAVDGCLRIRRVSHNLCNTHNLEWEQAERAGQAKRAFMDAAGALPAARGV
FT                   DYGRCLVCPDRPAISPTTRLCQQHQTRWHYGEAAGMDQDRFEHWARTQDPLPGYGLCQA
FT                   RCPFLACTSLGLCLQHLNRYKIDNRPGGARSQNSRGPLKDGRPLPVTYGDEKTFRAWCA
FT                   AAEPVTQPGLVNLHGLSPLLRAEIQWGLHTHAQAAQHSEWSTNGIRNLVRYCWRGSITS
FT                   LMDLHDEGYAGLTRKQMDSEVRKIIWEIINGLRCVYYSPSDTKDAGFLETDHFGRRFKN
FT                   AQSHFDITAVPQRWLRDLLWDHLAELLRSPQCPRTRGPFDQMRRAAVELGVFLQADAPD
FT                   AGHDHTALRREHAERFVADQRHRARHSLPSLGMVLVDGRSPTVTDLSCQFVFNQSRKLL
FT                   YSAITAGHAERLGIDTGFLTAIPFGGTGIKQRSRNPFSDDVARALTDETNLRRLEELDL
FT                   NDRGLRDIWETIVATGRRCSEVVGLRLDCIGRYRGLAMLWHDQTKVGNYNEGIRIPEPV
FT                   YQCLDARRTKTLHRFEKRYGRTPTAAERPGLALFPSRIRNPNGRQPISYGHFNQRFKTW
FT                   IAGLDLGGAYVAHQARHTLATNLLRAGATLTHIRRYLGQLSERMAEHYVKITNSDLEDV
FT                   LNTVWVAGPGAPHPGELLSGDTTPIDRETALALALDLSRRSTPADGGFCTYQPVVDGGA
FT                   CPWKLDCENCDNFVLSGADLLYWRRKAEQWRSIAENAPDDATADYLHTVFEPTAKAIKG
FT                   LEQALAALGILDEALTLDLRRPQDYFHRTWSTAFRARDLAALQAPDDATGQP"
FT   misc_feature    complement(5452..6024)
FT                   /locus_tag="SCAB_0051"
FT                   /note="HMMPfam hit to PF00589, Phage integrase family,
FT                   score 7.8e-07"
FT                   /inference="protein motif:PFAM:PF00589"
FT   CDS_pept        complement(7527..8687)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="PMID:12618462"
FT                   /note="cluster 0310 with SCAB91011"
FT                   /note="SCAB0041 and SCAB0051 also have similarity to A.
FT                   nicotinovorans plasmid; note codon 5 TTA-Leu BldA target"
FT                   /note="TTA-Leu codon(s) 5 may indicate regulation by BldA"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0061"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67235"
FT                   /db_xref="GOA:C9Z9V5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C9Z9V5"
FT                   /protein_id="CBG67235.1"
FT                   /translation="MVGELRVQEIVRGNGQVSYTVVDTDCTLVAEADGFLRACRAGTDR
FT                   TYAYVLVDHLRWLRFAGLTVESVSLEDLRHYMAALGADYPGPFGLPWRENKRPYGHSAL
FT                   KTTAACLKGFYLRLGTHGVNPALAEALRVTRLPTRVDRRRAMLGHVLHSMPANPLAPAE
FT                   QIRRHPKMLPEGAREVLSGAVSCARDRMVVTWLADGGFRIGELCGLRLVDLHLREQAAC
FT                   GQCRGPHVHICHREDNANRARVKTKTPWTWQDNVVSGGTVRRASPAMIHTYFEYITTQY
FT                   PAQTAHGMLLVSLHGPSRGQPWTTAAARGMLRRAAARGQIGRVVPHAFRHSFATAVLDA
FT                   ARGNAVIAREAGGWASAATVEQVYGHVDVHDPVFAAALEQVWGARP"
FT   misc_feature    complement(7566..8195)
FT                   /locus_tag="SCAB_0061"
FT                   /note="HMMPfam hit to PF00589, Phage integrase family,
FT                   score 2e-05"
FT                   /inference="protein motif:PFAM:PF00589"
FT   regulatory      complement(8673..8675)
FT                   /note="TTA_Leu (rare) indicates regulation by availability
FT                   of BldA"
FT                   /regulatory_class="other"
FT   CDS_pept        complement(8877..9815)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0071"
FT                   /product="conserved hypothetical protein"
FT                   /note="PMID: 6318753"
FT                   /note="nearest match sequenced as part of S. hygroscopicus
FT                   hygromycin B biosynthesis cluster"
FT                   /note="cluster 0311 with SCAB91001"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0071"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67236"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZB93"
FT                   /protein_id="CBG67236.1"
FT                   /translation="MSRRRLHALGTSDSEDSPKGRNPGVPLCEYKESSSCRDGAVHHAR
FT                   TTAAQDGYFGVDTPTRLCGYRPGLLTIWMKDGVLMASPTATPGVSDGALSPLGQRLRVL
FT                   LGAERVVGDLRRYFGIDLPPDGVPYTGSRFEHLAGGGDRPEVANRFTAEDLVAVQTLSV
FT                   TVPAAVALDLLEGPLGARLSGLLHAIPRDIDMVDADADVVADGSPADQAWQLLEDQPDV
FT                   GWVIAGKLLARKRPRLLPVYDKVVRCALGRPRPSFWLALHAALRADDHALHRQLFELRQ
FT                   VAGVPETVSALRICDVAVWMGHRAEGHACPR"
FT   CDS_pept        complement(9853..10953)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0081"
FT                   /product="putative secreted protein"
FT                   /note="cluster 0312 with SCAB90991"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0081"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67237"
FT                   /db_xref="GOA:C9Z9V3"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:C9Z9V3"
FT                   /protein_id="CBG67237.1"
FT                   /translation="MTRTIGLALSGGGSRAAAFHLGCLRALHDRDLLDCIRVVSGISGG
FT                   SLLAALWAYGPKEFTDFDASTTDLLRSGLQLDIARQAFKPSAAARNLTAAARAGTRQLF
FT                   TRTTQVTVARPANRTDALAAVLAHKAFGTTTLADVTHPGLDVVLTATDLATTNAVRFGS
FT                   TRSGCSRYGTITEPVHVATAVAASAAYPVFLPALERTFTFQYRDGHHQQHTVLLTDGGV
FT                   YDNLGLSVLEPGRSPHHTQHVYDVPFIISCDAGLGELALKAPHFMFGRLSRSFATVHRK
FT                   AQDSARARLHEWAASGRIDGFALAYLGMKDDRLPAPPADLVPRSAVASYPTNFAAMARS
FT                   DFEAITTRGEQLMRTVLPMYLRPAHG"
FT   misc_feature    complement(10258..10935)
FT                   /locus_tag="SCAB_0081"
FT                   /note="HMMPfam hit to PF01734, Patatin-like phospholipase,
FT                   score 1e-12"
FT                   /inference="protein motif:PFAM:PF01734"
FT   misc_feature    complement(10900..10953)
FT                   /locus_tag="SCAB_0081"
FT                   /note="Signal peptide predicted for SCAB0081 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.660) with cleavage site
FT                   probability 0.573 between residues 18 and 19"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(10950..13493)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0091"
FT                   /product="conserved hypothetical protein"
FT                   /note="PMID:16452442"
FT                   /note="cluster 0313 with SCAB90981"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0091"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67238"
FT                   /db_xref="GOA:C9Z9V2"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="InterPro:IPR032865"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:C9Z9V2"
FT                   /protein_id="CBG67238.1"
FT                   /translation="MKDSATLELTEGQQLAIDQLHRIVQASRGSVAATHVAATAGGYVE
FT                   ARVSVGCANLSPTQGGLRLRSVEAVTLRIPPNFPFTAPSVQTRHTRFAGAPHVNWGRHL
FT                   CLYRSTATEWDPADGMYGFITRLLDWFEAAAAGQLDRPGEPLHPPNALTDHTAGLLVIR
FT                   HDAPVARPDGPWLGAAVLHQVNDIRCDVVDWLAVEDPWPDSLEQLRESAALPAGARAFL
FT                   APVVVTTKHLTFEYPLTARELVESLARDHITPRLLLGLTGFVAGHNRTLLCPDADATVS
FT                   TGDDEDTPAAPVHLLLGTPSRGIAGDGPRRTHLVAWHLPDFADQVGRLTADTAFSGHAY
FT                   LAELGDEVVRFGTDWLDRQSTRWMRVYEARPEVTVRRDHASPAAWLRGKRILVLGAGAL
FT                   GAPVADMCARAGAAHLTVADHGLVHPGILARQPYTDADIGFSKARVLADRLNRIDPHAT
FT                   RVEALVGNVTTQLSALDLHTFDLIWDCTANRIVRAHLERARRTDTAPWPHLATLMIGHH
FT                   ATRGIAAISPRGATGGGTDVLRRTALAAHADATRAFDDLIDDFFPTTPPTELFQPEPGC
FT                   SDATFTGSAADVTALAGQLATGVLHALAEPADRHAMAVLIVRMPTGPTSTQPSGPRWLT
FT                   WPNDTLATDEATGYDVRITPAALAEMRAEARRGARVRGPRVETGGTLLGAVDDATGVIF
FT                   IDEATGPPPDSLLTEAYFQHGLDGVGGHLTARRKATGNISRFLGMWHTHPHTAAQPSTT
FT                   DRAAMTSLTLPLDDAPARALVLIAGGPPPVWHQWLATGDSPDLYAHLAARTASVTVEPP
FT                   PQQPPAHLGPVQWWPGGYSTRPHSPVPVPRKGSRS"
FT   misc_feature    complement(11934..12335)
FT                   /locus_tag="SCAB_0091"
FT                   /note="HMMPfam hit to PF00899, ThiF family, score 1e-19"
FT                   /inference="protein motif:PFAM:PF00899"
FT   CDS_pept        complement(13490..14809)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0101"
FT                   /product="conserved hypothetical protein"
FT                   /note="PMID:16452442"
FT                   /note="cluster 0314 with SCAB90971"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0101"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67239"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZB96"
FT                   /protein_id="CBG67239.1"
FT                   /translation="MKRCDMVEAELPGQGVVFWPVGTGDSTTIVLGDNLVMQVDLRDMK
FT                   AADEDDAVVAAVIDRLEETLPQPDGTTPYLAVFALTHADSDHCCGFGDLLESSILIGEI
FT                   WATPRLWRELSEDKPMCEDAQRFQDEVERRVDATLKAIKDGKEPPSGDRVRIIGYDEDR
FT                   ELHSYAELPDEYFTFPGDVITKVDGEDVADRFEAFVHAPFKDHCAGDRNDTSLALQVQL
FT                   KASDGTVGRLLFLGDLAYPIIKMIFENSEAAGNADRVEWDVLLSPHHCSKKAMYAEGED
FT                   GKEELKQDLLDLLQAHASPDARVIASSLPFREKDEKGNNPPHLLARDAYASITDYEVLC
FT                   TGEYPSKEEPRPVVFALEAGLGLELVDVTDLENKSQVLHAAGGGRRLLAALGTTRFPAT
FT                   ALTAAAGLPRQRGTDAARAGVQRARGDKAEPAVQIGFGAA"
FT   CDS_pept        15414..15791
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0111"
FT                   /product="hypothetical protein"
FT                   /note="cluster 0315 with SCAB90961"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0111"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67240"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZB97"
FT                   /protein_id="CBG67240.1"
FT                   /translation="MEATGIRKRFLGLPVDIAFDDAELARVCNSDAARRVRFGPEAAAA
FT                   LHRRLGQMAAADHLADLHRLAAARLRPDPADSGISRVVSLGDHGHLVVRPRDDPPAAHR
FT                   DGTLDEHSVRALIVTAIAITR"
FT   CDS_pept        15838..16983
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0121"
FT                   /product="putative DNA-binding protein"
FT                   /note="cluster 0316 with SCAB90951"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0121"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67241"
FT                   /db_xref="GOA:C9Z9U9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C9Z9U9"
FT                   /protein_id="CBG67241.1"
FT                   /translation="MTPPPAPPFAYAPDSAQPPGETLKEQLEALGIPQADLARRTGLST
FT                   KHINQIVQGTAVLTPETALLLERATGIPASMWNQLEAAWRTHVTRQQELQQLSKRIDWL
FT                   DNFSLTELVKRSILPNKDRSADNLQRLLAFFGVADPGVAEDLWRSYRTAFRRSTVLKTD
FT                   DYATAVWLRQAELKARALPCQPFDRAALTALLPSLRALTLDDPATWPGRITQLCAQAGV
FT                   AVVFLPAPPLTSVSGVTRWLTPDKVGIALSDRFKKDDHFWFTVFHEIGHTLLHGKRLTF
FT                   LDNTDRADERTPEGDRSEEEADTFAAQTLIPPEHNAAYRRLARRPMPFDNVKAFARQAG
FT                   IAPGIVVGRLQHDGALPWTHGNNLKRPVRFPHNGPAEDQPQ"
FT   misc_feature    15904..16068
FT                   /locus_tag="SCAB_0121"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   1.6e-10"
FT                   /inference="protein motif:PFAM:PF01381"
FT   misc_feature    16486..16890
FT                   /locus_tag="SCAB_0121"
FT                   /note="HMMPfam hit to PF06114, Domain of unknown function
FT                   (DUF955), score 5.9e-05"
FT                   /inference="protein motif:PFAM:PF06114"
FT   misc_feature    16627..16656
FT                   /note="PS00142 Neutral zinc metallopeptidases, zinc-binding
FT                   region signature."
FT                   /inference="protein motif:Prosite:PS00142"
FT   CDS_pept        16980..17270
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0131"
FT                   /product="conserved hypothetical protein"
FT                   /note="cluster 0317 with SCAB90941"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0131"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67242"
FT                   /db_xref="UniProtKB/TrEMBL:C9Z9U8"
FT                   /protein_id="CBG67242.1"
FT                   /translation="MTDHPRKGTVAAPGSPGFALHTLGWRAFQDLCAAVLREVWAQSVH
FT                   TFADSNDGGRDGAFYGTWQQPPDPIGVQDVPDGPFVLQCKHTKKADTTLTP"
FT   CDS_pept        complement(17301..18194)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0141"
FT                   /product="putative integrase core domain"
FT                   /note="PMID:12127493"
FT                   /note="matches SCAB90931 in TIR"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0141"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67243"
FT                   /db_xref="GOA:C9Z9U7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C9Z9U7"
FT                   /protein_id="CBG67243.1"
FT                   /translation="MSEVYAFIEAEKTTHNVALLCRLLKVARSSFYAWLAGEPARAARR
FT                   AADDALAHEITVLHIASRCTYGVPRIHAELRRMDRRVNRKRVERIMRECDITGVTRRKR
FT                   RSLTRPARKAVPAHDLIGRDFTAADPGRKLVGDITYIPTDEGWLYLATWLDLATREIVG
FT                   YSMADHHRASLVVDALTMAAGRGRLQTGCIVHSDRGAEYTSDELRREISRLGLRQSMGR
FT                   TGSCYDNAAAESFFALLKAEIGTRRWPDRTTARAEIFAFIETFYNRKRLRRHPVWGYLT
FT                   PLETRQRHEQEHALAA"
FT   misc_feature    complement(17334..17819)
FT                   /locus_tag="SCAB_0141"
FT                   /note="HMMPfam hit to PF00665, Integrase core domain, score
FT                   1.9e-34"
FT                   /inference="protein motif:PFAM:PF00665"
FT   misc_feature    18039..18810
FT                   /note="insertion sequence: exact duplication of 771bp (1)"
FT   CDS_pept        complement(18191..18496)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0151"
FT                   /product="putative transposase"
FT                   /note="PMID:8973350"
FT                   /note="PMID:9862476"
FT                   /note="matches SCAB90921 in TIR"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0151"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67244"
FT                   /db_xref="GOA:C9ZBA1"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBA1"
FT                   /protein_id="CBG67244.1"
FT                   /translation="MTSKSNRSRRYSEEFKRDAVALVRSSGKTVTEVAREIGVSSEGLR
FT                   NWVKQDTIDRGQGSPGELTSAEREELRRLRRQNREQAETIEVLRKAAVFFAKESDR"
FT   misc_feature    complement(18233..18475)
FT                   /locus_tag="SCAB_0151"
FT                   /note="HMMPfam hit to PF01527, Transposase, score 7.7e-21"
FT                   /inference="protein motif:PFAM:PF01527"
FT   CDS_pept        complement(18498..>19010)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0161"
FT                   /product="putative IS transposase"
FT                   /note="PMID:1650732"
FT                   /note="PMID:16208464"
FT                   /note="see also SCAB0171, SCAB42801/42811,
FT                   SCAB44411/SCAB44421, same pattern of apparent overlap"
FT                   /note="TTA-Leu codon(s) 101 may indicate regulation by
FT                   BldA"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0161"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67245"
FT                   /db_xref="GOA:C9ZBA2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBA2"
FT                   /protein_id="CBG67245.1"
FT                   /translation="AGLVAVRGRLGEHAGPEKGDLTGPNPVDRGKYGSKIHLITERTGL
FT                   PISVAISGANLHDSQALIPLVKGIPPIRSRRGRRRRRPGKLHADKGYDYAHLRRWLRKR
FT                   GITHRIARKGVESSQRLGRHRWIIERTMAWLAGCRRLHRRYERKADHFLAFTSIACTLI
FT                   CYRRLTK"
FT   misc_feature    complement(18516..18953)
FT                   /locus_tag="SCAB_0161"
FT                   /note="HMMPfam hit to PF01609, Transposase DDE domain,
FT                   score 5.1e-10"
FT                   /inference="protein motif:PFAM:PF01609"
FT   CDS_pept        complement(18947..19306)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0171"
FT                   /product="conserved hypothetical protein, IS-associated"
FT                   /note="PMID:1650732"
FT                   /note="association with SCAB0161 suggested IS involvement,
FT                   see also SCAB42801/42811, SCAB44411/SCAB44421"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0171"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67246"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C9Z5J5"
FT                   /protein_id="CBG67246.1"
FT                   /translation="MVGIVERLVPDELWELFQRVVPEAPSRPQGGGRRRHGDREVLAAI
FT                   VFVATSGCTWQQLPSASFGPSGATAHRRFAEWTKARVWARLHRLVLDELGARGELDWSR
FT                   CAVDSVNMRALKRGT"
FT   misc_feature    complement(19148..19180)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(19380..19562)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0181"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67247"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBA4"
FT                   /protein_id="CBG67247.1"
FT                   /translation="MQLPVPCPGHLIPDATDRFDAAYRAAKAQRAVFVGIEREGERWTL
FT                   KVKLPLDVGHLETGT"
FT   CDS_pept        19768..20592
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0191"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0191"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67248"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBA5"
FT                   /protein_id="CBG67248.1"
FT                   /translation="MLTEALMAVAGAGGTAVVQAAGTDAWTGLRQRVARLLGRGDTQRE
FT                   SAELERLDRTAQALEEADATGETERTRLRQEASWQTRFESLLENLADSEQQQVATELQA
FT                   LVAEQQEFAARQGVVGNTFNGPAALQVGNHNQQENRFHIASYLPAPVGPRVILQVSNSI
FT                   PVYDLPDGSQDLGDHFVSVEAVNTGDQPIAITSWGIELPGDRRMFVTRGENWATPLPHV
FT                   LAPGAPPARFLIRADELRRVEREQRIPYTQMRPYVGLADGTVVRADRSVPLA"
FT   CDS_pept        complement(20670..20855)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0201"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67249"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBA6"
FT                   /protein_id="CBG67249.1"
FT                   /translation="MIVRLLGGPLAGRVLTTTDAPWAGGWLTAGDADWGLYVPVHRDPA
FT                   TGIVLAEARVTIPRQR"
FT   CDS_pept        complement(21282..21518)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0211"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67250"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBA7"
FT                   /protein_id="CBG67250.1"
FT                   /translation="MDVTDFPDDLVQTQAAWNATYQALAAPRPRDTTALRRRLLLLSVR
FT                   LWWHPYWETVPLVPAARSELRHLVRAHGAVRAA"
FT   CDS_pept        complement(21636..22469)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0221"
FT                   /product="conserved hypothetical protein"
FT                   /note="PMID: 12127493"
FT                   /note="cluster 0318 with SCAB32061"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0221"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67251"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBA8"
FT                   /protein_id="CBG67251.1"
FT                   /translation="MYSPPPDPDTEQRMRVHRASAAKALDVQTEPGGEFWGWAGRTLGT
FT                   PARTAAGEPAWLRLVSAPEDKASGKLWDGALDAQHAFGDLYGHRPALLGVHDAFDDTTA
FT                   YRAELSARVHEPVLSDDPILRHDSQLPDSWWADLTGTLEKVSVVATERVAVRQQYMDRA
FT                   ILEFLGIPAPAVTSWTSAHADLHWANVTAPLKVLDWEGWGRAPEGFDGATLYAYSLLQP
FT                   DTAARVRAAFPVLGSPAGLAAEATVCAQLLQTVARGDNLVLEGPLRNWAEELRRR"
FT   CDS_pept        complement(22450..23355)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0231"
FT                   /product="conserved hypothetical protein"
FT                   /note="PMID:12127493"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0231"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67252"
FT                   /db_xref="GOA:C9ZBA9"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBA9"
FT                   /protein_id="CBG67252.1"
FT                   /translation="MTAQLALGTYRCQAIPEAAVRAAASGAWIDTAPNYATGQAQTLLL
FT                   PVLAAHPHVRISTKAGFFTAATGADAVNDGVLTEDQAVAGHSLAPNYVRWQIRRNRAQL
FT                   GRERLDLVLLHNPERAHPGDRPALHRAIRDAFAVLEEAVAAGHVTGYGIATWAGLEEAF
FT                   TVGELLALAAEAAGGQQHHLAAIQLPVSLVMMTPIVQALHGHGPLPAAVDAGLRVMASA
FT                   PLHGGELPGMVDQELADLIRPGLTPAQTCVLTVASCPGVTDVLLAASGAPHWKEAADAV
FT                   AQPSLTAAKLREITGVLASP"
FT   misc_feature    complement(22459..23355)
FT                   /locus_tag="SCAB_0231"
FT                   /note="HMMPfam hit to PF00248, Aldo/keto reductase family,
FT                   score 0.00023"
FT                   /inference="protein motif:PFAM:PF00248"
FT   misc_feature    complement(22582..22614)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(23352..24524)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="PMID:12127493"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0241"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67253"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR039994"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBB0"
FT                   /protein_id="CBG67253.1"
FT                   /translation="MTRLSIAACLGEDFLAQALHREHRHVPGALDVAGLMTFDDLNQIL
FT                   ATHRLEPPRMRLSRDGETLLVGGYTTPVATRRHTVWHRLHPAELHARLKEGASIALDSV
FT                   DELHPPIARLCEAIERELHTRVQANLYASWSATEGFGIHWDDHDTVIVQLDGAKRWRIY
FT                   GTTRPYPLYRDIEDPGEAPTEPVADLVLWPGDVLYVPRGVWHAVSADQGTRSLHVTCGL
FT                   QTHTATDLMTWVSEQLLTHEDWRRDLPLLAAPDVQGDAVDGMRKRLAELLDDPELLARY
FT                   RAAMDGQAAGRMVPSLPYIDTVPVDGGLRVRLTTARAVLDVGEDMVTLSAAGTVYEFAP
FT                   EAEAVLRPLVDGRTVDLAALAHTADLALEDVAALVQELVAGQAATVGSLL"
FT   misc_feature    complement(23574..24494)
FT                   /locus_tag="SCAB_0241"
FT                   /note="HMMPfam hit to PF08007, Cupin superfamily protein,
FT                   score 1.7e-104"
FT                   /inference="protein motif:PFAM:PF08007"
FT   CDS_pept        24862..26190
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="PMID:12127493"
FT                   /note="TTA-Leu codon(s) 4, 87, 403 may indicate regulation
FT                   by BldA"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0261"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67254"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBB1"
FT                   /protein_id="CBG67254.1"
FT                   /translation="MDDLPPSPAQVPRHLLGDPAFVRSLRERDFTTVFAMAHDAGISFN
FT                   RIAEACALKSDRVSQIARGAAAVTALATVERIAGGLRIPGALLGLAAQPWEDTAVLSTE
FT                   SDHGEDPMKRRNLLRGALAAGLTAPALAALTAARTDVDQTLSPDAPEDLADLEAAAESY
FT                   GYGYHGQAPTRVLADLVTDFTTLRPLLTVPQPAPVRARLCRTAGQMAGMTAIVLHDLGS
FT                   RRESRGWFATAARAAAESGDPQLHAWVLAREAMVPLNYGAPRAAAELADQARHAAGTRP
FT                   TAAAVLAAAVAARAYALNHQAEQARAALTAADALMGRLPEGERSDTWLTYGEQKHHVHL
FT                   SHAFTTLGDTRRARESQQRALELSAPTSTMTRTLLNIDAAACSHHDGDTEQACRRAVDA
FT                   LTALPADYRTGLVRRRALDLYEAIPAQHHRERAVRELRDVVAG"
FT   CDS_pept        complement(26197..26682)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="PMID:12127493"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0271"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67255"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBB2"
FT                   /protein_id="CBG67255.1"
FT                   /translation="MKLGKQQNKDVPLIRHDRDTSGDLWYAMTRLQADHPDSAGPIPPF
FT                   ERPVARLSIADPNDIVLSARVELFEDEPMGRLHDVIDTVTRDLAGPKGIGAYALVPDVA
FT                   LEVMIGVRQELPLHAAHVAGLTQLLWDAMGTMSTRNAPGGGQCFHREGTGRARPLWA"
FT   CDS_pept        complement(26836..27873)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0281"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67256"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBB3"
FT                   /protein_id="CBG67256.1"
FT                   /translation="MAPPLLIPSGSAINPMVLDRPMLLPILDANALLVEACALAKHGGR
FT                   QDRVTALAVTGRATPYIAAHVPGEVDEHLAKVAADLEASERQARRVLNEQILPALRVVD
FT                   LEIRDHLAPQTRHILRVDREMPKRHRGDPDDAPTMALAEFLGPCVIVSKDSVFSRFGFA
FT                   VIDWIPVAESVLRMAGLEATAANALVLIDIAFQLFGTGVHRLVVLAANNPLAATAAVGG
FT                   LLWWCHRQGYLTRDNWRRRLSQAGGVAKPLLELAEAGMTEHRALGDSLLVVEPPAYPTR
FT                   EQLAARYLARCGRSLTPGELRDALARRGHIISAAQLKRDMQDHGAFVRAPGDLWTVGRP
FT                   VRQKA"
FT   CDS_pept        complement(28012..28185)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0291"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0291"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67257"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBB4"
FT                   /protein_id="CBG67257.1"
FT                   /translation="MFGSPEAVAELARRVADVDALENGVTALWEAVMSRKPANAQALAA
FT                   AGADPWRPSLGG"
FT   CDS_pept        28496..30724
FT                   /transl_table=11
FT                   /gene="tapL"
FT                   /locus_tag="SCAB_0311"
FT                   /product="putative telomere-binding protein"
FT                   /note="PMID:12651895"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0311"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67258"
FT                   /db_xref="GOA:C9ZBB5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBB5"
FT                   /protein_id="CBG67258.1"
FT                   /translation="MSELFDAVDALVASRSPLPPPAERRRLRQAHALTLDEVASALDVR
FT                   RATVGGWESGRTEPRPPEREAYARLLKQLAQLYPAPENTGAPQEDTDTTAAKTVTPAAP
FT                   AASQPAGEAPEAAAAPAAEEPPAAVGAPAAVSLPRPERAPGPRRPAVKKAAPADTPASG
FT                   GAYAHGPLLVLDADAERRVTGYGVGGLILDVPAKSLPALVEWTLTEARLGAERLHGSGK
FT                   DADPLLVLTEAACERYGLPAALSESEGLAGRLPEGHRVIRQLERADWQLTRRGLGPWAR
FT                   IYRPAQGGRRQCVQLCIPSWRALDGRAWGHAAQLEPAELARVLGVYAARVMTPVGSTAV
FT                   TGLQLMTTLNPPTRASEPDESGRRHRELRPGSLGTEPVDPAPCEAIDGHPVLAHLPRFH
FT                   VRGPDERLFEEAYDWARDLTDAECMQRYLVGIDVNLAFGAAANGAVVGLATPPVHVTKP
FT                   AFDAAVPGSWLVDLSHVDLARVKVAKQWRDLDAALLPSPFTPTGQRPTGPAWYATPTVA
FT                   YAVELGYDVTPLEGWVRRESGRFLDGWYKRLRDAYVATMADLGVAEKLPPADFLQAMDG
FT                   YKSRDPELGIVVDAVKMTVKGGIGKLQEKARGGGWKPGQAWPALARPTWRPDIRAAVIS
FT                   RARINMHRKMLNLAAATGQYPVAVLSDCAVYAADGPSPLDVLPYDADGKTVPGSFRLGV
FT                   SPGMVKHEGTQSMLWGADVLEQLGADGHVANLARYIKTGEVTAKDTGE"
FT   CDS_pept        30739..31296
FT                   /transl_table=11
FT                   /gene="tpgL"
FT                   /locus_tag="SCAB_0321"
FT                   /product="terminal protein TpgL"
FT                   /note="PMID:12651895"
FT                   /note="PMID:11410532"
FT                   /note="PMID:11985710"
FT                   /note="PMID:12127493"
FT                   /note="many sequenced similar found on unpublished
FT                   Streptomyces plasmids found in INSDB"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0321"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67259"
FT                   /db_xref="GOA:C9ZBB6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBB6"
FT                   /protein_id="CBG67259.1"
FT                   /translation="MVTVGEELDKAVQGAFTRPIPKSAGAQMRYLVKQHQRSTQRVAEL
FT                   LGISQRTVERYVKNQIKQPRPELADRLEREVRTRWQPQIRARAKQAAATTSGIMIDVQA
FT                   RFGYTAAPGTTDQARVRHLTLALPPHHAARLLQAQETGADENDLRQVAAEALGEIYFRD
FT                   NGRRAHGLEVQLNDIVDLQFEL"
FT   tRNA            complement(31448..31521)
FT                   /gene="tRNA-Met"
FT                   /product="transfer RNA-Met"
FT                   /anticodon="(pos:31485..31487,aa:Met)"
FT                   /note="tRNA Met anticodon CAT, Cove score 66.36"
FT                   /note="tRNA Met anticodon CAT, Cove score 79.35"
FT   CDS_pept        31752..33404
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0331"
FT                   /product="putative serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0331"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67260"
FT                   /db_xref="GOA:C9ZBB7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBB7"
FT                   /protein_id="CBG67260.1"
FT                   /translation="MRAVDHQGEASVSSRVQSLQQGDPRRVGPYRVVGRLGFGGMGTVY
FT                   AALSAAGERMAVKVVHPAQAADDEFRARFRREVQLSQRVTGPCLVPVLDADPDAPAPWL
FT                   ATAFIPGPTLDQYVAAGPLAGARLYALAAGTAAALSAVHEAGVVHRDVKPQNVILAPSG
FT                   PMVLDFGIAHALDGTSVTRTGVMTGTPGWISPEHYRTGTVGPEGDVFAWGALVAYAATG
FT                   RLPFGSGAADAVAFRVLSAEPDLDGMGDDLRQLVDRALSKEPPSRPAASELAQECGELL
FT                   ASQTTAVTGPADLPQPTLIADLVGLNWDLPSDEPIWPAPSKHTGRTRLYLAVVAAAVVV
FT                   GSLGGVLVATQSSTATRGPASTPGGQRTSAAGLTPAAQHSASDETGPALTASDVPSSSS
FT                   PSPRSSPAPSPAYTRSDSAQPTVEEWAAARVPATQAEKAAAQRLREGAAPVLQGQQYMG
FT                   DEVTVTFNPSAQTMFVTFGPGSYPEGRSYQDDADWTDIVRGLMFGSCAEAQQDFHDDIT
FT                   WPYGRATVVYRESMASPLIANFREVTHTDSCRV"
FT   misc_feature    31839..32594
FT                   /locus_tag="SCAB_0331"
FT                   /note="HMMPfam hit to PF00069, Protein kinase domain, score
FT                   1.7e-37"
FT                   /inference="protein motif:PFAM:PF00069"
FT   misc_feature    31857..31925
FT                   /note="PS00107 Protein kinases ATP-binding region
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00107"
FT   misc_feature    32190..32228
FT                   /note="PS00108 Serine/Threonine protein kinases active-site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00108"
FT   misc_feature    32736..32804
FT                   /locus_tag="SCAB_0331"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB0331 by TMHMM2.0 at aa 329-351"
FT   CDS_pept        join(33609..34097,34099..34209)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0332"
FT                   /product="conserved hypothetical protein"
FT                   /note="pseudo: possible frameshift, missing STOP"
FT   CDS_pept        34268..34921
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0342"
FT                   /product="conserved hypothetical protein"
FT                   /note="pseudo: missing STOP"
FT   CDS_pept        34965..35387
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0351"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0351"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67263"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBB8"
FT                   /protein_id="CBG67263.1"
FT                   /translation="MTALQFDRHGNRVWRKAQGLLDSEHVRREIGEVATAYGVCKEPTN
FT                   VAAGGQSCPLRFRCLGCKHYTTDISYLPDLEAYLADVRRLISRIRGGLDDLGAEERAKI
FT                   EQAVSTVRRRRGVMLGMPGMRRIGQPLPDVRPRRSM"
FT   misc_feature    35091..35123
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        35384..35926
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0361"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0361"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67264"
FT                   /db_xref="GOA:C9ZBB9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBB9"
FT                   /protein_id="CBG67264.1"
FT                   /translation="MNAASDGRKADSARRRERVVKAINAAAQGTGRISVSAIARHAGVD
FT                   RTFLYRHPDLLALVHAAETEPAQQGPASSVAVSRASLQADLAHAQARNTLLAARIQLLE
FT                   RRLSGELGEQAWRESGLEIPTDIEALQRRITGLKQRNVEPTAAPEESQADLSAAREANR
FT                   ELTKAINQRGQPRNVAG"
FT   CDS_pept        36111..37106
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0371"
FT                   /product="putative IS transposase"
FT                   /note="PMID:1332944"
FT                   /note="overlaps SCAB0372 seems to be common pattern see
FT                   also SCAB0691, SCAB0991, SCAB23721, SCAB42901, SCAB90821"
FT                   /note="TTA-Leu codon(s) 4 may indicate regulation by BldA"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0371"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67265"
FT                   /db_xref="GOA:C9Z9T6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C9Z9T6"
FT                   /protein_id="CBG67265.1"
FT                   /translation="MTRLRHQHDQGSPLPDQLSSISVPASTAVTPGCDCYVHRFGSLAP
FT                   GRRAACYPSDMTDAEWAEVRAAMPVPAWLLKRGGRPEAYCHRTMLDAVRYLVDNGVKWT
FT                   ALPVDFPYWRAVYDFFRRWRAYDYARELYERLRRSARERSGRNAEPSAGIIDSQSVDAS
FT                   ETVGEDSRGYDGGKSRDGRKRHILTDTEGLLLEVTVTTADVHDSKAAPALLETFMQQPG
FT                   RLLQLVWVDSAYQGPALARAFARHGVRTEVVRRCDGQRGFVVLARRWVVERTLSWLARS
FT                   RRLNRDHERRPDHHAQMVWWAAVIRLSRRLAADAPRWPEKRPGRLPRARA"
FT   misc_feature    36564..37037
FT                   /locus_tag="SCAB_0371"
FT                   /note="HMMPfam hit to PF01609, Transposase DDE domain,
FT                   score 3.6e-26"
FT                   /inference="protein motif:PFAM:PF01609"
FT   CDS_pept        complement(37024..37614)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="maybe missing stop codon, overlaps see SCAB0371
FT                   putative IS transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0372"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67266"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBC1"
FT                   /protein_id="CBG67266.1"
FT                   /translation="MLWIEEGAMPSVLRLMEQREARARQDLESWTEVLEQAQAEVDAAR
FT                   ERVERARVGREELVSVLAGESPVNTPVLVPSGGEMAAALGSSGSGVGHGERPPVWRSGM
FT                   GEEVLSGLYREVFAAMVAASGPVNGVELTRAVGREAEIKNEVEKIRHRAYVLEKRGWLV
FT                   RANDGRFMPAPGAVGRDASPASAERLRPGAGTV"
FT   CDS_pept        38006..39295
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0381"
FT                   /product="putative transposase"
FT                   /note="PMID:1849509"
FT                   /note="PMID:16597970"
FT                   /note="see also SCAB14291"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0381"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67267"
FT                   /db_xref="GOA:C9ZBC2"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBC2"
FT                   /protein_id="CBG67267.1"
FT                   /translation="MELESVEPVESAQLGQAAPVSDEQLVAMLVERARSEGLQLTGQGG
FT                   LLQQLTKRVLESALEGEITDHVGYDKHDVAGRNSGNSRNGTRAKTVLTDVGPVEVKVPR
FT                   DTAGTFEPQIVKKRQRRLTGVDEMVLSLSAKGLTHGEISAHLAEVYGAEVSKQTITTIT
FT                   DKVVEGMAEWQARPLDRVYPVVFVDAINVKIRDGKVANRPVYVAMAVTVEGTRDILGIW
FT                   AGDGGEGAKHWLQVFTELKNRGTEDVLMLVCDGLKGLPDAVETVWPRTVVQTCIVHLIR
FT                   NSIRYCARQDWDKVAKDLKPVYTAPSEAAATERFLEFSERWGTKYPAVIKLWSDAWAEM
FT                   VPFLSFDVEIRKVICSTNAIESVNARIRKAVRARGHFPTEAAALKCVYMALMSLDPTGK
FT                   GRRRWTMRWKAPLNAFQIAFDGRLTPTDQR"
FT   misc_feature    38063..39208
FT                   /locus_tag="SCAB_0381"
FT                   /note="HMMPfam hit to PF00872, Transposase, Mutator family,
FT                   score 1.2e-147"
FT                   /inference="protein motif:PFAM:PF00872"
FT   misc_feature    38765..38839
FT                   /note="PS01007 Transposases, Mutator family, signature."
FT                   /inference="protein motif:Prosite:PS01007"
FT   CDS_pept        complement(39360..40706)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0391"
FT                   /product="putative IS transposase"
FT                   /note="PMID:11895946"
FT                   /note="TTA-Leu codon(s) 338 may indicate regulation by
FT                   BldA"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0391"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67268"
FT                   /db_xref="GOA:C9ZBC3"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBC3"
FT                   /protein_id="CBG67268.1"
FT                   /translation="MQELRCDLRWKAGCGLGLHDMAFDPSLLAYFRRRLARSARPNRIF
FT                   EAVREVVKATGVLKGKHRRALDSTVLDDAVATQDTVTQIIAAVRAVIREVPGADAVAAA
FT                   QCGAHDYTDPGKPKIAWNDEQARAELVDALVTDALRLLGHLPEQQLGDKAANAVGILAL
FT                   VAGQDVEPAEDSDGRDGRWRITQGTAPNRMVSTIDHEARHVHKTRSHRQDGFKAHLAVE
FT                   PETGVYTAVALRPGAGPEHHEAAVGLDLLAEEDTPVDAFGDTAYSTGDARQALNEAGHR
FT                   LFLKPAPLRPAVPGGFTLDDFAIDTTTALVTCPAGHTVALSDPGGQHHQRKASFGNLCT
FT                   GCHLRERCTKARAGRILTIRPHHDLQTAARHQAATDPGWQADYRRWRPPVERAVAWLVH
FT                   HGNRRLRYRGTIKNNLWLHTRAAALNLRRLINLGLTHTSGNWHIAPAGT"
FT   misc_feature    complement(39429..40121)
FT                   /locus_tag="SCAB_0391"
FT                   /note="HMMPfam hit to PF01609, Transposase DDE domain,
FT                   score 0.0023"
FT                   /inference="protein motif:PFAM:PF01609"
FT   misc_feature    complement(39675..39692)
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   CDS_pept        complement(40911..42230)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0401"
FT                   /product="putative transposase"
FT                   /note="PMID:10616714"
FT                   /note="PMID:12791134"
FT                   /note="see also SCAB14521, SCAB40521, SCAB42871"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0401"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67269"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBC4"
FT                   /protein_id="CBG67269.1"
FT                   /translation="MVSQAGAVLLLEAVRKTGLDQAISAALAPWRKPRAVHDPGKILLD
FT                   LALAVAMGGDCLADIGMLRAEPAVFGPVASDPTVSRLIDTLAASGEKALQAVRSERAEV
FT                   RQRAWRLAGRAAPDAGGTVTVDLDGVLVIAHSDKEDAAPTWKRTYGHHPLMGFVDHGPG
FT                   GTGEPVAALLRPGNAGSNTASDHVTAAQLALAQLPKKYRRGRRTLIRTDSAGGTHDFVG
FT                   WLAQRGRWLSYSAGMVITDAIHQHVLKVPASAWTAAVETGGEIRDGAWVAELTGDVLDG
FT                   WPRGMRLIVRKERPHPGAQLRLTDADGLRLTCFATNTSGRPIAELELRHRLRARAEDRI
FT                   RAARATGLRNLPLHRTAQNRIWLEIVQIALDLLAWMPMLALTGKARLWEPRRLRLRLFT
FT                   TAGQFVTTGRRRILRLARHWPWTSHITAALERLARLPNPG"
FT   misc_feature    complement(41115..41861)
FT                   /locus_tag="SCAB_0401"
FT                   /note="HMMPfam hit to PF01609, Transposase DDE domain,
FT                   score 0.003"
FT                   /inference="protein motif:PFAM:PF01609"
FT   CDS_pept        join(42534..42935,42938..43549)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0411"
FT                   /product="putative transposase"
FT                   /note="pseudo: frameshift after codon 134"
FT                   /db_xref="PSEUDO:CBG67270.1"
FT   misc_feature    43421..43450
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   CDS_pept        complement(43866..44963)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0431"
FT                   /product="putative sortase-sorted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0431"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67271"
FT                   /db_xref="GOA:C9ZBC6"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBC6"
FT                   /protein_id="CBG67271.1"
FT                   /translation="MRPLQSVGSRLTVAAMTIVLGTPGLATADEAADGNDATYYISLGD
FT                   SLASGYQPDVDKDTDVAYTDQLYTQLKQRTPGLKHIRLGCTAETTESLLKGGKCDYPNA
FT                   KSQLDAALKAMAQHHGKVTYVTLSVGANDILLNCVSPAGTLDGACLNSRSQTMATNLAQ
FT                   IAGALRKAGAKDTQFVGSTYHNPFLATWLLGAEGQQAAKESAPLLEAANTGITQVYKST
FT                   GFKVADLPGTFSSNDFTTQVNVPGAGEVPANVAKICQLTWACTKKDPHPNAEGHKVIAG
FT                   AFAAELARNDAPAAGATPTPTPSESATPEPGKDTGANDPKTNGDLAETGASSSAPVVAG
FT                   AGLAVVAAGAAAVYFARRRRTVEEG"
FT   misc_feature    complement(43896..43964)
FT                   /locus_tag="SCAB_0431"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB0431 by TMHMM2.0 at aa 319-341"
FT   misc_feature    complement(43974..43988)
FT                   /note="possible sortase signal"
FT   CDS_pept        45652..46029
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0441"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67272"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBC7"
FT                   /protein_id="CBG67272.1"
FT                   /translation="MLDRRRRTVPWTFARARLEDGAGVCTSIGKILGNTMIFKPLATSD
FT                   NPNLTAYDADGGRPGTGEGSPWAPAGAGSPHGRNAGQRMPWRRQIWFFLALRVLPESQV
FT                   HWLLSARGWVETPETATHLPR"
FT   CDS_pept        46026..46139
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0451"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0451"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67273"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBC8"
FT                   /protein_id="CBG67273.1"
FT                   /translation="MTLPLLPIRILAFLAVLSLGAGGTQLNGGGYATSLAG"
FT   misc_feature    46026..46118
FT                   /locus_tag="SCAB_0451"
FT                   /note="Signal peptide predicted for SCAB0451 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.971) with cleavage site
FT                   probability 0.594 between residues 31 and 32"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    46053..46121
FT                   /locus_tag="SCAB_0451"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB0451 by TMHMM2.0 at aa 10-32"
FT   CDS_pept        complement(46691..47065)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0461"
FT                   /product="putative IS transposase"
FT                   /note="PMID:1650732"
FT                   /note="PMID:16208464"
FT                   /note="see also SCAB0471"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0461"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67274"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBC9"
FT                   /protein_id="CBG67274.1"
FT                   /translation="MSLTGGNRNDVTQLIPLLDKIPPVAGTVGRPRRRPDMLFADRGYD
FT                   HDKYRRLLRKRGIRPAIAERGQPHGSGLGIFRWVVERTLSWLHGFRRLRIRWERRDDIH
FT                   EAFLGLATCLITHRHVQRLC"
FT   misc_feature    complement(46715..47065)
FT                   /locus_tag="SCAB_0461"
FT                   /note="HMMPfam hit to PF01609, Transposase DDE domain,
FT                   score 0.017"
FT                   /inference="protein motif:PFAM:PF01609"
FT   CDS_pept        complement(47056..47478)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0471"
FT                   /product="conserved hypothetical protein, IS-associated"
FT                   /note="PMID:16208464"
FT                   /note="PMID:1650732"
FT                   /note="see SCAB0461"
FT                   /note="TTA-Leu codon(s) 12 may indicate regulation by BldA"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0471"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67275"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBD0"
FT                   /protein_id="CBG67275.1"
FT                   /translation="MSDELWSLIEPLLPEPGPKLVAGRPRVPDRQALCGILFVLHTGIQ
FT                   WEYLPQELGFGSGMTCWRRLAAWNEAGVWEKLHVVLLKKLRSAKQLDWSRAVIDSSHVR
FT                   AARRGPKAVPARSTAHGRAASTTSLSTGRASRSRCR"
FT   CDS_pept        complement(47589..48938)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0481"
FT                   /product="putative cyclopropane-fatty-acyl-phospholipid
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0481"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67276"
FT                   /db_xref="GOA:C9ZBD1"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBD1"
FT                   /protein_id="CBG67276.1"
FT                   /translation="MSEAAAAVLARFSEQVLGLPLPVGIRLWDGSTAGPEDGPAFVLRD
FT                   REALRRLLWRPGELGLARAWVAGDLEVDGDLYELLKRISTLVWERDEPGSRTAAFRQAL
FT                   SVLTTPATLRTVSRTLGLAGMGLPPAPPAEEVVRRRGPAHSMRRDKAAISHHYDVGNDF
FT                   YALVLGPSLVYSCAYWQGDPSSGSGDTLEQAQEAKLDLVCRKLALREGQRLLDVGCGWG
FT                   SLAMHAAERYGVQVVGVTISVEQAALARERVAAAGLEHLVEIRVQDYRQIDDSPFDAIS
FT                   SIGMAEHVGKKRYRAYADILHRLLKPGGRLLNHQIARRPLRDEGEYRMDPFIDRYVFPD
FT                   GELAPVGSTASLLEEAGFEVRDVEALREHYALTLREWVANLEAHWDEAVKLTSPGRARV
FT                   WRLYMAASAVGFENNTMGVNQVLAVRTDGGGRSGMPLRRDFLGTSASALA"
FT   misc_feature    complement(47664..48509)
FT                   /locus_tag="SCAB_0481"
FT                   /note="HMMPfam hit to PF02353,
FT                   Cyclopropane-fatty-acyl-phospholipid, score 3.1e-128"
FT                   /inference="protein motif:PFAM:PF02353"
FT   misc_feature    complement(48000..48296)
FT                   /locus_tag="SCAB_0481"
FT                   /note="HMMPfam hit to PF08241, Methyltransferase domain,
FT                   score 1e-17"
FT                   /inference="protein motif:PFAM:PF08241"
FT   misc_feature    complement(48006..48296)
FT                   /locus_tag="SCAB_0481"
FT                   /note="HMMPfam hit to PF08242, Methyltransferase domain,
FT                   score 3.3e-18"
FT                   /inference="protein motif:PFAM:PF08242"
FT   misc_feature    complement(48147..48179)
FT                   /note="PS00626 Regulator of chromosome condensation (RCC1)
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00626"
FT   misc_feature    complement(48411..48443)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(49099..49464)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0491"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity to S. avermitilis hypothetical protein
FT                   breaks off beyond codon 36"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0491"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67277"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBD2"
FT                   /protein_id="CBG67277.1"
FT                   /translation="MKVALHTKVRADRIEEYEAAHRQVPEQLTVVIRAAGVGEWTTGAA
FT                   VRLRPARHRTAGHAPGSDNVSDHGLCGDRRGSRGRDGLRAVAARAVLLGQPQPSLLVSP
FT                   WRHGSARRGEPVVTRTG"
FT   CDS_pept        complement(49461..50489)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0501"
FT                   /product="putative secreted oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0501"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67278"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBD3"
FT                   /protein_id="CBG67278.1"
FT                   /translation="MRTTTLGGSAVPVSELALGCAALGNLLHPVTDEAAHAAVEAAWDV
FT                   GVRTFDTAPHYGLGLSERRLGAALRDRPRDTYTLSTKVGRLLVPGREEGAGDDLANGFA
FT                   VPATHRRVWDFSADGVLRSLEASLERLGLDRVDVALLHDPDGHADQALREAYPALERLR
FT                   AEGVIGAIGVGMNQSALPARFLRETDIDMVLLAGRYTLLEQDSLTELLPEAAARGRSVV
FT                   IGGVFNSGLLTAPRPGATYDYAPAPQPVLDRALRLLAVCERHDVPLRAAALRFPFGHSA
FT                   VASVLTGARSSHEVRDTVEQLRRPIPAALWDELRAEGLLAPDTPVPAAAPTGEAMPSEE
FT                   PS"
FT   misc_feature    complement(49542..50471)
FT                   /locus_tag="SCAB_0501"
FT                   /note="HMMPfam hit to PF00248, Aldo/keto reductase family,
FT                   score 7.4e-16"
FT                   /inference="protein motif:PFAM:PF00248"
FT   misc_feature    complement(50379..50489)
FT                   /locus_tag="SCAB_0501"
FT                   /note="Signal peptide predicted for SCAB0501 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.912) with cleavage site
FT                   probability 0.584 between residues 37 and 38"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(50486..51244)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0511"
FT                   /product="probable short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0511"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67279"
FT                   /db_xref="GOA:C9ZBD4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBD4"
FT                   /protein_id="CBG67279.1"
FT                   /translation="MIGLSGLRAVVTGGASGIGLATARALAAQGASVAVLDLDPGGVSE
FT                   PLLGLQADVTDDVSVRAAVEQAAERLGGLDILVNNAGIGAVGTIEDNPDEQWHRVLDVN
FT                   VLGIVRTTRAALPHLRRSAHAAVVNTCSIGATAGLPQRALYCASKGAVRSLTLAMAADH
FT                   VREGIRVNCVNPGTADTPWVGRLLDAADDPEGERAALNARQPMGRLVTADEVAAAIVYL
FT                   ASPAAASVTGTSLAVDGGMQGLRLRPVDRS"
FT   misc_feature    complement(50753..51226)
FT                   /locus_tag="SCAB_0511"
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase,
FT                   score 1.6e-21"
FT                   /inference="protein motif:PFAM:PF00106"
FT   misc_feature    complement(50765..50851)
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00061"
FT   misc_feature    complement(51164..51244)
FT                   /locus_tag="SCAB_0511"
FT                   /note="Signal peptide predicted for SCAB0511 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.466 between residues 27 and 28"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(51241..52578)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0521"
FT                   /product="putative racemase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0521"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67280"
FT                   /db_xref="GOA:C9ZBD5"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034610"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBD5"
FT                   /protein_id="CBG67280.1"
FT                   /translation="MTTTSARITAVDTYDVRFPTSRELDGSDAMNPDPDYSAAYVVLRT
FT                   DAGDGHEGHGFTFTIGRGNDVQVAAIDALRPHVVSRSVQELCADPGSLSRDLIGDSQLR
FT                   WLGPEKGVMHMAIGAVVNAVWDLASKRAGQPLWRLLAHAEPEWLVSQVDFRYITDALTP
FT                   EDALTLLRDGRTGLAQREAVLLERGYPGYTTSPGWLGYSDEKLTRLAKQAVADGFTQIK
FT                   LKVGADLDDDIRRLRTARAAVGDGVRIAIDANQRWNVDEAIEWTNALAEFDPYWIEEPT
FT                   SPDDILGHASVRRAVAPVKVATGEHVQNRIVFKQLLQAGAIDVLQIDAARVGGVNENLA
FT                   ILLLAAKFGVPVCPHAGGVGLCELVQHLSMFDYLALSGTTDDRVIEFVDHLHEHFTAPV
FT                   VMRDGHYTAPLIPGFSATMREKSIAEYRYPDGAFWVADRAAQKEAA"
FT   misc_feature    complement(51298..52026)
FT                   /locus_tag="SCAB_0521"
FT                   /note="HMMPfam hit to PF01188, Mandelate racemase /
FT                   muconate lactonizing en, score 1.7e-09"
FT                   /inference="protein motif:PFAM:PF01188"
FT   misc_feature    complement(51739..51834)
FT                   /note="PS00909 Mandelate racemase / muconate lactonizing
FT                   enzyme family signature 2."
FT                   /inference="protein motif:Prosite:PS00909"
FT   CDS_pept        complement(52593..53444)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0531"
FT                   /product="putative 2-hydroxyhepta-2,4-diene-1,7-dioate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0531"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67281"
FT                   /db_xref="GOA:C9ZBD6"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBD6"
FT                   /protein_id="CBG67281.1"
FT                   /translation="MKLLRVGAPGEERPAVRTDDGRLLDLSSVAPDIDGDFLASGGVDR
FT                   ARAAVEAGELPVLDPDGLRIGAPVARPGKIICVGLNYRDHAAETGAAIPPRPVVFMKDP
FT                   GTVVGPYDEVLIPRGSVKTDWEVELAVVIGRRARYLEGPEEAAGVIAGYAISHDVSERE
FT                   FQLEYSSQWDLGKSCETFNPLGPWLVTADEVGDPQDLGLRLSVNGVKRQNGHTGEMIFG
FT                   VDHIVSYLSQYLVLEPGDVINTGTPAGVALGLPGTPFLRPGDTVELSVDGLGSQRQTFA
FT                   QA"
FT   misc_feature    complement(52680..53180)
FT                   /locus_tag="SCAB_0531"
FT                   /note="HMMPfam hit to PF01557, Fumarylacetoacetate (FAA)
FT                   hydrolase fam, score 5.8e-61"
FT                   /inference="protein motif:PFAM:PF01557"
FT   CDS_pept        complement(54072..55541)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0541"
FT                   /product="putative putative racemase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0541"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67282"
FT                   /db_xref="GOA:C9ZBD7"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR034610"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBD7"
FT                   /protein_id="CBG67282.1"
FT                   /translation="MRWRLPALALSVRLTDHERLSVSSTSVSRITGLDTYDIRFPTSRE
FT                   LDGSDAMNTDPDYSAAYLVLRTDSEDGLEGHGFAFTIGRGNDVQVAALDVLRAHVVGRS
FT                   VEDLCDDPGSLARDLTGDSQLRWLGPEKGVMHMAVGAVINAVWDLAAKRADKPLWKFLA
FT                   DADPEWLADQIDYRYITDALTRQEAVTILQRGREGRTARESDLLAHGYPACTTSPGWLG
FT                   YTDEKLTRLAQRAVADGFRQIKLKVGADLDDDIRRFRAARTAVGPASASPWTPTSAGTS
FT                   TKPSPGPPRWPILTPTLVQQRQQLCDVVAVSAGQRDCERDALSVGEDVVLAARPCTVDR
FT                   AGPAFGPRRAARTWEESITARDQSSFFAARSFLSSTRCSSSHTPASFHAARRRQHVIPD
FT                   PKAQLLRQVLPLDTGVQHEQDPAQHLPVRHPRPALHQLRTRLGQQRFDERPQFIRHDPW
FT                   PRLSFPHERGEGRGRRTGSCRSGADNARIVP"
FT   misc_feature    complement(55053..55412)
FT                   /locus_tag="SCAB_0541"
FT                   /note="HMMPfam hit to PF02746, Mandelate racemase /
FT                   muconate lactonizing en, score 0.00072"
FT                   /inference="protein motif:PFAM:PF02746"
FT   CDS_pept        56281..57648
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0551"
FT                   /product="putative secreted solute-binding protein
FT                   (transport system associated)"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0551"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67283"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBD8"
FT                   /protein_id="CBG67283.1"
FT                   /translation="MRRFNEARRNPLPRALTALSAVAVLTSSAAACSSSGSEGSDTTGS
FT                   APVTLTVQQQTGQETLFGYFAKAFHKAHPNVTVKLQTISQEQKAGSNLTVLGSANAPDV
FT                   GFVPVGSSPYTALTSRGGLTDLSDVWSSGDLAKRYGSGVSGSLKVGGKPYVVAFSQAIY
FT                   NVVWYNPAAFAKAGVTVPTDHRFATPEDLIAAAKKLKSAGYAPLQLGGASGYQASWMVD
FT                   ALLPTSASPAQLENYLASYNSKTAVTAKYTDPAFTKVLSTLKNYRKSGVYQDGFLGQKY
FT                   QDAETPFLAGKAGMFLGGNFTAADFVPAKTSVKPDWLLLPPVNAGTKTTQTGYYGDALG
FT                   IPVRAQHKAWAKKFLEFVMSEKAQSEGVVGTANLLPGVKDLPASAFTKLDANSRSILAD
FT                   IAKNGSAAGWTSVVPNALAQTFIDPKIQAMYSGSLSPSALAQQQQDELLSFRKSAS"
FT   misc_feature    56281..56397
FT                   /locus_tag="SCAB_0551"
FT                   /note="Signal peptide predicted for SCAB0551 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.519 between residues 39 and 40"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    56326..57375
FT                   /locus_tag="SCAB_0551"
FT                   /note="HMMPfam hit to PF01547, Bacterial extracellular
FT                   solute-binding prot, score 2.2e-20"
FT                   /inference="protein motif:PFAM:PF01547"
FT   misc_feature    56344..56376
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        57859..58704
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0561"
FT                   /product="putative binding protein dependent transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0561"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67284"
FT                   /db_xref="GOA:C9ZBD9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBD9"
FT                   /protein_id="CBG67284.1"
FT                   /translation="MTRLALVPALVLLAVFVLGAIVQTVRISTTDWVGFGPMHSVGLDN
FT                   YRTVLKSSDTYQSLGVTLVYAAASAVATIVISSLLAAAVSHGVKGGRFYRVIWFLPGVA
FT                   PAAAVSIFWTASFQPHSGGVNQVLGHIGLGNAHAWLGDASTAVWPVVFVTVWAGVGFAF
FT                   LLLLGAMEQVPVSIYEAARIDGASTARQFFSMTLPMIRPVFVMTALLEFMWAFNGFTTV
FT                   WAMTQGGPGTATSILPVRIYREALLKGQFGPASALAVLSAVVLIAVGLVGVRASRSKEA
FT                   "
FT   misc_feature    57859..57936
FT                   /locus_tag="SCAB_0561"
FT                   /note="Signal peptide predicted for SCAB0561 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.995) with cleavage site
FT                   probability 0.307 between residues 26 and 27"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    join(57871..57939,58033..58101,58135..58203,58294..58362,
FT                   58465..58533,58609..58677)
FT                   /locus_tag="SCAB_0561"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SCAB0561 by TMHMM2.0 at aa 5-27, 59-81, 93-115, 146-168,
FT                   203-225 and 251-273"
FT   misc_feature    58021..58701
FT                   /locus_tag="SCAB_0561"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 3.1e-07"
FT                   /inference="protein motif:PFAM:PF00528"
FT   misc_feature    58366..58452
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS_pept        58701..59540
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0571"
FT                   /product="putative probable transmembrane transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0571"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67285"
FT                   /db_xref="GOA:C9ZBE0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBE0"
FT                   /protein_id="CBG67285.1"
FT                   /translation="MMRNLLGRGTARAALVLWTLLAVVPFVLILLLSVRSNADIYLNGL
FT                   GITGKILPGNYARAWQGSAGTAGLTNYFGNSLIAAVTALVFNLGAGVTAAYFATHLSDR
FT                   SRIWFTRLFVSSTVLPIVLMVVPYYQAFNAFGVLNMPVVIGIAYGALALPTTVLIMHSF
FT                   FVDFPVELLEAAALDGTGAWRTYVRIVLPLAKGAVTAVAMLTLVFVWGETQLGVVLLQS
FT                   GESQTVPVGLLSFQGQYTTDQGALFAGLSLASIPIILLYLVFHKNVTKGIALGGVFK"
FT   misc_feature    58701..58814
FT                   /locus_tag="SCAB_0571"
FT                   /note="Signal peptide predicted for SCAB0571 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.728 between residues 38 and 39"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    join(58737..58805,58929..58997,59034..59096,59124..59192,
FT                   59265..59333,59433..59492)
FT                   /locus_tag="SCAB_0571"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SCAB0571 by TMHMM2.0 at aa 13-35, 77-99, 112-132, 142-164,
FT                   189-211 and 245-264"
FT   misc_feature    58905..59522
FT                   /locus_tag="SCAB_0571"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 1.2e-11"
FT                   /inference="protein motif:PFAM:PF00528"
FT   misc_feature    59190..59276
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS_pept        59537..62071
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0581"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0581"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67286"
FT                   /db_xref="GOA:C9ZBE1"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR027414"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBE1"
FT                   /protein_id="CBG67286.1"
FT                   /translation="MTTNPLYAPLSQAVDGLDVSRRHPIVRTPAAGDFFEGALLGNGEF
FT                   GAVVVPRPDAIVIHLGHNAVWDKRAQVVDPDRLGTFAKVLTAAEEAARHGRPDEDEEFA
FT                   RYLADTEEGYGAPYPKPFPCGSVLLSLDTRRCEVLGYHVDIATGICSVQLTIDGAPSTV
FT                   EIFVAADSDTAWVRWSAHGTATLPVRGLRVLPDPLGYDGADGPADPIEAGNAYTRPKSA
FT                   FTPNEHLTHEQSSHHLAFVQGLPVTGEALPDTPAFRLGLTSDTELTAGTVAGFKGRRVA
FT                   LDPLATHVAPTRELNLRIDLTQDELSALSAAPVAVEMGDQDTARSATTASWRDFWARSA
FT                   IDVGGHELEALWYRNLYWTRCALRDGGVAPGLFGPWTYRDIGSGFHGDYHFNYNVQQLY
FT                   WGLFVTGHEDLHHPYLDLLDSLLPQARRTAEQYYGMPGAAFSLIGWPLETTLAPYLCPK
FT                   WAWEAFIPAWAVQTLWWHYLYTGDVDLLADRIAPFLVDVAQFLLDYLDAGTERLARDDG
FT                   RLHVYPTVVPEVYGLSDGLRLNVDGHVDIVFFTFAFQALVDADEALRTAGRDALPEDLV
FT                   ERARAAVSQLVPLPTTETDEGTVWVSVAGEDPDVVYNVPAAAMAVFPCEAVSLSSPADQ
FT                   VDIARRTVRRQRTEGGNDLVFVAMQEARLGQLDLERWLRHVRYCTIPNGTATARVQCAG
FT                   GRYDDATPFDFMARMGVWTENFAAGAVISECLLQSHDGVIRILPNWPLDLPVSFTELRT
FT                   RGGHRVSFTRRPGEADRLELTGGHERELTVVPPWSGPSTVHPAAYSTEEAHAIHHPPGP
FT                   IRLSVQTGTVVRISPVPSLNDELEGTTTCAIS"
FT   misc_feature    60266..60283
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT                   /inference="protein motif:Prosite:PS00343"
FT   CDS_pept        63256..65919
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0601"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0601"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67287"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR039469"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBE2"
FT                   /protein_id="CBG67287.1"
FT                   /translation="MPMTQRRRRFLPRLRATLIASAAALACMLVTLSAPFPASAVDQVT
FT                   RTDDFERANGSLGANWASDRGTWSIASGEALSAATPTNAVATYRPVQLGSSYTVSAQIR
FT                   IVSSSPSGAEWSGIAANVQGTTSLDYYVLRVTTAGGARTGQWQLLKMAASTTPTVLAQG
FT                   NMNAPYGTSLELNLGRTGTRFTVSVRNSDSGATLVDTSYTLPTTDPTRVGGSAGLYSNT
FT                   GNLRAKSFSLTTSTPAITPTATRSDDFERANGSLGANWASDRGTWSIASGEALSAATPT
FT                   NAVATYRPVQLGSSYTVSAHIRIVSSSPSGAEWSGIAANVQGTTSLDYYVLRVTTAGGA
FT                   RTGQWQLLKMAASTTPTVLAQGNMNAPYGTSLELNLGRTGTRFTVSVRNSDSGATLVDT
FT                   SYTLPTTDPTRVGGSAGLYSNTGNLRAKSFSLTTSTPAISPPGTLDCTVDKGSYDFPDA
FT                   QQQVLQTIPVDTTWAGMPVTQRVLTHNDDQYVAYYDDARRMTIAHRSLSDDSWTTKVLP
FT                   STLGWDSHNYVSMGLDRDGNLHVSGNMHNVALVYFRTTVPGDVTSLTRVTTMIDASTEN
FT                   SVTYPEFVNRQDGSLVFSHRNGGSGDGVTYFNVYDEASSAWSRLVDEPLFDGEGSDDNP
FT                   SGTWNAYFENPALGPDGWFHMIWVWRDTGDAATNSRLSYAKSRNLVDWFDSAGTALTTP
FT                   FRYGEADVIDPVPNGGGLLNGNAKLGFDAEGTPIISYHKYDGDGNSQIYVARPDGSGAW
FT                   DIHQVSDWKGRWRFGGGGSLVFTVSMLGSEVMEDGNIRVDFTCSGEPRSIVIDGGLHPV
FT                   AEAATPALPAEITDVRGTYPGLAVRLQTDLAGRNDTGTYYLRWESLPANQDKPRTDWPA
FT                   EGSALEVVLLGPPSAG"
FT   misc_feature    63256..63375
FT                   /locus_tag="SCAB_0601"
FT                   /note="Signal peptide predicted for SCAB0601 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.713 between residues 58 and 59"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    63295..63363
FT                   /locus_tag="SCAB_0601"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB0601 by TMHMM2.0 at aa 32-54"
FT   misc_feature    63304..63336
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    64966..65004
FT                   /note="PS00018 EF-hand calcium-binding domain."
FT                   /inference="protein motif:Prosite:PS00018"
FT   CDS_pept        complement(66571..67704)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0611"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0611"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67288"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBE3"
FT                   /protein_id="CBG67288.1"
FT                   /translation="MKELAGRLTALDPDAGAAVRVIAYFDRLAEHRAGLEAMVRGVAVL
FT                   AGCPARLADAGRRVRLRVETDGHRRDTDQSPDPAWPSAALSPDGAPALWLERAGAPSVV
FT                   DAVTLERAAAAIRVVLDRTRGRAPTAHADDPALVETLLDATAPEQVRLHAARQLGLDPA
FT                   TRARVAAPFDGPPRIVNASARRGPIHPHARPSTPGPAPVPARGTAPTHAGPATADPGPA
FT                   HLDAGSAGTALPPGRVGVGPAVPLLELPDSWAAARTALRFTADGTPHDPGPRVVYADEL
FT                   GGIGLLAELVVPGADPPPDVRALDAAVADAPWMLTTLHAVASTASLRAAAVEVNVHHST
FT                   LQDRLGHAEALLGWAVRTPQGRLRLQLALAMRHLGRA"
FT   CDS_pept        complement(67954..68928)
FT                   /transl_table=11
FT                   /gene="lipW"
FT                   /locus_tag="SCAB_0621"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0621"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67289"
FT                   /db_xref="GOA:C9ZBE4"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBE4"
FT                   /protein_id="CBG67289.1"
FT                   /translation="MTLTPPPFDPELAAALEMIKDTLLTQLTMDEIEATRNGPGIEMWA
FT                   DMDLTLGGAFEVEDRVVPGPENAPDISLLICRPVDPATDGPLPVIYHVHGGGMVLGNNR
FT                   VGVDAPLRWANELGAVVVSVEYRLAPENPYPAPIDDVYAGLLWIADHAEEIGADAERIV
FT                   ITGASAGGGLTAALALLLRDRKGPRPVGQMLMCPMLDDRNDTPSVYQMEGLGAWDRTAN
FT                   DTGWTALLGERRGGPDVSPYAAPARADDLTGLPPAFLDVGSAETFRDEVVAYATRLWQA
FT                   GGAAELHVWPGGFHGFESFAPQAVLSQACQAAQVAWLRRLLAE"
FT   misc_feature    complement(67999..68031)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(68032..68661)
FT                   /gene="lipW"
FT                   /locus_tag="SCAB_0621"
FT                   /note="HMMPfam hit to PF07859, alpha/beta hydrolase fold,
FT                   score 7.6e-73"
FT                   /inference="protein motif:PFAM:PF07859"
FT   CDS_pept        complement(69190..69342)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0622"
FT                   /product="hypothetical protein"
FT                   /note="no db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0622"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67290"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBE5"
FT                   /protein_id="CBG67290.1"
FT                   /translation="MGDWGFRSVGVSHRPGLVSSTLMALATTRVCPLAVTDVLLAEVTT
FT                   RVTPS"
FT   CDS_pept        70400..72415
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0631"
FT                   /product="putative glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0631"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67291"
FT                   /db_xref="GOA:C9ZBE6"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR000933"
FT                   /db_xref="InterPro:IPR011024"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR016286"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBE6"
FT                   /protein_id="CBG67291.1"
FT                   /translation="MKAAALAGGVAAFGLPQALWPATAEAYTVPSKMDWWYQARFGMFI
FT                   HFGSYSYLGQGEWAFDSQQWSKANYQNQVTQNFNPTQFNAATIAELAKNAGMKYLVITA
FT                   KHHEGYAMWNSDVAGFTDTTGTKLYNLRDFNGIQTDPLMNLKTECESRGIKFCLYYSIL
FT                   DWNHPSQTDRHESGLTTMSSQAARTAYIADMKAQLQELLDRYDPALLWFDGDWFAEPSS
FT                   PTLEDWWLESDGVDLYNWLIARKPGLIVNERVKRDHGLGDYAVAEFGIPAEPMGRPWER
FT                   CATMNGAWGYQAGRENSYRSVKDVVQELVTVVSRDGNLLLNIGPKGDGSVTAGTQTVLN
FT                   GLASWMSTYSDSIHGTSGSPFATEPAWGRVTKKSGKLFAHVFTWPTNGQLRIPVIDNTI
FT                   SRVYLLNNPSVSLPYTVTDQINVTVPATAPNANASVVCVEVQGMPVRVSATVFQNVDYQ
FT                   GARAVLPLGSYTSSQLSAAGLAPAAASSILVPDGYQVTGYSGDNFTGTAWTFTSNTPDL
FT                   GVTGNNDVIRSLKVTFRPDKYFRLNNVTNHWALDSGGNVASGSNLKQWESIDHANLQWQ
FT                   AIELGNGYYRLVNRTNGMVADGWGATSNGDPARQKAWDGSNTQQWRITHRGQGQYSIAN
FT                   RSTGLVLDGGGMVAAGAVAKQWTWQQHTNLLWTFGA"
FT   misc_feature    70400..70477
FT                   /locus_tag="SCAB_0631"
FT                   /note="Signal peptide predicted for SCAB0631 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.984) with cleavage site
FT                   probability 0.782 between residues 26 and 27"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    70400..71578
FT                   /locus_tag="SCAB_0631"
FT                   /note="HMMPfam hit to PF01120, Alpha-L-fucosidase, score
FT                   7.3e-15"
FT                   /inference="protein motif:PFAM:PF01120"
FT   misc_feature    71744..71791
FT                   /note="PS00225 Crystallins beta and gamma 'Greek key' motif
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00225"
FT   misc_feature    72008..72400
FT                   /locus_tag="SCAB_0631"
FT                   /note="HMMPfam hit to PF00652, Ricin-type beta-trefoil
FT                   lectin domain, score 0.00024"
FT                   /inference="protein motif:PFAM:PF00652"
FT   CDS_pept        complement(72438..72779)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0632"
FT                   /product="conserved hypothetical protein"
FT                   /note="pseudo: missing stop codon"
FT   CDS_pept        73089..73226
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0641"
FT                   /product="conserved hypothetical protein"
FT                   /note="significant matches only to Nterminal section of
FT                   putative cds"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0641"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67293"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBE7"
FT                   /protein_id="CBG67293.1"
FT                   /translation="MEGGTTANNSNVLQWPWLNKANQKWTFTKTGDGYYKIKTLRSVTS
FT                   "
FT   CDS_pept        73302..74942
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0651"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0651"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67294"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBE8"
FT                   /protein_id="CBG67294.1"
FT                   /translation="MHTTRRLAARLTATASATCLAAVGLALVPAADASAAGAPQGGHVY
FT                   ALTAAHSGKNAAVLSDSLANGARVVQKTVSGGPGQLWEAVDHGDGTFSLVNINSGKCMD
FT                   IQNGSLNAGAAIIQWPCTGAGNQRWTFSGSAVVSARSGLCLDVSDNSTAEDHAIIQWTC
FT                   RNTTNQQWSLTERPRSATWGPAMVSGGQTFTSQTIRMVVHNNTSGAGLRIRLSNLRSTA
FT                   ALSVGAVTVAVQSSGATAVAGTTRTVTFGRSATPTIPAGQEVTSDVIPMPVVAEQNLLV
FT                   SVHLPGTTGASTYHNDAHQTSYLSAAGTGNHAAEEAATNFTTTTARWFYVAGLDVVSPT
FT                   AKGTVVAIGDSITDGSSATNNANQRWPDYLARRLQAQSGGQRLGVVNAGIGGNRVVTDS
FT                   PSAQQGIAARTRFSHDVLTQPGVKNAIVLEGINDINNTTTPTPADQIIAGYQTMIDQAH
FT                   TAGVRIIGGTILPHSSQTAAKAAIRAQVNDWIRTSGAFDAVIDFDAALRDPANPARLLP
FT                   AYDSGDHLHPNSAGMQAIANAVDLALLTS"
FT   misc_feature    73302..73406
FT                   /locus_tag="SCAB_0651"
FT                   /note="Signal peptide predicted for SCAB0651 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.968 between residues 35 and 36"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    73320..73388
FT                   /locus_tag="SCAB_0651"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB0651 by TMHMM2.0 at aa 7-29"
FT   misc_feature    73422..73814
FT                   /locus_tag="SCAB_0651"
FT                   /note="HMMPfam hit to PF00652, Ricin-type beta-trefoil
FT                   lectin domain, score 2.6e-25"
FT                   /inference="protein motif:PFAM:PF00652"
FT   misc_feature    74334..74918
FT                   /locus_tag="SCAB_0651"
FT                   /note="HMMPfam hit to PF00657, GDSL-like
FT                   Lipase/Acylhydrolase, score 9.2e-26"
FT                   /inference="protein motif:PFAM:PF00657"
FT   CDS_pept        75232..75510
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0652"
FT                   /product="conserved hypothetical protein (fragment)"
FT                   /note="pseudo: fragment"
FT                   /db_xref="PSEUDO:CBG67295.1"
FT   CDS_pept        complement(75560..75709)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0661"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0661"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67296"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBF0"
FT                   /protein_id="CBG67296.1"
FT                   /translation="MPEQLTVVIRAVGVGEWTTGTAVRLRPARHRTAGHAPGWITASEL
FT                   AGRV"
FT   CDS_pept        complement(75776..76051)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0671"
FT                   /product="conserved hypothetical protein (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0671"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67297"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBF1"
FT                   /protein_id="CBG67297.1"
FT                   /translation="MPQSSVSMAGQSSSITLECDCLRFPFGHSAVASVLTGARSSQEVR
FT                   DTVEQLRRPIPAALWDELRAEGLLAPDTPVPAAAPTGEAMPSEEPS"
FT   CDS_pept        76637..77683
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0681"
FT                   /product="putative secreted carbohydrate-binding transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0681"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67298"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBF2"
FT                   /protein_id="CBG67298.1"
FT                   /translation="MKLARPRSTAATAAAVLAIMALATACNRETTDSSSGDEPTIGIDL
FT                   PRADSDFWNSYGHYLKKDIRSADVDALPVSNSQSDVSRLVANVQLFQNMGAEAIIMAPQ
FT                   DSGAIASTLDTLSAAKVPVISVDTRPDKGDVYMVVRADNRAYGTKACEFLGEQLGGKGK
FT                   VAEFQGALDSINGRDRSAAFAQCMKEKYPKIKVLELPTEWKGDVASAKLQSLLAQHPDL
FT                   NGIYMQAGGVFLQPTLALLEQKGLLKPAGNKGHITIVSNDGIPQELDAIRDGYIDATVS
FT                   QPADLYAKYAMYYAKAAAKGRTFKPGPTDHDSTIVKIPNGLEDQLPARLVTRDNADDKS
FT                   LWGNSLPR"
FT   misc_feature    76637..76744
FT                   /locus_tag="SCAB_0681"
FT                   /note="Signal peptide predicted for SCAB0681 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.352 between residues 36 and 37"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    76682..76714
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        78044..79000
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0691"
FT                   /product="putative IS transposase"
FT                   /note="PMID:1332944"
FT                   /note="overlaps SCAB0692 seems to be common pattern see
FT                   also SCAB0371, SCAB0991, SCAB23721, SCAB42901, SCAB90821"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0691"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67299"
FT                   /db_xref="GOA:C9ZBF3"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBF3"
FT                   /protein_id="CBG67299.1"
FT                   /translation="MPDQLSSISVPASTAVTPGCDCYVHRFGSLAPGRRAACYPSDMTD
FT                   AEWAEVRAAMPVPAWLLKRGGRPEAYCHRTMLDAVRYLVDNGVKWTALPVDFPYWRAVY
FT                   DFFRRWRAYDYARELYERLRHSARERSGRNAEPSAGIIDSQSVDASETVGEDSRGYDGG
FT                   KSRDGRKRHILTDTEGLLLEVTVTTADVHDSKAAPALLETFMQQPGRLLQLVWVDSAYQ
FT                   GPALARAFARHGVRTEVVRRCDGQRGFVVLARRWVVERTLSWLARSRRLNRDHERRPDH
FT                   HAQMVWWAAVIRLSRRLAADAPRWPEKRPGRLPRARA"
FT   misc_feature    78458..78931
FT                   /locus_tag="SCAB_0691"
FT                   /note="HMMPfam hit to PF01609, Transposase DDE domain,
FT                   score 3.6e-26"
FT                   /inference="protein motif:PFAM:PF01609"
FT   CDS_pept        complement(78918..79508)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0692"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible coiled-coil region aa23-52; overlaps see
FT                   SCAB0691 putative IS transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0692"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67300"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBC1"
FT                   /protein_id="CBG67300.1"
FT                   /translation="MLWIEEGAMPSVLRLMEQREARARQDLESWTEVLEQAQAEVDAAR
FT                   ERVERARVGREELVSVLAGESPVNTPVLVPSGGEMAAALGSSGSGVGHGERPPVWRSGM
FT                   GEEVLSGLYREVFAAMVAASGPVNGVELTRAVGREAEIKNEVEKIRHRAYVLEKRGWLV
FT                   RANDGRFMPAPGAVGRDASPASAERLRPGAGTV"
FT   CDS_pept        79543..80247
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0701"
FT                   /product="putative IS transposase"
FT                   /note="PMID:15686551"
FT                   /note="overlaps 0692 maybe pseudo; strong match to gene on
FT                   S. turgidiscabies PAI"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0701"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67301"
FT                   /db_xref="GOA:C9ZBF5"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBF5"
FT                   /protein_id="CBG67301.1"
FT                   /translation="MPRTRRSPCSPNRDSLCHNALSLAQIRAALKRSGRTRSFDTESER
FT                   LRSVFRAEYAHHLPAVEDAFGQQLLALLKQLDATCQAADDLATATEAAFHQHADSEILL
FT                   SFPGLGPQLAARVLAEIGDDRTRFADARALKSYAGSAPITRASGKKRFVGRRFVKNNRL
FT                   MHAGFLWAFSALHASPGANAHYRRRREHGDWHNAAQRHLLNRFLGQLHHCLQTRQPFDE
FT                   QRAFTPLLQASA"
FT   misc_feature    79768..80097
FT                   /locus_tag="SCAB_0701"
FT                   /note="HMMPfam hit to PF02371, Transposase
FT                   IS116/IS110/IS902 family, score 1.4e-39"
FT                   /inference="protein motif:PFAM:PF02371"
FT   CDS_pept        complement(81253..82089)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0711"
FT                   /product="putative LuxR-family regulator"
FT                   /note="PMID:12819191"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0711"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67302"
FT                   /db_xref="GOA:C9ZBF6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBF6"
FT                   /protein_id="CBG67302.1"
FT                   /translation="MLAAEMHCARGDIAYARAWLDLVPDTLTHPLAARTRLALRYQSGR
FT                   AEEALNSARHDARQARKNGQLADVERLLLRILSLAALQDQPQTIQQTLEELETLHEEAA
FT                   TPTTYEALLLARGIAHRNTDSALTAHRLISRRGDVHLSIAASMCLADLADTPRTWLTEA
FT                   MRNAQRLGLGGPFRTVVTRVTQRRDIPVPRFRQAHQTLSEPDIALVRMVSDGATNRQIA
FT                   AQLACSHKTVEQRLTRLFRRTGTGSRTELAASWMNGTLTRPGKVSDPSSPVPPDDR"
FT   misc_feature    complement(81325..81498)
FT                   /locus_tag="SCAB_0711"
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR family, score 1.7e-06"
FT                   /inference="protein motif:PFAM:PF00196"
FT   misc_feature    complement(81364..81447)
FT                   /note="PS00622 Bacterial regulatory proteins, luxR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00622"
FT   CDS_pept        82155..82682
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0721"
FT                   /product="putative oxidoreductase"
FT                   /note="PF00441 and PF08028 fatty acid oxidation; may
FT                   suggest role in secondary metabolite synthesis for instance
FT                   PMID: 15942003"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0721"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67303"
FT                   /db_xref="GOA:C9ZBF7"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBF7"
FT                   /protein_id="CBG67303.1"
FT                   /translation="MPARPPSFPPGSRAPCVFAPLAHLGWSACWLGTAAGALSRTLRLL
FT                   RSPEERRRRDLKSELLLTRLSRARQRIDTVQAMLSHATGVYVSLPDRERGGAPWQLLVN
FT                   ALKVTASEQCPAAVDELIELVGLRHGYLRHQPLGLERALRDLRSASLNYGNDRLHLANG
FT                   SLSLLDQETTLA"
FT   misc_feature    82185..82658
FT                   /locus_tag="SCAB_0721"
FT                   /note="HMMPfam hit to PF00441, Acyl-CoA dehydrogenase,
FT                   C-terminal doma, score 0.0012"
FT                   /inference="protein motif:PFAM:PF00441"
FT   misc_feature    82209..82241
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    82224..82613
FT                   /locus_tag="SCAB_0721"
FT                   /note="HMMPfam hit to PF08028, Acyl-CoA dehydrogenase,
FT                   C-terminal doma, score 0.0044"
FT                   /inference="protein motif:PFAM:PF08028"
FT   CDS_pept        82825..83475
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0731"
FT                   /product="putative phosphopantetheinyl transferase"
FT                   /note="PMID:11390684"
FT                   /note="domain prediction suggests cds may be fragment of
FT                   secondary metabolism biosynthesis cluster see also
FT                   SCAB0721, SCAB0751"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0731"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67304"
FT                   /db_xref="GOA:C9ZBF8"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="InterPro:IPR041354"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBF8"
FT                   /protein_id="CBG67304.1"
FT                   /translation="MLAAPAAVQRLRPEEYRSAAGMAAWRAREHLAGRALLRLLLAETA
FT                   GEAGARAPVIPEPGGRPRLPGFPDTGVSISHSGPYAAAAVATGLDVGVDAQVPRPPSAA
FT                   LLRRCCAPGTAARLASQPPERAAVAFARIWAVQEACVKARGTGLSGAPWRVRAGPEGQD
FT                   GSWGALQWRRPPWHDAAGAEPVAVACAFGPPEAHPAHPADAPRSRPDPAPRTS"
FT   misc_feature    83095..83283
FT                   /locus_tag="SCAB_0731"
FT                   /note="HMMPfam hit to PF01648, 4'-phosphopantetheinyl
FT                   transferase superfami, score 5.9e-06"
FT                   /inference="protein motif:PFAM:PF01648"
FT   CDS_pept        83492..84517
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0741"
FT                   /product="hypothetical protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0741"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67305"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCS2"
FT                   /protein_id="CBG67305.1"
FT                   /translation="MEKPMRTDATRPISRGLSCYTENLAGYLAARAPARADLTARSVRL
FT                   AVDPATGRFSHHDRALNNLPDGRRLAYRGAPDAEAALTGIAVELAGHARVLAVADSGAL
FT                   PWLSGAADAHAPHLILVDGRTPDGGWHVVDGFTALFSGGGHQEPFAGELSGAELTALLA
FT                   FPRGLSEVHRARNALAFGFPVPTPAQETYQWLAEEQGTTAEHLPGEPWLTGAGALEETA
FT                   RLVLADLRDDGERGVLEDVWAAAQHHIFRDAHLLTADGALSPEERRAVDATTAKWRELP
FT                   RLLRFAANSARRGRPRPSLVTSAFTALAELEAAASPLHAAHGYGVPTALTDVSSHAGQG
FT                   S"
FT   CDS_pept        84523..86145
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0751"
FT                   /product="putative AMP-binding protein"
FT                   /note="PMID:10930733"
FT                   /note="PMID:11048953"
FT                   /note="domain prediction suggests cds may be fragment of
FT                   secondary metabolism biosynthesis cluster see also
FT                   SCAB0731, SCAB0721"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0751"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67306"
FT                   /db_xref="GOA:C9ZCS3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCS3"
FT                   /protein_id="CBG67306.1"
FT                   /translation="MPTTLTLWDRFARTAARHPDRPALVAGTTTLTYAQLRAHAESLAA
FT                   RLTADAPPPRRVALLAARTPVTYAAYLAVQRLGAAVVPLNPAAPSGRNEAVVQQADAAL
FT                   VLADATSDSGPAGRAAPLLPVALTDPSKAPDLRGLPGPGPHDTAYVLFTSGSTGRPKGV
FT                   VIRHANTDAYLDHAVERSGAGPDSRLSQTFGLTFDPSVFDMFVAWSTGAALVVPSADDL
FT                   MDPAGFVRRHRLTHWFSVPSVVSLAARLRRLPPDSMPTLRYAAFAGEPLTVRHARAFAE
FT                   AAPAACLENLYGPTELTVTCTGYRLPADPATWPQTANGTVPIGTAHPGAETVVVDERMR
FT                   PADQGELLVRGPQRFPGYLDPVDDPGRFATGEPDTGLTPYEGGPLTGSQWYRTGDRVAR
FT                   EGDDFVHLGRLDNQVKISGYRVELGEVEEALRSCPGVADAVVVARTERSTSVLEAVYTG
FT                   DAPDPAPLLAALQERLPAYMVPRTLLRLPELPRNLNGKTDRKAVQAALDTARPAASGPL
FT                   RPTPTARPAPGARRTTRLPEGTR"
FT   misc_feature    84616..85845
FT                   /locus_tag="SCAB_0751"
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
FT                   2.3e-101"
FT                   /inference="protein motif:PFAM:PF00501"
FT   misc_feature    84970..85005
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT                   /inference="protein motif:Prosite:PS00455"
FT   CDS_pept        86147..86647
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0761"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0761"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67307"
FT                   /db_xref="GOA:C9ZCS4"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCS4"
FT                   /protein_id="CBG67307.1"
FT                   /translation="MTAPTTPTALPGREEFCSAMAQLATGVAVITTAGPDGPVGCTANA
FT                   VLSLSTEPPSVLVSLAASGRTVRHARAHGSFAVNILGWQQRDLMHRFARLPPAERFDGV
FT                   PHRDEEGCPVLTATAATVVCRLDQAPTVLDHTLLIGRVLWTAQDPTAPALVLYQRHQHP
FT                   VAG"
FT   misc_feature    86204..86641
FT                   /locus_tag="SCAB_0761"
FT                   /note="HMMPfam hit to PF01613, Flavin reductase like
FT                   domain, score 3e-35"
FT                   /inference="protein motif:PFAM:PF01613"
FT   misc_feature    86375..86404
FT                   /note="PS00904 Protein prenyltransferases alpha subunit
FT                   repeat signature."
FT                   /inference="protein motif:Prosite:PS00904"
FT   CDS_pept        86703..87962
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0771"
FT                   /product="putative aminotransferase"
FT                   /note="PMID:15128576"
FT                   /note="related to ectoine biosynthesis aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0771"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67308"
FT                   /db_xref="GOA:C9ZCS5"
FT                   /db_xref="InterPro:IPR004637"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR012773"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCS5"
FT                   /protein_id="CBG67308.1"
FT                   /translation="MSVFATMESEVRSYSRAWPTVFATGRGAVLRDESGRSFIDFFAGA
FT                   GALNYGHNPPELKAALLDYLSGDGVTHGLDMHTTAKRVFLERLRDLVLTPRGLDYRVQF
FT                   PGPGGTNAVEAALKLARKITGRHTVAYFQRGFHGMTLGALAITANSAKRAGAGVPLPHT
FT                   VPVPFDNSSDDEGKSVARLVGSLDGVAADGPLAAVVVETVQGEGGVNPARSAWLRALAA
FT                   WAQEHGTLLVVDDIQMGCGRTGPFFSFETAGIVPDLVCLSKSISGYGTPMALTLIRPEY
FT                   DVWKPGEHNGTFRGYNPAFVTGARALELFWSDRALENRTSTLGERVRRALTETARRHGL
FT                   AAPRGRGLAWGLPFDRPGAAREVCDAAYRGGLLLETAGPHDEVAKVLPPLTVADEHLEQ
FT                   GLGILDEAVTSVVARRTLAA"
FT   misc_feature    86763..87770
FT                   /locus_tag="SCAB_0771"
FT                   /note="HMMPfam hit to PF00202, Aminotransferase class-III,
FT                   score 3.3e-53"
FT                   /inference="protein motif:PFAM:PF00202"
FT   CDS_pept        88085..88759
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0781"
FT                   /product="putative LysE type efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0781"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67309"
FT                   /db_xref="GOA:C9ZCS6"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCS6"
FT                   /protein_id="CBG67309.1"
FT                   /translation="MSVDLAGFLGVVMVAYMVPGPDFLVVVRSAAEHPAKGRAAALGAQ
FT                   TGLCVHMLAAAAGLSLIAARSPVVYDAIKLLGAAYLVYLGIRAVLAARRTAHERRTETA
FT                   AAARPDGLIAPRTQAPDEPSSGRRRSGFTEGFLTNVLNPKAALFFLSILPQFVHDGGST
FT                   AQQIFFLGILDVLIGVVYWFALVAVAARLRAFLARPEIRHRWELTTGWLFIAIGIGVAA
FT                   AS"
FT   misc_feature    88085..88177
FT                   /locus_tag="SCAB_0781"
FT                   /note="Signal peptide predicted for SCAB0781 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.893) with cleavage site
FT                   probability 0.442 between residues 31 and 32"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    join(88097..88165,88202..88270,88298..88357,88487..88555,
FT                   88583..88651,88685..88753)
FT                   /locus_tag="SCAB_0781"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SCAB0781 by TMHMM2.0 at aa 5-27, 40-62, 72-91, 135-157,
FT                   167-189 and 201-223"
FT   misc_feature    88121..88756
FT                   /locus_tag="SCAB_0781"
FT                   /note="HMMPfam hit to PF01810, LysE type translocator,
FT                   score 1.3e-24"
FT                   /inference="protein motif:PFAM:PF01810"
FT   CDS_pept        complement(join(88876..89487,89490..89891))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0791"
FT                   /product="putative transposase"
FT                   /note="pseudo: frameshift after codon 134"
FT                   /db_xref="PSEUDO:CBG67310.1"
FT   misc_feature    complement(88975..89004)
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   CDS_pept        complement(90026..90625)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0811"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0811"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67311"
FT                   /db_xref="GOA:C9ZCS8"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCS8"
FT                   /protein_id="CBG67311.1"
FT                   /translation="MRRLVRRRRSAPDRYSAAVGDVVGHGLHAAAVMGMLRSALSAVIR
FT                   AIPSPAQALEVLGLYARSLEGATAATAVKVLIDTRSRLIIYSNAGHPPPVLLHSDGTCD
FT                   LLDQATDPPLGARPHHVPRPQAGLPYIPGDTLVLYTDGLIERRGEDIDTGLARLTTALA
FT                   QDRTLAPAQLADTLLTRLAVAGGSPDDIALVIIRLY"
FT   misc_feature    complement(90029..90595)
FT                   /locus_tag="SCAB_0811"
FT                   /note="HMMPfam hit to PF07228, Stage II sporulation protein
FT                   E (SpoIIE), score 9.4e-52"
FT                   /inference="protein motif:PFAM:PF07228"
FT   CDS_pept        complement(90630..91265)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0821"
FT                   /product="conserved hypothetical protein"
FT                   /note="PAS domain may indicate role in signal detection"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0821"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67312"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCS9"
FT                   /protein_id="CBG67312.1"
FT                   /translation="MTADIDVTAFFDATPSPYLVLDADLVIRYVNAAYLTATGRTRKDL
FT                   VGRHFFDALPQNPGALDDAQRSPKASLLRVLDTGEADTLVLQRYDISAPDQPGAFEERW
FT                   WSNIHTPLPGPDGAVQWIVQRAEDVTAFVQARRARELASELTEREEGMASELYVRAREV
FT                   YRLNEELRQAHARERRSPSPCRQPCSPRLTWTGTATPSPCATCRRPHH"
FT   misc_feature    complement(90864..91235)
FT                   /locus_tag="SCAB_0821"
FT                   /note="HMMPfam hit to PF08448, PAS fold, score 8.4e-13"
FT                   /inference="protein motif:PFAM:PF08448"
FT   misc_feature    complement(90888..91253)
FT                   /locus_tag="SCAB_0821"
FT                   /note="HMMPfam hit to PF00989, PAS fold, score 0.0046"
FT                   /inference="protein motif:PFAM:PF00989"
FT   CDS_pept        91560..91922
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0831"
FT                   /product="putative transposase"
FT                   /note="PMID:8973350"
FT                   /note="see also SCAB1341, SCAB10021, SCAB81311"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0831"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67313"
FT                   /db_xref="GOA:C9ZCT0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCT0"
FT                   /protein_id="CBG67313.1"
FT                   /translation="MRRKLTAGQMGLMRGPVTMAAPRKYSLELRERAVRMYRTTEPKPQ
FT                   IKKLAVDLGVHPEALRGWIRQAEADAGERDDRLTTDERAELAALRKENAQLKRANDVLR
FT                   TASAFFAAQLDPTRPR"
FT   misc_feature    91647..91868
FT                   /locus_tag="SCAB_0831"
FT                   /note="HMMPfam hit to PF01527, Transposase, score 9e-14"
FT                   /inference="protein motif:PFAM:PF01527"
FT   CDS_pept        91919..92836
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0841"
FT                   /product="putative integrase component"
FT                   /note="PMID:91141314"
FT                   /note="see also SCAB1351, SCAB10011, SCAB81301, SCAB90851"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0841"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67314"
FT                   /db_xref="GOA:C9Z3C1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C9Z3C1"
FT                   /protein_id="CBG67314.1"
FT                   /translation="MTALVDEHPRLGVECVLRELHIPSSTYYRWRRAEKEPCERRRRDV
FT                   ELAERIKEIHAESGGNYGSPRVHAVLRREGTRVGRKRVERLMREADIAGISPRRKGFTR
FT                   RDPKASLAPDLVNRDFTAPAPNRLWVTDLTMVSTGEGPLWLSAIRDAFSRRVVAWETSA
FT                   RADADLVLTTLEYALASREVEPGKLIHHADHGCQYTSIKLTTRLMRAGVEASMGSVGDS
FT                   YDNALAENLWMLIKTEGLRGRTFTTRAEANLALFEYIDGFYNSRRIQERLGFLSPIEFE
FT                   EKYYAEQATAEPTNLNTRQPLLTS"
FT   misc_feature    92279..92764
FT                   /locus_tag="SCAB_0841"
FT                   /note="HMMPfam hit to PF00665, Integrase core domain, score
FT                   3.2e-30"
FT                   /inference="protein motif:PFAM:PF00665"
FT   CDS_pept        complement(92979..93158)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0851"
FT                   /product="putative hydrophobic protein"
FT                   /note="PMID:12791134"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0851"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67315"
FT                   /db_xref="GOA:C9ZCT2"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCT2"
FT                   /protein_id="CBG67315.1"
FT                   /translation="MITMVPLLLVLLLALILFGAGFALKALWWIAVIVLVVWLLGFVIR
FT                   SADTGGRRGRWYRW"
FT   misc_feature    complement(join(93018..93077,93087..93146))
FT                   /locus_tag="SCAB_0851"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SCAB0851 by TMHMM2.0 at aa 2-21 and 25-44"
FT   misc_feature    complement(93084..93149)
FT                   /locus_tag="SCAB_0851"
FT                   /note="Signal peptide predicted for SCAB0851 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.946) with cleavage site
FT                   probability 0.340 between residues 22 and 23"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(93219..93368)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0861"
FT                   /product="putative membrane protein"
FT                   /note="no db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0861"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67316"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCT3"
FT                   /protein_id="CBG67316.1"
FT                   /translation="MRWRKVSIVSLTAGACGHSALELDEPAVAQRPGGEVNARRNWVLC
FT                   PKVR"
FT   misc_feature    complement(93300..93368)
FT                   /locus_tag="SCAB_0861"
FT                   /note="Signal peptide predicted for SCAB0861 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.823) with cleavage site
FT                   probability 0.610 between residues 23 and 24"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    complement(93321..93353)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        93666..94580
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0871"
FT                   /product="putative pyridoxal-phosphate protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0871"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67317"
FT                   /db_xref="GOA:C9ZCT4"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCT4"
FT                   /protein_id="CBG67317.1"
FT                   /translation="MWQPDEVTDPASGTRLPFDEAPADLLQTEASCWHLASDADWHGFP
FT                   GLAAGYCMLDPIKVTLTCPGLDATGVMSEWGIPARILTAYLTTRGIVVEKTDSYTTLVL
FT                   FSMGITKGKWGTLLDALMDFKDLYDGDAPLDRVLPALVAEHPRRYTGRSLRDLCQEMHD
FT                   HLRDACLVELLDRAFQQLPEPVAPPQLCYERLIRGGTERIRLGDAPGRIAAAMVTVTPP
FT                   GIPVLMPGESIGEEEGPLLRYLSALESFDRHFPGFGSETHGVTRCPDTGDYLIECLRPD
FT                   EQEEPGAITPAQRRRTQSAKTMG"
FT   misc_feature    94077..94481
FT                   /locus_tag="SCAB_0871"
FT                   /note="HMMPfam hit to PF03711, Orn/Lys/Arg decarboxylase,
FT                   C-terminal doma, score 9e-53"
FT                   /inference="protein motif:PFAM:PF03711"
FT   CDS_pept        complement(94673..95371)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0881"
FT                   /product="putative sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0881"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67318"
FT                   /db_xref="GOA:C9ZCT5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCT5"
FT                   /protein_id="CBG67318.1"
FT                   /translation="METQRKAMVSDIAHELRTPLTNIRGWLEVTRDGLVEPDLELIASL
FT                   HDEALLLQHIIDDLQDLAAADAGTLALHREPVRADDVVAQTVSAHRARAESSDIRLCTH
FT                   TDPGLVLDADPVRMRQVLGNLTSNALRHTPAGGTVTLTARQDGDLAVLIVEDTGSGIAA
FT                   DDLPHVFERFWRAEKSRSRRTGGSGLGLSIVRQFVEAHEGTVTVDSDAGKGCVFTLGLP
FT                   RTQHTDRRTP"
FT   misc_feature    complement(94700..95035)
FT                   /locus_tag="SCAB_0881"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 2e-46"
FT                   /inference="protein motif:PFAM:PF02518"
FT   misc_feature    complement(95168..95362)
FT                   /locus_tag="SCAB_0881"
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain, score 3.4e-15"
FT                   /inference="protein motif:PFAM:PF00512"
FT   CDS_pept        96057..96224
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0891"
FT                   /product="putative transposase fragment"
FT                   /note="pseudo: short fragment"
FT                   /db_xref="PSEUDO:CBG67319.1"
FT   CDS_pept        complement(96623..98653)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0901"
FT                   /product="putative flavin-binding oxidoreductase"
FT                   /note="PMID:11315118"
FT                   /note="PMID:14769868"
FT                   /note="TTA-Leu codon(s) 115 may indicate regulation by
FT                   BldA"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0901"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67320"
FT                   /db_xref="GOA:C9ZCT7"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCT7"
FT                   /protein_id="CBG67320.1"
FT                   /translation="MTGDHEAVVAGSDLSRRSFATAAGMAAAATTLAGGAPASAMPVQA
FT                   VPAAPAPTRGADFDRCLAVARALLVVDDNDRPLVPRYERVLKDGLPAQRSAKPKRVLVV
FT                   GAGPAGLVTALLLKRAGHHVTVLEANGNRAGGRIKTFRRGGHERAAQPFADPRQYAEAG
FT                   AMRLPSSHPLVMGLIDQLNLKKRRFHYVDVDGEGQPANRTWIYVNGIRMRRVDYARAPR
FT                   RINRSFGVPRARWDTPAAAILRSVLDPVRDEFSTVDAGGKRVDKPLPERVRGWARVIQR
FT                   FGDWSMFRFLTEHAGLDERTVDLIGTLENLTSRLPLSFIHSFIGSSLISPDTAFWELEG
FT                   GTAVLPDALLAQVRDTVRFDRRVTRVEYHDPDRPSSETPHVGRKGHRVWVDTVSEGRDG
FT                   PVVREQFTADAAVVTVPFSGLRHVQISPLMSYRKRRAVAELHYDSATKVLLEFSRRWWE
FT                   FTEADWKRELGRIDPKLYDAYRTGRTPADGSLLGVHPSVPDGHITAGQRTHYAANRAVS
FT                   RDQPQAAHVVGGGSVSDSANRFMYNPSHPVPGSSGGVVLASYSWADDALRWDSLDDEAR
FT                   YPHALCGLQQVYGQRVEVFYTGAGRTQSWLRDPYAYGEASVLLPGQHTELLPSIPLPEG
FT                   PLHFAGDHTSLKPAWIEGALESAVRAALEVHTSRSDGQPAY"
FT   misc_feature    complement(96656..98332)
FT                   /locus_tag="SCAB_0901"
FT                   /note="HMMPfam hit to PF01593, Flavin containing amine
FT                   oxidoreductase, score 4.5e-44"
FT                   /inference="protein motif:PFAM:PF01593"
FT   misc_feature    complement(98510..98653)
FT                   /locus_tag="SCAB_0901"
FT                   /note="Signal peptide predicted for SCAB0901 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.994) with cleavage site
FT                   probability 0.756 between residues 48 and 49"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        98956..100848
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0911"
FT                   /product="putative NAD-binding lipoprotein"
FT                   /note="PMID:15112998"
FT                   /note="PMID:2844130"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0911"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67321"
FT                   /db_xref="GOA:C9ZCT8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR010420"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCT8"
FT                   /protein_id="CBG67321.1"
FT                   /translation="MGRRAELKGRARYWFDTTLARGTSALVGWLAVGCLVVVLPASAVL
FT                   VWTDPHAPASRAERLAEIWRLTGETLRLGGATGPLLRVLLSVLLALVALVYVSTLVGLI
FT                   TTGLTERLTALRRGRSTVLEQGHSVVLGWSEQVFTVVSELVAANANQRYGAVAVLADRN
FT                   KTTMEEALRSKVGATGRTRLICRSGPPTDPVLLALTNPGAASAVLVLPHDDPSGDPDVV
FT                   KTLLALRSALGQGEGPPVVAAVRDDRYRLAATLAAGSRGIVLESDAITARLIVQSARRP
FT                   GLSLVYRDLLDFAGDEFYLAFDPALTGRSFGDTLLAYATSSVVGLLRDGRPLLNPPPQT
FT                   LIGPGDRLIVITRDDDTARLSDCSGLVDESVMTPWRPANARPERLLILGWNRRASLIVE
FT                   QLGRSAAHGSVIAVVADRDEVTAEQVRGIDTHSAPCLTVTFRPGDITRPETLRCLEIDS
FT                   YDSVVVLGPDPVAGQQPDEADNRTLVTLLVLQLLERQTGRELPVVTEMTDDRNRTLAPV
FT                   SPGADVIISGKLIGLLMAQISQNRHLAAVFEELFSPTGSQIHLRPASSYVLPGCEASFA
FT                   TVVAAAQRRGECAIGYRRHDRAMAAPDHGVRINPDKNERRCWTGRDEVVVIAQD"
FT   misc_feature    98956..99093
FT                   /locus_tag="SCAB_0911"
FT                   /note="Signal peptide predicted for SCAB0911 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.934) with cleavage site
FT                   probability 0.588 between residues 46 and 47"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    99025..99057
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    join(99028..99096,99202..99270)
FT                   /locus_tag="SCAB_0911"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SCAB0911 by TMHMM2.0 at aa 25-47 and 83-105"
FT   misc_feature    100108..100536
FT                   /locus_tag="SCAB_0911"
FT                   /note="HMMPfam hit to PF02254, TrkA-N domain, score
FT                   4.4e-05"
FT                   /inference="protein motif:PFAM:PF02254"
FT   CDS_pept        complement(101123..102121)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0912"
FT                   /product="putative former transposase"
FT                   /note="missing stop codon"
FT                   /note="pseudo: seems to be missing stop codon similarity
FT                   breaks at codon 330"
FT   misc_feature    complement(101132..101134)
FT                   /note="similarity breaks off here"
FT   CDS_pept        complement(102058..102534)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0921"
FT                   /product="hypothetical protein"
FT                   /note="no significant db matches"
FT                   /note="TTA-Leu codon(s) 148 may indicate regulation by
FT                   BldA"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0921"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67323"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCT9"
FT                   /protein_id="CBG67323.1"
FT                   /translation="MDDTAGQAACEVRRARSRSTWSPRVAPGPHPFGTGGRTVTGKSVE
FT                   ILWSALAVPMRPRPVLRFAPVTGQGASRGFFRCGRRGPGDKVLGAVVQMSKNARSQPIR
FT                   TFGSDQSEGQPGELTSAEREELRRLRKENREQQQTIEKLKKATLDSTGQSNSAG"
FT   CDS_pept        102568..104058
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0931"
FT                   /product="putative serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0931"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67324"
FT                   /db_xref="GOA:C9ZCU0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCU0"
FT                   /protein_id="CBG67324.1"
FT                   /translation="MIQRQTLAGRYRVGSRLGSGGMAEVYLAQDLRLGRTVAVKTLRAD
FT                   MAFDPYFRERFRREARSAASLNHPSVVAVYDSGEEQLTGGGVLPYIVMEYVPGTTLAER
FT                   LRSEIPPTLQQALELTDGVLRALEHAHGAGIVHRDVKPANVMLTADGAVKVMDFGIARA
FT                   MSGQETAITQASIVIGTAEYLSPEQAIGQPADARSDLYAVGCLFHELLTGRPPFHGGSP
FT                   LSVAHRQVRETLRAPSEIVPGIPPEVDALVLKALAKDPAQRHQDAPAMRAAVAAVRTSL
FT                   TAEAPTTATLHIDSGRTEFDLERSEPPSAATRKARNPRRRTRPRRVLHAVAVSLVIALG
FT                   GAGTSVWLTLHSPAESRQHQVPAPDLLGRTLPDARAQARTTGFRLVRSSSGLCSDLRQT
FT                   GGRVCGQSPSAGSLLDQGSVITVFVAPRDRRTDTASASTTHNEILVTTQWAPSAALFAL
FT                   GSTPRSFALGSTPRSSTAPASERSMQSGLSGRDGAAKP"
FT   misc_feature    102598..103389
FT                   /locus_tag="SCAB_0931"
FT                   /note="HMMPfam hit to PF00069, Protein kinase domain, score
FT                   1.1e-61"
FT                   /inference="protein motif:PFAM:PF00069"
FT   misc_feature    102616..102687
FT                   /note="PS00107 Protein kinases ATP-binding region
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00107"
FT   misc_feature    102970..103008
FT                   /note="PS00108 Serine/Threonine protein kinases active-site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00108"
FT   misc_feature    103546..103614
FT                   /locus_tag="SCAB_0931"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB0931 by TMHMM2.0 at aa 327-349"
FT   CDS_pept        complement(104593..105996)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0951"
FT                   /product="putative FAD-binding protein"
FT                   /note="PMID:12183628"
FT                   /note="PMID:15797213"
FT                   /note="PMID:12770825"
FT                   /note="PMID:12940979"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0951"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67325"
FT                   /db_xref="GOA:C9ZCU1"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCU1"
FT                   /protein_id="CBG67325.1"
FT                   /translation="MNAEHTVIIGAGMAGLLTAAVIGATGRPVTVLEQNRSHGMPAPRG
FT                   GVPQGRQPHVLLHRGLSAIEELLPGLRKQLVAAGGVPLDTGDLAWLGERGWAPFGTPAL
FT                   ELVSATRPLVEHLVRQRVAELPGVELRGGARVRGLSRGATTTGGGWMVECFNAPPVRAD
FT                   LVVDASGRSSRLPDWLSPWGIEKPATTVVDAGFGYAGRVYAAPPDHLGKVAGIVILPVP
FT                   GAPAGGVALPVEDGRWMVAAVGAGDHRPPRDPAGFDAFLNRLRDPALADFTRSAHPLGD
FT                   ITAHRRTNNVRRRYDRLTHWPDGLLVVGDALCAFNPVYGQGITVASTQALLLRQALATD
FT                   VRPGRERRLMRRLHRAADLPWAIATGEDLRHTAGRPASGLDALFGRWSGEVDRLAAHGN
FT                   LRAQRALDRVYHLVGSPAGLLHPALLASAVRGRLLGLPTPVPRPPLTTGSAQPDQTDTD
FT                   RHPSYPPAP"
FT   misc_feature    complement(104896..105990)
FT                   /locus_tag="SCAB_0951"
FT                   /note="HMMPfam hit to PF01494, FAD binding domain, score
FT                   0.0011"
FT                   /inference="protein motif:PFAM:PF01494"
FT   misc_feature    complement(105919..105978)
FT                   /locus_tag="SCAB_0951"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB0951 by TMHMM2.0 at aa 7-26"
FT   misc_feature    complement(105919..105996)
FT                   /locus_tag="SCAB_0951"
FT                   /note="Signal peptide predicted for SCAB0951 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.926) with cleavage site
FT                   probability 0.323 between residues 26 and 27"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(106002..106790)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0961"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0961"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67326"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCU2"
FT                   /protein_id="CBG67326.1"
FT                   /translation="MIEMHSDSVSRRENMAMVSPRQLIQNHPDRESGTPSNSIEVRFLR
FT                   PGDVKALITLEHAKWDQDQAADRVELAARIQAFPGLSIGAFETGGAALASLFMKPITTA
FT                   ELGSAATWADCARVETPHPKATGSLFGISLSSVDADAVTAIFEFFWPHALKHGWRDIYL
FT                   GSPMPGLQAWRRANPDMPVEVYMREKRQDLPRDPQLRYYHNKGFKDIVACKSGYFPHTA
FT                   SLDYGAILRGHIPLSAGAPLWRLVPLPWLKQMRRLLFRLV"
FT   CDS_pept        107130..107783
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0971"
FT                   /product="putative acyl-[acyl-carrier protein] desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0971"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67327"
FT                   /db_xref="GOA:C9ZCU3"
FT                   /db_xref="InterPro:IPR005067"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCU3"
FT                   /protein_id="CBG67327.1"
FT                   /translation="MPTADIRLLLDLEPVVEADLNRHLATAKEWFPHEYVPWSRGLDFD
FT                   GVLGGQAWAPGQSNLPEAVRTSLIVNLLTEDNLPIYHRVIAEYFGRDGAWGTWVHRWTA
FT                   EEDRHGHVIRDYLLATRAVNPVALERARMVHLATGFELEYTGAAEALAYVSFQELATRI
FT                   AHRNTGRLSGGPVCDQLLARVAQDENLHMSSTATCSTRRSTWCPMPPCVRSPGS"
FT   misc_feature    107133..107780
FT                   /locus_tag="SCAB_0971"
FT                   /note="HMMPfam hit to PF03405, Fatty acid desaturase, score
FT                   2.2e-08"
FT                   /inference="protein motif:PFAM:PF03405"
FT   CDS_pept        108135..108560
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0981"
FT                   /product="hypothetical protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0981"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67328"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCU4"
FT                   /protein_id="CBG67328.1"
FT                   /translation="MTEASDFRPLPAATGTPMAHLHSETPAVFRRMGSDWPAVSTWTFR
FT                   HIASLAPSLPVQLVKGNREKDHTAFTESTLGEYLDSLTVGSLTGESPDGDDRTYLKEFD
FT                   LLQRFPGLRDDLSALWQRESLFGEQGLRRVRGMIAAG"
FT   CDS_pept        108579..109169
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0982"
FT                   /product="conserved hypothetical protein"
FT                   /note="overlaps see SCAB0991 putative IS transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0982"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67329"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZBC1"
FT                   /protein_id="CBG67329.1"
FT                   /translation="MLWIEEGAMPSVLRLMEQREARARQDLESWTEVLEQAQAEVDAAR
FT                   ERVERARVGREELVSVLAGESPVNTPVLVPSGGEMAAALGSSGSGVGHGERPPVWRSGM
FT                   GEEVLSGLYREVFAAMVAASGPVNGVELTRAVGREAEIKNEVEKIRHRAYVLEKRGWLV
FT                   RANDGRFMPAPGAVGRDASPASAERLRPGAGTV"
FT   CDS_pept        complement(109087..110082)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_0991"
FT                   /product="putative IS transposase"
FT                   /note="PMID:1332944"
FT                   /note="see also SCAB0371, SCAB0691, SCAB23721, SCAB42901,
FT                   SCAB90821"
FT                   /note="TTA-Leu codon(s) 4 may indicate regulation by BldA"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_0991"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67330"
FT                   /db_xref="GOA:C9YZ30"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C9YZ30"
FT                   /protein_id="CBG67330.1"
FT                   /translation="MTRLRHQHDQGSPLPDQLSSISVPASTAVTPGCDCYVHRFGSLAP
FT                   GRRAACYPSDMTDAEWAEVRAAMPVPAWLLKRGGRPEAYCHRTMLDAVRYLVDNGVKWT
FT                   ALPVDFPYWRAVYDFFRRWRAYDYARELYERLRHSARERSGRNAEPSAGIIDSQSVDAS
FT                   ETVGEDSRGYDGGKSRDGRKRHILTDTEGLLLEVTVTTADVHDSKAAPALLETFMQQPG
FT                   RLLQLVWVDSAYQGPALARAFARHGVRTEVVRRCDGQRGFVVLARRWVVERTLSWLARS
FT                   RRLNRDHERRPDHHAQMVWWAAVIRLSRRLAADAPRWPEKRPGRLPRARA"
FT   misc_feature    complement(109156..109629)
FT                   /locus_tag="SCAB_0991"
FT                   /note="HMMPfam hit to PF01609, Transposase DDE domain,
FT                   score 3.6e-26"
FT                   /inference="protein motif:PFAM:PF01609"
FT   CDS_pept        complement(110102..110818)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1001"
FT                   /product="putative mini-circle(IS117)-related transposase"
FT                   /note="PMID:2575701"
FT                   /note="PMID: 15686551"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1001"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67331"
FT                   /db_xref="GOA:C9ZCU7"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCU7"
FT                   /protein_id="CBG67331.1"
FT                   /translation="MLVTCTNERIQEDSLNVSCGIDWAERHHDVAFVDDTGTQLAKARI
FT                   SDDAAGYHKLLDLLAEHGDSPENPIPIAVETSHGLLVAVLRTGSREVFAINPLAASRYR
FT                   DRHGVSRKKSDPGDALVLANILRTDRHAHRPLPADSELAQAIAVLARAQQDAVWSRQQV
FT                   ANQVRSLLREYYPAALHAFQGKEGGLTRADARVILTLAPIPAKAARLSALWLTGFRSRC
FT                   AARVIIWTEVRVRSRA"
FT   misc_feature    complement(110267..110566)
FT                   /locus_tag="SCAB_1001"
FT                   /note="HMMPfam hit to PF01548, Transposase, score 5.6e-35"
FT                   /inference="protein motif:PFAM:PF01548"
FT   CDS_pept        complement(111788..113008)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1021"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1021"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67332"
FT                   /db_xref="GOA:C9ZCU8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCU8"
FT                   /protein_id="CBG67332.1"
FT                   /translation="MTLTDQLTDVPSTPRRKVLISGAGIAGPALAFWLNRYGYAVTVVE
FT                   KAPTLRGGGYPIDVRGTALEVVRRMGILPRLRDAHIDLRRLTFLDSDGSEVTSLHPHAV
FT                   TGGVAGRDLEVRRGDLTQALYTAVRDDVEFLFNDSIDTLDQGEHGVDVTFHGGGSRTFD
FT                   MVFGADGMHSRTREMLFGPEEQFHRYLGYCFAVFTMRNTFGLSHETVMWNAPGRAAALY
FT                   AVWDDDEVHAFLNFARPEPPMDVFRGPQAQRDLVAEVFADAGWEVPGMLAALREAEDLF
FT                   FDGVSQIRMPRWSSGRVALVGDAAYAPSFLTGQGTSLALVGAYMLAGCLADRGHGAGFA
FT                   AYERDTRQFVTANQGLVSQGGATLFPTTAQALEQRNERLRSLSAMPPAEGKPAHSALTL
FT                   LEPLRPA"
FT   misc_feature    complement(111938..112966)
FT                   /locus_tag="SCAB_1021"
FT                   /note="HMMPfam hit to PF01494, FAD binding domain, score
FT                   4.7e-05"
FT                   /inference="protein motif:PFAM:PF01494"
FT   misc_feature    complement(112022..112054)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(113001..115956)
FT                   /note="putative ABC transport system"
FT   CDS_pept        complement(113005..114420)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1031"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1031"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67333"
FT                   /db_xref="GOA:C9ZCU9"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCU9"
FT                   /protein_id="CBG67333.1"
FT                   /translation="MTERTLMTTTLAPPAPIGKAAVGALGLLALSAGALESVVSPTIPL
FT                   LERELDMSQSEGALLSIVLLITGALITPLAGKFGDRYGGKRVLIRLMALVAVGGTVSAL
FT                   APNLPVLLLGQVLQGAMVGALPLSFIVVRRNLPPGESKVAIGVVSGLFVGGGMVGMLSA
FT                   GPVAEQLPRHWMFALPTIAVIGATLLVNRLMPSDQPGGSDGADIDWPGLLLLSGTLVTL
FT                   MLVLALAPEAASQPLVLGALVVFLAVFVTGWVSVERRAASPMIDLHMLARPAIWKACAL
FT                   TFVICLGTSMAVYLVPQLLDERGDGYGFSAGATEIGFFLLPGAVAATLAGPLGGIGDRR
FT                   FGSRAVVNTGVVMMAVSLVVLASVHTEVWHLVVGKALIALANGLCVTAMMTSTATAVDA
FT                   KDTGIATSLILVSRVLGYAVGGQLGGALLTAATPSGSQVAAESAYVTGFVVAGVVTSLA
FT                   LFVTRTMPKGVKE"
FT   misc_feature    complement(join(113038..113097,113125..113193,
FT                   113251..113319,113329..113388,113422..113490,
FT                   113533..113601,113659..113727,113737..113796,
FT                   113833..113901,113929..113988,114025..114093,
FT                   114103..114162,114196..114249,114292..114360))
FT                   /locus_tag="SCAB_1031"
FT                   /note="14 probable transmembrane helices predicted for
FT                   SCAB1031 by TMHMM2.0 at aa 21-43, 58-75, 87-106, 110-132,
FT                   145-164, 174-196, 209-228, 232-254, 274-296, 311-333,
FT                   345-364, 368-390, 410-432 and 442-461"
FT   misc_feature    complement(113134..114348)
FT                   /locus_tag="SCAB_1031"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 6.7e-39"
FT                   /inference="protein motif:PFAM:PF07690"
FT   misc_feature    complement(114361..114420)
FT                   /locus_tag="SCAB_1031"
FT                   /note="Signal peptide predicted for SCAB1031 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.900) with cleavage site
FT                   probability 0.680 between residues 20 and 21"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(114614..114907)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1041"
FT                   /product="putative ABC transport system integral membrane
FT                   protein (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1041"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67334"
FT                   /db_xref="GOA:C9ZCV0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCV0"
FT                   /protein_id="CBG67334.1"
FT                   /translation="MMTVLDRRRELGMLRLAGSTRRQVMTMLRREGLPAAVVGVVLGSA
FT                   IAAATLIPMMSGVTGDMPYVPPLVYGCFAVAAGGLALPAVTLPARATLRRWS"
FT   misc_feature    complement(join(114650..114718,114746..114814))
FT                   /locus_tag="SCAB_1041"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SCAB1041 by TMHMM2.0 at aa 32-54 and 64-86"
FT   misc_feature    complement(114692..114724)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(114764..114907)
FT                   /locus_tag="SCAB_1041"
FT                   /note="Signal peptide predicted for SCAB1041 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.860) with cleavage site
FT                   probability 0.451 between residues 48 and 49"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(115105..115956)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1051"
FT                   /product="putative ABC transport system ATP binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1051"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67335"
FT                   /db_xref="GOA:C9ZCV1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCV1"
FT                   /protein_id="CBG67335.1"
FT                   /translation="MRLRRGKRQKADNRPEVSAATVPLAVELRDVRRQYGRGAGTVHAL
FT                   AGIDLALPRGTFTAVMGPSGSGKSTFLQCAAGLDRPTAGSVRLGGTEITGMSQNELTEL
FT                   RRSRLGFVFQVFNLLPSLTVEQNVLMPVRLAGQRQVRRQAQAVLAQVGLADKAKRRPGE
FT                   LSGGEQQRVAVARALVTSPDVIFADEPTGGLDTGTAAEVLGLLRNAVDALGATVVQVSH
FT                   DPAAAAWATVCGSSPTAPSPTTSSAVRRSRSRHGWPCSPRAPPAPVRWRGRRRDAPQRT
FT                   RP"
FT   misc_feature    complement(115255..115794)
FT                   /locus_tag="SCAB_1051"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.7e-51"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    complement(115423..115467)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(115750..115773)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(116091..116765)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1061"
FT                   /product="putative two component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1061"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67336"
FT                   /db_xref="GOA:C9ZCV2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCV2"
FT                   /protein_id="CBG67336.1"
FT                   /translation="MTTRVIIVDDQAMVRAGFAALLAAQSDIDVVGEAPDGAQGVELSR
FT                   RTHPDVVLMDVRMPEMDGLEAARRLLEPAPGVTHRPRVLMLTTFDVDDYVYEALRAGAS
FT                   GFLLKDAPPADLIAAVRVVASGDALLAPSVTRRLIADFARQRPAVRGKPALRLKRLTER
FT                   ETEVLTLVARGQSNGEIAQTLVLAEQTVKTHVSRVLTKLDLRDRAQAVVFAYESGLVAP
FT                   GE"
FT   misc_feature    complement(116124..116297)
FT                   /locus_tag="SCAB_1061"
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR fami, score 2.1e-20"
FT                   /inference="protein motif:PFAM:PF00196"
FT   misc_feature    complement(116160..116318)
FT                   /locus_tag="SCAB_1061"
FT                   /note="HMMPfam hit to PF08281, Sigma-70, region, score
FT                   0.0011"
FT                   /inference="protein motif:PFAM:PF08281"
FT   misc_feature    complement(116163..116246)
FT                   /note="PS00622 Bacterial regulatory proteins, luxR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00622"
FT   misc_feature    complement(116403..116759)
FT                   /locus_tag="SCAB_1061"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 1e-32"
FT                   /inference="protein motif:PFAM:PF00072"
FT   CDS_pept        complement(116778..118013)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1071"
FT                   /product="putative two component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1071"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67337"
FT                   /db_xref="GOA:C9ZCV3"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCV3"
FT                   /inference="protein motif:GO:0000155"
FT                   /protein_id="CBG67337.1"
FT                   /translation="MEEERPRALLAGASRRWVRLLPWAVAFVLCVALLPTTIVVLSADY
FT                   GLTGGVAGALAGALAVAQAAPLPLAVVRPLQAWYVVFVADVAGALALLTVDFQERLLWP
FT                   FPPMEIVGYVGLCLALGLRERRRTLLLVWLATAAANVALGFVAPHGFGAMGLLFTILGG
FT                   VALLLGGALRERSEAQRRLVEQETISEAERGRRTLLEERARIARELHDVVAHHMSVITV
FT                   QADTAEYRLDRLPPDVREEFTSIAATARESLGDMRRLLGVLRNEEAHGELVPQPGLAQI
FT                   GQLVEVTARARGPVEFTPCDVEVPEAVGLSAYRIVQEALSNVVRHAPGARTQVSLSVTA
FT                   SDPQDGARLTVLVVNGPPPQPPDGPLEVGGTGHGLVGMRERVRLVGGSLDTGPLPDGGF
FT                   RVAARLPLNFLD"
FT   misc_feature    complement(116790..117095)
FT                   /locus_tag="SCAB_1071"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 9.5e-15"
FT                   /inference="protein motif:PFAM:PF02518"
FT   misc_feature    complement(117207..117413)
FT                   /locus_tag="SCAB_1071"
FT                   /note="HMMPfam hit to PF07730, Histidine kinase, score
FT                   6.2e-27"
FT                   /inference="protein motif:PFAM:PF07730"
FT   misc_feature    complement(join(117498..117566,117576..117629,
FT                   117648..117701,117729..117782,117801..117869,
FT                   117897..117956))
FT                   /locus_tag="SCAB_1071"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SCAB1071 by TMHMM2.0 at aa 20-39, 49-71, 78-95, 105-122,
FT                   129-146 and 150-172"
FT   misc_feature    complement(117822..118013)
FT                   /locus_tag="SCAB_1071"
FT                   /note="Signal peptide predicted for SCAB1071 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.905) with cleavage site
FT                   probability 0.752 between residues 64 and 65"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(118209..118577)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1081"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1081"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67338"
FT                   /db_xref="GOA:C9ZCV4"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCV4"
FT                   /protein_id="CBG67338.1"
FT                   /translation="MKLHGFQDLRRRTGRERLVEGTLLVAHVAAYVTLLLTTMPLTHAL
FT                   VFAALHQAWFGLHLGMAFAPHHKGTDMPDPDGEKGGHLRLQVLTSRTVRGSFLTDWFRG
FT                   ASTTRSSTTCSPACPART"
FT   misc_feature    complement(118449..118517)
FT                   /locus_tag="SCAB_1081"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB1081 by TMHMM2.0 at aa 21-43"
FT   CDS_pept        complement(119147..121054)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1101"
FT                   /product="putative secreted glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1101"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67339"
FT                   /db_xref="GOA:C9ZCV5"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCV5"
FT                   /protein_id="CBG67339.1"
FT                   /translation="MRGTFVRAALAAVFLLSPLVSVPADAQEPAGAAVSAAGWTAPLST
FT                   RGRWIVDADGDRFKLRSGNWHGASGTWNGSGSVDEDANHHAGENSGRTPLGLDRAPVAE
FT                   IIAGFREIGINSVRLPFSNEMIHDGVPVTDDAVAANPALRGRTPLQVYDAVVRDLTAAG
FT                   LAVILNNHTNTTRWYCGVDGNERWNASRSDREWEDDWLFMARRYRDNPRVVGADLYNEV
FT                   RRDIWDDANWGLGDAHDWFAASQRVGDRILTEANPELLIIVEGINWTGVPVDGLPHERP
FT                   TLEPVRRLSHTLVDSGKLVYSAHFYDYTGPRHSGATGIGETSDPRYRDLTPAELVDVLT
FT                   RQAFFVTGEQNRHFTAPVWISEFGVGGRAETGVRPRAWFENFVDQLIRTDADFAYWPLV
FT                   GRHENRTGNGWALLHWDAAGDRMGVYDGDDWRAAAWARLTGAPGRTGHVDPVPEWVMLS
FT                   PDHGDFVASRRMRALPDWDPGARKAVCPDGLRLLGLSHTGNRGLCSDVSAGPGWDPAAG
FT                   HRVVVDERYVVPGRDWAGGYTKLQCPDRHFLTGYSVRGAAVSAALCVPAAPGPPLGTGG
FT                   HTVWFDRGDNRGSAPKGGDFAQGHYKGQCADGEYAAGIAYTGRVGSSRTPDALYCRPLG
FT                   "
FT   misc_feature    complement(119834..120832)
FT                   /locus_tag="SCAB_1101"
FT                   /note="HMMPfam hit to PF00150, Cellulase (glycosyl
FT                   hydrolase family 5), score 9.6e-10"
FT                   /inference="protein motif:PFAM:PF00150"
FT   misc_feature    complement(120386..120415)
FT                   /note="PS00659 Glycosyl hydrolases family 5 signature."
FT                   /inference="protein motif:Prosite:PS00659"
FT   misc_feature    complement(120959..121054)
FT                   /locus_tag="SCAB_1101"
FT                   /note="Signal peptide predicted for SCAB1101 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.574 between residues 32 and 33"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        121386..121829
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1111"
FT                   /product="hypothetical protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1111"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67340"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCV6"
FT                   /protein_id="CBG67340.1"
FT                   /translation="MGELFTEAQVLMLGGRPAEGVALQQEARGLMYGLIERNPADHAAK
FT                   EMLGNLLYGLGSTLTSAGEPGEALDALTECAAVYEELAASAAPGEESASTMVPLLADVH
FT                   ARKAHALGHGASAVVESDEAVVTCLELDAGEAARPICSTSPGS"
FT   CDS_pept        complement(122258..122848)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1121"
FT                   /product="putative F420-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1121"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67341"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCV7"
FT                   /protein_id="CBG67341.1"
FT                   /translation="MTTIAVLGNGRVGGNLAAALARAGHEVTVADRTSGVAAVRTARIV
FT                   INATPGAGSLDRLAALREELRDKILVDVSNATTDGPDGLPADLLHPGSSLAEQLQEALP
FT                   ETRVVKTLNTMLFPVMTSPATLVQAPTAFLSGEDLQAKQTVHELLTDLGWQKEWITDLG
FT                   GIQTARATEAAILFVPHVIRSAGFTPFAISIAR"
FT   misc_feature    complement(122321..122842)
FT                   /locus_tag="SCAB_1121"
FT                   /note="HMMPfam hit to PF03807, NADP oxidoreductase coenzyme
FT                   F420-depen, score 6.7e-07"
FT                   /inference="protein motif:PFAM:PF03807"
FT   misc_feature    complement(122366..122848)
FT                   /locus_tag="SCAB_1121"
FT                   /note="HMMPfam hit to PF03446, NAD binding domain of
FT                   6-phosphogluconat, score 0.00024"
FT                   /inference="protein motif:PFAM:PF03446"
FT   misc_feature    complement(122666..122695)
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   CDS_pept        complement(122890..123708)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1131"
FT                   /product="putative inositol-1-monophosphatase"
FT                   /note="Function of phosphatidylinositol in mycobacteria:
FT                   PMID: 15634688"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1131"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67342"
FT                   /db_xref="GOA:C9ZCV8"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCV8"
FT                   /protein_id="CBG67342.1"
FT                   /translation="MPETLQTTDVAVSDADLLAQTAIAVREAGSALRQRFGEVTSPQSR
FT                   EELMRALAVNDDAALDILRPRLTGLLPTAGWVEDELDGGALPPGEWWVVDPAEGNVNHL
FT                   HALPEWAVTATLVRENQPVLTAVHLPLTGETYTALTGAGAHLDGRPLHVSQSADLALSI
FT                   VATSQARPDEDEKVVRRVGSSITAMLFDALVVRVAVPATLHLLNVAAGRIDAFWQFAGA
FT                   RADLLPGALLVTEAGGRISDAEGRPWTPQSQSFLAAAPGVHAEAAATLSR"
FT   misc_feature    complement(122893..123669)
FT                   /locus_tag="SCAB_1131"
FT                   /note="HMMPfam hit to PF00459, Inositol monophosphatase
FT                   family, score 2.3e-21"
FT                   /inference="protein motif:PFAM:PF00459"
FT   misc_feature    complement(123307..123324)
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT                   /inference="protein motif:Prosite:PS00343"
FT   CDS_pept        123860..124753
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1141"
FT                   /product="putative LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1141"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67343"
FT                   /db_xref="GOA:C9ZCV9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCV9"
FT                   /protein_id="CBG67343.1"
FT                   /translation="MNLLAALDALLEEGSVAGAAARLHVTAPAMSRSLGRIRRTTGDQI
FT                   LVRTGRTMAPTPYAIAVREQVHELLHQVQGVLAPSRELDLATLERTFTLRWHDSLVALS
FT                   GPALLAAVRDQAPGVRLRFVAESSTDTPELRRGEVDLEANANRPNAPDIRVENVGETHL
FT                   VIVMRQGHPLTRVGTVTAKRYAAAEHITVSRRGNLGNAIDDALARLGLSRRVVATVPTE
FT                   AAALEFVRGSDNLISVPEATTRPAAADLGLVVLPLPLELPSAPIYLSWHQRYDTDHAHA
FT                   WLRRLARTTLARCGAS"
FT   misc_feature    123860..124039
FT                   /locus_tag="SCAB_1141"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 1.3e-16"
FT                   /inference="protein motif:PFAM:PF00126"
FT   misc_feature    123902..123994
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    124112..124735
FT                   /locus_tag="SCAB_1141"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 7.6e-22"
FT                   /inference="protein motif:PFAM:PF03466"
FT   CDS_pept        complement(124877..125266)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1161"
FT                   /product="putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1161"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67344"
FT                   /db_xref="GOA:C9ZCW0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCW0"
FT                   /protein_id="CBG67344.1"
FT                   /translation="MVLEAVEGYRPFFQPSEFLDKPYVSVSADVVVAENDDTARALATG
FT                   YGPWVRSIRTAEGAIEYPTPEEARAHPWTGEDRALVQDRLDTQFVGSPGRVADQLEQLQ
FT                   EATGGEGRHGQVGVRDGQSGGRPSP"
FT   CDS_pept        125945..126310
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1171"
FT                   /product="putative peptidase fragment"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1171"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67345"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCW1"
FT                   /protein_id="CBG67345.1"
FT                   /translation="MDVRARFRIGSVSNTFSSVVLLQLVQEGRLELDAPVNRHLPGPLP
FT                   DDRITVRHLLTHRSGLADYTNAMFEQTVPGFEAVRNRVFSYQELVDLSHQTSGPRASAS
FT                   VTASSDTAYRRSGGEST"
FT   CDS_pept        complement(126358..126693)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1181"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1181"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67346"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCW2"
FT                   /protein_id="CBG67346.1"
FT                   /translation="MGVRRDRHPYGPLVSPVRPRACPGLAITRRTVTGLADRLPTVAPD
FT                   LPGHPDYPRILAAFNHATRPLRAKDVCEAFGHELLPKSVEGTRAKLKRLVKLGILTEAD
FT                   TGNFARK"
FT   CDS_pept        126786..127622
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1191"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1191"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67347"
FT                   /db_xref="InterPro:IPR025507"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCW3"
FT                   /protein_id="CBG67347.1"
FT                   /translation="MAAFAVVLAASCAAPALAFGSVPASAGGGGLTAIGLTESQRLVEF
FT                   DVDRPAHAWSLGKISGLAGDSRLVGIDFRVQNGKLYGVGDRGGIYTLDARAKARKVSQL
FT                   TVALSGTAFGVDFNPAANRLRVVSDTGQNLRHNIDDPAAPLTTTVDGTLTNPTTPPSTA
FT                   RGVTGAAYTNNDLSTATATTLFDLDTMADRISLQSPANAGTLAPTGNLGVDAALDAGFD
FT                   IYYHPTSGTNRGFAAIATAGVHRLYGVNLLTGKATDKGSFPKKFQVTDLALPIDQK"
FT   misc_feature    126786..126863
FT                   /locus_tag="SCAB_1191"
FT                   /note="Signal peptide predicted for SCAB1191 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.878 between residues 26 and 27"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    126789..126821
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(127740..127991)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1201"
FT                   /product="putative transposase fragment"
FT                   /note="pseudo: isolated short fragment"
FT                   /db_xref="PSEUDO:CBG67348.1"
FT   CDS_pept        complement(128596..129168)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1221"
FT                   /product="hypothetical protein"
FT                   /note="no db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1221"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67349"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCW5"
FT                   /protein_id="CBG67349.1"
FT                   /translation="MAGPTGRGNSLGAALNDLLRTQVTPRHRLSSYNAKHWHAQLSQLT
FT                   ATHRGQQALADAGLHVTAKTLINWLSDAEYNVRRSYLDIIHTAYENVAVVPADPIPRHI
FT                   KRGQYEISGIVKTGDDERTRGTVDAAPLRIDGTRGQWDAIEELWFAGELSDDEFEDHFI
FT                   DDVIVEDIGEGTDGWEFPGASYAVEVR"
FT   misc_feature    complement(129100..129156)
FT                   /note="PS00095 C-5 cytosine-specific DNA methylases
FT                   C-terminal signature."
FT                   /inference="protein motif:Prosite:PS00095"
FT   CDS_pept        complement(129168..131735)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1231"
FT                   /product="putative ATP-binding protein"
FT                   /note="product inferred from PF03796 ATP-binding function"
FT                   /note="no full-length matches in db"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1231"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67350"
FT                   /db_xref="GOA:C9ZCW6"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCW6"
FT                   /protein_id="CBG67350.1"
FT                   /translation="MSQSPQEEGAINATTARNSLYSLVKLVEEEGRTTLITKHKVRALL
FT                   VPLDRFPAARRTDAFPAHVLSTAQRDFGDLVTLAAQGQPQVLLRNTTPVAVLLPADSSP
FT                   DALSSDTAAYPGAASAGGAVNSQGSQDRGSTPRRLATLGDAIGSVLTDGPVGGPTFGLS
FT                   GLDTATGGLQRGKLTLVAARPSVGGSLLGLAAARKTALVDHDMVLYAASGPNRDDIFRR
FT                   IISAETGGEYARLKQGRLTQHEQNIAHQLVQAGDLLMIDDGSDLTAEDIRETAPHMEGL
FT                   ALVVVDRLQTVHSARLPLSGERLPAASQVLATLARTLHVPVLAIVDSDDPALLDLLDAD
FT                   VTLTLTPTEDPARVQVTVTERDFGTIGSAYLQPDLVHARFLDAGAAPLEHTDSPAGPGL
FT                   SAAVGETAARELAEAALPYTAGGHQGIPAALTRELAAWRTAVKSGDQGALTALLPSLLQ
FT                   AAATVSQWPDTHEGHRLANALRPYGTSQSAGTAGGAGQPQATGAAVHAPVDNTQARASV
FT                   PEDGEEDGEDGLAPGDEEDEPEGHVFPALKILKDSVGRSKMHPIKVIRKEERDSGPWPL
FT                   ITEHMDGEPRWVHPGVTASRVPHIRANGKRVRRDQLDVPESFGEGVLCLIDRNGSFPSA
FT                   CSAVPLAPNKLLHTGPLDEYDKAGAGIYLIDIPEWARTDMPHPLGRIIDRPDENGHVWV
FT                   TTPHIKQLMKLVRDNHLAAMPAIHDSWTGKANESLFKPFYEATRKARTELVQAGGDPYK
FT                   AYKTRLSIALRLLWPKRPAQRSPFWRPDWRMSMVAEASVRHWTVAFKAVQEGHTLVALR
FT                   NVDQAIFWTPPGTPPSTYRIGTGFGEVKRKFVQAGQTILEGDD"
FT   misc_feature    complement(130728..131279)
FT                   /locus_tag="SCAB_1231"
FT                   /note="HMMPfam hit to PF03796, DnaB-like helicase C
FT                   terminal domain, score 8.1e-10"
FT                   /inference="protein motif:PFAM:PF03796"
FT   CDS_pept        complement(join(132399..132893,132897..133511))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1261"
FT                   /product="conserved hypothetical protein"
FT                   /note="pseudo: amber STOP after codon 205"
FT                   /db_xref="PSEUDO:CBG67351.1"
FT   CDS_pept        complement(133664..133807)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1271"
FT                   /product="conserved hypothetical protein (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1271"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67352"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCW8"
FT                   /protein_id="CBG67352.1"
FT                   /translation="MLAWQLGGPLPIVPLAGVSSVAQLEENLAAVDLELTAEQRHRLDA
FT                   AH"
FT   misc_feature    complement(133703..133732)
FT                   /note="PS00422 Granins signature 1."
FT                   /inference="protein motif:Prosite:PS00422"
FT   CDS_pept        complement(134260..136305)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1281"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1281"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67353"
FT                   /db_xref="InterPro:IPR011518"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCW9"
FT                   /protein_id="CBG67353.1"
FT                   /translation="MRFEVLLPHLDERQRRLLLATEARLLGHGGVRAVARAAGVSETTV
FT                   RRGVFELEAGETTASAGRTRRPGGGRKRAEQVDPALLPALLALVEPDERGDPMSPLRWT
FT                   TKSLRILADELTGQGHPVSAMTVGRLLKDNGFSLQAQAKTLEGEQHPNRDAQFRYINEQ
FT                   VKRHRADDEPVISVDTKKKEMLGQLPNPGRQWRPKGDPVRVDDHSFFSGPTGEAAIPYG
FT                   IYDPSADTGWVNVGVDHDTSVFAVASIRRWWQARGRHDYPQASQLLITADAGGSNGYRY
FT                   RLWKAELAEFAAETGLAVTVCHFPPGTSKWNKIEHRLFSHITMNWRGRPLTSHEVVVNA
FT                   IAATKTRSGLRVEAELDTGRYPLGIEVSKAQLKSLPIEYHDTHGTWNYTVRPDGPCDGE
FT                   PTPLTDRDAARRRVLDLLAEPALTGMSREDLTALAGKLTPELGPLREERLHRKRGGPRR
FT                   HGAGDNKRPVLAPADRILLSVIYLRHVCSQNLLAEMLGLCQRTLGPSIKEIRRLLQEHS
FT                   ISITPTTLCFSSSQELEDFVRSGTPVTARLQRTHHLADPALTGMDRTELALLIDQLSLQ
FT                   QAALIERRRHQHRGGPRRPGTRGGVFRQKITDAERLLAAVLYERKLGTRQVLADAFGVS
FT                   LGTLNNALKDAQPVLREAGITLPPAPTRFATGAELLASIDSNTPTG"
FT   misc_feature    complement(135127..136062)
FT                   /locus_tag="SCAB_1281"
FT                   /note="HMMPfam hit to PF07592, Rhodopirellula transposase,
FT                   score 1.7e-157"
FT                   /inference="protein motif:PFAM:PF07592"
FT   CDS_pept        136765..137697
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1291"
FT                   /product="conserved hypothetical protein"
FT                   /note="contains PF01839 FG-GAP repeats see also SCAB3201,
FT                   SCAB58141"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1291"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67354"
FT                   /db_xref="GOA:C9ZCX0"
FT                   /db_xref="InterPro:IPR000413"
FT                   /db_xref="InterPro:IPR013517"
FT                   /db_xref="InterPro:IPR013519"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCX0"
FT                   /protein_id="CBG67354.1"
FT                   /translation="MWKGPVTRAGQPTAILPLLDRADWWGDDAGDASCATNGGCQEDGD
FT                   SISGPIRSTRAGDVNGDGDGKDDIVAWKYAGDGQWGNRLFLGGGSTGFTRGWVPADGTA
FT                   TGTGTGIGDVNNDGFDDVVVGNYGNGGWSGDKVRIAFGAASGLSEERVQTFDQDLPGFP
FT                   GAEEEGDGIGSTVSVADVNGDGFGDIALGIPGEDIGDLTDAGSVALVPGSASGVTGAGT
FT                   QIFHQDTAGVAGAAESDDQFGASSALLDVDGDGHADLAAGSEAENGWNGAVWVLRGTAT
FT                   GLTATSSLAFGAGDLSAPATGARFGALLR"
FT   misc_feature    137278..137394
FT                   /locus_tag="SCAB_1291"
FT                   /note="HMMPfam hit to PF01839, FG-GAP repeat, score
FT                   0.00015"
FT                   /inference="protein motif:PFAM:PF01839"
FT   misc_feature    137488..137592
FT                   /locus_tag="SCAB_1291"
FT                   /note="HMMPfam hit to PF01839, FG-GAP repeat, score
FT                   0.00014"
FT                   /inference="protein motif:PFAM:PF01839"
FT   CDS_pept        complement(138213..139085)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1311"
FT                   /product="putative integrase core domain"
FT                   /note="PMID:12127493"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1311"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67355"
FT                   /db_xref="GOA:C9ZCX1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCX1"
FT                   /protein_id="CBG67355.1"
FT                   /translation="MTVHPFIEAEKRAGHSVKRACELLKVSRTAFYARRTATPGPRAVR
FT                   DAELAAQITDVHTRSRGTYGAPRVHAMLKRAGAGCGRRRVARLMRAAGLQGRHRRRRHL
FT                   TTVPDPKAVLRPDLIARDFRPDPDGLDTRWCGDITYIATDEGWLYLATVIDIASRRVVG
FT                   WATADHLQTDLVADALTAACRQRRPTWPVIFHSDRGCQYTSQQLAALAEQLGVRLSVGR
FT                   TGQCWDNALAESFFATIKRELLDTTAWPSRAAVRTAIFDFIEGWYNLHRLHSSLGYRSP
FT                   AEYETALAA"
FT   misc_feature    complement(138228..138710)
FT                   /locus_tag="SCAB_1311"
FT                   /note="HMMPfam hit to PF00665, Integrase core domain, score
FT                   4.1e-44"
FT                   /inference="protein motif:PFAM:PF00665"
FT   CDS_pept        complement(139082..139399)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1321"
FT                   /product="putative IS3-family transposase"
FT                   /note="PMID:8973350"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1321"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67356"
FT                   /db_xref="GOA:C9ZCX2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCX2"
FT                   /protein_id="CBG67356.1"
FT                   /translation="MSIMESMGKKKPRPRRSFTPEFKAEIVELCRRGDRSVGQIAKDFD
FT                   LTETAVRLWVSQAEVDAGERDGLASSEREELAALRRENRRLREVVEVLKRATAFFAKET
FT                   R"
FT   misc_feature    complement(139121..139357)
FT                   /locus_tag="SCAB_1321"
FT                   /note="HMMPfam hit to PF01527, Transposase, score 1e-18"
FT                   /inference="protein motif:PFAM:PF01527"
FT   CDS_pept        139889..140107
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1331"
FT                   /product="conserved hypothetical protein (fragment)"
FT                   /note="PMID:15328113"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1331"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67357"
FT                   /db_xref="GOA:C9ZCX3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCX3"
FT                   /protein_id="CBG67357.1"
FT                   /translation="MVGGPLSSSEDTLDALFTRAARRRPDAVAIQDARGELSFAKAELR
FT                   ATQLASVLIHAGVQLGDPVIIHCDDHQ"
FT   CDS_pept        140204..140482
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1341"
FT                   /product="putative transposase"
FT                   /note="PMID:8973350"
FT                   /note="see also SCAB0831, SCAB10021, SCAB81311"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1341"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67358"
FT                   /db_xref="GOA:C9Z3C2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C9Z3C2"
FT                   /protein_id="CBG67358.1"
FT                   /translation="MRERAVRMYRTTEPKPQIKKLAVDLGVHPEALRGWIRQAEADAGE
FT                   RDDRLTTDERAELAALRKENAQLKRANDVLRTASAFFAAQLDPTRPR"
FT   misc_feature    140207..140428
FT                   /locus_tag="SCAB_1341"
FT                   /note="HMMPfam hit to PF01527, Transposase, score 9e-14"
FT                   /inference="protein motif:PFAM:PF01527"
FT   CDS_pept        140479..141396
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1351"
FT                   /product="putative integrase component"
FT                   /note="PMID:91141314"
FT                   /note="see also SCAB0841, SCAB10011, SCAB81301, SCAB90851"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1351"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67359"
FT                   /db_xref="GOA:C9Z3C1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C9Z3C1"
FT                   /protein_id="CBG67359.1"
FT                   /translation="MTALVDEHPRLGVECVLRELHIPSSTYYRWRRAEKEPCERRRRDV
FT                   ELAERIKEIHAESGGNYGSPRVHAVLRREGTRVGRKRVERLMREADIAGISPRRKGFTR
FT                   RDPKASLAPDLVNRDFTAPAPNRLWVTDLTMVSTGEGPLWLSAIRDAFSRRVVAWETSA
FT                   RADADLVLTTLEYALASREVEPGKLIHHADHGCQYTSIKLTTRLMRAGVEASMGSVGDS
FT                   YDNALAENLWMLIKTEGLRGRTFTTRAEANLALFEYIDGFYNSRRIQERLGFLSPIEFE
FT                   EKYYAEQATAEPTNLNTRQPLLTS"
FT   misc_feature    140839..141324
FT                   /locus_tag="SCAB_1351"
FT                   /note="HMMPfam hit to PF00665, Integrase core domain, score
FT                   3.2e-30"
FT                   /inference="protein motif:PFAM:PF00665"
FT   CDS_pept        141440..142393
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1361"
FT                   /product="conserved hypothetical protein (fragment)"
FT                   /note="PMID:15328113"
FT                   /note="PMID:16208464"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1361"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67360"
FT                   /db_xref="GOA:C9ZCX6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCX6"
FT                   /protein_id="CBG67360.1"
FT                   /translation="MAQLAVLKAGGVCVPAAHGHNRAQLRAIASISGASTVLCSRSTRG
FT                   AWPRRFAALPLDDQGTTRLAAAHRRESALPLSHPREAAYLMLSGGGPDGPVGYLTDHRA
FT                   WRLATAQRIRAAGPAPHRVFVAGPPADPRAVSAMWWAFACGGSLRALPDTGAPVARDGM
FT                   LCAAVFSPEEYDAVVATLPIRPRLVQLLGGPVPDALVARHFAALPGTRLRADFAPIDGA
FT                   LPWTSREVRPTGDAESPGALGTAVPHVRARVLDRNGRAQEVGHEGELCGAGDALPFDAV
FT                   RRPGIAAPAWEETALLRSRVSVRRSADGGFRLAGPA"
FT   misc_feature    141839..141871
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    141890..141907
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT                   /inference="protein motif:Prosite:PS00343"
FT   misc_feature    142226..142261
FT                   /note="PS00070 Aldehyde dehydrogenases cysteine active
FT                   site."
FT                   /inference="protein motif:Prosite:PS00070"
FT   CDS_pept        complement(142512..144437)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1371"
FT                   /product="putative AfsR-family regulatory protein"
FT                   /note="many more streptomycete homologs"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1371"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67361"
FT                   /db_xref="GOA:C9ZCX7"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCX7"
FT                   /protein_id="CBG67361.1"
FT                   /translation="MRAWRGDTEVVLGPPKQRAVLALLADRAGDVVSIEHIIDAVWGSD
FT                   VPQTAANGVHTYVAGLRRVLDPGRSRRGSSSVLVSAAGGYCLRVSPDVVDLTRFTRCHA
FT                   QARRARAEGDLNGALKLYQECLSLWRGEAYGGIPGPHAAMERTRLQDLRMTVVEEWASD
FT                   MLRAGRQGEVVADLSAAVAEEPLREKLRWLLMLALYRCDRQAHALAVYTETQRLLSREL
FT                   GIEPGAELANLHQDILAGREVAACRDESRAPVAALVGSAPHDRPRPAQLPPVARGFVGR
FT                   GTELSDLEELLSEDVSRSGAAMTVAVVDGLAGVGKTEFALQLAHRLTDRFPDGQLFVDL
FT                   GSTGLRGKRLTASEALGQLLSSLGVDDDRMPGDPAGRISLYRSLLHGRRMLVVLDDALS
FT                   AEQARSLIPGGPSIVLVTSRHRLTGLVIRDGAHPITLGPLSERESTELLTYLGGDRLRH
FT                   ERAATTRMARICEGLPLALRSVVEALIAAHDVPTTTAVSRYADRRRLLDHLTVEGDAAA
FT                   NVRTVFEASYRALPEEAARMFRYLGLSSVGPITLQQAALLADTSLTTTRRLLDVLADRH
FT                   LLERTSQGCYRFHGLIGIYAAECAEYEPKSHRDLALIRLREWEDDFVSRRVAALEQNKT
FT                   PQVTMV"
FT   misc_feature    complement(142734..143660)
FT                   /locus_tag="SCAB_1371"
FT                   /note="HMMPfam hit to PF00931, NB-ARC domain, score
FT                   1.2e-06"
FT                   /inference="protein motif:PFAM:PF00931"
FT   misc_feature    complement(143487..143510)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(143724..144158)
FT                   /locus_tag="SCAB_1371"
FT                   /note="HMMPfam hit to PF03704, Bacterial transcriptional
FT                   activator domai, score 3.9e-39"
FT                   /inference="protein motif:PFAM:PF03704"
FT   misc_feature    complement(144177..144419)
FT                   /locus_tag="SCAB_1371"
FT                   /note="HMMPfam hit to PF00486, Transcriptional regulatory
FT                   protein, C ter, score 3.6e-18"
FT                   /inference="protein motif:PFAM:PF00486"
FT   CDS_pept        complement(144538..145887)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1381"
FT                   /product="putative salicylate synthase"
FT                   /note="TTA-Leu codon(s) 153 may indicate regulation by
FT                   BldA"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1381"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67362"
FT                   /db_xref="GOA:C9ZCX8"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019996"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCX8"
FT                   /protein_id="CBG67362.1"
FT                   /translation="MVHTSREPLDIAVGFAASGLFDTTMVHETAGEWSIAGGVAAEVIV
FT                   DSESIRCTRDGVTRAEPWSGDPLTSVKNFLADLPIHDWTAYGWCAFELSHAIAGMAGEE
FT                   GTLLHLVVPRTELRLADSRVYLRSLDSDALAAAENMVARIAAESTPTELPTVPADLEIG
FT                   ADAYRRSVASLVAEIRAGKLQKAILSREIPVAAQIDFPASYHKGRLENTPARSFLFDMG
FT                   GLRCFGFSPETVVEVSADGRVSSQPLAGTRALTGDPQLDQKLRDDLLADPKELHEHAIS
FT                   VKVAVDELIGPCEPESVVVQEYMSIKERGSVQHLASRVVGQLPQGASCWDAFAAVFPAV
FT                   TASGVPKESAYQAISRYERNRRGPYAGAVLKVGEDGAMDAALVLRSVYAQSSRTWLRAG
FT                   AGIVERSTPDRELEETREKLRCVAASLVGCADRAGTTALRTDAVRSGARG"
FT   misc_feature    complement(144610..145401)
FT                   /locus_tag="SCAB_1381"
FT                   /note="HMMPfam hit to PF00425, chorismate binding enzyme,
FT                   score 7e-51"
FT                   /inference="protein motif:PFAM:PF00425"
FT   regulatory      complement(145429..145431)
FT                   /note="TTA_Leu (rare) indicates regulation by availability
FT                   of BldA"
FT                   /regulatory_class="other"
FT   misc_feature    complement(146184..146319)
FT                   /note="GC trough"
FT   CDS_pept        146641..148344
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1391"
FT                   /product="conserved hypothetical protein"
FT                   /note="cluster 0386 with SCAB77921"
FT                   /note="TTA-Leu codon(s) 222 may indicate regulation by
FT                   BldA"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1391"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67363"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCX9"
FT                   /protein_id="CBG67363.1"
FT                   /translation="MVRMSNSTIPEASRLPRQIADAYVDALVDLDPIMGTYIGVTASSG
FT                   QLPDFSPAGQDAVAGLARATLKQLTEAEATPGADSAVERRCARLLRERLTAELAVHEAG
FT                   EGLRTVSNISSPLHEVRTAFTLNPTDTDEDWAAIARRLRAVPDALRGYRAALDTGRRRG
FT                   LPAGPRQVAAVIGQLTEWIGADRSWFARFTDPGPERLRAELTAAARIATGALVELRTWL
FT                   RDSYAPAVEGTPDIVGPERYGLLARYHNGTDLDLKEAYAYGWAEFHRLLTEMRKEAEKV
FT                   LPGTRDPWRALSWCDRHGEAVEGVEETRQWLQSLMDEAIDALDGTHFELAERIRRVESC
FT                   IAPPGSAAAPYYTEPSLDFSRPGRTWLPTMGETRFPAYDLVTTWYHEGVPGHHLQLAQW
FT                   AHVADSLSRYQTTVGVVSANAEGWALYAERLMDELGFLSSAERRLGYLDAQMHRAIRVV
FT                   IDIGMHLELGIPADSPFHPTERWTPELAEEFLAGHSSRPADYVESEIIRYLGMAGQAIG
FT                   YKLGERVWLQGREAARARHGAAFDLKAWHMAALSQGSLGLDDLLNEISAL"
FT   misc_feature    146731..148341
FT                   /locus_tag="SCAB_1391"
FT                   /note="HMMPfam hit to PF05960, Bacterial protein of unknown
FT                   function (DUF88, score 1.2e-64"
FT                   /inference="protein motif:PFAM:PF05960"
FT   regulatory      147304..147306
FT                   /note="TTA_Leu (rare) indicates regulation by availability
FT                   of BldA"
FT                   /regulatory_class="other"
FT   CDS_pept        148658..149341
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1401"
FT                   /product="putative TetR-family regulator"
FT                   /note="PMID:15271354"
FT                   /note="PMID:9512878"
FT                   /note="PMID:1878971"
FT                   /note="PMID:10767533"
FT                   /note="PMID:11050092"
FT                   /note="cluster 0388 with SCAB1731"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1401"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67364"
FT                   /db_xref="GOA:C9ZCY0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCY0"
FT                   /protein_id="CBG67364.1"
FT                   /translation="MKEEGRMESRTKRVGRTGRPPRLSQEAIIAAAQRLLAEEGADSLS
FT                   MRRLAKELSSTPMAIYHHVHDKDELLLLLLEAHAQNIPHPELPEDPRERMIAAGQLLHD
FT                   VLADCPWIVEVLATDNLMAASALWIVEAIVDAAVDCGLTPEEAVDAYRTVWYYTVGELM
FT                   IRVTRARHQAESARPSYRDQTLATLPAETFPRLASLADRWAELTARDTHHQGLEAVVDG
FT                   LIARA"
FT   misc_feature    148739..148879
FT                   /locus_tag="SCAB_1401"
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 2.3e-12"
FT                   /inference="protein motif:PFAM:PF00440"
FT   misc_feature    148907..149338
FT                   /locus_tag="SCAB_1401"
FT                   /note="HMMPfam hit to PF02909, Tetracyclin repressor,
FT                   C-terminal all-alpha, score 8e-06"
FT                   /inference="protein motif:PFAM:PF02909"
FT   misc_feature    149027..149071
FT                   /note="PS00024 Hemopexin domain signature."
FT                   /inference="protein motif:Prosite:PS00024"
FT   CDS_pept        complement(149399..150997)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1411"
FT                   /product="putative AMP-binding NRPS ligase"
FT                   /note="PMID:11029592"
FT                   /note="PMID:12221282"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1411"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67365"
FT                   /db_xref="GOA:C9ZCY1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCY1"
FT                   /protein_id="CBG67365.1"
FT                   /translation="MRPPAEMIRRYRERGYWTDETLGEWPYRTPDHSARIAVVTPDRSL
FT                   TFGALDLAADRTAAGLRARGLRAGERVVVQLPNSPELVVLSLALFRLGAVPVFALPAHR
FT                   EAEITHLVDTAEATVYVCPSETVDGDYARLAKEVAARCGTLREVLVAGGGGAFTPLDEV
FT                   DAEPVELPAPDPLDVALFLLSGGTTGRPKLIPRTHADYTYQLRESARLCGFGPDSRYLA
FT                   ALPMAHNFALACPGVLGVLRLGGTAVLAPVPTPDVCFPLVEQARATASSLVPPLLRLWL
FT                   EAAEWNDCDLSSLGLLQVGGAKLDPDTARRVPATLGCRLQQVYGMAEGLLNFTRLDDPS
FT                   DVVCNTQGRPMSPADEILVLRRDGRPAAPGEPGELLTRGPYTLRGYYRASDHNRTSFTE
FT                   DGYFRTGDLVTRTTDGNLEVVGRVNDVVNRGGEKVPALELEEHLLADDRIRAAAVIALP
FT                   DELMGESTCACVVPHDPGDPPTLREVQAALRTRGIAAYKLPDRLVVRARLPLTGVGKVD
FT                   KKALRAQVLDEGPVG"
FT   misc_feature    complement(149459..149476)
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT                   /inference="protein motif:Prosite:PS00343"
FT   misc_feature    complement(149636..150862)
FT                   /locus_tag="SCAB_1411"
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
FT                   1.4e-106"
FT                   /inference="protein motif:PFAM:PF00501"
FT   misc_feature    complement(150296..150328)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(150422..150457)
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT                   /inference="protein motif:Prosite:PS00455"
FT   CDS_pept        complement(151099..151827)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1421"
FT                   /product="putative thioesterase"
FT                   /note="PMID:12940979"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1421"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67366"
FT                   /db_xref="GOA:C9ZCY2"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCY2"
FT                   /protein_id="CBG67366.1"
FT                   /translation="MLCFPHAGGAASHYRAWAADAPWDVEFAVIQYPGREDRYDEPAPT
FT                   DMSELVGPITAELLADRHEGAHLRTVLFGHSMGAAVAYEVARGLTAAGRPPAALVVSGR
FT                   PAPPLSRPGTVHLGSDDDLLADLHRLGGTSSRVLDDASLMAAVLPTIRRDYQLIETYGP
FT                   LPGVPLRAPVTVLRGDRDPEVDEREAAAWREATEGPCELHALPGDHFYLEAHRLQILDH
FT                   VVARARGTADVTPQRWPSMP"
FT   misc_feature    complement(151147..151827)
FT                   /locus_tag="SCAB_1421"
FT                   /note="HMMPfam hit to PF00975, Thioesterase domain, score
FT                   1.7e-58"
FT                   /inference="protein motif:PFAM:PF00975"
FT   CDS_pept        complement(151916..153631)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1431"
FT                   /product="putative ABC transporter ATP-binding subunit"
FT                   /note="maybe involved in secondary metabolite NRPS"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1431"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67367"
FT                   /db_xref="GOA:C9ZCY3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCY3"
FT                   /protein_id="CBG67367.1"
FT                   /translation="MISLLLRVLGDEHAGPLRRTLSLMTVAAVAEGLAYALLVPILRAL
FT                   FGSEPQHAWGWLGAFAAAASVCALLRYRADVSGFRAGAALSRGLHHRLGDHLARLPLGW
FT                   FTPRRVGDVTVLASRSVLQVMAVPAHRLQPLISAGVLPLTVVIVMLCYDWRLGVAAVVA
FT                   KPVVAAALIWTGRATAAHDAERARRGDEAAGRVVEYLRAQPVLRVGGRTSERFRLLDDA
FT                   LDGQRRAVRRSALSALPGVLGLSFTVQAVFTALLVLGTWLALGGRIEPAEVLALLVLAA
FT                   RCVDPLLSLSDLSGQMRASRGELERLDTVLREPPLAEPGKPVEPRGSGLVLDSVVLRRG
FT                   GRTVLDGVSLTVPEGKRVAVVGPSGAGKSTLLQLLARFHDVDAGAVRLGGVDVRDIGTE
FT                   DLMSRVSVVFQDVYLFDGTIEENVRLGRPDADEADVLAAAEAARLDEVVARLPDGWATR
FT                   VGEGGAVLSGGERQRVSIARAMLKDAPVVLLDEATSGLDPENEQAVQDGLDRLLAGRTV
FT                   VVVAHRLRTVRETDLIAFLDGGRIVEQGTHEELLRRGGRYAQFWQVSLTPVPSE"
FT   misc_feature    complement(152015..152569)
FT                   /locus_tag="SCAB_1431"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   3.9e-63"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    complement(152192..152236)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(152525..152548)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(join(152861..152929,153107..153166,
FT                   153176..153229,153422..153475,153503..153571))
FT                   /locus_tag="SCAB_1431"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SCAB1431 by TMHMM2.0 at aa 21-43, 53-70, 135-152, 156-175
FT                   and 235-257"
FT   CDS_pept        complement(153628..155421)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1441"
FT                   /product="putative ABC transporter ATP-binding subunit"
FT                   /note="maybe involved in secondary metabolite NRPS"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1441"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67368"
FT                   /db_xref="GOA:C9ZCY4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCY4"
FT                   /protein_id="CBG67368.1"
FT                   /translation="MTTRAESAGRPLTGLLRPHRLGLTAVLLLQIVSALGGLAPLVAVV
FT                   ELGRALLLPGPVDKDHVWTVVTVGAVGLLVRVLFGALSSGIGHLIDGELQLSVRRLLAE
FT                   HLGRVPLGWYARRSSGELGQVVQNDVAALHPLTAHTPGEITSAVVVPLVSLVYLFVVDW
FT                   RLTLIALVPVVLGLVLNLMLMSDSRSRDQLALDAAMGRIAGSAVEFVEGISVVKAFGGA
FT                   GRAHRAFIKAADDFADYFLGWVSGVAALGALASLALSPTFVLVVILTGGTALITADAMP
FT                   PADLLPFLLLGLGLTAPIAALGHGLDDVQAARRAAGRIQELLRVAPQPEPATPVPPRGH
FT                   RVELRDVVFSYEPGREVLRGVDLVLEPGTVTALVGPSGSGKSTLAQLLPRFFDPTRGSV
FT                   SLGGVDLRDIGSRDLYRLVSFVLQDVRLLRTSVAENIALAVPHADRDDIVRAAGLARIH
FT                   DRILELPRGYDSVIGEEVGLSGGEAQRISIARALLSDAPVLVLDEATAFADPSTEYDVR
FT                   CALDTLRENRTQLVIAHRLETVAEADKVLVLQDGIVVEQGTPAELLAQDGKFAAMWEAQ
FT                   RTWPDSAPPAREAAAEGGEYR"
FT   misc_feature    complement(153769..154320)
FT                   /locus_tag="SCAB_1441"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   7.8e-53"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    complement(153946..153990)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(154276..154299)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(join(154504..154572,154615..154683,
FT                   154870..154929,154939..154992,155167..155235,
FT                   155293..155361))
FT                   /locus_tag="SCAB_1441"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SCAB1441 by TMHMM2.0 at aa 21-43, 63-85, 144-161, 165-184,
FT                   247-269 and 284-306"
FT   misc_feature    complement(154525..155355)
FT                   /locus_tag="SCAB_1441"
FT                   /note="HMMPfam hit to PF00664, ABC transporter
FT                   transmembrane region, score 1.4e-12"
FT                   /inference="protein motif:PFAM:PF00664"
FT   CDS_pept        complement(155418..156881)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1451"
FT                   /product="putative transporter component"
FT                   /note="PMID:15271354"
FT                   /note="maybe involved in secondary metabolite NRPS"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1451"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67369"
FT                   /db_xref="GOA:C9ZCY5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCY5"
FT                   /inference="protein motif:GO:0005886"
FT                   /protein_id="CBG67369.1"
FT                   /translation="MKEKGPDRGRVLLAVALAQFTVTMVMSIVNVALPAIRSGLGFAPE
FT                   QLSWVINAYALVFGGLLLLGGRAADVYGQRRLLVLGAVVFAAASLGGALAQNPTQMIVA
FT                   RVGQGLGAAAMAPAALAVLTTTQREGPERTRALGVYAAVSAVGGAVGVLAGGLLTEYGG
FT                   WRWVMFVNVPLALAVAWLARRHVPAGAAAGTRRLDVLGGVLGTGGIGLLVLGVVRTNEY
FT                   AWSSATTLGTLAGAAVLLLAFVLAETRSRVTDPLVRLGLLARRGIGGANLFLLLVCAGQ
FT                   FAGFYFVSLYLQQVLGLKPVTTGAAFLPFCAGMIAGSAVSTRLLGALSAKALLVPGALV
FT                   AAAGFGWFALISPTGSVLADILGPSLVAGFGIGVCFVPPTGAATQGLPPHEAGMASALL
FT                   NSARQIGGALGLAVLVTVQVQHTRGALRSGESPEEAMTSGFGLGLGLAGAILAVAALVA
FT                   AVVLPGRSREGAPAEPSGQAGLPATEVRR"
FT   misc_feature    complement(join(155496..155564,155628..155696,
FT                   155733..155801,155829..155888,155907..155975,
FT                   156018..156086,156147..156215,156228..156287,
FT                   156336..156395,156408..156476,156513..156581,
FT                   156594..156653,156687..156740,156783..156851))
FT                   /locus_tag="SCAB_1451"
FT                   /note="14 probable transmembrane helices predicted for
FT                   SCAB1451 by TMHMM2.0 at aa 11-33, 48-65, 77-96, 101-123,
FT                   136-158, 163-182, 199-218, 223-245, 266-288, 303-325,
FT                   332-351, 361-383, 396-418 and 440-462"
FT   misc_feature    complement(155625..156839)
FT                   /locus_tag="SCAB_1451"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 2.4e-52"
FT                   /inference="protein motif:PFAM:PF07690"
FT   misc_feature    complement(156789..156881)
FT                   /locus_tag="SCAB_1451"
FT                   /note="Signal peptide predicted for SCAB1451 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.898) with cleavage site
FT                   probability 0.514 between residues 31 and 32"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(156952..158016)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1461"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1461"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67370"
FT                   /db_xref="GOA:C9ZCY6"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR010091"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCY6"
FT                   /protein_id="CBG67370.1"
FT                   /translation="MNGAGCGPLRVVVCGTRFGQVYLSALRRCPERYRLVGVVARGGAR
FT                   SVALAEEYGVPLYSSVDQLPGDVDVACVVVSSSVGGGQGAELARQLMERGVHVLQEHPV
FT                   HPAELADCLRTARGTGTQYLLNTFYPHIEPVRRFVAAARRLVELRTPVFVDAMSAVQVS
FT                   FDLLDILGEIFGGVRPWSLGPVCAAGDRPLTSVDATVAGVPLTLRVENRMEPGDDSTSL
FT                   FLHRVTVGTDAGNLTLVNTHGPVVWSPVQRTAPDPVGRFVPGPGASAELLGPDGAPSWK
FT                   AVLEEAWPAGVVHALDELAARIAEGADPLRGTQRHLTVAHAWQELTGALGYPQVAVPRP
FT                   GPAVTAADLLPAVG"
FT   misc_feature    complement(157636..157992)
FT                   /locus_tag="SCAB_1461"
FT                   /note="HMMPfam hit to PF01408, Oxidoreductase family,
FT                   NAD-binding Rossm, score 2.9e-38"
FT                   /inference="protein motif:PFAM:PF01408"
FT   CDS_pept        complement(158013..163541)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1471"
FT                   /product="putative non-ribosomal peptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1471"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67371"
FT                   /db_xref="GOA:C9ZCY7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR041464"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCY7"
FT                   /protein_id="CBG67371.1"
FT                   /translation="MTVGELISEFELAGIQLWREGRQLRFRAPRGAMTDERLAALRGSK
FT                   EQLLSELPDRVPSGAAGGAAPGAPASAWVAEPEARHEPFPLTDIQSAYLLGRDAAFDYG
FT                   GVSCHIYLEFRRPADLDPDRLQQAWDSLVERHDMLRSVIAQDGTQRIAPALADTRIRVT
FT                   DLREASAEAVGEATAAVREELSHRVHPAGERPMYEVRLTRLADHSLLHLSMDFMTLDWI
FT                   SIQLLLTELDRRYERPGCPLPPIDATFRDYVAAERRLRDTERYARDRAYWRGRVDELPA
FT                   GPALPLADGHTPADTPPRFRRLAASLTEDAWKALKARAAAHGITAANAVLAAYAETIGR
FT                   WSAGERFSLGLTVLNRMPLHPHADRLLGDFTSVSLLAVDQSGRAAFADRARGLGERLFE
FT                   DLDHRLCGGVEVLRELARRRGREAALMPVVFTGGIGVVGRALGEGAERLRPVYGISQTP
FT                   QVWIDCQATDQFGGLEVNWDVREGVFPDGLVDEMFAAFAGLLRRLAEQDGPWAAADPLG
FT                   LPAAQRARRAAVNATAAAEPGGLLHEPLVAYARHNPGRTAVIDATGSMTYGEWLGRAAR
FT                   VATELRTAGCHPGDFVAVLMDKGRDQVVGVLGALLAGGVYVPVDVAQPQVRRDRILTGC
FT                   GARYAVVRDPDLARTLPAGCRPVDVSGAAPLPSSETPVEHPVAPGDLAYVIHTSGSTGE
FT                   PKGVMISHRAAANTVHDINQRFAVGDTDRVLGLAALGFDLSVYDLFGPTALGAALVLPD
FT                   PARRGDPSHWADLVERHGVTLWNSVPAQLQMLAHYLDAEPRGLDRLRLALLSGDWIPLA
FT                   LPAHAGRHLPGAELVSLGGATEAAIWSIHHRIRRVEPHWRSIPYGTPLANQGFRVLDGA
FT                   LRDRPDLVAGELYITGVGLAEGYLNDPERTAERFPRHPETGERLYRTGDLGRYLPDGEI
FT                   EFLGRADQQVKIRGHRIELGEIDAVLGEHPAVGSSAVLVEGTEALERSLVAFVEPAVRT
FT                   GGTDSTVARAVAAEAAAVNAGYGQGPAPDPGRIAGYVDRLNHAFVLSMAEALAPSGLFA
FT                   GEEARSEAEMARRLEVDERHHGLLRRWLHALERAGLVRREGTEGTWRGAAAPERAEVER
FT                   AWADLAAHAPAEVCPPPLLAYFRAHSDVLPALLRGEEEAVRLFFPGGSQDIARAWYADN
FT                   LAAGRLLETLAAAVRGVASEVRDRPLRVLEVGGGIGAATGPVLEALGDRPVEYLFTDVS
FT                   EYFLTDARQRFGSRPGTSFGLFDMDRDPREQGLLPNSFDVVLSAGALNNARDTARVIDR
FT                   LRTLLAPRGWLCLLEMTREHPEITATQAFMMEEPEDLRRERGNLFVHEEEWRRLLVEAG
FT                   AEDVLSLPGPDDPFAALGQGVFAASFKQDRAELDAEEVGRWVAERLPVHMVPAHIQVVD
FT                   ALPLTSNGKVDRKRLLGWVPRRGERAAERTAEPPRPGVERRVAELWAELLGGELPDRER
FT                   GFFDAGGDSLLAARLVGRVRACVPEAADVSFDVLLRALLHTPTVAGLAGRLTAPAGSGG
FT                   GTPARSAAGAVRRSALVDLGGGGSGPLRLLVHEGLGTLVPYRPLIKELTADSSLLGLAV
FT                   PDSDGYLELAPHRLVEDLGAAYAREVLAAGHREVEVVGYCSGGLIAAELARALGEGGVV
FT                   VRGLTVVSSYRIPYRLDDELMVDYAFARVMGGDLDALGWPADEGEMGRALAAALARSPK
FT                   ALAPGAFELLDGDEGLDAVAHRFRLLARRSRDERRAELHRALARTEAGLGDVGQVAALH
FT                   RVFSHTVEAVTAYDPLPYAGDITFLRPLAPTHFIPGFQDDMTGFWREMCLGELTVVDVP
FT                   GDHFTCVQPPYVARTAAALTRRTGAGR"
FT   misc_feature    complement(158199..158246)
FT                   /note="PS00225 Crystallins beta and gamma 'Greek key' motif
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00225"
FT   misc_feature    complement(159006..159218)
FT                   /locus_tag="SCAB_1471"
FT                   /note="HMMPfam hit to PF00550, Phosphopantetheine
FT                   attachment site, score 5.3e-07"
FT                   /inference="protein motif:PFAM:PF00550"
FT   misc_feature    complement(159102..159149)
FT                   /note="PS00012 Phosphopantetheine attachment site."
FT                   /inference="protein motif:Prosite:PS00012"
FT   misc_feature    complement(159651..159959)
FT                   /locus_tag="SCAB_1471"
FT                   /note="HMMPfam hit to PF08241, Methyltransferase domain,
FT                   score 3.3e-11"
FT                   /inference="protein motif:PFAM:PF08241"
FT   misc_feature    complement(159657..159959)
FT                   /locus_tag="SCAB_1471"
FT                   /note="HMMPfam hit to PF08242, Methyltransferase domain,
FT                   score 2.3e-20"
FT                   /inference="protein motif:PFAM:PF08242"
FT   misc_feature    complement(160641..161846)
FT                   /locus_tag="SCAB_1471"
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
FT                   3.2e-135"
FT                   /inference="protein motif:PFAM:PF00501"
FT   misc_feature    complement(161454..161489)
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT                   /inference="protein motif:Prosite:PS00455"
FT   misc_feature    complement(162165..162335)
FT                   /locus_tag="SCAB_1471"
FT                   /note="HMMPfam hit to PF08415, Nonribosomal peptide
FT                   synthase, score 1.8e-23"
FT                   /inference="protein motif:PFAM:PF08415"
FT   misc_feature    complement(162399..163304)
FT                   /locus_tag="SCAB_1471"
FT                   /note="HMMPfam hit to PF00668, Condensation domain, score
FT                   1.5e-39"
FT                   /inference="protein motif:PFAM:PF00668"
FT   CDS_pept        complement(163538..168115)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1481"
FT                   /product="putative non-ribosomal peptide synthase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1481"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67372"
FT                   /db_xref="GOA:C9ZCY8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCY8"
FT                   /protein_id="CBG67372.1"
FT                   /translation="MSQEIVPPKAVPVSTAAPVWDPETLRQEVARLLDMDLRPEHDDVN
FT                   LFELGLHSMQLMVLTNKLNRAGARVDFRRLSEEPRLSAWYALLANTAAGAPAPEPADRR
FT                   AARDGVLDTGEAFALTAVQQAYWIGRSDDQALGGVGCHAYLEIDARDVDAGRLERAVRA
FT                   LLDLHPMLRARFEADGTQRVLARSPWPGLTVHDFGGLSAEAAAPALEELRGRLSHRRLD
FT                   VGAGEVLDLQLSRLPGAGHRLHLNVDLLVADVHSIRLLLADLAALYEDPTSVSGPAYTF
FT                   QRYLAERAETRRSERETARAYWQRRLPELPGGPRLPLAVEPAALPVTRFVRRTHELAPG
FT                   EWRALRQRAARAGVTPAVLLATAFSEVLARFSGEDRFLLNLPLFDRDLEAHPQIGRIVA
FT                   DFTSLVLLEVDLIRGDDFAERARAVQRQLHEDVAHAAYTGVDVLRDFVRADGDAPRSAP
FT                   VVFACNLDAPLVPDACAARFGELTWMLSQTPQVWLDHQVYATRDGGLLLAWDTVDDLFP
FT                   AEMPAAMMTAYTTLLRDLAGDGPVEVDLTLPVAQRRRRDEVNSEVREHSGRLLHTAFFE
FT                   RAGQRAAEPALLWQDDGRLTHGELAERALRIAGSLARRGVGPGTSVVVTAPKGPDQIAA
FT                   VLGVLAAGAAYVPVGVDQPAARRTRILELSGARLVLDGTGLPRSPGGAAEVLTLDEALA
FT                   GEPLDAPVPAAPDDTSYVIFTSGSTGTPKGVEVSHRAAVNTVEDIDERFGIGAGDRVLA
FT                   VSALDFDLSVWDIFGLLSEGGALVLVDESDRRDASRWLALCARHGVTVWNSVPALLDMA
FT                   LTAADGNALPASLRLALLSGDWIGLDLPGRLDAATHGRCRLVGLGGATEAAIWSNAYEV
FT                   TEVPAHWVSVPYGKPLRNQRFRVVDGRGRECPDWVPGELWIGGDGVALGYRGDAALTTE
FT                   RFPVVAGERWYRTGDLGRYWPDGNLEFLGRLDHQVKINGFRVELGEIEAALQSHPEVSS
FT                   AVVVTVGDRRRELVAAVVERAPHDAGQDSGAEDAGPSPHADSGPAPEADPLEQGLVEAV
FT                   LAEVIAPLVTPATAPAGTLPVRAEQRPVLDAWLDRLARQEVVRRDGAAVRPGARWAEVR
FT                   APGRFGELRERTAGSHLEPVANALAWAAPMLTAVLTGEAHASVLLDDPVLSPEGLADAM
FT                   PATRDCLAAIAAALRADAADAAQPLTVGEWDAMSGLGAGRLLAALPPGSVDYTLLGSSP
FT                   TLLAAADARLADSGHRVRTVHQGGAALPAAHLHAYDAVVAANVLHRMPSPETAAATMAL
FT                   LLRPGGRLHVLERTHLTPLALLIALPLEAEAGRLRPGGPGGSWLRSGQRWARACVAAGL
FT                   VNARVERAEATGEVLLTAERPRTARGADVEDLRRWLADRVPAHMVPGHFAALPVLPLSA
FT                   NGKVDRRALQSLLAALTDSPRESAEPPRGAMEQTVADLWTKLLPVASVGRDENFFALGG
FT                   DSLLATRLVTEVHRALGVELPMRDVMRAPTVAALGALIEGLLGAAQDREPGDEALAGDF
FT                   EEGVL"
FT   misc_feature    complement(163619..163813)
FT                   /locus_tag="SCAB_1481"
FT                   /note="HMMPfam hit to PF00550, Phosphopantetheine
FT                   attachment site, score 2.2e-20"
FT                   /inference="protein motif:PFAM:PF00550"
FT   misc_feature    complement(163697..163744)
FT                   /note="PS00012 Phosphopantetheine attachment site."
FT                   /inference="protein motif:Prosite:PS00012"
FT   misc_feature    complement(164234..164524)
FT                   /locus_tag="SCAB_1481"
FT                   /note="HMMPfam hit to PF08241, Methyltransferase domain,
FT                   score 0.00027"
FT                   /inference="protein motif:PFAM:PF08241"
FT   misc_feature    complement(164240..164515)
FT                   /locus_tag="SCAB_1481"
FT                   /note="HMMPfam hit to PF08242, Methyltransferase domain,
FT                   score 3.2e-10"
FT                   /inference="protein motif:PFAM:PF08242"
FT   misc_feature    complement(165140..166330)
FT                   /locus_tag="SCAB_1481"
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
FT                   1.1e-138"
FT                   /inference="protein motif:PFAM:PF00501"
FT   misc_feature    complement(165200..165226)
FT                   /note="PS00697 ATP-dependent DNA ligase AMP-binding site."
FT                   /inference="protein motif:Prosite:PS00697"
FT   misc_feature    complement(165947..165982)
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT                   /inference="protein motif:Prosite:PS00455"
FT   misc_feature    complement(166646..166816)
FT                   /locus_tag="SCAB_1481"
FT                   /note="HMMPfam hit to PF08415, Nonribosomal peptide
FT                   synthase, score 1.9e-18"
FT                   /inference="protein motif:PFAM:PF08415"
FT   misc_feature    complement(166880..167779)
FT                   /locus_tag="SCAB_1481"
FT                   /note="HMMPfam hit to PF00668, Condensation domain, score
FT                   3.4e-37"
FT                   /inference="protein motif:PFAM:PF00668"
FT   misc_feature    complement(167852..168049)
FT                   /locus_tag="SCAB_1481"
FT                   /note="HMMPfam hit to PF00550, Phosphopantetheine
FT                   attachment site, score 4.4e-06"
FT                   /inference="protein motif:PFAM:PF00550"
FT   misc_feature    complement(168131..168184)
FT                   /note="query for promoter pattern"
FT   CDS_pept        complement(168334..168876)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1491"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1491"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67373"
FT                   /db_xref="GOA:C9ZCY9"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCY9"
FT                   /protein_id="CBG67373.1"
FT                   /translation="MTGTVTAVSRDSGHAFSKPNRESITLLAGLGVAGDAHAGRTVKHR
FT                   VRVEQDPTRPNLRQVHLMPEEALEEWGAAGFRVVPGALGENITTRGIHLLGLPVGTVLR
FT                   IGHDAVLEVTGLRTPCKQIDDFQDGLLKHVVGRDDAGAVTHKAGIMSVVRAAGVVRAGD
FT                   AIEVELPPEPHLPLGRV"
FT   misc_feature    complement(168376..168741)
FT                   /locus_tag="SCAB_1491"
FT                   /note="HMMPfam hit to PF03473, MOSC domain, score 2.5e-15"
FT                   /inference="protein motif:PFAM:PF03473"
FT   CDS_pept        complement(168873..169148)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1501"
FT                   /product="hypothetical protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1501"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67374"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCZ0"
FT                   /protein_id="CBG67374.1"
FT                   /translation="MDLATVVRDLEQLAAELRAPRLRRIPPEISAACDALSCAAVLLRS
FT                   RQHVPGGDAMRGELLFDAIALARSTVEATKVACRERAGARVRGSGA"
FT   CDS_pept        complement(169244..171043)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1511"
FT                   /product="putative carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1511"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67375"
FT                   /db_xref="GOA:C9ZCZ1"
FT                   /db_xref="InterPro:IPR003696"
FT                   /db_xref="InterPro:IPR031730"
FT                   /db_xref="InterPro:IPR038152"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCZ1"
FT                   /protein_id="CBG67375.1"
FT                   /translation="MIVLGCNGFTRGAELFAEQYGAVGTEKHYVLGHDAGAALLIDGKL
FT                   VAAVEEERLNREKKTSDFPADAVKWCLEKAGIEFSDVDLIAIPWKFSDQVFDAMMAELA
FT                   GAPLKPADKVLRLSHLGALFDGALGPDAILADFAARTGFTPDPDKVVFVQHHLAHAMTG
FT                   YYMAGQKDTAFLISDGRAELFSSLIGEIRDGRIRVFDESTISANDSLGNLFASITRYLG
FT                   FVPNNDEYKVMGLSGFAEPPSPNPFLEHIVQLHEDGRYTLCRPHDPENGRAFDDLFAKY
FT                   FGPYEDTVEYKANLAAAAQEMLTVVTSHQLRALEARTELNHLLFEGGLALNCVNNTKLL
FT                   ESSRFEDMSVSFGASDTGVVIGAAVHAWANHPDTSAEVKFAGSVTPYLGPEYDSDTIEQ
FT                   SLREFTGRVRWTRLAEDEVVDQVAKLLTEKVVIGWFQGRLEHGPRALGHRSILANPKFP
FT                   DIKDVINTRVKHREPFRPFAPIVLESDAPKIFEMGRKKRSPYMTFVFPVRPEYHDIIPG
FT                   ATHVDGTSRVQTLTDEDAPLLTSLLRRFTTLTDVPCLINTSFNVAGEPIVCSPADAVNC
FT                   FLGTEIDYLVLGNYLVTKTDRSA"
FT   misc_feature    complement(169460..170566)
FT                   /locus_tag="SCAB_1511"
FT                   /note="HMMPfam hit to PF02543, Carbamoyltransferase, score
FT                   8.8e-74"
FT                   /inference="protein motif:PFAM:PF02543"
FT   CDS_pept        171305..172276
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1521"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1521"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67376"
FT                   /db_xref="GOA:C9ZCZ2"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCZ2"
FT                   /protein_id="CBG67376.1"
FT                   /translation="MDRILRNLIAWQRADGPPVPVRDLGVAEARERYLANATGQPRRRG
FT                   GPRDAVTAVDRTVDAADGVTFRCRVYTPGTDEGRLVTYLHGGGWALGDIDSHDQVCRIV
FT                   AASLGAVVVSADYRRAPEFPYPTPLLDAVAAARWAGRAFPGREHVLAGDSAGASLAIGV
FT                   ALDARDSGELRFAAQLLLYPPVDPRLLFAAAGEHAEGYLLSVDDMAYHYDLYVPDLERR
FT                   LDPAIDLLSADLRHLPPTVVATAEFDPLHDEGVELADKLAVAGVPVRHVPGPGLVHGYF
FT                   LMQDIVPAAATRSRDVLQELETMLRATRRPAPGWYAEAVGVD"
FT   misc_feature    171545..172150
FT                   /locus_tag="SCAB_1521"
FT                   /note="HMMPfam hit to PF07859, alpha/beta hydrolase fold,
FT                   score 1.4e-67"
FT                   /inference="protein motif:PFAM:PF07859"
FT   CDS_pept        complement(172372..174042)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1531"
FT                   /product="putative adenylation protein"
FT                   /note="PMID:15113000"
FT                   /note="PMID:15870461"
FT                   /note="PMID:16208464"
FT                   /note="may be related to gene cluster SCAB1381-SCAB1481"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1531"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67377"
FT                   /db_xref="GOA:C9ZCZ3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCZ3"
FT                   /protein_id="CBG67377.1"
FT                   /translation="MIFVDDVERPDGATRWSYAALDAEARRIGAWLAARYPVGTRVLLL
FT                   YPTGFDFAAAYAGCLYAGVVAVPAPLPGRYRHEQERVSGIARNAAVSVVLTDGANLPEV
FT                   QVWARTRGLGARVVATDGGALPDPEAWTPREPDRRTVAMLQYTSGTTGEPKGVVLSHGN
FT                   LLHNVDGQRRAFGLTADVRLGGWLPLYHDMGLLGQLLPALLLGATCVLMRPSAFLQRPH
FT                   HWLRLISDYDICSSAAPNFAYELCCARVTEEQMAGLDLSRWRIASNGSERIDIATLDAF
FT                   AKRFAPAGLRDDALCPCYGMAEATVFVSAAARRKAVVTTVDADEVKRHRFVPAEAGVEL
FT                   VSCGTPHDYEVRIVDARTGDEAEPGDIGEIWLRGPSLARQYWNDPAATEHAFLASGFVR
FT                   TGDLGTVLEGELYVAGRLQEVLTVGGRHLHPQDVERELRARYPELASAGAAFTVPTAGL
FT                   VPAQALVVTHEVLGRPAEECLRALADGIRQTVVRKFGVPVSGVCLLRRGGVRRTTSGKI
FT                   QRVVMRRLFLDEELKVLYADHEPGVAEVLRERRRKRAAS"
FT   misc_feature    complement(172696..173994)
FT                   /locus_tag="SCAB_1531"
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
FT                   4.2e-81"
FT                   /inference="protein motif:PFAM:PF00501"
FT   misc_feature    complement(173578..173613)
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT                   /inference="protein motif:Prosite:PS00455"
FT   CDS_pept        complement(174285..176006)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1551"
FT                   /product="putative adenylation protein"
FT                   /note="PMID:16208464"
FT                   /note="PMID:11048953"
FT                   /note="may be related to gene cluster SCAB1381-1481"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1551"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67378"
FT                   /db_xref="GOA:C9ZCZ4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCZ4"
FT                   /protein_id="CBG67378.1"
FT                   /translation="MTVTDPFPSVWHALLAEAERGSDGSALTLIPEPGTEDTLRYDALV
FT                   GNAARCAAALAERGVGHGDRVLLCLPTGVEFLTAFFGTQLLGAVPTAIAVPIRFGGAAG
FT                   FAGQMKELVAYLRPAAVVTTEAVIEALPELAGATLLDGAALYARAIASDAPSHPIRRPD
FT                   LDDTALIQCTSGSTGRPKGVMISHAALAANCRQLTDATGWTRADTTVSWAPLYHDMGLI
FT                   TGVLCPVYVGGGTVLMPPTRFLRAPGEWLRHISTYRGAVAAAPNFAYGYVTSRVRDEEL
FT                   DGVDLSCWRMAFCGAEPVQPATARRFVERFSRWGLPPRAFTPGYGMAEATLVITVKRPD
FT                   APFRYDSIDRETAVTGGRVVDVDPQSPTAVQVVDCGVPVADAEVRVVDDNGDPLGENRI
FT                   GHVQFRSRSRTTGYFDLPEESAAATDATDWWRTGDIGYLRDGSLRITSRAKDLIIMRGA
FT                   NYFPSDFEQAAETVPGVRLGAVIAVGHRPEDADSEELHLIVETELDGAQHEALRQAVRA
FT                   AVSSRTGVTPAAIHLVPKRSIPKTTSGKLQRAKARHLFVEGAPAAPIRGASGAAPR"
FT   misc_feature    complement(174567..175886)
FT                   /locus_tag="SCAB_1551"
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
FT                   2.1e-79"
FT                   /inference="protein motif:PFAM:PF00501"
FT   misc_feature    complement(175464..175499)
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT                   /inference="protein motif:Prosite:PS00455"
FT   CDS_pept        complement(176003..178735)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1561"
FT                   /product="conserved hypothetical protein"
FT                   /note="may have class III aminotransferase activity from
FT                   domain match; similar architecture to Caulobacter Q0M3P5
FT                   (36% aa_id)"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1561"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67379"
FT                   /db_xref="GOA:C9ZCZ5"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCZ5"
FT                   /protein_id="CBG67379.1"
FT                   /translation="MSADSDFARYARPEFARLFRALHLDVTYRAGRGDHLTLERPDGEA
FT                   GSGTGDQVLDLVGGAGSSLFGHNHPALVEVARRCLDEEVPFNAQGSFRPGTAELARLLS
FT                   DTVGATTGARYVVTLGSTGADAVEAAVKHATVERRRRLGALQEEFELILRRVRREGAGH
FT                   VLCASGPAAGLPCEELLTEGLETIAAMRRADPLFVSLKNAFHGKTTGAGTLTHGGNVPA
FT                   DLHVPGPRHRRLHDWTPRAVVTALDAELLPVYPVTIDADGVPHSVVRHLSPLAACFVEP
FT                   VQGESGVHEVPAETLAALRELADRHGAALVFDEIQCGMARTGTFLASASSGVAADYYLF
FT                   SKSLGGGLAKVSALLVTADRYVPEFGRHHTSTFADDDFSSRIAAAAVRLALDWRERIGD
FT                   VGALLRERLDEVAARWPDAVAEVRGRGLLLGVEFRLPRPESGLLREVFDSESLGYLIAG
FT                   RLLHTHRIRVIPTLSAPTTVRVQPSALLQPADVDRVAAAFDDVAGLLSHGDYATLLEHL
FT                   TVPPAGDWQPRQHVPQPRESRLVRRGARRAEVPRVVFLANLDVPGKLGAMAPELAPWSD
FT                   EQCAAALDRIQGELDPFEVVRHRVTSETRGTVEVVMVAVPFTAAQANAALRAGQGPWLR
FT                   RTVLDGVELAVSLGADVIGLGGHTSIVTNAARDVVEDLTRVTSGNSLTAACAYDLLRLT
FT                   LLESGAGERRVGLVGGVGNIGAVMAELVAPHCESLVLVGRPGSARRLATVTDRLTGVTD
FT                   VSVAEDLEALRDCSIVVSATNAADPVILPHHLAGDRKVLVCDLAVPGDVHPAVAGLSNV
FT                   TLVSGGRIQLPGLQTPRFPGITLPPGILYSCLAETILLGFEPTTSSPSYGGLTSAGVLA
FT                   ARDLAGRHGFHPARIVSDDVSVRPWVVDQLSSVIEENIG"
FT   misc_feature    complement(176261..176662)
FT                   /locus_tag="SCAB_1561"
FT                   /note="HMMPfam hit to PF01488, Shikimate / quinate
FT                   5-dehydrogenase, score 3.6e-06"
FT                   /inference="protein motif:PFAM:PF01488"
FT   misc_feature    complement(177431..178612)
FT                   /locus_tag="SCAB_1561"
FT                   /note="HMMPfam hit to PF00202, Aminotransferase class-III,
FT                   score 1.6e-18"
FT                   /inference="protein motif:PFAM:PF00202"
FT   CDS_pept        complement(178732..178992)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1571"
FT                   /product="putative phosphopantetheine-binding carrier
FT                   protein"
FT                   /note="no significant db matches, may be related to gene
FT                   cluster SCAB1381-SCAB1481"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1571"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67380"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCZ6"
FT                   /protein_id="CBG67380.1"
FT                   /translation="MIHDVFEVIEELFRERLRISEINPDVPLVDYGLDSVRSIDLVIEM
FT                   ENTFGIRISDEQAASMLTLRDAVDHVTASLMVRPGQGENAA"
FT   misc_feature    complement(178780..178974)
FT                   /locus_tag="SCAB_1571"
FT                   /note="HMMPfam hit to PF00550, Phosphopantetheine
FT                   attachment site, score 2.7e-11"
FT                   /inference="protein motif:PFAM:PF00550"
FT   misc_feature    complement(178858..178905)
FT                   /note="PS00012 Phosphopantetheine attachment site."
FT                   /inference="protein motif:Prosite:PS00012"
FT   misc_feature    complement(178948..179011)
FT                   /note="GC trough"
FT   CDS_pept        complement(179027..179593)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1581"
FT                   /product="conserved hypothetical protein"
FT                   /note="some similar proteins are annotated as
FT                   phosphopantetheinyl transferases, )BAF92600, EDP57114) but
FT                   no conserved domain found; may be related to gene cluster
FT                   SCAB1381-1481"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1581"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67381"
FT                   /db_xref="GOA:C9ZCZ7"
FT                   /db_xref="InterPro:IPR003542"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="InterPro:IPR041354"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCZ7"
FT                   /protein_id="CBG67381.1"
FT                   /translation="MTVEPELPRGVAAETALSFHPVPWPHGPAEQFAAGRRAAGAALAA
FT                   AGSADRVVPRAPDGRPVFPRGFPGSISHTERLAVAAVVPGAQAVGVDIEDTAVTERMAR
FT                   FVFRRRERQTLLAPAGEYSPGELFVAKEAAFKALNAIAVLGDFVFWQIQLSRSGDVLRA
FT                   SYGGASVPVRVRSQTDLSLAVAIRR"
FT   CDS_pept        complement(179604..179861)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1591"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1591"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67382"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCZ8"
FT                   /protein_id="CBG67382.1"
FT                   /translation="MSDQEAEAARQRIRGLLTDLFGNDRFVSGVPDDMSLREAGVSSTG
FT                   LVGLLVAMEDAFGFEWDDEVHPEVLRSIDSLAGHVVALRG"
FT   misc_feature    complement(179703..179750)
FT                   /note="PS00012 Phosphopantetheine attachment site."
FT                   /inference="protein motif:Prosite:PS00012"
FT   CDS_pept        complement(179854..180717)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1601"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1601"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67383"
FT                   /db_xref="GOA:C9ZCZ9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZCZ9"
FT                   /protein_id="CBG67383.1"
FT                   /translation="MPVDEETQQDLSYHQDAPRARTRDGVELYYESVGEGTAVTFLNNF
FT                   FLTAPFWREYTGELSRRHRVVTYDFCNHGASTRLPQEPTWEEHAADVIGLLDALEIEST
FT                   YLVGTSASTQLARDVALEYPDRVRGLVLAGPVFGLRGMRRHRQLNRAWLLTLKNEGIAA
FT                   LYNHMYPEVIAGEMNEEGGTPGFLGLRESFVAMNTPEELINGLTLAQKGDTSPELLSRV
FT                   VAPTLIVLGDDDILLSPGRGRDLAALFPKGRCEIMSNAGHVPYLDDPETFQTLVLKFVE
FT                   EAEAHV"
FT   misc_feature    complement(179884..180531)
FT                   /locus_tag="SCAB_1601"
FT                   /note="HMMPfam hit to PF00561, alpha/beta hydrolase fold,
FT                   score 2.4e-17"
FT                   /inference="protein motif:PFAM:PF00561"
FT   CDS_pept        complement(180704..181669)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1611"
FT                   /product="putative 2-nitropropane dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1611"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67384"
FT                   /db_xref="GOA:C9ZD00"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZD00"
FT                   /protein_id="CBG67384.1"
FT                   /translation="MSLLQSGMGGVAGTELACAVSDAGAAGCAGGYKLVGDALSAMLTR
FT                   LTEGTGRPVGVNLIPEVVGPRELDRQVAQVLDETPERVHLSFFGMPEDAVFERVAAAGR
FT                   PVVVQIGTVADGVHAAEQGAVVVAQGVEAGGHLLGTARRDELVGALRARMPDTCLVASG
FT                   GIGSPEEAGRAVAAGADGVLLGTAFVVATESRAHPCFKAAVTAAEGSDTVITDVYEIGW
FT                   PGRRHRVLATSATADPGQAKKFIGRTVVEGKPYLVPRFSSAVPTEATTGRIDEMAMYCG
FT                   LSCSAVSHEVPAAAVVAEFARVLPGAGARNQTRVESHASG"
FT   misc_feature    complement(180761..181669)
FT                   /locus_tag="SCAB_1611"
FT                   /note="HMMPfam hit to PF03060, 2-nitropropane dioxygenase,
FT                   score 7.2e-11"
FT                   /inference="protein motif:PFAM:PF03060"
FT   misc_feature    complement(181133..181195)
FT                   /note="PS00912 Dihydroorotate dehydrogenase signature 2."
FT                   /inference="protein motif:Prosite:PS00912"
FT   misc_feature    complement(181595..181669)
FT                   /locus_tag="SCAB_1611"
FT                   /note="Signal peptide predicted for SCAB1611 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.829) with cleavage site
FT                   probability 0.820 between residues 25 and 26"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(181705..182532)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1621"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1621"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67385"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZD01"
FT                   /protein_id="CBG67385.1"
FT                   /translation="MTTVTDNGLSTLDGGQLRLLRAVDSVFRRLADGWDAPEFRYPFLM
FT                   RCQDLDRFDYYDNFPHLGLTATRLDPERVGPLLAESSRPVDRIPTDVMEPSGFALPSAA
FT                   CYAVYVDLAGTAVPAEGTTRTTVGTCFRNENHYDGLQRLLGFSMREIVHVGPEDGAKNH
FT                   LQRAKDAVLVLCAELGLDVRVEVATDPFFDKNSGKAKMQRLFPVKEEFVVEGLAIGSVN
FT                   YHRNFFGERCAIQAGDATAHTSCLAFGLERWVHTLTQRFGGVAAAVSAVEGLG"
FT   misc_feature    complement(182038..182067)
FT                   /note="PS00215 Mitochondrial energy transfer proteins
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00215"
FT   misc_feature    complement(182083..182142)
FT                   /note="PS00179 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00179"
FT   CDS_pept        complement(182529..182774)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1631"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67386"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZD02"
FT                   /protein_id="CBG67386.1"
FT                   /translation="MTSPVQTVREFILGRNPQLGQVPDDLDLIDSRAINSLAFVEFIFL
FT                   LEEITGEAIDPEDVNLDDFRTVKAIEARFFEQKAAR"
FT   CDS_pept        complement(182771..183649)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1641"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1641"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67387"
FT                   /db_xref="GOA:C9ZD03"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR025859"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZD03"
FT                   /protein_id="CBG67387.1"
FT                   /translation="MAVREIEPIVLDLGRLENLAESGYYNPYTMFDWPEAIEPDQPWMS
FT                   ESLTTLAGTPMWDELTREQQIALTRFEAINFFSLNIHGIRELMSEVVMRIHERPYADVS
FT                   EFLHHFIGEENEHMWFFAQFCLRYGGKLYPAQPTLKADSVEHLSTVARELIVFARILIF
FT                   EEIVDYYNAHMATDQSLPPIAREINRVHHQDESRHVAFGRMIFTHLLGQVARRDPDEVP
FT                   LVAEYLENYLQYSIATLYNPAAYRDAGIPDALALRRRALQHPARSKAHDDVLKRTRKFL
FT                   TKSGVGREIIK"
FT   CDS_pept        complement(183690..184634)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1651"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1651"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67388"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZD04"
FT                   /protein_id="CBG67388.1"
FT                   /translation="MSWEKVADSIEFIPDQYSDRTQPESVAREMLGCDAADIDTLVEGG
FT                   LPFEDRAGVRCFDANDLYNLGMYSGRSTTQPELAFRMLFRFAGRPVDDLLRPKSWTFRV
FT                   RMECVDCAGVAPWHLEAPDVQRFGGRVEEVTTPTASAGSAEYTATVTTTGARTPLVSPV
FT                   LRQLVHDYLDASYRWQMIPVPMQADQRLVHSLGATSCIAASLFLAERFRAAGYRAEAKR
FT                   GWFCGVLGGALDLPHACVEVEDEDGALRTVDIAKAQLAARLSADTRAFQELCLGSIYNK
FT                   VIPSTASCNEALGLHACGSQLPIRVRADIRAIR"
FT   CDS_pept        complement(184916..185506)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1661"
FT                   /product="putative luxR family regulator"
FT                   /note="PMID:7868594"
FT                   /note="PMID:10206788"
FT                   /note="TTA-Leu codon(s) 16 may indicate regulation by BldA"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1661"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67389"
FT                   /db_xref="GOA:C9ZD05"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZD05"
FT                   /protein_id="CBG67389.1"
FT                   /translation="MVFDDLHLSRSALTALLEQRAEIKVVGSVDSKLAALEFAELHRPD
FT                   VVVISFDGRDAETIDLAEKIAVLPECRTLLVATVCIRSVVRRAFTGEIDGMVRRSAPPR
FT                   RFFEAVHLVHQGERAFDAELTVAAVAGGDCPLTLRQLSVLEHLDRGDTMEEIADRLCLS
FT                   EGTVRNYISSVVAKMGARNRIDALRIARDLQWI"
FT   misc_feature    complement(184937..185110)
FT                   /locus_tag="SCAB_1661"
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR family, score 1.2e-15"
FT                   /inference="protein motif:PFAM:PF00196"
FT   regulatory      complement(185459..185461)
FT                   /note="TTA_Leu (rare) indicates regulation by availability
FT                   of BldA"
FT                   /regulatory_class="other"
FT   CDS_pept        complement(185627..187210)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1671"
FT                   /product="putative adenylation protein"
FT                   /note="PMID:9006024"
FT                   /note="PMID:15569690"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1671"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67390"
FT                   /db_xref="GOA:C9ZD06"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZD06"
FT                   /protein_id="CBG67390.1"
FT                   /translation="MPWPEPCADDYRARGYWNDEILGSLPMSAPGARDRPAVVTATRTL
FT                   TYGEMDRAADRLAAGLRGLGLGSGDRVVVQLPNDVELLVLCIALFRLGALPVFAYPAHR
FT                   AAEIVHLVNSAEAVMYVCADEALDCDYRIIAKDVLAGAVTLRHVLVAGDPGPFAALAEV
FT                   DGDPVDLPVPDAREVAFFLLSGGTSGPPKLVPRTHADYAYQLRQSSRLCGFRRDTRYLC
FT                   ALPMGHNFALGCPGVLGTLRMGGTVVPAMAPTPELCFPLIESAGVTVTSLSPPLVSLWL
FT                   DAAERTAHHLGSLELLQVGEARLSPGTARRVSGGFGCVLQQVYGMAEGLLNYTRLDDPE
FT                   NVVLHTQGRPLAPADETRVIREDGQEAGPAEEGELLTRGPYTVRGYYRAEESDRAQFTG
FT                   DGFFRTGDVVRRTAAGYFEVVGRTNDVVNRGGEKVPAREVEQYLLGDPRIALAAVIGVP
FT                   HAELGEQTCVCVVPREAEHPPTLSEVRDGLRDRGIAPYKLPDRLVVLDRMPLTAVGKID
FT                   KSALRARLKH"
FT   misc_feature    complement(185849..187075)
FT                   /locus_tag="SCAB_1671"
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
FT                   3.7e-97"
FT                   /inference="protein motif:PFAM:PF00501"
FT   misc_feature    complement(186509..186541)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(186635..186670)
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT                   /inference="protein motif:Prosite:PS00455"
FT   misc_feature    complement(186701..186721)
FT                   /note="PS00387 Inorganic pyrophosphatase signature."
FT                   /inference="protein motif:Prosite:PS00387"
FT   CDS_pept        complement(187542..188024)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1681"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1681"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67391"
FT                   /db_xref="GOA:C9ZD07"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZD07"
FT                   /protein_id="CBG67391.1"
FT                   /translation="MCRPEEFRDVYHRVYREPPYDEDEAAADAFAAQHAEHARLPGFSV
FT                   TTVLDGGALGGFAYGVRREADWWHPRAVAPAPQRLRRPLFYVYELAVVRELRGRGHGRA
FT                   LLEALLTDRTERYAVLAASTRAPAHELYRRWGWTKAGELAGPPHGVELLARPLPLP"
FT   misc_feature    complement(187611..187889)
FT                   /locus_tag="SCAB_1681"
FT                   /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
FT                   family, score 1e-05"
FT                   /inference="protein motif:PFAM:PF00583"
FT   CDS_pept        complement(188038..189294)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1691"
FT                   /product="putative membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1691"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67392"
FT                   /db_xref="GOA:C9ZD08"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZD08"
FT                   /protein_id="CBG67392.1"
FT                   /translation="MAVIDTLGLPNARGRGPLIVAQVVDALGTGLFLPFAVVYFHTDKG
FT                   IALTTVGLMLSAAALLSLPAGPLAGPLIDWIGPRRVVVASNLVRVLTFTGYVFTDAPWQ
FT                   LVALVTVTLWGESQFRPAAASLVAQVADEGQRARWYAMERALRNVGIGTGGLLGGALVG
FT                   WGGTGGYTAVVVLNAVSFLVAAVLVGTWRRSAEPAVGGPTPAAHGPAMPRAGYREVLAD
FT                   RAFLGVLVTVGVFALCDLALTVLLSAYVIDARGLPAWQPGTLFAINTVLVVLAQTLVAR
FT                   AVERRRRPRVLQTAAALWAVSFALFAAVPTGRPVVAFGALVIGMVVFTAAELLQAPTSS
FT                   ALTVAIAAERVRGRYLGLEELMWSLARVLAPTAFTWLLVRGPGLPWLALGLCCLAAVVV
FT                   LARLDRVLPAHAVREPADA"
FT   misc_feature    complement(join(188086..188145,188344..188412,
FT                   188446..188514,188557..188625,188722..188790,
FT                   188803..188862,189175..189243))
FT                   /locus_tag="SCAB_1691"
FT                   /note="7 probable transmembrane helices predicted for
FT                   SCAB1691 by TMHMM2.0 at aa 18-40, 145-164, 169-191,
FT                   224-246, 261-283, 295-317 and 384-403"
FT   misc_feature    complement(188158..189243)
FT                   /locus_tag="SCAB_1691"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 4.1e-33"
FT                   /inference="protein motif:PFAM:PF07690"
FT   CDS_pept        complement(189304..191442)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1701"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1701"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67393"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="InterPro:IPR027624"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZD09"
FT                   /protein_id="CBG67393.1"
FT                   /translation="MDVEIYDIERDLCFLVTVNGGQFYISAPPSEFRSWAARCDGTRTR
FT                   SELLSGMAPEYAEVVDVLLHDGSLRPARATEDADRAAGLARTTVLLTGVPELTAPIAHA
FT                   LEPVGYARVEPAPGDLSGVDTRDTVLVAAFAHPAHKELARLDELCAGLGLRWLPLRRER
FT                   GRALLGPAVTPGLTADFTDVLERRLAAAPDPRVVAAVRDADEPAGGPPSGADARWVAAQ
FT                   LGAYLERWVAEGAGGDEVELDARGFGRIHRTVLPVPTRPRPVTRGDAEADLLVDDQVGV
FT                   VTGVQELAPLPGMPARLRACAVDVADMRRVADWPNDRQAFGTSWSGFDGARRSAVGEAV
FT                   ERYCGSRLPQDRLRVGSYTALRRAGVPALDPRRLHLYSRRQYLSDGFPFVPLTTDSECA
FT                   WVEGRSWTTGEPVWVPAFLVAHGEHDPVAYSDPLVAGVAAGVTQEQAVTSGLEEVIERD
FT                   TTMLWWANTPRLPRLPMPERIHELVHDSLDAYDITLIHLDNEFDVPVLAAAVSDRANRR
FT                   LTIGFAARPDALQAAEKALAEGFTLHHTCHYLDNDKALAEGQEQLPHLGNLKPYRADRR
FT                   YLDSYRADFVDVRDLLCQQQLHLDPRAGERVAPWVRDLPTGSWDGLPALPERSLAAYRE
FT                   RVEARGFEVISVDLTTCDVEAAGFSAAHTIVPGLVSNFPAGMPMWGGGRIADAAVRLGW
FT                   RPEPPAEEELNHFPLPHA"
FT   misc_feature    complement(189430..190548)
FT                   /locus_tag="SCAB_1701"
FT                   /note="HMMPfam hit to PF02624, YcaO-like family, score
FT                   3.1e-19"
FT                   /inference="protein motif:PFAM:PF02624"
FT   CDS_pept        complement(191563..191697)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1711"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1711"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67394"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZD10"
FT                   /protein_id="CBG67394.1"
FT                   /translation="MRGNSMISTVKANVICAVVHNRAVVHNRAVVHNRAVVHNRSVVK"
FT   CDS_pept        complement(191861..193333)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1721"
FT                   /product="putative transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1721"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67395"
FT                   /db_xref="GOA:C9ZD11"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZD11"
FT                   /protein_id="CBG67395.1"
FT                   /translation="MMNGTKENATGSPVARPGLTLAAVAVVQFMVSLDLSVVNVGLPEI
FT                   AAGLGFSAVGLTWVIHAYALTFGGLLLLGGKAADRYGRKRVLLFGLGLFGLASLLGGFA
FT                   QAPGQLVGARAAQGIGAAALAPAALALLTATFPTGKARVKAFGAWSAMNAAGGALGVLA
FT                   GGLLTEYAGWRWVMFVNVPMATVALAMAWRGIVDTRPTGRAGRPDVLGAVLATGGLGLL
FT                   VFGVVRTDQHGWTSTITLSTLAVSVVLLAAFVWVERTTAREPLVRLGLFANRSVAGANS
FT                   YNLLVGAAMASAFYFMSLYLQRVLGKGAAETGLMFLPFALGVVVGSVLAIKLGYKVAPR
FT                   TLMVLGGLLTALGFAWFGLIRPDGGFLTDVLGPSIAASVGFGLCLGPLVSTATVGVAPA
FT                   ETGTASGLLNSSRQIGASLGLAALGTAAEHRSGHSVTPMALNDGYALGLNLSAALLVVG
FT                   VIIALAVLRRPDEPVGGPESVPEPAAPERAAG"
FT   misc_feature    complement(join(191936..192004,192143..192211,
FT                   192254..192310,192329..192397,192440..192508,
FT                   192566..192625,192653..192709,192746..192805,
FT                   192833..192901,192938..193006,193019..193078,
FT                   193115..193183,193241..193300))
FT                   /locus_tag="SCAB_1721"
FT                   /note="13 probable transmembrane helices predicted for
FT                   SCAB1721 by TMHMM2.0 at aa 12-31, 51-73, 86-105, 110-132,
FT                   145-167, 177-196, 209-227, 237-256, 276-298, 313-335,
FT                   342-360, 375-397 and 444-466"
FT   misc_feature    complement(192050..193264)
FT                   /locus_tag="SCAB_1721"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 1.2e-54"
FT                   /inference="protein motif:PFAM:PF07690"
FT   misc_feature    complement(193064..193114)
FT                   /note="PS00216 Sugar transport proteins signature 1."
FT                   /inference="protein motif:Prosite:PS00216"
FT   CDS_pept        193475..194197
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1731"
FT                   /product="putative TetR-family regulator"
FT                   /note="PMID:15271354"
FT                   /note="PMID:11959542"
FT                   /note="cluster 0388 with SCAB1401"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1731"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67396"
FT                   /db_xref="GOA:C9ZD12"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR003012"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZD12"
FT                   /protein_id="CBG67396.1"
FT                   /translation="MPEPSAPLASHGRTGRPPVTSRTQILSAARRLIDRDGWEKLTIRR
FT                   LAAELGIGATTLYHHIQNKEDLLVLLLNHYIDQLERPDLPSDPPERIVTAATAMHDALA
FT                   GWPWAAEILTVDGFVGLLDESALWMVEAILSGAGDRGCSPEQAVEVFRSIWYYTVGEIL
FT                   VRAHSDGRQDGDERTLARQTPFSSLDASQVPCLAAVGGRWAALAARDTYRRGLRAFVDG
FT                   LLAQASVPCPTRRSANPR"
FT   misc_feature    193547..193687
FT                   /locus_tag="SCAB_1731"
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 1.9e-13"
FT                   /inference="protein motif:PFAM:PF00440"
FT   misc_feature    193724..194155
FT                   /locus_tag="SCAB_1731"
FT                   /note="HMMPfam hit to PF02909, Tetracyclin repressor,
FT                   C-terminal all-alpha, score 0.0016"
FT                   /inference="protein motif:PFAM:PF02909"
FT   CDS_pept        complement(194598..195497)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1741"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1741"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67397"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZD13"
FT                   /protein_id="CBG67397.1"
FT                   /translation="MLSRYSGRLLDLALITALAAVGCSSSEEPGREPAGPDVRPLSGAT
FT                   AFSHVDSVRLHDREERAVAACMTARGQAYTVQPAIASARGAETNPYGLLTPQRAAADGY
FT                   GIVGEYLHLRSTPPPTDKPRTKAWQQALTGTAEHRVTLQLPGGTDVEYSTDGCIARANA
FT                   EVYGPKWNTLEPLTMKLASMVLATVEEQPTYRKALRRWSACMTKSGHPAADLQAARAPL
FT                   NARLPAAAEDEEELRALGRDEIEAANADARCQMDTGLAEAVADVQRKVERKLLTAQNRE
FT                   TIARYRQAKERALNDAAE"
FT   misc_feature    complement(195420..195497)
FT                   /locus_tag="SCAB_1741"
FT                   /note="Signal peptide predicted for SCAB1741 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.984) with cleavage site
FT                   probability 0.310 between residues 26 and 27"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    complement(195429..195461)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(195491..195856)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1751"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1751"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67398"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEE0"
FT                   /protein_id="CBG67398.1"
FT                   /translation="MKQILPKAGVVLGAVALAATALVTAGPANAAYSDCPSGALCAYLG
FT                   TGGAGDPGTVYGNNTNLLQYNKFNNAESLYNNGNNCDVRVYSGLNYTGSEALAQRGHAY
FT                   SPLYSPWKDNVASNRWC"
FT   misc_feature    complement(195494..195766)
FT                   /locus_tag="SCAB_1751"
FT                   /note="HMMPfam hit to PF03995, Peptidase inhibitor family
FT                   I36, score 1.9e-19"
FT                   /inference="protein motif:PFAM:PF03995"
FT   misc_feature    complement(195713..195784)
FT                   /note="PS00583 pfkB family of carbohydrate kinases
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00583"
FT   misc_feature    complement(195761..195829)
FT                   /locus_tag="SCAB_1751"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB1751 by TMHMM2.0 at aa 10-32"
FT   misc_feature    complement(195767..195856)
FT                   /locus_tag="SCAB_1751"
FT                   /note="Signal peptide predicted for SCAB1751 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.929 between residues 30 and 31"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(196254..196571)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1761"
FT                   /product="conserved hypothetical protein (fragment)"
FT                   /note="PMID:15123265"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1761"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67399"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEE1"
FT                   /protein_id="CBG67399.1"
FT                   /translation="MLSRRLCLQPREVQEALDHARLQQDDEQWRAKYATRAGIEGIIHQ
FT                   AVAVVGMRRARCFGFQKTHLEHVFSAAALNLIRPDAWWNGHPLDRTRVSHLARLDLSLA
FT                   A"
FT   CDS_pept        196711..196857
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1771"
FT                   /product="putative secreted protein"
FT                   /note="no db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1771"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67400"
FT                   /db_xref="GOA:C9ZEE2"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEE2"
FT                   /protein_id="CBG67400.1"
FT                   /translation="MAVVSDDLDAGAGLLGAYWAAFGIGAVIGALALGAAKRLPLWPAM
FT                   LGI"
FT   misc_feature    196753..196818
FT                   /locus_tag="SCAB_1771"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB1771 by TMHMM2.0 at aa 15-36"
FT   CDS_pept        join(196943..197521,197525..197665)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1781"
FT                   /product="putative transposase"
FT                   /note="PMID:1650732"
FT                   /note="pseudo: inframe opal STOP after codon 193"
FT                   /db_xref="PSEUDO:CBG67401.1"
FT   CDS_pept        complement(197682..198674)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1801"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1801"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67402"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEE4"
FT                   /protein_id="CBG67402.1"
FT                   /translation="MRYGLENIAQWDGRMTRAVGNPHEVARRDELADAGRDGNWQRVLT
FT                   ILSSRDQRSWVNAVRPDGKKRYAPLHQAAWHGAPTGIVQGLLEYGAWRTLRNSAGERPA
FT                   DIAAARGHHHLARILEPEVKHHVPGDVLADLQRNLYALITRYDKTAPYCVRLPQLEVLT
FT                   ELDPPAYWIRTAGGIFIIALRGMELNVEAIGKMDHDSSPVLRITADGVHEPSGEPWTAR
FT                   TPAAVTIADLFDPEPAHWGLRGDPYLWRALRGHLSDADAPTSVDEVVSRLHTAFRELVG
FT                   LDLAEERQSFVYRAQYAHGGTSSGMISLDTWRERLLPLLAERARTLLEA"
FT   CDS_pept        complement(join(199350..199541,199545..200705,
FT                   200749..201171,201171..201311))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1822"
FT                   /product="conserved hypothetical protein"
FT                   /note="PMID:1135118"
FT                   /note="PMID:14769868"
FT                   /note="strong matches to characterised gene S. platensis
FT                   L-glutamate oxidase. Appears pseudo due to two frameshift
FT                   nonsense mutations (after codons 47 and 188), an opal stop
FT                   by codon 575"
FT   CDS_pept        201611..202318
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1851"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1851"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67404"
FT                   /db_xref="GOA:C9ZEE5"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEE5"
FT                   /protein_id="CBG67404.1"
FT                   /translation="MEQRPGTGARARYWFDTSLTRGTSALVGWLVLVCLAVVLPASAAL
FT                   VWTSGHAPATLSGKVAAIWRLTGETMRLGGTTGSPARVALSVLLALVALVYVSTLVGLI
FT                   TTGLTERLIALRRGRSKLLERGHVVVLGWSEQVFTVVSELVAAGANQRRSAVAILADRD
FT                   KTAMEESLQSKVGPTGRTRLICRSGPSADPSVLALTSPATADSVIVLPPTRPWPAGSSA
FT                   RRCLPTATPARSG"
FT   misc_feature    201611..201739
FT                   /locus_tag="SCAB_1851"
FT                   /note="Signal peptide predicted for SCAB1851 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.944) with cleavage site
FT                   probability 0.472 between residues 43 and 44"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    join(201683..201751,201869..201937)
FT                   /locus_tag="SCAB_1851"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SCAB1851 by TMHMM2.0 at aa 25-47 and 87-109"
FT   CDS_pept        202330..203295
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1861"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1861"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67405"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEE6"
FT                   /protein_id="CBG67405.1"
FT                   /translation="MPWLNPPARTVLEPDDQLLVIAADDDTAELADCVPLVDERSVAGP
FT                   RPSDARPERLLVLGWNRRAPLVLREWGRNAPPGSVADVAADEDEAVVRAACDDDSDGEG
FT                   ADWTCVALRDDTTRPDTLAGLNLGSYDSVIVLGQEPRAGVPLDEPDTRTLVTLLVLRHL
FT                   ERRTGRELPVVTELTDDGNRPLAPLGPGADVIISGQLIGLLMAQISQNHHLADVFDELF
FT                   SASGTQIHLRSAADYVVTGHETSFATVVAAARARGECAVGYRSHADARRAPGYGLRLNP
FT                   PKADRRRWFDGDEVVVIAGEGWRGAVRSGGLPLPRRTPRG"
FT   CDS_pept        complement(203249..203434)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1862"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1862"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67406"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEE7"
FT                   /protein_id="CBG67406.1"
FT                   /translation="MLWTITHAPAPGRPLGATALSTSGSHHRLGDTLRATRVFAGAAFD
FT                   VIILGEYGEEAGVRRS"
FT   CDS_pept        204836..205585
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1891"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1891"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67407"
FT                   /db_xref="GOA:C9ZEE8"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEE8"
FT                   /protein_id="CBG67407.1"
FT                   /translation="MIMFEMPVNPFEFSEDALSRISADDSWAPIELEIPKANAKVIRHF
FT                   LTPAEVGTFATELAAQRFAPVGRDGIAANYAEGDPVAHLRATAESTSLAAEFYRRLRTL
FT                   LSLEVGSDDPTDSDGRPWRPAAVNPRMRFITYEHGGFIVPHYDSPYVAPDGKRTLLTMV
FT                   VYLSYEAVGGETRFIADKQNDLPFAQRDFSDWPRLAKPEEVLSAHRPEPGDALLFWHRT
FT                   LHDSAPLLEGTKTILRTDVLYEPVDVP"
FT   CDS_pept        205769..206653
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1901"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1901"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67408"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEE9"
FT                   /protein_id="CBG67408.1"
FT                   /translation="MTNGWINTDWVETVSRDGLHLMLTRLEVRVPTSEGRKFITCGLAR
FT                   KTYVVKDGTACQVSSYALGRDLGSPDNYDFEIVSATGGPPIRRLFNRDGVPAEKLEGAL
FT                   FDAHEGLDDGEYIVRIAAGMTTSWDSGTGQSIELPVPCHELAFVVVGSSPQEVRASTGG
FT                   PWAARPPVEIPVVDWRDQPTAEAAWEAYLNGNGISPDAYGIFSPQHLMRNQRDTALEIL
FT                   RSEGYAIPRTPEPAERPGTWLGHWGGAWMPADVLAALHTVPDDTAQRAWYQGAKKSLDI
FT                   AWDMHLVWTTDVF"
FT   CDS_pept        206922..207140
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1911"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1911"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67409"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEF0"
FT                   /protein_id="CBG67409.1"
FT                   /translation="MRNTPNKITVLHLDDSGTKGTVIAEVSDPRFDTPTTLARHGDRLY
FT                   VTNAHFYSADPANTDYAITAIPDPARR"
FT   CDS_pept        complement(207502..207615)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1921"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1921"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67410"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEF1"
FT                   /protein_id="CBG67410.1"
FT                   /translation="MEKARRAGEQWRGHVTETGDTGDWDEAAVPVGPWGVR"
FT   CDS_pept        208031..209590
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1931"
FT                   /product="putative GntR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1931"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67411"
FT                   /db_xref="GOA:C9ZEF2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEF2"
FT                   /protein_id="CBG67411.1"
FT                   /translation="MPQESTALPLGGFTLDRTLPEPLYQQLYERLKDSICSGQLRPGVR
FT                   LPATRTLAQELRVSRNTVLVAYERLVTERFATGQVGSGTHVAVHHGEGRRSSARTSKVT
FT                   RLPTPPEERGRTSQLSGTAQLMLQATRAFDERQRTSPTAVAQPFVLGVPALDLFPGKQW
FT                   SRVVSRRAARLPNSLLHAQDPVGYWPLRKEVATYLGLARGVSCTAEQVVITNSTRTITH
FT                   LLARVLLEPGDEVMVENPGFPGARTALVAAGVVPCPVDVDHEGLCISSGESRHPSARMA
FT                   LVTPNHQFPTGCLMSEFRRGELLDWAVRSDGWVIEDDYDGEFTSGSPFPPLQHMDTAGR
FT                   VIYLGTLNKALFPALRLAYAVVPPDLVDIVAAAQHSAYGAPPVLEQAAVHDFMAEHHFA
FT                   RHIRRMRQAYRERREGCVRALRDQFGSMVRVMSATTAGTHLVAGFPPGTNERLLSRLSS
FT                   HAGATVYPLSSYYSTGTAPVPALVLGFGATPPEQAVLGVRGIAAAFERSACADGPGHGL
FT                   DG"
FT   misc_feature    208097..208288
FT                   /locus_tag="SCAB_1931"
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR fam, score 5.9e-17"
FT                   /inference="protein motif:PFAM:PF00392"
FT   misc_feature    208166..208240
FT                   /note="PS00043 Bacterial regulatory proteins, gntR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00043"
FT   misc_feature    208463..209398
FT                   /locus_tag="SCAB_1931"
FT                   /note="HMMPfam hit to PF00155, Aminotransferase class I and
FT                   II, score 3.9e-06"
FT                   /inference="protein motif:PFAM:PF00155"
FT   CDS_pept        complement(209707..211230)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1941"
FT                   /product="putative nitrite reductase large subunit NirB"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1941"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67412"
FT                   /db_xref="GOA:C9ZEF3"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEF3"
FT                   /protein_id="CBG67412.1"
FT                   /translation="MSDRLVLVGHGMVGHTLLTALDARGALRDRPVTVVAEEYVPAYDR
FT                   IQLSRYLRETGPADHLFRRTGPAGLLLGGPGPGDGTGIRTRLGDPAVAIDRRRRRVTTA
FT                   AGRVLAYDALILATGARPLVPPVPGSAATGCFTYRTAADVRAIRAHCDTAGAAGSGVVI
FT                   GGGLLGLEAAGALRTLGLTVHVVEFSPWLMPRQLDEYAGWTLRRHIENLGITVHTGTRL
FT                   TAVETDACDRATGVRLQPPDGAPPLGVGADVVVFAAGVRPRDELARSCGLAVGERGGVV
FT                   VDETCRTRDEHIYAVGDCALPHDGHAHGLLAPGNAMAQVVADRLTGGTRTYTGWDAATR
FT                   LKLLGVEVASLGDRPEEAAPGAYEATHLDTRAGVYRSLRVSGEGRLLGGTFVGDTSGYT
FT                   TLRPLVAGGLPLPAPVEELVVPGVPPDRPSAVGPLPDETVICHCHDVPACTVRSAVRDG
FT                   CATLAAVRHRTRAGSGCGSCADTVAALLGEGLPALGPAATTPTPTGSPV"
FT   misc_feature    complement(209761..209919)
FT                   /locus_tag="SCAB_1941"
FT                   /note="HMMPfam hit to PF04324, BFD-like [2Fe-2S] binding
FT                   domain, score 3.5e-16"
FT                   /inference="protein motif:PFAM:PF04324"
FT   misc_feature    complement(210319..211221)
FT                   /locus_tag="SCAB_1941"
FT                   /note="HMMPfam hit to PF07992, Pyridine
FT                   nucleotide-disulphide oxidoreduc, score 4.3e-34"
FT                   /inference="protein motif:PFAM:PF07992"
FT   misc_feature    complement(210454..210756)
FT                   /locus_tag="SCAB_1941"
FT                   /note="HMMPfam hit to PF00070, Pyridine
FT                   nucleotide-disulphide oxidoreduc, score 2.1e-22"
FT                   /inference="protein motif:PFAM:PF00070"
FT   misc_feature    complement(210826..210858)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(211227..212516)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1951"
FT                   /product="putative nitrite reductase NirB"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1951"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67413"
FT                   /db_xref="GOA:C9ZEF4"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEF4"
FT                   /protein_id="CBG67413.1"
FT                   /translation="MRRPPYKPCDHRFLEVRMGREDGTAHRVLVVGCGMAGARFVGRLA
FT                   ALNPDVRITVLDGEHHPAHNRTLLTGVLAGHHRPEDTALPLPPGIDLRTGVRVVAVRRA
FT                   TRTVVDSTGTEHPYDALVLATGSRPRDPWPRFRRASGEHRLHTLDDCRRLIADHVGTRT
FT                   RAVVVGGGLLGVEAALGLAARAHPVTLVHRGPHLLHRRLDGRAGALVRALLEDAGVTVR
FT                   TGTPATGSVRGPGNPGILLGDGDTVGADFVVAASGTRPCVGLARAAGLPVGAGVRVDDT
FT                   LASVADPRVYAIGDCAEHRGVVHDTAVPAWRQAEVLAARLSGHDRHARFTGSRALTRLI
FT                   AGDVDLAVFGEATTGTGAVLPGGAGTDVLSISDDRRHVYKKIVIRDDRVVGGILLGDLA
FT                   TVDTVRRAYEATRPLPPDRLHLVSALGGDG"
FT   misc_feature    complement(211614..212438)
FT                   /locus_tag="SCAB_1951"
FT                   /note="HMMPfam hit to PF07992, Pyridine
FT                   nucleotide-disulphide oxidoreduc, score 3.8e-26"
FT                   /inference="protein motif:PFAM:PF07992"
FT   misc_feature    complement(211746..212027)
FT                   /locus_tag="SCAB_1951"
FT                   /note="HMMPfam hit to PF00070, Pyridine
FT                   nucleotide-disulphide oxidoreduc, score 4.4e-22"
FT                   /inference="protein motif:PFAM:PF00070"
FT   CDS_pept        complement(212488..214638)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1961"
FT                   /product="putative molybdopterin-binding oxidoreductase"
FT                   /note="PMID: 2941757"
FT                   /note="TTA-Leu codon(s) 23, 354 may indicate regulation by
FT                   BldA"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1961"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67414"
FT                   /db_xref="GOA:C9ZEF5"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEF5"
FT                   /protein_id="CBG67414.1"
FT                   /translation="MTGRAGAVRTHCPYCALQCGTELRPDLDGPAPLAVSGWPEFPVNQ
FT                   GALCGKGQHAVDLLDPAGRLGTPLVRDGRGTPLRPATWDEALRRVVTGIRSTQTAHGSD
FT                   AVGVFGGGGLTNEKAYLLGKFARVALRTSAIDYNGRFCMSSAAAAVNRAFGLDRGLPFP
FT                   LADIAGTDCVLLVGANPADTMPPALRHFTRLADRGGRLVVVDPRRTRTAARADLHLRPL
FT                   PGTDLALALGMLHIALAEGHVDEDFVASRTTGFEAVRTTAMEYWPARAEGLTGVPAHQI
FT                   RAAVRMFAQAPTGMVLTARGTEQHSKGTDTVHGWINLCLALGKAGRPYSGYGCLTGQGN
FT                   GQGGREHGQKADQLPGYRSLTDPAALAHVARVWGVAPEELPGPGTSAYEMLDTAGTPDG
FT                   VRALLVMGSNPVVSAPNAGHVERRLRALDLLVVADVVRSETAELADVVLPSAQWAEETG
FT                   TLTNLEGRVILRRKAVEPPARVRTDLQILSALAARLGRTEGFPADPRLVFDELRAASAG
FT                   GRADYAGISYERISAENGVFWPCPAPGHRGTPRLFLDSFATPDGRARMVPVHHRPTAET
FT                   TDERYPLHLVTGRVLAHYQSGAQTRRVAASRAAAPEPYVEIHPTTAGRLGVTDGEPVTV
FT                   TSRRGRAVAPARLSTDIRPDVVFMPFHWSGPGRANTVTNPALDPVSRMPEFKVCAVHVA
FT                   PVAPPRTHPPGRPGAATAVQAL"
FT   misc_feature    complement(212569..212892)
FT                   /locus_tag="SCAB_1961"
FT                   /note="HMMPfam hit to PF01568, Molydopterin dinucleotide
FT                   binding dom, score 4.5e-45"
FT                   /inference="protein motif:PFAM:PF01568"
FT   misc_feature    complement(213160..214449)
FT                   /locus_tag="SCAB_1961"
FT                   /note="HMMPfam hit to PF00384, Molybdopterin
FT                   oxidoreductase, score 6.5e-107"
FT                   /inference="protein motif:PFAM:PF00384"
FT   misc_feature    complement(214456..214620)
FT                   /locus_tag="SCAB_1961"
FT                   /note="HMMPfam hit to PF04879, Molybdopterin oxidoreductase
FT                   Fe4S4 do, score 4.9e-12"
FT                   /inference="protein motif:PFAM:PF04879"
FT   CDS_pept        complement(214635..216818)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1971"
FT                   /product="putative aminodeoxychorismate synthase"
FT                   /note="PMID:9044253"
FT                   /note="PMID:14700630"
FT                   /note="PMID:14652074"
FT                   /note="PMID:11782498"
FT                   /note="PMID:8472954"
FT                   /note="PMID:15184904"
FT                   /note="PMID:8704974"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1971"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67415"
FT                   /db_xref="GOA:C9ZEF6"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEF6"
FT                   /protein_id="CBG67415.1"
FT                   /translation="MRTLLVDNYDSYTYNLFQLIAQVNGAEPVVVHNDSPDCATLDLND
FT                   FDNVVISPGPGDPTRPKDFGACAPIIESARLPLLGVCLGHQGIAAGSGARIERAPAARH
FT                   GHLTAVRHDGRELFHGLPQDFTAVRYHSLCVREPLPPELEPTAWAEDGVLMGLRHRTRP
FT                   LWGVQFHPESVATEFGYELLGNFRDLTERFHHERGRARRRTPARSASHLVPVKTGTRPT
FT                   PRNVEPRPYRLHTRIMESAVDTEAAFTRLFADSSHAFWLDSSLIDPRLSRFSFLGDASG
FT                   PLSEIVRYRVGDGAVEVTAAGGQPQRVEGTVFDYLQTALRARRVENPALPVDFSCGYVG
FT                   YFGYELKADCGATTTHTSPTPDAFWIFSDRLIAVDHQQGATYLLALSDGSPRSDRDATV
FT                   WMERTAAGLAALPRPRPTPVPDQQAVDNALLEPSLVRDRAQYLADIATCKQELLAGESY
FT                   EICLTNAVQAPRPADGLRFYRNLRRSNPAPYAAYLRLDGMEIACSSPERFLRITRDGMV
FT                   ETKPIKGTARRGADEAEDARLRRELTTSPKVRAENLMIVDLLRNDLGRVCEVGSVTVPR
FT                   LMRTETYATVHQLVSTIRGRLRADADALDCVRACFPGGSMTGAPKLRTLDIIDSLETRA
FT                   RGVYSGAIGFLSCNGTADLNIVIRTAVLTKEGLHAGAGGAIVLDSDLVEEYEEMLLKAA
FT                   TSLRVLLAGTSGQDSAPTTDGPAPAHAAEGGLR"
FT   misc_feature    complement(214719..215510)
FT                   /locus_tag="SCAB_1971"
FT                   /note="HMMPfam hit to PF00425, chorismate binding enzyme,
FT                   score 1.9e-114"
FT                   /inference="protein motif:PFAM:PF00425"
FT   misc_feature    complement(214875..214907)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(215670..216113)
FT                   /locus_tag="SCAB_1971"
FT                   /note="HMMPfam hit to PF04715, Anthranilate synthase
FT                   component I, N, score 2.7e-23"
FT                   /inference="protein motif:PFAM:PF04715"
FT   misc_feature    complement(216252..216809)
FT                   /locus_tag="SCAB_1971"
FT                   /note="HMMPfam hit to PF00117, Glutamine amidotransferase
FT                   class-I, score 4.7e-66"
FT                   /inference="protein motif:PFAM:PF00117"
FT   misc_feature    complement(216555..216590)
FT                   /note="PS00442 Glutamine amidotransferases class-I active
FT                   site."
FT                   /inference="protein motif:Prosite:PS00442"
FT   CDS_pept        complement(216890..218344)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_1981"
FT                   /product="putative aldolase"
FT                   /note="PMID:8760910"
FT                   /note="cluster 0167 with SCAB12021 and SCAB67661"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1981"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67416"
FT                   /db_xref="GOA:C9ZEF7"
FT                   /db_xref="InterPro:IPR002480"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEF7"
FT                   /protein_id="CBG67416.1"
FT                   /translation="MPFSIRNRSTRMPVPPLLEPVGPADHVPDTQEGEESATGPSAPSW
FT                   HPPAWRGLPIRQQPQWPDPDEVAAVTDRLALLPALTTPSDVRSVLAALARVQNREAFVL
FT                   QGGDCAEPLGPAAVTGARDKHRVLGAVAERVSGCLDLPVVTVGRLAGQFAKPRSAAVEE
FT                   VDGRPLPVFRGLTVNGPEPHEDARTPDPYRMLSGYYTARNVLRELGALAHGTASSFAPR
FT                   AWDPAAAREVPWNRREEGTPDGSLRSLVHGYGQTRWTEDRGWLHTGLWTSHEALLLDYE
FT                   SPLTRQDPVTGEWFLLSTHLPWIGDRTRHVGDAHVEFLAGIANPVAVKIGPGAEPAEIV
FT                   RLCERLDPYRRPGRLTLICRLGARGLRGRLPSLVTAVRAAGHPVVWMSDPMHGNTTATG
FT                   TGVKTRHLKDMLDEVTDFFDVLRGLGEWPGGVHLEAAAAEVTECVGGTRVTCEAELDAA
FT                   YESLCDPRLNNEQLLAMADMVVKLAV"
FT   misc_feature    complement(216905..218215)
FT                   /locus_tag="SCAB_1981"
FT                   /note="HMMPfam hit to PF01474, Class-II DAHP synthetase
FT                   family, score 1.6e-161"
FT                   /inference="protein motif:PFAM:PF01474"
FT   CDS_pept        complement(218389..219039)
FT                   /transl_table=11
FT                   /gene="acpD"
FT                   /locus_tag="SCAB_1991"
FT                   /product="putative acyl carrier protein phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_1991"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67417"
FT                   /db_xref="GOA:C9ZEF8"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEF8"
FT                   /inference="protein motif:GO:0042967"
FT                   /protein_id="CBG67417.1"
FT                   /translation="MNADTPPAPSRLLHIAASPMGERSQSRAVAETLVTAYRRTRPHAT
FT                   TDVLDLWRERLPEFGAAAVGAKRTEAAGGRADGEGAVAWKEVRRVFEHFDSYDRYVFSV
FT                   PMWNFGIPYVLKHFIDVVSQAHMLFSFDRESGYRGLLRGKKAAVVYTSSVYGPGMPTEF
FT                   GDDHQTPAFDGWLRWAGITDISTIQLRAQQIADDADVLRRDAHARAQEIGRRF"
FT   misc_feature    complement(218398..219012)
FT                   /gene="acpD"
FT                   /locus_tag="SCAB_1991"
FT                   /note="HMMPfam hit to PF02525, Flavodoxin-like fold, score
FT                   5.8e-10"
FT                   /inference="protein motif:PFAM:PF02525"
FT   CDS_pept        complement(219036..220499)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2001"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2001"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67418"
FT                   /db_xref="GOA:C9ZEF9"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEF9"
FT                   /protein_id="CBG67418.1"
FT                   /translation="MSAPTGTATRAPADAAPGRPIQLDALGPRGAFRARNRLTVADVTG
FT                   RPVAELSQVPSLFVQRGLSALRAARPAGPGELAEVIARAGHTFAHGTVGGLSAPEHQRL
FT                   VSRVAGVPVAVVRAAAARIERAAAEVERTVRGARPTATAGHWRDPRTRGGGAVWARRGD
FT                   VFAVHAAGNHPGVHSLWLEALMLGYRVAVRPSGREPFTPHRLVTALREAGIGDDRLLLL
FT                   PTDHHEADGIVRGADLSLVYGGDAVVEKYRTHPNVLTQGPGRSKILLADPGVGAVTGAG
FT                   GAAGRSSALDTVVSSIRDEGGVACVNATAVLVAGDPGPVAEAIAERLAQLPSLPPDDDK
FT                   AVLPVRPTAEARGLEKYLLTQAAGARPHLGAEGIADELGDGSAALRPAVIQLDRPDAPQ
FT                   LGIELPFPCVWVAPWSPEDGIGPLRNTLVLTVIGRDGRLVEELVDELVDEPTIGNVHVG
FT                   DRPTHWMAPGVPHDGHLAEFLMRSKAVVR"
FT   CDS_pept        complement(220499..221593)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2011"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67419"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEG0"
FT                   /protein_id="CBG67419.1"
FT                   /translation="MAVASDPVLTFPPDQVPDPQEFIQAAMRWHFSPETGSPYWLRRAR
FT                   TLDFDPRRDVRTFDDLRLFPNTVNELRDVPARDLVPQGYGPAAEVVGIYESGGTTGAPK
FT                   RVAYLADWMDRYVTWSTRRMDQRGHPHGAHWLAMIPSGPHLWGEVVARQARRRGGFTST
FT                   IDLDPRWVKKCLAEGRADEAGRYVEHLLEQGRFLLETQDIGVLVITPPLLERLAQHEHL
FT                   VKLVNEKVRVIIWSGAHMDADSRYLFRTEVFPDVQLFGNYGSTMILCGAVERADGDEEC
FT                   VFDPFSPHVTFSVVDPGTGEPVPYGARGQVVMNHISRGALFPNNLERDVATRIRPEAGQ
FT                   LGDSVADVSPVKTFDDEVVIEGVY"
FT   misc_feature    complement(221282..221317)
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT                   /inference="protein motif:Prosite:PS00455"
FT   CDS_pept        complement(221652..223076)
FT                   /transl_table=11
FT                   /gene="narK"
FT                   /locus_tag="SCAB_2021"
FT                   /product="putative nitrite extrusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2021"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67420"
FT                   /db_xref="GOA:C9ZEG1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEG1"
FT                   /protein_id="CBG67420.1"
FT                   /translation="MPRPGSDVSVCFGRLSMSAEVKRGSPAIRYWDPEDDAFWRRTGRR
FT                   VAMRNLAFSILAEHVGFSVWSLWSVLVLFLGPEYGLSPADKFLLVSVPTLTGAVLRIPY
FT                   ALAVGRFGGRTWTVLSAVVLLAPTVLAAVYLRPGTSLGTLLMVSAVAGLGGGNFASSMA
FT                   NINAFFPERHKGWALGLNAGGGNLGVAVTQLAALAVLGTFGASEPRLLLGVFVPAIVVA
FT                   AVCAALFMDDLPGNRNDTDALRDVLRDAHCWVMSLLYLGTFGSFIGYCFAFGLVLQTQF
FT                   DRTPLQAASLTFLGPLLGSLTRPAGGWLADRIGGARVTFGVFVALMLGTGGAVVASRTD
FT                   SLGLFVADFIVLLALAGAGNGSTYKMIPAIFRAKALRDGAADEGDDGTGARLARARRLS
FT                   GALIGITGALGALGGVLINLAFRASFAGWGSGVPAFTGFLVFYAACATVTWAVYLRRRP
FT                   RPRTAHDSRPDAVLSV"
FT   misc_feature    complement(join(221715..221783,221826..221885,
FT                   221985..222044,222072..222140,222246..222314,
FT                   222387..222446,222465..222533,222663..222731,
FT                   222750..222818,222861..222929))
FT                   /gene="narK"
FT                   /locus_tag="SCAB_2021"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SCAB2021 by TMHMM2.0 at aa 50-72, 87-109, 116-138, 182-204,
FT                   211-230, 255-277, 313-335, 345-364, 398-417 and 432-454"
FT   misc_feature    complement(221799..222926)
FT                   /gene="narK"
FT                   /locus_tag="SCAB_2021"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 7.3e-13"
FT                   /inference="protein motif:PFAM:PF07690"
FT   misc_feature    complement(222870..222890)
FT                   /note="PS00340 Growth factor and cytokines receptors family
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00340"
FT   CDS_pept        complement(223188..223874)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2031"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67421"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEG2"
FT                   /protein_id="CBG67421.1"
FT                   /translation="MISVLPGTVAVYADLACPWAHVAVERLWRIRAESDLAGTVRFDHR
FT                   AVLLEVVNRGTLPKPVIDAEIPVAAEMEPDAGWRPWTEPDWRWPVSRLLAAEAVQAAKE
FT                   QGAAASEALDRALRRAFFADSACITMRHVVLDVAGSVPEVDAAALGEALDTGRARAATL
FT                   AQVADFAPGGAVTSPHLFTADGGSWPNPGVDYRWAGEPGDSAVVLKSDDPSVYHRILAA
FT                   AANSAR"
FT   CDS_pept        complement(223984..225783)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2041"
FT                   /product="putative fatty acid-coA ligase"
FT                   /note="nearby genes for phenol catabolism SCAB2071,
FT                   SCAB2091, SCAB2101"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2041"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67422"
FT                   /db_xref="GOA:C9ZEG3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEG3"
FT                   /protein_id="CBG67422.1"
FT                   /translation="MKIRSLQRHLASVRRMKLGPSHRGLRARLELVSERSLGVGTFLWH
FT                   TLDRAADLDAPLLHHLPRGGGEKDIRTYSLADLRDATERYARWFHAAGVARGDRVGVYS
FT                   GDGIANFVHFMALNSIGAIPAPVNPNMAPQTAARYLKRLEPRGVVADADRLETLLAATD
FT                   SPEGLGFTVSQEEVDSAGRVGPLPVGYPYMHGDHDPVLIAHSSGTTGMPKAPILGHRQF
FT                   FAGKRPRILTMPSGVDDKNLLVFPPSHGSGLSYMMMATLTGVPTLVMEEQRGPAVAEVM
FT                   RWWKPTVVIAFPITFGELAALGVEPSAASRVTTWLSTADASHEAHVRELVRLGRHRVGG
FT                   KWRQGSRYIDGLASTEVGMAVFQNIHGPDTDAYKRCVGHPEPIVEEATVYDEHGKRLGP
FT                   NEIGFIAVKTPTETLGYWNDPDLTHRSKHDGFWLTGDIGYYDEQGRFYQYDRATDVIHT
FT                   ARGPVYSLPTEEIVLKACRQAVDCVVAAAISPADEELSEPVAVVRLADRCDLTSRELLA
FT                   RLNGALRKSGAHELSAVVLVKGENDIPLGVTGKVLKREVRTTYEKVLLSDDDHGLDIAR
FT                   TRSARTEPSAPAPASRRRSAKAA"
FT   misc_feature    complement(224332..225564)
FT                   /locus_tag="SCAB_2041"
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
FT                   5e-44"
FT                   /inference="protein motif:PFAM:PF00501"
FT   misc_feature    complement(225145..225180)
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT                   /inference="protein motif:Prosite:PS00455"
FT   CDS_pept        complement(225903..226718)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2051"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2051"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67423"
FT                   /db_xref="GOA:C9ZEG4"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEG4"
FT                   /protein_id="CBG67423.1"
FT                   /translation="MRRVTVMRTEIDSQSFLVWNSGAGLVAEENDKGMVVADSWLVRDG
FT                   RVRSHEMHWDRFSDSVGSHGVDRGEIADFRAAVTARLPRAGAWFPRVELLAGPSPRLAL
FT                   RLRPAPALRDTARVWVADGVDPRTRPTVKGPDFAAQGRLRKQARLHGADEALLLDEDGH
FT                   AVEGAFSSLLWWDRGDLCTAPDDGRILSGITRRLLLDRAARLGVTVRHTRVSPARLARC
FT                   EVWITSALHGIRVVTGWAPGGAPAPPGALGAAGPWQAHLDSLLAPLPPG"
FT   CDS_pept        complement(226943..228295)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2061"
FT                   /product="putative transmembrane transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2061"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67424"
FT                   /db_xref="GOA:C9ZEG5"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEG5"
FT                   /protein_id="CBG67424.1"
FT                   /translation="MNRSMSETSSDAAVGTVAPPAPPHEPRENVARVAVASLVGTTIEY
FT                   YDFAVYGTAAALVLGPAFFPSTSSTGSTLAAFLTFAAAFLARPVGVVLFGTIGDRLGRK
FT                   RALVTSLVLMGIATVGVGLLPTYETVGVLAPVLLVALRLLQGVSMGGEWGGAVLLAAEH
FT                   APPGRRAVYASIPQIGALLGFLLSSAVILPTIAVAGRDGFAAGAWRVPFLLSTLLIVVG
FT                   FWVRTRVSESPVFRTGPQGDRPAAPRFPLGALVKEYPGRLLLGIGAAAGGSAVYYLTIV
FT                   YSLSYGPKALGIAQNTMLAAASVAAGVTAAAVVPVARLADRVGRRPVIMAGAIGCVVWA
FT                   LPMFGSMGTGNGLVITGAFTVGLVLFILMFAPIAAFLPELFPARLRYTGASATFILANT
FT                   LGGGFAPLVATWLNSHWKSPLVLGVYAGGLCLVSLLCVLALPETRDRDFAA"
FT   misc_feature    complement(226946..228202)
FT                   /locus_tag="SCAB_2061"
FT                   /note="HMMPfam hit to PF00083, Sugar (and other)
FT                   transporter, score 1.8e-17"
FT                   /inference="protein motif:PFAM:PF00083"
FT   misc_feature    complement(join(226976..227035,227063..227131,
FT                   227165..227233,227246..227314,227348..227416,
FT                   227444..227512,227615..227683,227711..227779,
FT                   227816..227884,227912..227980,228005..228073,
FT                   228101..228154))
FT                   /locus_tag="SCAB_2061"
FT                   /note="12 probable transmembrane helices predicted for
FT                   SCAB2061 by TMHMM2.0 at aa 48-65, 75-97, 106-128, 138-160,
FT                   173-195, 205-227, 262-284, 294-316, 328-350, 355-377,
FT                   389-411 and 421-440"
FT   misc_feature    complement(227054..228187)
FT                   /locus_tag="SCAB_2061"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 8.6e-18"
FT                   /inference="protein motif:PFAM:PF07690"
FT   misc_feature    complement(227297..227350)
FT                   /note="PS00216 Sugar transport proteins signature 1."
FT                   /inference="protein motif:Prosite:PS00216"
FT   misc_feature    complement(227789..227866)
FT                   /note="PS00217 Sugar transport proteins signature 2."
FT                   /inference="protein motif:Prosite:PS00217"
FT   CDS_pept        complement(228519..229541)
FT                   /transl_table=11
FT                   /gene="mhpE"
FT                   /locus_tag="SCAB_2071"
FT                   /product="4-hydroxy-2-ketovalerate aldolase"
FT                   /note="E. coli mhp operon inv in phenol degradation"
FT                   /note="annotation transferred from E. coli"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2071"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67425"
FT                   /db_xref="GOA:C9ZEG6"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR012425"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017629"
FT                   /db_xref="InterPro:IPR035685"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEG6"
FT                   /protein_id="CBG67425.1"
FT                   /translation="MTHKLYIQDVTLRDGMHAVRHRVDPVDVGRIVAALDAAGVDAIEV
FT                   AHGDGLAGGSLNYGPGSHTDWEWIETAAAHLTDAVLTTLLLPGIGTIAELERAHALGVR
FT                   SVRVATHCTEADISAQHIAKARDLGMDVAGFLMMSHMAPAVELAAQARLMESFGAHCVY
FT                   VTDSGGRLTMNGVRERVRAYRDVLDPATEIGIHAHENLSLSVANSVVAVEEGVTRVDAS
FT                   LAGQGAGAGNCPIEAFVAVANLQDWKHGCDLFALQDAADDLVRPLRDRPVQVDRETLTL
FT                   GYAGAYSSFLRHAESAAGRYGVDARALLLEVGRRGLVGGQEDMIVDIALDLVSARIPTR
FT                   "
FT   misc_feature    complement(228540..228731)
FT                   /gene="mhpE"
FT                   /locus_tag="SCAB_2071"
FT                   /note="HMMPfam hit to PF07836, DmpG-like communication
FT                   domain, score 3.7e-39"
FT                   /inference="protein motif:PFAM:PF07836"
FT   misc_feature    complement(228735..229505)
FT                   /gene="mhpE"
FT                   /locus_tag="SCAB_2071"
FT                   /note="HMMPfam hit to PF00682, HMGL-like, score 8.2e-82"
FT                   /inference="protein motif:PFAM:PF00682"
FT   CDS_pept        complement(229538..230473)
FT                   /transl_table=11
FT                   /gene="bphG"
FT                   /locus_tag="SCAB_2081"
FT                   /product="acetaldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2081"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67426"
FT                   /db_xref="GOA:C9ZEG7"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR003361"
FT                   /db_xref="InterPro:IPR015426"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEG7"
FT                   /protein_id="CBG67426.1"
FT                   /translation="MAVIGSGNIGTDLMIKILRLSDTLEMSAMVGIDPDSDGLARAARL
FT                   KIATTHQGVEGLIALPGFEDIGIVFDATSAKAHIANAARLAPYGKRLIDLTPAAIGPFV
FT                   VPPVNGDAQPDAMNVNMVTCGGQATIPVVGAVSAVTPVHYAEIVASIASRSAGPGTRAN
FT                   IDEFTETTSRAIESVGGAARGKAIIVLNPAEPPLIMRDTVFCLIGDADHEAVRASVETM
FT                   VGRVAQYVPGYRLKQQVQFIPVDGTEPVHTLVPPGAGPVRTRVSVFLEVEGAAHYLPAY
FT                   AGNLDIMTSAALRVAESIARRDAVPPEGRP"
FT   misc_feature    complement(230126..230473)
FT                   /gene="bphG"
FT                   /locus_tag="SCAB_2081"
FT                   /note="HMMPfam hit to PF01118, Semialdehyde dehydrogenase,
FT                   NAD bindin, score 2.5e-21"
FT                   /inference="protein motif:PFAM:PF01118"
FT   CDS_pept        complement(230485..231324)
FT                   /transl_table=11
FT                   /gene="mhpD"
FT                   /locus_tag="SCAB_2091"
FT                   /product="2-keto-4-pentenoate hydratase"
FT                   /note="annotation transferred from E. coli perhaps
FT                   breakdown of aromatics cf PMID:9492273"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2091"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67427"
FT                   /db_xref="GOA:C9ZEG8"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEG8"
FT                   /protein_id="CBG67427.1"
FT                   /translation="MTTMAIDTYAVERAVARLAAAVEGGRPVAPVRDLLGEHDVAAAYA
FT                   VQQELTRRRLAAGATVVGRKIGLTSPAVQKQLGVDQPDFGMLFADMDVSAEPEIPMERL
FT                   SQPKAEAEIAFVLGEDLADGDLDAARVRGAVEYAVAAIEIVDSRIAAWDIRLTDTVADN
FT                   ASSGLFVLGEHRVTPDAFEPRETTMRMYADDEPVSEGAGAACLGDPLNALAWLARTARE
FT                   HGLPLRAGQIVLSGALGPMVPVSPGVRIRAEISSLGTVTALFSARPQERHQPEEEDA"
FT   misc_feature    complement(230647..231303)
FT                   /gene="mhpD"
FT                   /locus_tag="SCAB_2091"
FT                   /note="HMMPfam hit to PF01689, Hydratase/decarboxylase,
FT                   score 1.9e-94"
FT                   /inference="protein motif:PFAM:PF01689"
FT   CDS_pept        complement(231321..232259)
FT                   /transl_table=11
FT                   /gene="mhpB"
FT                   /locus_tag="SCAB_2101"
FT                   /product="2,3-dihydroxyphenylpropionate 1,2-dioxygenase"
FT                   /note="annotation transferred from E. coli"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2101"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67428"
FT                   /db_xref="GOA:C9ZEG9"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR023789"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEG9"
FT                   /protein_id="CBG67428.1"
FT                   /translation="MTAAAVGLSHSPLIGRNDPDPEVLARVDRAVEEAREFIRAYDPEL
FT                   VVLYAPDHYNGFFYKEMPPFCLATEAHAVGDFGTSAGPLSVDTAAARALARGVLDQGVD
FT                   LTVSARMTVDHGFAQPLEVLFGGIDKVPVVPVFVNGVATPLGPVGRVRALGTAVGRAAA
FT                   EIDRRVLFLASGGLSHDPPVPVLDGAPPRVADALIEGRPPTPEQRARAEQRVVRAGRDY
FT                   AAGSTEMIPINPDWDNRFLDHVENGELAAFDTWTVEGMAKEGGNSAHEVRTWIAAFASL
FT                   AATGPYDLASRFYEAVPAWIAGFAVATAKGR"
FT   misc_feature    complement(231345..232250)
FT                   /gene="mhpB"
FT                   /locus_tag="SCAB_2101"
FT                   /note="HMMPfam hit to PF02900, Catalytic LigB subunit of
FT                   aromatic ring-open, score 7.6e-99"
FT                   /inference="protein motif:PFAM:PF02900"
FT   CDS_pept        complement(232269..233270)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2111"
FT                   /product="putative alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2111"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67429"
FT                   /db_xref="GOA:C9ZEH0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEH0"
FT                   /protein_id="CBG67429.1"
FT                   /translation="MLAATAISQSAADPLSGLVLRDVPEPIPRPGWSRVRVVASSLNMH
FT                   DVWTLRGVGHPPDRLPIILGCDAAGYDEDGNEVIVHPVIGDPDAGRGDETLDPGRALLS
FT                   ERHDGAFAEYLTVPARNLVPKPDWLSFDEAACLPVAWTTAYRMLFTQARITAGDRVLVQ
FT                   GAGGGVASAAIRLAVAAGAVVYATSRSADKRAEAVSWGARAAVAPGERLPERVDVVIET
FT                   VGEATWSHSLKSLRPGGTVVIAGATSGMNPPADLGRIFYLQQRILGSTGCTRVELVAML
FT                   RLMEATGVRPVIDRTLPLAEIHKGLQLMIDGGLTGKLVVHPPGPARPSTSQQ"
FT   misc_feature    complement(232413..232805)
FT                   /locus_tag="SCAB_2111"
FT                   /note="HMMPfam hit to PF00107, Zinc-binding dehydrogenase,
FT                   score 6.2e-29"
FT                   /inference="protein motif:PFAM:PF00107"
FT   misc_feature    complement(232896..233183)
FT                   /locus_tag="SCAB_2111"
FT                   /note="HMMPfam hit to PF08240, Alcohol dehydrogenase
FT                   GroES-like domain, score 1.1e-13"
FT                   /inference="protein motif:PFAM:PF08240"
FT   CDS_pept        complement(233457..234086)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2121"
FT                   /product="putative membrane protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2121"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67430"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEH1"
FT                   /protein_id="CBG67430.1"
FT                   /translation="MVVTPPDSARRTVIGDGWSLRPLAGTSGEPLGARRPAARGYAASC
FT                   DGTDRSGGGGGGGGEDGGGSAELLVHVQAVPHHPVRACYPFGAHDVVVWLGDGDDETDH
FT                   GDHGTDHGDGGTDHGDRGARAARVPEEAGADLLRVLVPALFATDARCRRVVAAPDEYDG
FT                   HAQRVLLAGGFRRITEADLPHGSVVLFAAEPPEVAGLSTALDDMPH"
FT   CDS_pept        complement(234107..235699)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2131"
FT                   /product="putative substrate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2131"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67431"
FT                   /db_xref="GOA:C9ZEH2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020459"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEH2"
FT                   /protein_id="CBG67431.1"
FT                   /translation="MAAVDISPATALHRRAQHPGPPAVVYENREITAVELGATVGEFAA
FT                   GLSEHGLRRGDRIAYLGLNSVTFLETLFAAARLGAVFVPLNFRLAADEVRHILNDCGAH
FT                   TVVVEEGHRELVESILHDIPARTRLLVDTDPACPATGTPAPAWTPLSTLRGPHRPVREP
FT                   VALYDDDLAALMYTSGTTGRPKGVMLTHGNLWWNAVNVDAVVDTRADDVNLALAPLFHI
FT                   GGLNAFTLRTLVRGGTVVLRRSFEPAQCLRDLVEHRVNTFFAVPAMYAALARVPGFADA
FT                   DLGALRSAIVAGAPVPPQLIRDYGEVGLSLQQAWGLTETAPFATYLPARLLPEKAGSAG
FT                   VAMPYTEIRLTHPGTGTGIEEPDTRGEICVRGPNVTSGYWDNPDATRGAFDDMGWFHTG
FT                   DIAYRDKDGFYHIVDRLKDMIISGGENVYPAEVERVLAELPGVLEAAVVGVPDARWGET
FT                   VLAVLSCAAGAEPTVEEVRAFADRYLARYKLPTDVLVIDRLPRNASGKLDKIELRRWVT
FT                   ARRNAPSTATATA"
FT   misc_feature    complement(234359..235606)
FT                   /locus_tag="SCAB_2131"
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
FT                   3.7e-123"
FT                   /inference="protein motif:PFAM:PF00501"
FT   misc_feature    complement(235145..235180)
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT                   /inference="protein motif:Prosite:PS00455"
FT   CDS_pept        complement(235712..236605)
FT                   /transl_table=11
FT                   /gene="hcaB"
FT                   /locus_tag="SCAB_2141"
FT                   /product="2,3-dihydroxy-2,3-dihydrophenylpropionatedehydr
FT                   og enase"
FT                   /note="annotation transferred from E. coli"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2141"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67432"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEH3"
FT                   /protein_id="CBG67432.1"
FT                   /translation="MGSGWLENEVALITGGGSGIGRAVALRYLAEGARVAILGRTAAQL
FT                   EEVVRAAGELGDRVLPLTGDVRSPDDLHRAVETTVERLGRLDILVPNAGIWDYHRSVTR
FT                   LSGKELAEAFDEIFAINVKGYALAVEAAWRELVATRGSIVMTLSNASQHTDGGGSLYTA
FT                   SKHACLGLLRQFAFELAPRVRVNGVAVGGMRTQLRGPESLGLHHRTLAASFARNEEAQA
FT                   LSGEKPPPLIPLYDSSVEPEDFTGPYVLLASRTDSGTITGAVIPADGGIAVRGFRAPAG
FT                   GAGLCPPHMNASPDSH"
FT   misc_feature    complement(236066..236581)
FT                   /gene="hcaB"
FT                   /locus_tag="SCAB_2141"
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase,
FT                   score 3.3e-19"
FT                   /inference="protein motif:PFAM:PF00106"
FT   misc_feature    complement(236411..236428)
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT                   /inference="protein motif:Prosite:PS00343"
FT   CDS_pept        complement(236608..237474)
FT                   /transl_table=11
FT                   /gene="bphD"
FT                   /locus_tag="SCAB_2151"
FT                   /product="2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate
FT                   hydrolase BphD"
FT                   /note="annotation transferred, perhaps biphenyl catabolism
FT                   cf PMID: 2160220"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2151"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67433"
FT                   /db_xref="GOA:C9ZEH4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEH4"
FT                   /protein_id="CBG67433.1"
FT                   /translation="MTTDQTQEPKLVEQTVRTTLGPVRVSETGEGPVLVMLHGGGPGAS
FT                   AVANYHQNLPALASRFRVVLPDQPGFGGSYRPTEAELGARSITEITVDALLQTLDALGI
FT                   DRFHLLGNSLGGAAALATALEVPARVEKLVLMAPGGGWLPFGPTPTEGQKAMFRYYHGE
FT                   GPTLKKMRDFIGVMTAEPKRWADTAQARYEASLDESHIAFYHAYNAAFAKRHGMDPLWQ
FT                   RVHEITAPTLLLWGRDDRTITLEGAQLMLKQIRDVQLHVFGGCGHWVQLERRAEFERLV
FT                   TDFIEGA"
FT   misc_feature    complement(236626..237294)
FT                   /gene="bphD"
FT                   /locus_tag="SCAB_2151"
FT                   /note="HMMPfam hit to PF00561, alpha/beta hydrolase fold,
FT                   score 6.2e-28"
FT                   /inference="protein motif:PFAM:PF00561"
FT   misc_feature    complement(237145..237174)
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   CDS_pept        complement(237570..238136)
FT                   /transl_table=11
FT                   /gene="hcaF"
FT                   /locus_tag="SCAB_2161"
FT                   /product="3-phenylpropionate dioxygenase, beta subunit"
FT                   /note="this operon in E. coli encodes a pathway for
FT                   catabolism of aromatic acids"
FT                   /note="annotation transferred from E. coli"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2161"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67434"
FT                   /db_xref="GOA:C9ZEH5"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEH5"
FT                   /protein_id="CBG67434.1"
FT                   /translation="MSIHAPEPAVAGTEPVSDADVRLHFEVQRLYAREAQLLDQHRYAD
FT                   WLELFTEDLHYWAPVRTNRLRRQQALADGTPGEVAIFDETRASLAWRIRRFDSGMAWAE
FT                   DPPSRSRHLITNVMVRAAEEPGEYLAESAFLCYRNRLEREVDLYAGGRTDLLRRAPEDG
FT                   RLLIARRTILLDQNVLLAKNISTFL"
FT   misc_feature    complement(237591..238040)
FT                   /gene="hcaF"
FT                   /locus_tag="SCAB_2161"
FT                   /note="HMMPfam hit to PF00866, Ring hydroxylating beta
FT                   subunit, score 3.6e-69"
FT                   /inference="protein motif:PFAM:PF00866"
FT   CDS_pept        complement(238257..239483)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2171"
FT                   /product="putative aromatic hydrocarbons catabolism-related
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2171"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67435"
FT                   /db_xref="GOA:C9ZEH6"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEH6"
FT                   /protein_id="CBG67435.1"
FT                   /translation="MSTPPPPPRRIAVVGTGPAAVSTCDALRAQGYDGQVVLYGAEHGL
FT                   PYDRPPLSKDVLLGKARRADILLRPEGWYEEQRVQLRDGTRVRAIRPRAGGVELADGTI
FT                   AEADRIVLATGGTPRPLPVPGGDDPAVHQVRTWEDADRLRERLLPGARVIVVGAGLIGA
FT                   ETAAVAVSLGCRVTLVDPVPVPLAAAVGGDIAGALHRRHTAEGVEVLTAGVAHVERSPQ
FT                   GLRVGLTGHGGTLAADILVAGIGIRPATDTAETAGLRVDNGVVVHPGQRTSHPHVFAVG
FT                   DVARPDGHRVRHEHWEAAQRDGEAAALGILGRPAPDAGAPWFWSDRYGARLEAVGTMAD
FT                   AGRHVLRGDPADGAFTAFGLRGDRLVAAAAIDRSRDIKAARRLIDRAIPLSAEELTDEH
FT                   TDLRTLLTR"
FT   misc_feature    complement(238620..239456)
FT                   /locus_tag="SCAB_2171"
FT                   /note="HMMPfam hit to PF07992, Pyridine
FT                   nucleotide-disulphide oxidoreduc, score 4.8e-45"
FT                   /inference="protein motif:PFAM:PF07992"
FT   misc_feature    complement(238749..239030)
FT                   /locus_tag="SCAB_2171"
FT                   /note="HMMPfam hit to PF00070, Pyridine
FT                   nucleotide-disulphide oxidoreduc, score 3.1e-17"
FT                   /inference="protein motif:PFAM:PF00070"
FT   misc_feature    complement(239391..239483)
FT                   /locus_tag="SCAB_2171"
FT                   /note="Signal peptide predicted for SCAB2171 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.763) with cleavage site
FT                   probability 0.492 between residues 31 and 32"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(239480..239815)
FT                   /transl_table=11
FT                   /gene="hcaC"
FT                   /locus_tag="SCAB_2181"
FT                   /product="ferredoxin subunit of phenylpropionate
FT                   dioxygenase"
FT                   /note="annotation transferred from E. coli"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2181"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67436"
FT                   /db_xref="GOA:C9ZEH7"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEH7"
FT                   /protein_id="CBG67436.1"
FT                   /translation="MRVAAVGDIEDGEALKVPAETSGHGEAIAVFHEGGAYFALDDTCS
FT                   HGRASLSEGWIEDGEVECPLHSARFCLKSGEPQCMPATLAVRTHHVEVRDGAVWLHPGR
FT                   TAAEADA"
FT   misc_feature    complement(239528..239815)
FT                   /gene="hcaC"
FT                   /locus_tag="SCAB_2181"
FT                   /note="HMMPfam hit to PF00355, Rieske [2Fe-2S] domain,
FT                   score 1e-16"
FT                   /inference="protein motif:PFAM:PF00355"
FT   CDS_pept        complement(239842..241167)
FT                   /transl_table=11
FT                   /gene="hcaE"
FT                   /locus_tag="SCAB_2191"
FT                   /product="3-phenylpropionate dioxygenase, alpha subunit"
FT                   /note="annotation transferred from E. coli, perhaps
FT                   3-phenylpropionic acid breakdown cf PMID: 9603882"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2191"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67437"
FT                   /db_xref="GOA:C9ZEH8"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEH8"
FT                   /protein_id="CBG67437.1"
FT                   /translation="MTAPPVRHGERVTGVPRANVDVSAYFDLDHGLIDRTIFSDRALYQ
FT                   QELRRVFAPSWLFLAHESQFGRPGDFFTTYMGEDPVIVAMGRDRKLRAFLNACRHRGMR
FT                   VCRADAGAAKAFTCSYHGWSYDMSGKLVNVPNQDDYPDHFEQDRWGLVEVARLDTYKGL
FT                   VFATWNPEAPPLAEALGGMTWYMDAMLDRDPEGTEAVGGVHKWVLEGNWKLAAEQFASD
FT                   WYHVNISHASALMVMSPTGKGPKAEIVQTPGRQYADPLGHGHGFPTHPKSRFDDRIVHA
FT                   HYDYEALRERLGDARVEGPMTTGHATVFPNFSYLPVNGSIRIWHPKGPDRMEVWAWTLV
FT                   DRSMPDEVKNAQRLYNLRTFGPTGIFEQDDGENWSECQATAHGFVSGSMTLNYQMGLGL
FT                   ETQDGVHPGTTGRLYTDGAARTMYARWRDLMNTPAWHEKDDT"
FT   misc_feature    complement(239863..240645)
FT                   /gene="hcaE"
FT                   /locus_tag="SCAB_2191"
FT                   /note="HMMPfam hit to PF00848, Ring hydroxylating alpha
FT                   subunit (cat, score 3.9e-86"
FT                   /inference="protein motif:PFAM:PF00848"
FT   misc_feature    complement(240703..241005)
FT                   /gene="hcaE"
FT                   /locus_tag="SCAB_2191"
FT                   /note="HMMPfam hit to PF00355, Rieske [2Fe-2S] domain,
FT                   score 4.6e-34"
FT                   /inference="protein motif:PFAM:PF00355"
FT   CDS_pept        241578..242501
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2211"
FT                   /product="putative transcriptional repressor (IclR family)"
FT                   /note="annotation transferred from E. coli"
FT                   /note="TTA-Leu codon(s) 276 may indicate regulation by
FT                   BldA"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2211"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67438"
FT                   /db_xref="GOA:C9ZEH9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEH9"
FT                   /protein_id="CBG67438.1"
FT                   /translation="MMAASAQFREPAMSLSSPTPHLIEGSLTEPPPADGSRPQAPTAAP
FT                   DQRTAVDKALVLLKSLAEQDREIGVSELARRTRLTKSTAFRLLGILQRNDLVERVGSDY
FT                   RLGAQLFDIGTRVYGPTSLLLRERLLPHLADLYVLTQETVHLAVLHDTDIVYVNKIHGH
FT                   RATRSPSRIGARLPAYCTAVGKALLAFDHDAMEAAIAAGLPRLTEHTVTDPDVFRAELR
FT                   RIRRDGIAYDHQEATLGLTCVAVPVMGPAGRPVAALSVAGADHRFDRARFAPALRRVAY
FT                   EAARAINSAARAQRYAASSQGDAPAP"
FT   misc_feature    242067..242447
FT                   /locus_tag="SCAB_2211"
FT                   /note="HMMPfam hit to PF01614, Bacterial transcriptional
FT                   regulator, score 6.6e-39"
FT                   /inference="protein motif:PFAM:PF01614"
FT   CDS_pept        complement(242519..243133)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2221"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2221"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67439"
FT                   /db_xref="GOA:C9ZEI0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEI0"
FT                   /protein_id="CBG67439.1"
FT                   /translation="MVSAGNAVVARNVRLLREQRGLSLARLAREAGLAKQTLSNLEQGT
FT                   GNPTVDTLFSIATALGVPVTRLVAEREQVMTVQRGADVVWKEHEGLETRALDHVYGSGV
FT                   IENYLVRVGPDRDGAGRPIEPHPVGTLEHLYVISGRVRVGPAESPVELDAGDFVRYPGD
FT                   RPHVYQSLDGESLVHIVVSVPRVQPGTGGTKTQRTHGGDAP"
FT   misc_feature    complement(242588..242812)
FT                   /locus_tag="SCAB_2221"
FT                   /note="HMMPfam hit to PF07883, Cupin domain, score 0.00011"
FT                   /inference="protein motif:PFAM:PF07883"
FT   misc_feature    complement(242933..243097)
FT                   /locus_tag="SCAB_2221"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   3e-16"
FT                   /inference="protein motif:PFAM:PF01381"
FT   CDS_pept        complement(243762..245345)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2231"
FT                   /product="putative transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2231"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67440"
FT                   /db_xref="GOA:C9ZEI1"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEI1"
FT                   /protein_id="CBG67440.1"
FT                   /translation="MTGTYVTADLPVFFVFLVCALFLVMWAGPQRGTVSEFYVSDGLLK
FT                   PAHNGVALFGDVMSAAALLGSPGLIALTGYDGTLSVLGPAVSWIVILLLVAERYHSTTE
FT                   FTIGDRLARRLRSRPVHLAAGVATLVVCLLYLIAQLVGASALTVGILGSAGRGMEGAVS
FT                   AGLGALMVLYVVLGGMRAATLVQTVKAVLLVGGGVALALLVLARFDFDPGALLSSAAKG
FT                   SGHGDAFLRPGLRFGGGSTQLDSLSEQLALLIGAAGLPHLLMRISTVPTPSAARRSVQY
FT                   AAVLTVVFYLAALVLGFGSAALVGTQVIAGDSPSGNTAVLLLAAHIGGSLLLTFVACLT
FT                   FATVLAVVAGVTLAAATSLAHDIYGAFLTHGTASGQQELVVARAAAVAVGTTATLLAVF
FT                   ARSLNVSFLIGLAFAVAASAIVPALLYSMLWKSFTTRGATWSIYGGLLTSVVLVGLSPQ
FT                   VSGSATALLPQLDFSVFPFRNPALVAVPVGFLLGWLGSALPGPVEPTDVPPSPRVVPEE
FT                   PGAPVVRPRA"
FT   misc_feature    complement(join(243855..243923,243960..244028,
FT                   244056..244124,244143..244211,244239..244307,
FT                   244326..244394,244437..244505,244539..244598,
FT                   244722..244775,244809..244877,244920..244988,
FT                   245049..245117,245130..245198,245259..245318))
FT                   /locus_tag="SCAB_2231"
FT                   /note="14 probable transmembrane helices predicted for
FT                   SCAB2231 by TMHMM2.0 at aa 10-29, 50-72, 77-99, 120-142,
FT                   157-179, 191-208, 250-269, 281-303, 318-340, 347-369,
FT                   379-401, 408-430, 440-462 and 475-497"
FT   misc_feature    complement(244011..245237)
FT                   /locus_tag="SCAB_2231"
FT                   /note="HMMPfam hit to PF00474, Sodium:solute symporter
FT                   family, score 1.9e-42"
FT                   /inference="protein motif:PFAM:PF00474"
FT   misc_feature    complement(244332..244364)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(245342..246007)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2241"
FT                   /product="putative membrane protein"
FT                   /note="no significant db matches"
FT                   /note="TTA-Leu codon(s) 30, 134 may indicate regulation by
FT                   BldA"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2241"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67441"
FT                   /db_xref="GOA:C9ZEI2"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEI2"
FT                   /protein_id="CBG67441.1"
FT                   /translation="MNLRKRHPQDPRRPQPISRPPQTPQPQDSLQDPLVAVLLYLSHLD
FT                   HEHLYSEEELSRAIHDCHRSYGSVADLCVWYRQSLGVGQAVTVVQERRDWALNIASHLA
FT                   HRHPYDRSLPWCSGVTLAEAFRTVGADRTLRRARRRAFLVAAPVIGLYLLISCLGETAE
FT                   NIMATRVVGLLNVGLLLGLVQLAAVVAWLQWYGRYCRTTIDPLVESPVTPDERLEHQP"
FT   misc_feature    complement(join(245432..245500,245528..245587))
FT                   /locus_tag="SCAB_2241"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SCAB2241 by TMHMM2.0 at aa 141-160 and 170-192"
FT   misc_feature    complement(245537..245569)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(246256..247353)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2251"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67442"
FT                   /db_xref="InterPro:IPR035948"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEI3"
FT                   /protein_id="CBG67442.1"
FT                   /translation="MAGDRIIHMVFVRTTPPRPVDVAAVFPELAPLARPAIRLHPRPGS
FT                   PSVGESSVGGPLLWPAEEPWPHCEASHLHVDSGFRESPADVRLMRRMRVRWHGDHGGPG
FT                   TTPEEEALKAQNAARLAERLDAGPPPADCPVPMLPVAQLYLRDIPLLRPPGQADLLQVL
FT                   WCPYDHDPDHKPLIALFWRSAAGIGDTLATPPEPYEVNWEGYLPEPCVLAPEAITDYPD
FT                   SLDLSPQTRSMVEDRSRWQAAGATMNSSYATYPRDFYDEHLGDAPGWKVGGWPPWGRTD
FT                   PKPRYCAVCEVRMVPLLTIASREWDGGEGHSWAPYEDQAAANATGQCCGQRPSQPTKVE
FT                   VGSTDNMQIYICPASSEHPHTDLIQ"
FT   CDS_pept        complement(247758..248525)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2261"
FT                   /product="putative oxidoreductase"
FT                   /note="PMID:11388460"
FT                   /note="cluster 0168 with SCAB12071 and SCAB79721; substrate
FT                   maybe related to levodione"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2261"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67443"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEI4"
FT                   /protein_id="CBG67443.1"
FT                   /translation="MTPTYDFSGQVAFVTGAASGMGLAAARAFADSGAAVVLADRDPDT
FT                   VHRAAEEITGSGAQAIGVVCDVTDEQQVEAAVRTAVSEYGRLDMAFNNAGIQVDPSDAA
FT                   DETAENFDRVNGVNLRGVWASMKHELRQMREQGSGAIVNCSSLGGLVGLPERAAYHASK
FT                   HGVIGLTRSAAVEYAPRGIRINAVCPGVINTPMVADMLEGQAEAMAGIIKEQPIGRLGT
FT                   AEEVAAAVLWLCSHGAGFVIGAALPVDGGFTVH"
FT   misc_feature    complement(247992..248498)
FT                   /locus_tag="SCAB_2261"
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase,
FT                   score 5.4e-32"
FT                   /inference="protein motif:PFAM:PF00106"
FT   misc_feature    complement(248436..248525)
FT                   /locus_tag="SCAB_2261"
FT                   /note="Signal peptide predicted for SCAB2261 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.985 between residues 30 and 31"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(248865..249245)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2271"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2271"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67444"
FT                   /db_xref="InterPro:IPR016888"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEI5"
FT                   /protein_id="CBG67444.1"
FT                   /translation="MTAWSSGDIARVAATDDLRIAPLRADGVTHGTLTWIWSVVVDGRL
FT                   FVRAYNGTNSRWYKSAMNQRAGRITAAGSTFEVTFAAADPSLTDRIDAAYRDKYSGSPY
FT                   LPPMVATGPQAATVEITPGRTA"
FT   CDS_pept        complement(249288..250328)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2281"
FT                   /product="putative zinc-binding alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2281"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67445"
FT                   /db_xref="GOA:C9ZEI6"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEI6"
FT                   /protein_id="CBG67445.1"
FT                   /translation="MKRNLHMRGAVIHAPGDVRVEERENPTIVAQTDAIIRVSAACVCG
FT                   SDLWDYRGINEVKQPTPIGHEYVGVVTEIGDEVKNIGVGDFVVGSFMASDNTCEICEAG
FT                   YQSRCAHVEFVGAGGAQAEYLRVPLADGTLVATPAMPDEDLIPSLLAASDVLGTGWFGA
FT                   VAAEVGPGRTVAVVGDGAVGLLAILAAKQLGAERIIAMSRHASRQKLAREFGATDIVEE
FT                   RGDEGVARIKELTGGYGAHSVIEAVGTQESMMQAIRSARPGGHVGYVGVAHGVELPGEE
FT                   LFFAEVHLHGGPAPVRRFLPELIRLIWDRTIDPGKVFDLTLPLDEAAEGYKAMDERRAI
FT                   KTLLKP"
FT   misc_feature    complement(249402..249821)
FT                   /locus_tag="SCAB_2281"
FT                   /note="HMMPfam hit to PF00107, Zinc-binding dehydrogenase,
FT                   score 2.7e-36"
FT                   /inference="protein motif:PFAM:PF00107"
FT   misc_feature    complement(249918..250238)
FT                   /locus_tag="SCAB_2281"
FT                   /note="HMMPfam hit to PF08240, Alcohol dehydrogenase
FT                   GroES-like domain, score 1.1e-28"
FT                   /inference="protein motif:PFAM:PF08240"
FT   misc_feature    complement(250095..250139)
FT                   /note="PS00059 Zinc-containing alcohol dehydrogenases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00059"
FT   CDS_pept        250433..251374
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2301"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2301"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67446"
FT                   /db_xref="GOA:C9ZEI7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEI7"
FT                   /protein_id="CBG67446.1"
FT                   /translation="MEFQQEIRGFLMSRRARITPEQAGLPFVGGNRRVEGLRREEVAML
FT                   AGLSVEYYTRLERGRLGGASESVLDAIARTLQLDDDERAHLYDLARNVAPGAPRRRPRP
FT                   TSPITASVQQVLASMSVPAVVQNGRLDLLAANDLGRALYADLFPAGKQPPNFARYVFLD
FT                   PRAEAFYDDIDQAKNLLVAILRATAGRDPLDKQVSELIGELSVRSTDFGTRWAKHNVRR
FT                   HSRGRKVVHHRAVGTLELVYDDFALPGDPHVTITTWTAAPGTPSADCLTLLATWAETQK
FT                   QAQKQAQAMDAVHESSTTSRADTSEHRDGDGR"
FT   CDS_pept        complement(251474..252373)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2311"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2311"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67447"
FT                   /db_xref="GOA:C9ZEI8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEI8"
FT                   /protein_id="CBG67447.1"
FT                   /translation="MKGMEPLPDDRSDHRTEIRDFLASRRAKITPEQAGLPTSGRRRVP
FT                   GLRREEVAVLAGVSTEWYTRLEKGHINGVSEDVLAAVAQALELDDDERTYLFDLARAAR
FT                   PARRPPSRRRDVAVPPRVQWLLDSMTMSSAFVRNGRQDIVAGNALARALHAPVFESETT
FT                   DKHGRPNVARYIFLDPGSQQFFVDWDAAASATAALLRAEAGREPHDRALRELIGELSTL
FT                   SPDFRHRWAAHEVRIRHDGIKRLWHPEVGDLELTYQSLDLPLSHRAMHDLTLYTAEPGS
FT                   TSEDRLKLLASLAATRPT"
FT   CDS_pept        252595..253779
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2321"
FT                   /product="putative chloramphenicol resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2321"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67448"
FT                   /db_xref="GOA:C9ZEI9"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEI9"
FT                   /protein_id="CBG67448.1"
FT                   /translation="MLALGTFLMGTTEFVVAGLLPEIAGDLQVSVARTGLMITVFAVGM
FT                   IVGAPLTAMLTLRLPTRLTLMLALAVFALGHVIVAVGSGLTMLLAARFLTAIATGAFWA
FT                   VANVAATRAAGPAAGARALGLVGAGAMLANVVGVPLGAFAGQLMGWRGPFWALAALAAA
FT                   AVPLIARTVPQDGPAQRVGSIRSELTALRSGRLWLVLAACATTTGGVLAAYSYIAPLLT
FT                   DRAGLAAGLVPLVLVGFGLGALAGSLVGGRLGDRRPHLVTVAAAAGATLLLLAIVLSAG
FT                   SAPATIVLVTLLGFFGLGANPVLMALAVRYAGQAPTLASALTVSAFNLGTAIGSWFAGL
FT                   ALERAGTTGPTVVGAAIAALTLIPTIALALRQHQRAGSPGTSVRYAAPVPADQA"
FT   misc_feature    252598..253623
FT                   /locus_tag="SCAB_2321"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 7.2e-44"
FT                   /inference="protein motif:PFAM:PF07690"
FT   misc_feature    join(252697..252765,252784..252843,252856..252924,
FT                   252958..253026,253054..253113,253174..253242,
FT                   253270..253338,253372..253440,253453..253521,
FT                   253540..253608,253636..253704)
FT                   /locus_tag="SCAB_2321"
FT                   /note="11 probable transmembrane helices predicted for
FT                   SCAB2321 by TMHMM2.0 at aa 35-57, 64-83, 88-110, 122-144,
FT                   154-173, 194-216, 226-248, 260-282, 287-309, 316-338 and
FT                   348-370"
FT   misc_feature    253174..253224
FT                   /note="PS00606 Beta-ketoacyl synthases active site."
FT                   /inference="protein motif:Prosite:PS00606"
FT   CDS_pept        253852..254895
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2331"
FT                   /product="zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2331"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67449"
FT                   /db_xref="GOA:C9ZEJ0"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEJ0"
FT                   /protein_id="CBG67449.1"
FT                   /translation="MRATLLYGAGDVRVEDVPDSVIKLPTDALVRITASCVCGSDLWPY
FT                   ASAKPEDGPARMGHEFIGIVEDTGTEVTTVKRGDLVVAPFAISDNTCAFCREGLHTSCA
FT                   HAQANFWDGEAEEGGQAEAVRVPLADGTLVKLPVAADSALIPSLLTLSDVFGTGYHAAV
FT                   AGGVSERTRVTVIGDGAVGLLGVLSAKRLGAEQIILMGRHQARTDLGREFGATDVVSAR
FT                   GEEGIARARELTGGEGTHVVLECVGNMPAYEQAVGIVRPGGVISRVGVPQYEEAPIGFG
FT                   SLFRHNIRLAGGPAPVRAYIEELLPDILSGAIEPGKVFDVTTGLDGVPAGYQDMADRKS
FT                   LKVLINP"
FT   misc_feature    253924..254259
FT                   /locus_tag="SCAB_2331"
FT                   /note="HMMPfam hit to PF08240, Alcohol dehydrogenase
FT                   GroES-like domain, score 3e-33"
FT                   /inference="protein motif:PFAM:PF08240"
FT   misc_feature    254023..254067
FT                   /note="PS00059 Zinc-containing alcohol dehydrogenases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00059"
FT   misc_feature    254356..254781
FT                   /locus_tag="SCAB_2331"
FT                   /note="HMMPfam hit to PF00107, Zinc-binding dehydrogenase,
FT                   score 1.3e-26"
FT                   /inference="protein motif:PFAM:PF00107"
FT   CDS_pept        255237..255728
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2341"
FT                   /product="putative glycosidase (fragment)"
FT                   /note="PMID:12831847"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2341"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67450"
FT                   /db_xref="GOA:C9ZEJ1"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEJ1"
FT                   /protein_id="CBG67450.1"
FT                   /translation="MSTGDFPRGRWHGHWIAAELPEFAVDPTSVGGDLLPAGFSRAQFR
FT                   RTFDLETASGVPDRAPLRVSADSRYLLWVNGVEVGRGLIRCQPRRLRYDEYDIAGLLRP
FT                   GRNVIAVLVTYYGHANSFWQPAASSGVMGRDAQLATGTGVGAGKGLRAGSTAELLPAGG
FT                   "
FT   CDS_pept        complement(256076..256486)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2351"
FT                   /product="putative secreted protein"
FT                   /note="no signficant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2351"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67451"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEJ2"
FT                   /protein_id="CBG67451.1"
FT                   /translation="MALSAARKRTAIMLASLTLMGGTATGGVAVAAGTAAATVFPCDVN
FT                   MSSTGRLSAGYYNGNTVIPSTSQVTAAGKEAQCILKYHGYNPGTVDGIFGRNSKAAAKK
FT                   FQEIYNDACNGNLDEDGVIGEESWPRLRRLSC"
FT   misc_feature    complement(256082..256282)
FT                   /locus_tag="SCAB_2351"
FT                   /note="HMMPfam hit to PF01471, Putative peptidoglycan
FT                   binding domain, score 0.0018"
FT                   /inference="protein motif:PFAM:PF01471"
FT   misc_feature    complement(256385..256453)
FT                   /locus_tag="SCAB_2351"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB2351 by TMHMM2.0 at aa 12-34"
FT   misc_feature    complement(256394..256486)
FT                   /locus_tag="SCAB_2351"
FT                   /note="Signal peptide predicted for SCAB2351 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.319 between residues 31 and 32"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        256815..257642
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2361"
FT                   /product="putative peptidoglycan-binding surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2361"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67452"
FT                   /db_xref="GOA:C9ZEJ3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEJ3"
FT                   /protein_id="CBG67452.1"
FT                   /translation="MRRWKALPESLDPRIRQLVVQLRQLKDHSGLSLAALASRTSYSKS
FT                   SWERFLNGKAVPPRTAVEAMADACGGDRINLTALWEVATSAVVPDAAPPGAQEQPGPEA
FT                   VREEERSSEPERPYERASPSERKGSRRPLPRGPLAMASATAVVVACAVAALVAARPWES
FT                   TAEPGEQGRSTSVPTSTYSARTFPCYFTVRDGLLYAGHSTTLADEYGVGTTVEAVAEVQ
FT                   CLVKKHGFDPKGIDASFGPNTKAAVQRFQRSRGLEDDGIVGPMTWRELRKPSG"
FT   misc_feature    257454..257636
FT                   /locus_tag="SCAB_2361"
FT                   /note="HMMPfam hit to PF01471, Putative peptidoglycan
FT                   binding domain, score 1.8e-18"
FT                   /inference="protein motif:PFAM:PF01471"
FT   CDS_pept        257635..258522
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2371"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2371"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67453"
FT                   /db_xref="GOA:C9ZEJ4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR021224"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEJ4"
FT                   /protein_id="CBG67453.1"
FT                   /translation="MAEGTRPEPSRTSGPAAPEVRHLLERLREAKHGTGLSFAALAART
FT                   SYSKSSWERYLNGRTLPPRDAVETLAKLSGTDPARLLALWRLADRAWSGRDARDTAAAG
FT                   EAAGQKTRREGTVDSPARADVRAGTPPLAPRAQNPNRRAVVAAMAGAALAAALGAGSWA
FT                   TWAWTYGDGREEAAPRLSTGPCRGESCTGRNSEQRDTDCWTDAGSRARREIAGRVVELR
FT                   VSLMCRASWGRITEPRRGDRVWVETTDGQHQSGQVAVPNRAIYTLMIGIERPSDARACF
FT                   ELAGGRSGCTAWGR"
FT   CDS_pept        258692..259189
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2381"
FT                   /product="putative secreted protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2381"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67454"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEJ5"
FT                   /protein_id="CBG67454.1"
FT                   /translation="MIHRTRSRTYAAAVGALVMAATVPLLTPTAAHAANACHRNNNILV
FT                   TAEVKTHYPVTLHGATIKLYSERRNGAAFFQTVGARAGDVISIHRTHRVATGSAEHYWW
FT                   NNSQAGSYDYCETTASRDGFVQTERIDGAHHGVRACLRRNGNQQCAGWWYADNDDDSGD
FT                   IT"
FT   misc_feature    258731..258790
FT                   /locus_tag="SCAB_2381"
FT                   /note="Signal peptide predicted for SCAB2381 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.997 between residues 20 and 21"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(259353..260843)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2391"
FT                   /product="putative beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2391"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67455"
FT                   /db_xref="GOA:C9ZEJ6"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017736"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEJ6"
FT                   /protein_id="CBG67455.1"
FT                   /translation="MPPTAPAHTTIPLERTYVVTAAQQSRSAPDAARTFPRGFLWGSAT
FT                   ASYQIEGAAAEDGRTPSIWDTYARTPGRVRNGDTGDIATDHYHRWNEDVALMAELGLGA
FT                   YRFSLAWPRIQPTGRGPAVQKGLDFYRRLADALLEKNIQPVATLYHWDLPQELEDAGGW
FT                   PERATAERFAEYAALAADALGDRVKTWTTLNEPWCSSFLGYGSGVHAPGRTDPVAALRA
FT                   AHHLNLGHGLAVQALRDRLRADAQVSVTLNIHHVRPLTDSDGDADAVRRIDALANRVFT
FT                   GPMLNGAYPEDLLKDTAELTDWSFVQDGDLRTIHQPLDFLGVNYYSPTLVSEADGSGTH
FT                   TSDGHGNSADSPWPAADRVAFHQPPGETTAMGWAVDPSGLYDLLRRLSVDFPGLPLVIT
FT                   ENGAAFDDYADPAGQVNDPARIAYVRGHLAAVHQAILDGSDVRGYFLWSLLDNFEWGHG
FT                   YSKRFGAVYVDYPTGTRIPKASARWYAEVARTGVLPGA"
FT   misc_feature    complement(259365..260753)
FT                   /locus_tag="SCAB_2391"
FT                   /note="HMMPfam hit to PF00232, Glycosyl hydrolase family,
FT                   score 3.3e-212"
FT                   /inference="protein motif:PFAM:PF00232"
FT   misc_feature    complement(259632..259658)
FT                   /note="PS00572 Glycosyl hydrolases family 1 active site."
FT                   /inference="protein motif:Prosite:PS00572"
FT   misc_feature    complement(260685..260729)
FT                   /note="PS00653 Glycosyl hydrolases family 1 N-terminal
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00653"
FT   CDS_pept        complement(260932..261849)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2401"
FT                   /product="putative sugar transport integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2401"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67456"
FT                   /db_xref="GOA:C9ZEJ7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEJ7"
FT                   /protein_id="CBG67456.1"
FT                   /translation="MTTQSLPARTTSAVRTSRKPAGRGGRLLRQRAGRQHHAGPLAYVL
FT                   LAVMALLSIFPLYWTMVAASTDNTRVSQTPPPFLPGPNLFSNLARAWDEAAMGKAMVNS
FT                   LIVAGVIALSTVMFATLAGFAFAKLRFKGRNGLLMLVIGTMLVPPQLGVVPLFMMMAEL
FT                   GWSQQLPAVIFPTLVSAVGVFFMRQYLSEALPDELVEAGRVDGAHSLRIFWSIVLPVAR
FT                   PAMAVLFMITFVHAWNDFFWPFVVLDMTNPTVPVALTQLSAGYVRDQSLIMAGALLGTL
FT                   PLLAMFIVFGRQIVSGIMAGAVKG"
FT   misc_feature    complement(260935..261549)
FT                   /locus_tag="SCAB_2401"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 1e-12"
FT                   /inference="protein motif:PFAM:PF00528"
FT   misc_feature    complement(join(260977..261045,261148..261216,
FT                   261295..261363,261376..261444,261469..261537,
FT                   261661..261729))
FT                   /locus_tag="SCAB_2401"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SCAB2401 by TMHMM2.0 at aa 41-63, 105-127, 136-158,
FT                   163-185, 212-234 and 269-291"
FT   misc_feature    complement(261658..261849)
FT                   /locus_tag="SCAB_2401"
FT                   /note="Signal peptide predicted for SCAB2401 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.820) with cleavage site
FT                   probability 0.819 between residues 64 and 65"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(261862..262833)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2411"
FT                   /product="putative sugar transport permease"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2411"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67457"
FT                   /db_xref="GOA:C9ZEJ8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEJ8"
FT                   /protein_id="CBG67457.1"
FT                   /translation="MATSTTTAPAGHSPDKGPARRRGALLHRLDLKGAPYAFVAPFFVV
FT                   FAAFSFYPLIYTSWISLHDVELATLDVMQWVAFDNYVELWGDSRFWNALQNTITIGVLS
FT                   TVPQLLMALGLAHLLNYRMRASLFFRVASLVPYATSVAAAALVFTMLFERDFGMINWAL
FT                   GTVGIDPLDWEGGKWPAQIAISTIVIWRWTGYNALLYLAAMQAIPADRYEAASLDGASR
FT                   WKQFTHVTVPGIRSTIVFTIVLSTIGATQLFGEPLIFGQGPNGITGGADNQYQTLGLLL
FT                   YEEGWKNYQMGRSATVAWAMFLLLVLVFLVQRLVKRLRSGTS"
FT   misc_feature    complement(261871..262566)
FT                   /locus_tag="SCAB_2411"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 5.6e-15"
FT                   /inference="protein motif:PFAM:PF00528"
FT   misc_feature    complement(join(261901..261969,262075..262143,
FT                   262228..262296,262390..262458,262477..262545,
FT                   262654..262722))
FT                   /locus_tag="SCAB_2411"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SCAB2411 by TMHMM2.0 at aa 38-60, 97-119, 126-148, 180-202,
FT                   231-253 and 289-311"
FT   misc_feature    complement(262138..262224)
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS_pept        complement(262928..264205)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2421"
FT                   /product="putative solute binding lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2421"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67458"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEJ9"
FT                   /protein_id="CBG67458.1"
FT                   /translation="MATVAAVGALTLVVGCSGSDDSVTGGGKKDGKVTITMGLFGVMGI
FT                   KETGLLEQYEKENPGVDIKAEIAGDEQTYYTALQTRLAAGKGLKDIQGIEIGRAKEITE
FT                   TQASKFADFAGTSGTDHFLPWKESQISTADGKVLGLGTDIGPMAVCYRKDYFEKAGLPT
FT                   DRDEVAALWAGDWKKYVEVGRTFKKDFKGDKVAYMDAASGLFNAMVYGYPEQYYDEKGE
FT                   LIYDSNPAVKEAWNLAADAAEGGLTAKLRQFQPGWDPGLANGTFATAVCPAWMLSHISE
FT                   KAGAANKGKWDVAKAPKGANWGGSFLGVIEQSPVKKEAQKLVAWLTAPEQQAHIFKEIG
FT                   NIPSSREALESADVKNAKSAYFSDAPIGQIFGAAAQEIPDKQVLGRKDGTIKDTFSQGL
FT                   TLIEQQGTARDKAWKTTGERIEKAVG"
FT   misc_feature    complement(263207..264199)
FT                   /locus_tag="SCAB_2421"
FT                   /note="HMMPfam hit to PF01547, Bacterial extracellular
FT                   solute-binding prot, score 7.2e-19"
FT                   /inference="protein motif:PFAM:PF01547"
FT   misc_feature    complement(264149..264205)
FT                   /locus_tag="SCAB_2421"
FT                   /note="Signal peptide predicted for SCAB2421 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.748) with cleavage site
FT                   probability 0.312 between residues 19 and 20"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    complement(264158..264190)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        264556..265569
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2431"
FT                   /product="putative lacI-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2431"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67459"
FT                   /db_xref="GOA:C9ZEK0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEK0"
FT                   /protein_id="CBG67459.1"
FT                   /translation="MSGNRRPTIKTVAARAGVGRTTVSRVVNGSDLVSADARARVLAAI
FT                   KELKYVPNSVARGLVTNRTDAVALVIPESESRLGSEPFFAALIRGVSGALADSRTQLQL
FT                   MLVRDQAERDQLTESVATRRVDGVLLVSVHSTDRLPGMLEEMGLPTVLAGRRDAGEQLS
FT                   YVNADNAGGAAAAVRHLLERGRRRVATITGPLDMDVSRNRLAGWHTAHHEANLSASELL
FT                   VEEGDFTEESGVRAMRSLLERAPDLDAVFAASDLMAVGALTELKRQKRQVPRDVAVAGF
FT                   EDSVLARHTSPPLTTVRQPVEELGRTMARILTDITQHGAPRRQVTLPTELVVREST"
FT   misc_feature    264574..264651
FT                   /locus_tag="SCAB_2431"
FT                   /note="HMMPfam hit to PF00356, Bacterial regulatory
FT                   proteins, lacI fami, score 7.7e-07"
FT                   /inference="protein motif:PFAM:PF00356"
FT   misc_feature    264745..265560
FT                   /locus_tag="SCAB_2431"
FT                   /note="HMMPfam hit to PF00532, Periplasmic binding proteins
FT                   and sugar b, score 3.1e-09"
FT                   /inference="protein motif:PFAM:PF00532"
FT   CDS_pept        265748..266617
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2441"
FT                   /product="putative beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2441"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67460"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEK1"
FT                   /inference="protein motif:GO:0006805"
FT                   /protein_id="CBG67460.1"
FT                   /translation="MPLSVPRLRIGSTEIIALTDGEGPFFSPRAEAFPEATAAQWAEAD
FT                   RYDPGAVDAEGRWWLQFRAYAIRGDKGITLVDAGIGPADSPAGSWAPVPGTLPASLAAA
FT                   GIDPAEVDTVVLTHLHTDHVGWAVVTEAAAPSADGVMDGTASTGSAPGGRRPYFPNAEY
FT                   LLQRTEFDALDALNPQLREALTDPLAAAGRLRLLDGDTPLRAGRAVATPGHTPGHQSVL
FT                   VADGRELALITGDLLVHALQLLNVELAYAHENDPEAARHSRKRMLSRETATTLHLATPH
FT                   LTEPFILV"
FT   misc_feature    265928..266590
FT                   /locus_tag="SCAB_2441"
FT                   /note="HMMPfam hit to PF00753, Metallo-beta-lactamase
FT                   superfamily, score 1.2e-15"
FT                   /inference="protein motif:PFAM:PF00753"
FT   misc_feature    265964..265999
FT                   /note="PS00136 Serine proteases, subtilase family, aspartic
FT                   acid active site."
FT                   /inference="protein motif:Prosite:PS00136"
FT   CDS_pept        complement(266688..267665)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2451"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2451"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67461"
FT                   /db_xref="GOA:C9ZEK2"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR038762"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEK2"
FT                   /protein_id="CBG67461.1"
FT                   /translation="MSEGASGSATVVTSQKVREGLDDEYRRWQEKMNQVVRHFDGFAGT
FT                   ETYPPGPPGSGEERQWVVVFRFSDMDQLTAWLDSTTREELLTEGRPLLEGSPRQEVLAG
FT                   SEPAVPDREEGVTAVISHDVRQGKEEDFEHWQTKVLKAQEKFPGFMGNELFRPVKGIQD
FT                   HWVVVFRYDTREHLDAWLDSDVRERLLREGREYFSAYDVRKVGSAFSGWFRFGEGAGTE
FT                   EIPPNWKQAMTVVLALYPTVMVLNLTVGHGFDVVGVPGYLALFFGNVLSVSILTWLLMP
FT                   LVNRALAFWLQPGRTRTVGVHVAGAAVVVLCWALCILLFGLTTH"
FT   misc_feature    complement(join(266700..266768,266826..266894,
FT                   266907..266975))
FT                   /locus_tag="SCAB_2451"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SCAB2451 by TMHMM2.0 at aa 231-253, 258-280 and 300-322"
FT   misc_feature    complement(267102..267296)
FT                   /locus_tag="SCAB_2451"
FT                   /note="HMMPfam hit to PF03992, Antibiotic biosynthesis
FT                   monooxygenase, score 0.00039"
FT                   /inference="protein motif:PFAM:PF03992"
FT   CDS_pept        267795..268343
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2461"
FT                   /product="putative nucleotide deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2461"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67462"
FT                   /db_xref="GOA:C9ZEK3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEK3"
FT                   /protein_id="CBG67462.1"
FT                   /translation="MTEAVRLATESVNGGWGGPFGAVIIRDGEIISRGQNRVLLTGDPT
FT                   AHAEVEAIRKAVQRLNPEAPSISEEHQNESTLAYVSRPEGSPDPVPERARMLMGCSIYI
FT                   SGAPCPMCMSAIYWSRIDAVYFASDLDATRTIGFDDSFQYEDFQKPLDQRRIHVEQIYP
FT                   ELGAKAYASWTNKGNRHPY"
FT   misc_feature    267861..268178
FT                   /locus_tag="SCAB_2461"
FT                   /note="HMMPfam hit to PF00383, Cytidine and deoxycytidylate
FT                   deaminas, score 2.9e-07"
FT                   /inference="protein motif:PFAM:PF00383"
FT   CDS_pept        268746..269354
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2471"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2471"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67463"
FT                   /db_xref="GOA:C9ZEK4"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEK4"
FT                   /protein_id="CBG67463.1"
FT                   /translation="MSVSNKKIADATTPPLSVRRLDTDTWAAFAQLIEANNGVRGGCWC
FT                   MSFHVKVGKGRTPQHNRTEKEQRVRESRTHASLVFAGDDCLGWCQFGSPAELPEIKRER
FT                   RYEKDLTVLPDWRITCFFTGKGLRKRGVAHAALEGALTQISRNGGGTVEGYPEETHGRT
FT                   LSGSFLHTGPMAVFENHGFTRTRPISPHRWVVTLTVDPA"
FT   CDS_pept        complement(270571..271128)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2491"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2491"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67464"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEK5"
FT                   /protein_id="CBG67464.1"
FT                   /translation="MMPDSRLQPHASFSVTVEGQQVLIPGRLYNDEPPTDAVASLSSRQ
FT                   QQILHCLYSRHCDGMVRQRHLEKVVGSTDPWIVPFVVQLVGEYVLEILVVICDELRDLA
FT                   TSGTCGHLAYGQFLVDNPAFFARTQRRVVSYWSCYYRGTYASFPGYPGCTILDLLRSAA
FT                   SDKAGHPWPNLAPAGARVDGYC"
FT   CDS_pept        271505..271903
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2511"
FT                   /product="putative secreted protein"
FT                   /note="no db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2511"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67465"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEK6"
FT                   /protein_id="CBG67465.1"
FT                   /translation="MRTLRRASMVAGIVAMSTIGLATQAQASSNSGWVYTSNRSGAVYF
FT                   DADLNGYPGYEKITVCDNTTDNRGTEAVVQGYDGDGAVAYVVTDPSNNGECASAIGNFF
FT                   LEETAVKVTVYEYWGSNTAHPGYGSGVA"
FT   misc_feature    271529..271585
FT                   /locus_tag="SCAB_2511"
FT                   /note="Signal peptide predicted for SCAB2511 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.959) with cleavage site
FT                   probability 0.809 between residues 19 and 20"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(272125..272241)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2521"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67466"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEK7"
FT                   /protein_id="CBG67466.1"
FT                   /translation="MLSVYWANVEPRADGEAPLRRRPALVFVIVLTSVVVHR"
FT   CDS_pept        complement(272287..272937)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2531"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67467"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEK8"
FT                   /protein_id="CBG67467.1"
FT                   /translation="MPAERRLLDDDARPTGWRIVSGLTLGDCVAGFFALLTRTRAAQPA
FT                   PPGPAGTRPASPPRSPHAHRAADPSRTSDRSAHSLRSWRDAAAAPTAASRLVCRRSAQF
FT                   ISTAAARFRGISDTIGRMGLRSGSERDADGHVLYPNMGTRLPDLLVDMENDWGNLSQRF
FT                   NRMLANRVQRDSRQNVLSGAYRRLHGTFVRERLFTMEQSSRVLNAVKGYPGSP"
FT   CDS_pept        complement(273125..273376)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2541"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2541"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67468"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEK9"
FT                   /protein_id="CBG67468.1"
FT                   /translation="MQLVREGDCDVLSLGLLEIARALICAAPHSYVRAFGAAIGEFIDY
FT                   RPEERSAALAQVGASLDSIVAKQDLRPGDGLLAPLARP"
FT   CDS_pept        complement(273661..274917)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2561"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2561"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67469"
FT                   /db_xref="GOA:C9ZEL0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEL0"
FT                   /inference="protein motif:GO:0005886"
FT                   /protein_id="CBG67469.1"
FT                   /translation="MTSTAPRSTTAPTPDLAQVQPRILRVLFASQVLSGAGLAAGVTVG
FT                   ALLAQDMLGSTSLAGLPSALFTTGSALAAVAVGRISQARGRRPGLATGYLTGAIGSAGV
FT                   IIAAVLDNPVLLFITLFVYGAGTATNLQARYAGADLAAPGHRARAVSTVLVATTLGGVA
FT                   GPNLAAPTGTFAEQFGIPALAGPFILGGAAYALAALVLALWLRPDPLLLARAVAQAQEA
FT                   DATTAPTDADTTEGREGVVLGALVMILTQLVMVAIMTMTPVHMHDHGHGTGASGLVIAL
FT                   HIGAMYLPSPVTGWLVDRYGHMKIAAASGIILLAAGILAAAAPGDSVALLALALALLGL
FT                   GWNFGLVSGTAIITDTVPLATRAKTQGLVDVSIAIAGATGGMSSGIVVAAFSYPALALT
FT                   GGILSLALLPAVAATAYRR"
FT   misc_feature    complement(join(273670..273738,273748..273816,
FT                   273877..273936,273946..274005,274024..274092,
FT                   274135..274203,274303..274371,274414..274473,
FT                   274510..274578,274588..274656,274675..274743,
FT                   274771..274839))
FT                   /locus_tag="SCAB_2561"
FT                   /note="12 probable transmembrane helices predicted for
FT                   SCAB2561 by TMHMM2.0 at aa 27-49, 59-81, 88-110, 114-136,
FT                   149-168, 183-205, 239-261, 276-298, 305-324, 328-347,
FT                   368-390 and 394-416"
FT   misc_feature    complement(273751..274839)
FT                   /locus_tag="SCAB_2561"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 1.8e-27"
FT                   /inference="protein motif:PFAM:PF07690"
FT   CDS_pept        complement(275029..276162)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2571"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67470"
FT                   /db_xref="GOA:C9ZEL1"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEL1"
FT                   /protein_id="CBG67470.1"
FT                   /translation="MSRQDSHDIIVIGAGGGAGASGLAAAAALRAAGRDVVALKARNRI
FT                   GARLLSAPAERPGRALDLGDTWFWDGEERVRTLAARSGLETFDQHLAGDTMFEETTGTR
FT                   RLTGNLIEAPSRRFTAGTQGVAGALAAALPPGSLRLDTPVTAIHPNGQDGLDVLAPAGT
FT                   LHAEHVVLAVPPALALERIDFGDTLPADLVGLARATPVWMGAVAKVVADYPTAFWREGG
FT                   LAGAALSRTGPLQEVHDMSGPGGEPAALFGVAHARTVRPASSRPSPPSSPGSSARPPDA
FT                   PWPCTSRTGRQSIGPPRPPCSTSPTTRSSVPPLPATTSRWAAAQGVDRDGDRVRRAHRR
FT                   RPGRRRAGSANRPGNFWRARCPSRLVPVNPSGFGPVP"
FT   misc_feature    complement(276043..276129)
FT                   /note="PS00107 Protein kinases ATP-binding region
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00107"
FT   misc_feature    complement(276070..276138)
FT                   /locus_tag="SCAB_2571"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB2571 by TMHMM2.0 at aa 9-31"
FT   misc_feature    complement(276073..276162)
FT                   /locus_tag="SCAB_2571"
FT                   /note="Signal peptide predicted for SCAB2571 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.970) with cleavage site
FT                   probability 0.338 between residues 30 and 31"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(276655..278352)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2591"
FT                   /product="hypothetical protein (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2591"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67471"
FT                   /db_xref="GOA:C9ZEL2"
FT                   /db_xref="InterPro:IPR000413"
FT                   /db_xref="InterPro:IPR013517"
FT                   /db_xref="InterPro:IPR013519"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEL2"
FT                   /protein_id="CBG67471.1"
FT                   /translation="MRRWCPTGLPDVLVPPPAPPATSATTPSTLDQHSLNLFVTDAMGH
FT                   DVNASLMATSWSTPSLFAIEFLRCTTFTRRGPSPVTSHTFRSGGTVPRRTLTVAIAVTA
FT                   LATPLAFFATSGTASAVPVPPRTPMTDFNHDGHADLAVAAPFGTVGGVEKAGYVSVVYG
FT                   TASGPGTAGHQMISRATPGVPGDLQDTFAFGAQTLPGDLDGDSYTDLLVVGGGDSGEPT
FT                   VLWGSKDGLTGQNTVLPYRYSEFALGDFNGDGKRDLVVNSVPNDDPDVSGMTIQYGPFT
FT                   RDGKTRTQDSITTDDGSSGLRSFITGDLTGDGVDDIVTTHGFEEMQHEARFWKGSRTGV
FT                   GHTAKALGTAYSGTVGDVDGDGYGDLITRDIGSVSEVIDDAPGSITIQYGGSTGPSSTR
FT                   KKVITQATAGVPGASEAHDAFGASLSAGDVNGDGRAEVAVGVPGESLGAATGTGAVILL
FT                   KGASKSAGGMTGKGALAYNQSTAGVPGVSESGDDFGRQVSLSDLNKDGKADLTATAPGE
FT                   DGAFADSGALWNLYGSASGLTTTGAGTLSPVKLGAPEKDAQFGHTLGG"
FT   misc_feature    complement(276769..276876)
FT                   /locus_tag="SCAB_2591"
FT                   /note="HMMPfam hit to PF01839, FG-GAP repeat, score
FT                   0.00012"
FT                   /inference="protein motif:PFAM:PF01839"
FT   misc_feature    complement(276979..277095)
FT                   /locus_tag="SCAB_2591"
FT                   /note="HMMPfam hit to PF01839, FG-GAP repeat, score
FT                   3.9e-08"
FT                   /inference="protein motif:PFAM:PF01839"
FT   misc_feature    complement(277678..277776)
FT                   /locus_tag="SCAB_2591"
FT                   /note="HMMPfam hit to PF01839, FG-GAP repeat, score
FT                   0.00013"
FT                   /inference="protein motif:PFAM:PF01839"
FT   misc_feature    complement(277870..277989)
FT                   /locus_tag="SCAB_2591"
FT                   /note="HMMPfam hit to PF01839, FG-GAP repeat, score
FT                   0.00061"
FT                   /inference="protein motif:PFAM:PF01839"
FT   misc_feature    complement(278284..278352)
FT                   /locus_tag="SCAB_2591"
FT                   /note="Signal peptide predicted for SCAB2591 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.949) with cleavage site
FT                   probability 0.706 between residues 23 and 24"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(278388..279149)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2601"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2601"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67472"
FT                   /db_xref="GOA:C9ZEL3"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEL3"
FT                   /protein_id="CBG67472.1"
FT                   /translation="MAEVVEAGLWGLVAGSALLLGAALGYGLRVPQKVIATVMAFGAGV
FT                   LISAVSFELVGEAYEQAGLAPATVGTLIGALAYTGGNVWLARRGARHRKRSGHERTKAQ
FT                   PSEAEQGGSGMALALGALLDGVPESAVIGVSLLDGGAVSLVTVAAVFISNVPEGLSSAA
FT                   GMKKAGRGRGYVFGVWTAIAAAGTVAAVLGYTVVGSFSPAVIAAVTAVAAGAILAMIAD
FT                   TMIPEAFEDAHLAIGLITVSGFLVSFALSHT"
FT   misc_feature    complement(278397..279131)
FT                   /locus_tag="SCAB_2601"
FT                   /note="HMMPfam hit to PF02535, ZIP Zinc transporter, score
FT                   8.9e-06"
FT                   /inference="protein motif:PFAM:PF02535"
FT   misc_feature    complement(join(278397..278450,278487..278546,
FT                   278559..278627,278895..278954,278982..279050,
FT                   279069..279137))
FT                   /locus_tag="SCAB_2601"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SCAB2601 by TMHMM2.0 at aa 5-27, 34-56, 66-85, 175-197,
FT                   202-221 and 234-251"
FT   CDS_pept        complement(279284..279820)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2622"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2622"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67473"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEL4"
FT                   /protein_id="CBG67473.1"
FT                   /translation="MRTLFGDHSGRRLLEGQHMVAGVPQQGQQGAHRRLVDVVDDQYGA
FT                   VRARWRHVIGSDQTEFTSHRDRVEPGGDAELAGFESLPRQHHGSRGLGIRHAEARAHGE
FT                   HGPAEAVSAGHDGVRGAAHLADVQPRALLIPLAALTVWAEGHLPAKASERTRSPQRDRA
FT                   GSGPRWPERARDGQG"
FT   CDS_pept        complement(279820..280971)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2631"
FT                   /product="putative oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2631"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67474"
FT                   /db_xref="GOA:C9ZEL5"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEL5"
FT                   /protein_id="CBG67474.1"
FT                   /translation="MSWRRDDMNTTTLPDRTEVAIVGAGPTGLALAVTLASAGIDFVVL
FT                   DRLPEGANTSRAAVVHARTLEVLDELGASDELIARGVQVTRFAVRDGARRLLTVPFDQL
FT                   ATPHPYTLMVPQYETENVLLDRLRALGGDVHRPYEVASVVQDEDGVTLTMTSGRTLRAA
FT                   YAVGADGMHSTVREAAGIGFTGSAYAESFVLADVVMDWAPGPAEVSLTFGTTGLAVVAP
FT                   LPGGHYRVVATVDDAPATPDLGFVQHMLDERAPGQARVTDLAWSSRFRVHHRVAEHYRA
FT                   GRLLLAGDAAHVHSPAGGQGMNTGIQDGHALGRAFADGQLDGYEAQRRPVARRVVAFTH
FT                   RMTRLATTRNPMARGARNTVLPLLGRTSLPKKLATELAELNYR"
FT   misc_feature    complement(279955..280926)
FT                   /locus_tag="SCAB_2631"
FT                   /note="HMMPfam hit to PF01494, FAD binding domain, score
FT                   2.9e-76"
FT                   /inference="protein motif:PFAM:PF01494"
FT   misc_feature    complement(280843..280911)
FT                   /locus_tag="SCAB_2631"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB2631 by TMHMM2.0 at aa 21-43"
FT   CDS_pept        281071..281661
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2641"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2641"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67475"
FT                   /db_xref="GOA:C9ZEL6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041678"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEL6"
FT                   /protein_id="CBG67475.1"
FT                   /translation="MTQAAKITGTDRRSDRTKAAILRAARERFAAQGYERTTIRAVASD
FT                   AGIDPSMVMRYFGNKAQLFDATLAIDLRLPDLTGVPAARLAQALVRHFIERWEGDPADD
FT                   ALLVLMRSAVTNEQAAARMHEIFAAQVAPTLAAALGPEFAARRAGLVSAQLLGLGLTRY
FT                   LLRLPAVTALTPDEIERGLAPAIQAVLDPDQGR"
FT   misc_feature    281131..281271
FT                   /locus_tag="SCAB_2641"
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 1.2e-14"
FT                   /inference="protein motif:PFAM:PF00440"
FT   CDS_pept        complement(281649..281921)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2651"
FT                   /product="hypothetical protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2651"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67476"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEL7"
FT                   /protein_id="CBG67476.1"
FT                   /translation="MCTLADDHVMTLVVEASNPVTVRQMAVAVGLTAGIADLSATATSS
FT                   CPAVLTGDRSQGGMPESAAGVRRPAFPCVGLGPAVVCDDCGGQRP"
FT   CDS_pept        complement(282034..282915)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2661"
FT                   /product="putative hydrolase"
FT                   /note="PMID:11036020"
FT                   /note="PMID:16632249"
FT                   /note="PMID:12480894"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2661"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67477"
FT                   /db_xref="GOA:C9ZEL8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEL8"
FT                   /protein_id="CBG67477.1"
FT                   /translation="METHTLETAGADLVHDVRGPLPTTDGRPPLFMIGQPMDATGFAAL
FT                   AARLPERTVVTYDPRGLGRSTRKDGRVDHTPQTQADDVHAVIEALGAGPVEMFASSGGA
FT                   VTALAVVAKYPADITTLVAHEPPLITLPPDGPAAVRAWAGVREAYEKRGWGAGMAAFVA
FT                   MTSWKGEFTDAYFARPEADPAEFGMPTVDDGSRDDPLLSDRSWAVSSYRPDADAIAAAP
FT                   TRVVIAVGEESKDVLTGRTSVAAAELLGQQVSVFPSHHGGFLDGQFGYAGKPDEFAHRL
FT                   RQVLDGAAQTNR"
FT   misc_feature    complement(282067..282762)
FT                   /locus_tag="SCAB_2661"
FT                   /note="HMMPfam hit to PF00561, alpha/beta hydrolase fold,
FT                   score 4.9e-05"
FT                   /inference="protein motif:PFAM:PF00561"
FT   CDS_pept        complement(283042..283905)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2671"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2671"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67478"
FT                   /db_xref="GOA:C9ZEL9"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEL9"
FT                   /protein_id="CBG67478.1"
FT                   /translation="MLRVVGRFQRIAGFDRSMALASGALTALIPLAVLSGAVFGGESAD
FT                   RIINRYGLTGEGAEAVRAVFSAEAASAGVGVFGTVFLAISVLSFSRTMQRLFEQTWELK
FT                   PLGVRNTRNGLWWICVLSFYTAVIGWLYVALGGGRLGLAAAVCEVPVTTVFLTFSGRIL
FT                   SAKRLAGAALLPFAVCAAVLTAAYSVLATVYLPRLFNSYVSRYGAAGAAFGMASVLFGA
FT                   MLVLVLSSALGREVREELLRIRQGLRPSQDEVRRQWDGIVEQTRSRWRTARGQPPRSRP
FT                   EDDHPR"
FT   misc_feature    complement(join(283222..283290,283333..283401,
FT                   283420..283488,283498..283566,283639..283707,
FT                   283783..283851))
FT                   /locus_tag="SCAB_2671"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SCAB2671 by TMHMM2.0 at aa 19-41, 67-89, 114-136, 140-162,
FT                   169-191 and 206-228"
FT   misc_feature    complement(283786..283905)
FT                   /locus_tag="SCAB_2671"
FT                   /note="Signal peptide predicted for SCAB2671 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.733 between residues 40 and 41"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(284208..284852)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2681"
FT                   /product="putative repressor"
FT                   /note="PMID:12937892"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2681"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67479"
FT                   /db_xref="GOA:C9ZEM0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041583"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEM0"
FT                   /protein_id="CBG67479.1"
FT                   /translation="MSRPGGSAQQRDTPVLTERGGVRKAAILDAALRVIGDKGLAGLSM
FT                   RAIATEAGLPLGALGYYFKTKDDLILAAFELHTRREADRVLAAFAGVVDGDHADDIAEH
FT                   LTAFIQHGLTEARTRLVAEYEFLIEATRRPDLARVSRAWRQALQIQVGHVATRLGSDDP
FT                   ETDAEIILSVVAGLEIDHLSAPLDPSTTQAIRTALRRTITRLGLHGHAARP"
FT   misc_feature    complement(284634..284774)
FT                   /locus_tag="SCAB_2681"
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 5.3e-16"
FT                   /inference="protein motif:PFAM:PF00440"
FT   CDS_pept        285135..285947
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2691"
FT                   /product="putative 3-oxoacyl-[acyl-carrier protein]
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2691"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67480"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEM1"
FT                   /protein_id="CBG67480.1"
FT                   /translation="MNPTNADGRPVAIITGVGSASGIGFACAERLADDFSLMITSTTAR
FT                   IHSRVAELAGSCPVRGVAGDLTDARFAESVVAEALDVFGRIDVLVNNAGMVSVADPEDP
FT                   SSIATASDEQWRSALARNLDTTFHMTRAALRPMLERGYGRVVNMSSLSGPVMAYKGDVA
FT                   YHTAKAGLIGLTRSTAMDTAPRGVTVNAVAPGWIATGGLDEHVDALGAATPVGRAGRPE
FT                   EVAALVAFLASPESSYVTGQLFVVDGGNSIQEERGLGPTGAPASLFTH"
FT   misc_feature    285162..285683
FT                   /locus_tag="SCAB_2691"
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase,
FT                   score 2.6e-15"
FT                   /inference="protein motif:PFAM:PF00106"
FT   misc_feature    285183..285215
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        286007..287440
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2701"
FT                   /product="putative amidase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2701"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67481"
FT                   /db_xref="GOA:C9ZEM2"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEM2"
FT                   /protein_id="CBG67481.1"
FT                   /translation="MDLNYLSAEEMLGAFRRRELSPVEVLDSLIERVSKTGEVNAVAEE
FT                   MFDEAHEVARAAEARYAGKGPAPRALEGVPVAVKEEMPIAGRSHRLGSLLTEGTVATRT
FT                   QPMVQRLIDAGAVLHLRTTTPEFSIAVTTHSELWGVTRNPWNLDYSPGGSSGGSGAALA
FT                   AGLAPLATGSDIAGSIRVPSALCGVVGFRPPYGRVPSLPPLSFDTYCQDGPMARTVTDC
FT                   ALFQNVIAGPDLVDHVSVPAAPPLPTTFGSCAGLKVALAVTIGDFPVVPEAAANIERFA
FT                   NALRDAGAEVTPVEIPITRQSIMATAFAHYGLLLGPSVRECAPADDPRWSRNVLDVVEA
FT                   SEAALKKLGALRTFEEEGRMHAVLAGIYRDHDALICPTLATTGYPADATSAESVELAEG
FT                   VRFANLVSQCLTQLFNIASRHPVLNVPSGRAGNGVPTGVQIVARPFDDLTAFRLGAAAE
FT                   ARLGLWSDPDWRPRMAHRG"
FT   misc_feature    286076..287359
FT                   /locus_tag="SCAB_2701"
FT                   /note="HMMPfam hit to PF01425, Amidase, score 1.3e-71"
FT                   /inference="protein motif:PFAM:PF01425"
FT   misc_feature    286460..286555
FT                   /note="PS00571 Amidases signature."
FT                   /inference="protein motif:Prosite:PS00571"
FT   misc_feature    286733..286765
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        287433..290507
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2711"
FT                   /product="putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2711"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67482"
FT                   /db_xref="GOA:C9ZEM3"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEM3"
FT                   /protein_id="CBG67482.1"
FT                   /translation="MAETQRSSTDEATADVSVHAAPGAGTGTGTGTGTMLSEQDAARLL
FT                   REEWGIDGRLTDLGSTQDQIMLVEDAGNGRRHVLKVTLADGGAEAAHAEHLAIRHFRSR
FT                   DPGLVVPTAVPTLRDHDLVDLDGLRIQLLDWVPGTPLGSVAHLSPRALRCLGRLAARSV
FT                   SALAGFDHPGLHRRSSWDPRHAVQTVSGLTGHFTDAENALFERALAPVAELIAADTAGD
FT                   AAGRLPVQAVHTDIHEHNVVGDVDADGEFAPTGIIDFGDLVWTWRAAEIATPMLAAVAR
FT                   APEDPLGAVLPVLAGYLDRLSLSEAEADALWTLVRARAVLCAALQTLASQQDPDDEGAA
FT                   EVAAEDWRALRAVLETDPALATAVVRRACGFDAPETDLAELVARHSPSPVLLGQESGPL
FT                   RPVDLSVESELFSAGDWPDGGAFPPLGSDAETAVGRFDEVRLGRPDLTDRAPAALHLGA
FT                   DLFVPVGTEVFAPFDATVVRAEARAVVLQSRVDTTTFFVRLAGVAAHVPVGHTVRRGAE
FT                   VAVVAPSTGPLPAHVHVQLGLSPDLPGHGRVRDRAALLTLCADPSPLVGTPVRAEQGTT
FT                   VERVQERRAKYVAGAQSTYFDHPVQMVRGRRHWLYDSAGRRYLDMINNVAVVGHSHPAL
FT                   TKAAARQMALLNTNSRFLYDAMGEYAERLAATLPEELHTFFFVNSGSEAVDLAVQLARI
FT                   HTGRRSVVAVEGSYHGWTSDVFALDTLPHDRPRWREELDGHVHVTETPDPYRGRHGARA
FT                   EPYVESVRRACAEAGPGGGVAAFVSEPLLGSQGGIVPPPGYLAGAYAAVREAGGVCIAD
FT                   EIQVGMGRTGPAFWAFEGQGATPDIVAAAKATGNGHPLGVVACRAEIAAEFGRRAGFFS
FT                   STGGGPVSCRIGTAVLDVLRDERLPENARTVGAYLGGELNTLAARFPEIGAVYGEGLYR
FT                   GVDIVVPGGDKEPAPAAATQICERMLELGVVIQPTGVELNVLKIKPPLCFDTPAADYFL
FT                   ARFTQVLDERARSRAASARSVHRHPTTVQGGQGKE"
FT   misc_feature    287586..288365
FT                   /locus_tag="SCAB_2711"
FT                   /note="HMMPfam hit to PF01636, Phosphotransferase enzyme
FT                   family, score 1.8e-06"
FT                   /inference="protein motif:PFAM:PF01636"
FT   misc_feature    288789..289085
FT                   /locus_tag="SCAB_2711"
FT                   /note="HMMPfam hit to PF01551, Peptidase family M23, score
FT                   1.2e-05"
FT                   /inference="protein motif:PFAM:PF01551"
FT   misc_feature    289233..290240
FT                   /locus_tag="SCAB_2711"
FT                   /note="HMMPfam hit to PF00202, Aminotransferase class-III,
FT                   score 1.2e-47"
FT                   /inference="protein motif:PFAM:PF00202"
FT   misc_feature    289857..289973
FT                   /note="PS00600 Aminotransferases class-III
FT                   pyridoxal-phosphate attachment site."
FT                   /inference="protein motif:Prosite:PS00600"
FT   misc_feature    289965..289997
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        290514..291950
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2721"
FT                   /product="putative transport-related, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2721"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67483"
FT                   /db_xref="GOA:C9ZEM4"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEM4"
FT                   /protein_id="CBG67483.1"
FT                   /translation="MTGTPASEAGIEPHHVDPVPESHRRGRPRDLFHVWFASNLNVGNA
FT                   IFGAIIYSVCRSIPLALLAAVIGNVVGTVLMALHSIQGARLGIPQLIQSRGQFGYLGAL
FT                   VPVVVGSVMYVGFTVSVSLAGGIALKVATDGRIPLPLATSLVAALSVVPALMGNRAIHV
FT                   VARCATWPLTVSLIVVSAYTLVRGDGVAVTSGPVSLTSFLAGTGVAVTFALTYATAVSD
FT                   YSRYLPSDASGRAVFWWTAAGVFLSSTFCCVIGVLLAARFAAADVFQSASAALGGGALA
FT                   TVVLVVTALGLAVTNMLNLYGGMLNLITGLSTFVKIPNSFRTRAAMMLPTLVIGVGLAV
FT                   TASQDFTGNLTAFLSFLLLLLIPWGAVNLVDFYLVQHGEYDVPGMYTRSGKYWSDRATW
FT                   THYGVNLKVLIAFLAGVVSGIPAMSNAWYVGPVARRFADADLSWIPGMVVTSVVYLALV
FT                   RAGRGEPPTAVARPHGASPL"
FT   misc_feature    290565..291851
FT                   /locus_tag="SCAB_2721"
FT                   /note="HMMPfam hit to PF02133, Permease for
FT                   cytosine/purines, uracil,, score 2.4e-24"
FT                   /inference="protein motif:PFAM:PF02133"
FT   misc_feature    join(290604..290672,290691..290759,290817..290885,
FT                   290922..290981,290991..291059,291096..291164,
FT                   291222..291290,291327..291395,291474..291533,
FT                   291570..291638,291735..291803)
FT                   /locus_tag="SCAB_2721"
FT                   /note="11 probable transmembrane helices predicted for
FT                   SCAB2721 by TMHMM2.0 at aa 31-53, 60-82, 102-124, 137-156,
FT                   160-182, 195-217, 237-259, 272-294, 321-340, 353-375 and
FT                   408-430"
FT   CDS_pept        complement(292021..293271)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2731"
FT                   /product="putative two-component sensor kinase"
FT                   /note="cluster 0591 with SCAB28431"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2731"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67484"
FT                   /db_xref="GOA:C9ZEM5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEM5"
FT                   /protein_id="CBG67484.1"
FT                   /translation="MNRLSVRLRVTLAATVIVATVLTAASLVLILTLRDSLEGGVADEA
FT                   TRKVRADAAALKEDPILTAPPGEDGGASSTPPKSGHGAGTGGEKVVMAGGYATASKVVD
FT                   TVDGPVTVKARVSLAPVRNALDTLEQLLLVGVPALVVLMAVMTWQLMGRVLAPVESIRA
FT                   TFADITAKNLHRRVPEPVTRDEVARLARTMNVTLGQLESAVDRHKQFVADAAHELRNPV
FT                   ATLSARLELGMTQAPDLVTEALTDVARIKELTGDLLLLARLDGGEPLMGADVDLAQVAA
FT                   EAAARPAPVKIVLELESDVIVTGTRSHLERMVANLVANAVRHAASRITIKVTADGLDVI
FT                   DDGPGIPAASRERVFQRFHRLDEARARDAGGSGLGLAIARDIATAHGGTLTVQDTPHGA
FT                   HLSFRITGAGRTEHVHP"
FT   misc_feature    complement(292048..292362)
FT                   /locus_tag="SCAB_2731"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 9.4e-32"
FT                   /inference="protein motif:PFAM:PF02518"
FT   misc_feature    complement(292474..292656)
FT                   /locus_tag="SCAB_2731"
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain, score 2.7e-12"
FT                   /inference="protein motif:PFAM:PF00512"
FT   misc_feature    complement(292666..292875)
FT                   /locus_tag="SCAB_2731"
FT                   /note="HMMPfam hit to PF00672, HAMP domain, score 9.4e-11"
FT                   /inference="protein motif:PFAM:PF00672"
FT   misc_feature    complement(join(292828..292881,293176..293244))
FT                   /locus_tag="SCAB_2731"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SCAB2731 by TMHMM2.0 at aa 10-32 and 131-148"
FT   misc_feature    complement(293146..293271)
FT                   /locus_tag="SCAB_2731"
FT                   /note="Signal peptide predicted for SCAB2731 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.265 between residues 42 and 43"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(293268..293957)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2741"
FT                   /product="putative two-component system response regulator"
FT                   /note="cluster 0594 with SCAB28441"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2741"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67485"
FT                   /db_xref="GOA:C9ZEM6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEM6"
FT                   /protein_id="CBG67485.1"
FT                   /translation="MAETERMRLLLVEDELRLADVIKSGLVDKGFAVDVVGDGSEAVWM
FT                   AGEHRYDAIVLDVMLPGLNGFAVCRKLRESGNWTPIMMLTAMDGELDEVQSLDSGADDY
FT                   LAKPFSFAVLLARLRALVRRGAQERPAVIEVGDLQVDPAAACARRGGVHIALTPKEFAV
FT                   LHLLARRAGQVVTKTELLQHAWDFAFEGDPNIVEVYVSALRRKIDAPFAVRTLTTVRGS
FT                   GYLLERP"
FT   misc_feature    complement(293280..293507)
FT                   /locus_tag="SCAB_2741"
FT                   /note="HMMPfam hit to PF00486, Transcriptional regulatory
FT                   protein, C te, score 1.8e-23"
FT                   /inference="protein motif:PFAM:PF00486"
FT   misc_feature    complement(293601..293939)
FT                   /locus_tag="SCAB_2741"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 5.9e-32"
FT                   /inference="protein motif:PFAM:PF00072"
FT   CDS_pept        294086..294955
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2751"
FT                   /product="hypothetical protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2751"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67486"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEM7"
FT                   /protein_id="CBG67486.1"
FT                   /translation="MLATLVLAGCGTSQAAMAPGRNSSTPKALPDICAASTQRNGIVHC
FT                   TKPFPGTKPIRLPADPSGTQRYGALKRHGTKFHTRGGDLPLAAAVARQLTADVEDGRTA
FT                   YANTIYLATISKGTVTTIKPVADIDENAVLQAAFAGRAMEGTIGVRTRQGDYASDATLP
FT                   VRIELAKSPVHGELTGRITNATKAVRSAKGSCLAPLNRTEANPLVGGFTARITLERYPS
FT                   MHVAYDDELVLRWKSGASNMGHAYYPSIATLLGGDPLGRTWQAGLHGTPTAGPGLDLRL
FT                   VSGGGGTC"
FT   CDS_pept        294942..295652
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2761"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2761"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67487"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEM8"
FT                   /protein_id="CBG67487.1"
FT                   /translation="MEPADDMTGQSPRPYGTPTAPRVAVRGEAHLEVDPDLARIGITVA
FT                   ARGTDRGGTLSDLTRRNTAALDLVRSYGDVVERLETGTLAITPQLTERGRREHVRAYHG
FT                   HVRTTAELTDFTALGELTTRLAELDLTGVDGPWWTLRPDSPVHRAAHRTAVHDAVRCAR
FT                   AYAEALDATLVALLELSDSGLNAPVPADHGLHGAVSTEGFDGAEPPDALHLQPERQIVT
FT                   AHVEAHFVMTPPRL"
FT   misc_feature    294996..295637
FT                   /locus_tag="SCAB_2761"
FT                   /note="HMMPfam hit to PF04402, Protein of unknown function
FT                   (DUF541), score 4.5e-05"
FT                   /inference="protein motif:PFAM:PF04402"
FT   CDS_pept        295755..296066
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2771"
FT                   /product="hypothetical protein"
FT                   /note="no db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2771"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67488"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEM9"
FT                   /protein_id="CBG67488.1"
FT                   /translation="MRPVGGLVQPLGGGGPDGCRMGAGRTGSQAGGMTHRARRKEPDTP
FT                   LPPPADEPGHDVVPRGGDFLEFLGLVLGAGALVLLVVRPEIPEALVRALSSGTAGLVR"
FT   CDS_pept        296140..297927
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2781"
FT                   /product="putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2781"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67489"
FT                   /db_xref="GOA:C9ZEN0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEN0"
FT                   /protein_id="CBG67489.1"
FT                   /translation="MNTASAPTTDETSLSARETVRALYTYVRPHRWAVALGLLCALVGA
FT                   AGGLLQPLATKALVDRLASGGTITGILIALTVLVVLGTAVEAFGAYVLERTAESVVLAA
FT                   RRTVVGRLLRLRIAEWERIPPGDLMSRVTSDTTLLRAVSTQAVVSAATGAVAFVAAVVM
FT                   MAFLDVVLLGVTLGVVVLVGGATLLVMPRIARATERSQEAVGEISVALERAFGAFRTVK
FT                   ASGAEARETARVDAAARRAWRHGVKSAKWEAVAGSADELAVQLAFLAVLGVGGARVASG
FT                   EIPVSTLIAFLLYLFYLIEPVSRLVEAVSSYQEGAAAISRITQVDHLATEPADRAPVSL
FT                   PEQGAAASGPASVRFEDVSFRYRSGLPHVHQQVSFEVPGSGTTAFVGPSGAGKSTVFAL
FT                   IERFHEATGGRVLVDGKDVRDWSLAELRSAIGYVEQDAPVLAGTLRENLVFAAPGATDD
FT                   DIREVLDRTRLDALVERLPHGLDTPVGHRGSKLSGGERQRVAIARALLRRPRLLLLDEA
FT                   TSQLDAVNELALRDVITEVARETTVLVVAHRLSTVTGADRIVVMDAGRVRAVGTHEELV
FT                   TEDPLYAQLAATQLLAPAR"
FT   misc_feature    join(296236..296304,296347..296415,296575..296634,
FT                   296644..296712,296971..297039)
FT                   /locus_tag="SCAB_2781"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SCAB2781 by TMHMM2.0 at aa 33-55, 70-92, 146-165, 169-191
FT                   and 278-300"
FT   misc_feature    296239..297045
FT                   /locus_tag="SCAB_2781"
FT                   /note="HMMPfam hit to PF00664, ABC transporter
FT                   transmembrane region, score 1.8e-32"
FT                   /inference="protein motif:PFAM:PF00664"
FT   misc_feature    297277..297831
FT                   /locus_tag="SCAB_2781"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   2.1e-64"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    297298..297321
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    297610..297654
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        complement(298066..299160)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2791"
FT                   /product="putative two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2791"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67490"
FT                   /db_xref="GOA:C9ZEN1"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEN1"
FT                   /inference="protein motif:GO:0000155"
FT                   /protein_id="CBG67490.1"
FT                   /translation="MWQRVPAPVVDIVLVVAAAVDVRVVSMWGETRLEMVLAAVGCVAL
FT                   AFRRRFPLGVFLLTLPIALMQEIAVAVLAALFTLAERSRNRRLLAVCVVLAAVASSAPW
FT                   PLAAADRTMTLVFFVYCLATSVAPVLFGQLLQAQRDLARRLVEVEEAREHERTLHAQAV
FT                   LARERAQLAREMHDVVSHQVSLIAVRAGALQVATKDEDAKEAARTIRSLSVTTLDELRT
FT                   MVTLLRASGGRTTELTPQPTLADLRKLVASSGTHTELTGELPPTVGTPAQRALYRTVQE
FT                   ALTNVRKHAPGADARVELWQDGDGIGVTVTNSPPTRPSLSLPGSQQGLVGLRERADILH
FT                   GTLDAGPTAQGGYRVRLRVPLNTD"
FT   misc_feature    complement(298075..298353)
FT                   /locus_tag="SCAB_2791"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 2.2e-09"
FT                   /inference="protein motif:PFAM:PF02518"
FT   misc_feature    complement(298465..298662)
FT                   /locus_tag="SCAB_2791"
FT                   /note="HMMPfam hit to PF07730, Histidine kinase, score
FT                   6.7e-17"
FT                   /inference="protein motif:PFAM:PF07730"
FT   misc_feature    complement(298483..298521)
FT                   /note="PS00068 Malate dehydrogenase active site signature."
FT                   /inference="protein motif:Prosite:PS00068"
FT   misc_feature    complement(join(298756..298824,298837..298896,
FT                   298930..298998))
FT                   /locus_tag="SCAB_2791"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SCAB2791 by TMHMM2.0 at aa 55-77, 89-108 and 113-135"
FT   CDS_pept        complement(299175..299834)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2801"
FT                   /product="putative two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2801"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67491"
FT                   /db_xref="GOA:C9ZEN2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEN2"
FT                   /protein_id="CBG67491.1"
FT                   /translation="MVVDDEALVRSGFELILGASEDIEVVATAGGGHAVETVRRERPDV
FT                   VLLDIRMPDVDGLTVLRELRTMPDPPVVAMLTTFDADEYILTALHSGAAGFLLKDTEPE
FT                   QLAHLVRTLVAGGVVLSPKASRTLLHSHSGTGAAVDEEAARVRLLTARERDVLVLVAEG
FT                   LSNADIGARVHLGAGTVKDHVSAILGKLRVASRVQAALLAQRAGLLDEHTRSGAGR"
FT   misc_feature    complement(299226..299399)
FT                   /locus_tag="SCAB_2801"
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR fami, score 7.4e-17"
FT                   /inference="protein motif:PFAM:PF00196"
FT   misc_feature    complement(299256..299402)
FT                   /locus_tag="SCAB_2801"
FT                   /note="HMMPfam hit to PF04545, Sigma-70, region, score
FT                   0.0009"
FT                   /inference="protein motif:PFAM:PF04545"
FT   misc_feature    complement(299262..299420)
FT                   /locus_tag="SCAB_2801"
FT                   /note="HMMPfam hit to PF08281, Sigma-70, region, score
FT                   0.00035"
FT                   /inference="protein motif:PFAM:PF08281"
FT   misc_feature    complement(299265..299348)
FT                   /note="PS00622 Bacterial regulatory proteins, luxR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00622"
FT   misc_feature    complement(299502..299834)
FT                   /locus_tag="SCAB_2801"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 5.1e-30"
FT                   /inference="protein motif:PFAM:PF00072"
FT   CDS_pept        300004..301254
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2811"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2811"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67492"
FT                   /db_xref="GOA:C9ZEN3"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="InterPro:IPR012429"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEN3"
FT                   /protein_id="CBG67492.1"
FT                   /translation="MIGPISSLGLMTPDPDSTLLTSDPASPESGRGEPSTGTPGVGRLI
FT                   GLDLARGLAVFGMYAVHVGPAPSQGGVIGFLMELAQGRSSALFAVLAGFAVALITGRRT
FT                   PRTGPAGRQAVAKVIIRAVILVALGTALTLTGTPVVPILAFYGLFFLLVLPLYRLGAKP
FT                   LALIAVGWALVGPQLLYALKPVFGGRVFLSYGQADGPVSLFFTGGYPALTWVPFVIAGM
FT                   AVARCDLAATAVRIRLALTGAALAVTGYGGSWLAVRLVPGAAEAVRKAEERAGMSSGSS
FT                   VPSVSPDSIGIFGDTPAGMLASAPHSEATLSIVAATGVAILVITACLAAMDAFPRLRRL
FT                   AKPVIAVGSMSLTAYVYHIVAIWLLDTEALAVPPLYVLLGFIASITLLATLWSRFFERG
FT                   PLEWLMGRATGIARRIR"
FT   misc_feature    join(300238..300306,300343..300411,300421..300480,
FT                   300499..300567,300610..300678,300715..300783,
FT                   300928..300996,301030..301098,301126..301194)
FT                   /locus_tag="SCAB_2811"
FT                   /note="9 probable transmembrane helices predicted for
FT                   SCAB2811 by TMHMM2.0 at aa 79-101, 114-136, 140-159,
FT                   166-188, 203-225, 238-260, 309-331, 343-365 and 375-397"
FT   misc_feature    300952..300984
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        301473..302135
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2821"
FT                   /product="putative exported oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2821"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67493"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEN4"
FT                   /protein_id="CBG67493.1"
FT                   /translation="MGSSTGNGYRGPLWSELAADGHPLDFVGSGRNGSMADPGNEGHSG
FT                   YRIDQIAALADASLTRYRPDVVTLHIGTNDLRRASEVDTAVTRLRSLVHRITARVPDAT
FT                   VLVASLIVSTSSTEEQWRGAYHQAVRQVVSDAQGAGKRVAYVDMSGLTTADLADPLHPD
FT                   DSGYQKMADAFHRGVQAAGRAGWLKNPARVPAAWTAMSPVETPSALSGRGSPVWSCC"
FT   misc_feature    301473..301994
FT                   /locus_tag="SCAB_2821"
FT                   /note="HMMPfam hit to PF00657, GDSL-like
FT                   Lipase/Acylhydrolase, score 8.9e-07"
FT                   /inference="protein motif:PFAM:PF00657"
FT   CDS_pept        complement(302098..303369)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2831"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2831"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67494"
FT                   /db_xref="GOA:C9ZEN5"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="InterPro:IPR012429"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEN5"
FT                   /protein_id="CBG67494.1"
FT                   /translation="MTQIKPPPEETAAQEPSPPRPRASSESVGQISGPSLGRLVGVDLA
FT                   RALAVFGMYIVHIAPMTSASGSVGSWVYFLAEGRSSALFATLAGFSLMLIAGRREPKTG
FT                   LAGRRAKARIAIRAVILLALGTVLAMEYGDIIILAYYGVYFLLALLLVRLSARTLALVA
FT                   AGIAIVMPQLAFVLKMWLSDSVQQSINAYDPLERLSTVGVLDLLLTGLYPTITWMTFVV
FT                   AGMALARLDLSAVAVQRRLAALGAGLVVGAYGLSMLLAGTDAVWSLGGGGGPSSGSGPK
FT                   PMGSGSGPGSMGDGSGGPELSASDLLGAVAHTGTTFDTLGCVGAAILVIVGSMAAMDRL
FT                   PRVRCLAQPVIAVGTMSLTAYVGHFLAQSAWPASGAGTTTSWVPVLIYILGAIVFAVIW
FT                   SRFFRRGPLEYLLNSTTKLANRVR"
FT   misc_feature    complement(join(302161..302229,302257..302325,
FT                   302362..302430,302572..302640,302701..302769,
FT                   302827..302895,302914..302967,302977..303030,
FT                   303079..303132,303160..303228))
FT                   /locus_tag="SCAB_2831"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SCAB2831 by TMHMM2.0 at aa 7-29, 39-56, 73-90, 94-111,
FT                   118-140, 160-182, 203-225, 273-295, 308-330 and 340-362"
FT   CDS_pept        complement(303574..304683)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2841"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2841"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67495"
FT                   /db_xref="GOA:C9ZEN6"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEN6"
FT                   /protein_id="CBG67495.1"
FT                   /translation="MDPVVIPLLVAAIVVVFLVASSVRIVPQARRYNVERFGRYRRTLQ
FT                   PGLNMVVPVADRINTKLDVREQVYSSDPRPVITEDNLVVNIDTVLYYQITDPRAAAYEV
FT                   ADYLQAIDQLTVTTLRNVIGSMDLEETLTSREEINSRLRAVLDDATGKWGIRVNRVEIK
FT                   AIDPPATIKEAMEKQMRAERDKRAAILHAEGERQAKILTAEGTKQKDILEAQGAQQAMI
FT                   LRADGEAKAVELVFQAVHRNNADPKVLAYKYLETLPHLANSDNNTFWVIPGELTEAVRT
FT                   VTRAFGDESTTVTPTPGQPERAAPADDHDTPGGIGAPQLEAGSLVALDAAAAADEAGKQ
FT                   AAAAVSDAKAEAEAAKPAQAPRRARTSDE"
FT   misc_feature    complement(304096..304620)
FT                   /locus_tag="SCAB_2841"
FT                   /note="HMMPfam hit to PF01145, SPFH domain / Band, score
FT                   1.3e-78"
FT                   /inference="protein motif:PFAM:PF01145"
FT   misc_feature    complement(304195..304281)
FT                   /note="PS01270 Band 7 protein family signature."
FT                   /inference="protein motif:Prosite:PS01270"
FT   misc_feature    complement(304591..304683)
FT                   /locus_tag="SCAB_2841"
FT                   /note="Signal peptide predicted for SCAB2841 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.775) with cleavage site
FT                   probability 0.273 between residues 31 and 32"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    complement(304606..304674)
FT                   /locus_tag="SCAB_2841"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB2841 by TMHMM2.0 at aa 4-26"
FT   CDS_pept        complement(304713..305372)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2851"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2851"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67496"
FT                   /db_xref="GOA:C9ZEN7"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEN7"
FT                   /protein_id="CBG67496.1"
FT                   /translation="MEERRRARATAGHRLVRGDADARACAALDQAAWAVTFSDQGTPLH
FT                   RAETTVAVSVCPAFRKVAWWRKPLEEGDSMPWLFWLIAAAALGAAEFFTLTLVFGLLAG
FT                   AAVVAAVVAGVGIGLLGQLVALAAASAAGLLIMRPVVLRHMAQQPLVRDGTDALIGRRA
FT                   EVMQEVTATRGLIRLSGEEWSARALDESLVIPVGALVDVMEIEGATAIVYPRELLP"
FT   misc_feature    complement(304725..305138)
FT                   /locus_tag="SCAB_2851"
FT                   /note="HMMPfam hit to PF01957, Nodulation efficiency
FT                   protein D (NfeD), score 3.7e-19"
FT                   /inference="protein motif:PFAM:PF01957"
FT   misc_feature    complement(join(304965..305033,305076..305144))
FT                   /locus_tag="SCAB_2851"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SCAB2851 by TMHMM2.0 at aa 77-99 and 114-136"
FT   CDS_pept        complement(305937..306710)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2861"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2861"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67497"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEN8"
FT                   /protein_id="CBG67497.1"
FT                   /translation="MLGAAMVVLVGCGSQTAETAETEEAATGSGTASVWTLSAPIRIDG
FT                   VRTADGGRSLVVDAEVPDGARDCVRSLRGELDTVEHGTVYVKVTYETRSQDQASGCTDT
FT                   QRVKATVKLSEPLGSRKVMVNSMDVYTPVGATPPALRRCGENGCDPTPPRCTSSSYQQA
FT                   VNDTDIPEHTSWEERGCDGTWLVLDLSTRMGAACGDAGDGCSSSGVSQRWFYRAASSGW
FT                   RPVATSGDAGCAGIHRVQPELPEHLCASLPRLDRD"
FT   misc_feature    complement(306636..306710)
FT                   /locus_tag="SCAB_2861"
FT                   /note="Signal peptide predicted for SCAB2861 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.893) with cleavage site
FT                   probability 0.493 between residues 25 and 26"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    complement(306675..306707)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        307137..307724
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2871"
FT                   /product="putative sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2871"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67498"
FT                   /db_xref="GOA:C9ZEN9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZEN9"
FT                   /protein_id="CBG67498.1"
FT                   /translation="MRRRRTTAGEFGDPAGHRALEALYTAHADRVLAYLLHRTDRETAQ
FT                   DILSETFVLAWRKSGSVPDDALPWLLASARRLLANRVRSDQRHHALTARLAVMADRPET
FT                   SEIADTIGARAEVAAALSALSEQDREVLVLSAWYGLTARQAAVVLGCTAPTFAVRLHRA
FT                   RKRFRAALPPPVHVQQTRGALPQSHLTHRESA"
FT   misc_feature    307203..307400
FT                   /locus_tag="SCAB_2871"
FT                   /note="HMMPfam hit to PF04542, Sigma-70 region, score
FT                   1.2e-07"
FT                   /inference="protein motif:PFAM:PF04542"
FT   misc_feature    307476..307637
FT                   /locus_tag="SCAB_2871"
FT                   /note="HMMPfam hit to PF08281, Sigma-70, region, score
FT                   8e-14"
FT                   /inference="protein motif:PFAM:PF08281"
FT   misc_feature    307494..307643
FT                   /locus_tag="SCAB_2871"
FT                   /note="HMMPfam hit to PF04545, Sigma-70, region, score
FT                   4.1e-06"
FT                   /inference="protein motif:PFAM:PF04545"
FT   CDS_pept        307721..308335
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2881"
FT                   /product="putative membrane protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2881"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67499"
FT                   /db_xref="GOA:C9ZG58"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG58"
FT                   /protein_id="CBG67499.1"
FT                   /translation="MKPTVTQHGRGSDLAAIRALRPSDDDTDGWAASADGRAVLRDILR
FT                   RTEQPHGTAGAGRRRHLFMVGAVTAALLGGATTAAVATLGPWSEGGRDVVCARTLSPEA
FT                   DLSQLPIKDMKDFDPQNAARSCAVAWDRLWNQSAPGTAPKYPKPTRFAACYHPDAQPDD
FT                   GESSATDGRKRLGGPVIYPADGYPTKKAACAAIGSKPVVGG"
FT   misc_feature    307904..307972
FT                   /locus_tag="SCAB_2881"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB2881 by TMHMM2.0 at aa 62-84"
FT   CDS_pept        complement(308531..310501)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2891"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2891"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67500"
FT                   /db_xref="GOA:C9ZG59"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG59"
FT                   /protein_id="CBG67500.1"
FT                   /translation="MVSAEQTGRGGAVGTGAAVDRLGAARAVLWLVAAVLAVRQVAVAL
FT                   GTPRGEALTDLTRFTGTPFGGLVLKPLTRTAEEALGWGWTFGTLLLVVALGLVAARALP
FT                   GPATRRTALLAAPVAITLLMLSLPVRNTLYLGQTSVLPVLLVLVGCFLVRGERAGGVCV
FT                   GLAAAFQPTVLLFVVLLWFTDRRRAAASTGITFAAATAPAWVALPHDSYTYWVHHLAGV
FT                   GLGGRADDLANQSLHGALLRFGLTGPAEIALFLALAAAVAVVGMRRAVHHARDGQLLLA
FT                   VAITGCVVVAVSPTSWQHQLLWVLLTVVGRVGTKQSSRYAWPVAVVLVMTLPAKMMVPN
FT                   AAVLQPLRDNVVLLAALAAALLVPFLSRTSQHYRTPIPTRYAPRPQTRLRWAPLLRRVA
FT                   TRPNLLLELLLIRVTYAAYQRTRLEATGSRAAAEEHAGQILAVERVLFLDVEHWFNHTV
FT                   VRIGWLRGFFDFYYTSFHFVVPLTVLGVLYWRRPADYRWARTAIGFTTVLALVGFFFYP
FT                   LAPPRLMPGLGIIDTIHGVQDFSRPDYGRLTEVANQYAAMPSLHFGWSLWCGLTIAIVA
FT                   PRVWMKVLGLLHPFFTVLAIVATGNHWVLDAAGGAAVVGAGFGLTYLLTGPRTALGKDD
FT                   RKTDEGVPRTAVSSPPDPVRG"
FT   misc_feature    complement(join(308606..308674,308687..308755,
FT                   308774..308842,308948..309001,309035..309103,
FT                   309398..309451,309470..309538,309611..309670,
FT                   309707..309775,309878..309937,309956..310024,
FT                   310037..310105,310118..310171,310199..310267))
FT                   /locus_tag="SCAB_2891"
FT                   /note="14 probable transmembrane helices predicted for
FT                   SCAB2891 by TMHMM2.0 at aa 79-101, 111-128, 133-155,
FT                   160-182, 189-208, 243-265, 278-297, 322-344, 351-368,
FT                   467-489, 501-518, 554-576, 583-605 and 610-632"
FT   misc_feature    complement(309641..309673)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(310052..310084)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(310571..311359)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2901"
FT                   /product="putative secreted protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2901"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67501"
FT                   /db_xref="GOA:C9ZG60"
FT                   /db_xref="InterPro:IPR001574"
FT                   /db_xref="InterPro:IPR016138"
FT                   /db_xref="InterPro:IPR036041"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG60"
FT                   /protein_id="CBG67501.1"
FT                   /translation="MPTSVLIMVALSVLLGILVIFLPLGGADASAPTTADRRKTAETAE
FT                   TAETADGQRNADFPQVHWDLDRGSGAYLAMLDHLRNLAENSAQGRVTPDADTGVNTGIP
FT                   DDTEPWGFAGIVISCDNDTPAVHAVVRLSDFCVVRFYSDTPPGIVLNLASDVAHRDDTT
FT                   DDDWFLGKEDYDTLARVANQPLTSVDLSRSSLENSLGDLSFRGIDRTAQARGVLRYLIA
FT                   ITEASRLSPIAQRIASGMDNRSDVFLTAQQVGLMRNWDRC"
FT   misc_feature    complement(311003..311035)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(311273..311359)
FT                   /locus_tag="SCAB_2901"
FT                   /note="Signal peptide predicted for SCAB2901 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.635 between residues 29 and 30"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    complement(311279..311347)
FT                   /locus_tag="SCAB_2901"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB2901 by TMHMM2.0 at aa 5-27"
FT   CDS_pept        complement(311681..315412)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2911"
FT                   /product="putative WD-40 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2911"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67502"
FT                   /db_xref="GOA:C9ZG61"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG61"
FT                   /protein_id="CBG67502.1"
FT                   /translation="MGRPELPVDPAAGPVQRLAHDLRELRRSAGGVSYRTMAEKAGFSV
FT                   TTLAKAASGERLPSLAVLQAYVRACGADADAWEARWAEAEALAGEERHEDTDATPPYRG
FT                   LARFEADDRELFFGRDRLIDELSALACGSPFAVVFGASGSGKSSLLRAGLLPQLQEKIA
FT                   QQGRTAVLRILTPGDRPATTYGHLLTPEADDPECWVVVDQFEEVFTLCRERAERDRFLD
FT                   LLLAARDPGSRLRVLIAVRSDFYARCAEHPRLAEALHGSGLLVGPMTADGLREAVIGPA
FT                   QAAGLIVERTLTARLVEDVLDEPGGLPMLSHALLETWRRRKGRMLTLAAYEASGGVRGA
FT                   IAASAEEAYGELSPTQAHAARHLLLRMVEPGQGNADTRRPLSWEEVAGWEDPDVRAVAG
FT                   RLARARLLTTDDDGVQLAHEALITGWPRLREWIDADRERLRHHRQLTDAARTWLEHDRD
FT                   PGTLYRGTRLARAEELFADDDGGHDGLTSEETAFLVAAAQQRAAEERAATRARRRSRTL
FT                   TVSLCALLAVALVVGLTAVRLRQDSEKQTTDTAARRVAAVAEALRTTDPRTAMLLGVAA
FT                   WRTSPLPESRRALLGALAQRELGTFTDPAPGSTPERFLDASGRSLLSVEGGTWRTWNID
FT                   THRRIASGPAPRGTLLGATPGGRVLAILSAEGVRRLWDTRARRWIEASVAPADVVRFGA
FT                   GGRNYLVSTSADARAELRSLTDGRLVFRTPSAGRGERLDDVAADDDRLLAVCPSGKAPQ
FT                   VWDTVTRTTRSGAWTSARGVCGDRTSLSLAGGRLLALSGDRARVWDTASGRRLADLRDP
FT                   GAYRAVMSPDGSFLATGGGQEVRVWRLSTPTAPVLRHSLNNESLSDLGWDPSRPLLRYL
FT                   EGGTVHTLDLTTTLTRAWRARPLTGIRLSPDGRTLATAERVGDRYVFQLRNTRDGRLLR
FT                   TLPPSTLPAPVNRELPSSINLTQPLLAFSPDSRALAYGLSDPGVATAPQRLTLWDLTAG
FT                   RTKSTVDVATTTAAAPTHAIALGPGGRTLLTARGTLDGTVNEKWDTTRQRRAALLSAPG
FT                   GAHLAVSPDGGLLVTDNRLVRGDRSHAQDLVQHDDIGAIAFAPDGSTMAAGDATGRVAL
FT                   WDGDLRHRAGILRNVFPGPVDQSSDLAETITALAFSPDGRTLAVGGNGGTVQLWDVATQ
FT                   QPLGPPLPTPGESIDTLAFSPDSTTLYAGGMHVPLQRYVIDPDRAVSLVCARAGNTELT
FT                   RAQWRTHLPDRPYRRVCP"
FT   misc_feature    complement(311927..312040)
FT                   /locus_tag="SCAB_2911"
FT                   /note="HMMPfam hit to PF00400, WD domain, G-beta repeat,
FT                   score 0.00012"
FT                   /inference="protein motif:PFAM:PF00400"
FT   misc_feature    complement(314972..314995)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(315182..315349)
FT                   /locus_tag="SCAB_2911"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   1.1e-08"
FT                   /inference="protein motif:PFAM:PF01381"
FT   CDS_pept        315840..316574
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2921"
FT                   /product="putative membrane protein"
FT                   /note="TTA-Leu codon(s) 9 may indicate regulation by BldA"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2921"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67503"
FT                   /db_xref="GOA:C9ZG62"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG62"
FT                   /protein_id="CBG67503.1"
FT                   /translation="MATVGAAELLLGGIVMLGASVQWLTGMGFALIAVPALVLILGTAQ
FT                   GVALANFAAGTISLVGLTTRWRLVRIDAMVPLIIAAGCTVPAGSWAAARLPEPVLLVAI
FT                   GMLVTLAVAFVMGGVRIPALTGTRGALTAGAVGGFMNSAAGVGGPPYSLYAVNAGWSVR
FT                   EFVPNAQFYGVMVNLFSVTANGVPRLSGPAWSVAVAATVAGALLGKQLASRIPEEWVRR
FT                   LIFALALTGGLSVLVKGMHGML"
FT   misc_feature    315864..316547
FT                   /locus_tag="SCAB_2921"
FT                   /note="HMMPfam hit to PF01925, Domain of unknown function
FT                   DUF81, score 1.7e-08"
FT                   /inference="protein motif:PFAM:PF01925"
FT   misc_feature    join(315897..315965,315978..316046,316056..316115,
FT                   316134..316202,316392..316460,316494..316550)
FT                   /locus_tag="SCAB_2921"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SCAB2921 by TMHMM2.0 at aa 20-42, 47-69, 73-92, 99-121,
FT                   185-207 and 219-237"
FT   misc_feature    316056..316088
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(317127..318104)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2931"
FT                   /product="putative araC family regulatory protein"
FT                   /note="TTA-Leu codon(s) 56 may indicate regulation by BldA"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2931"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67504"
FT                   /db_xref="GOA:C9ZG63"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG63"
FT                   /protein_id="CBG67504.1"
FT                   /translation="MFRSEDVSVEDRFDVWRERIDPTRPSDATSIHASDFWATAHLMEM
FT                   GPVAVMSMSALPANYRRSSKMIRQSDPERYHLSLLLDGELALEHAARREVFGSWDLHVV
FT                   DSSQPYDLRATDDRQRRAVKGIGIDFPKASLPMPPDRIRPLLGRRLPGQDGVGALLTEF
FT                   LVNIDRQAETLQPCDAPTLGVTLLDLVSAWFASLVSAEATLQPETRRRVTAECVQAFIW
FT                   KNLRDPELTPSAIATAHHISVSYLHRIFQQSPREPVATWIRNRRLEGAHCDLANPSLRN
FT                   RPIHAVASYWCFPRPSDFARAFRSAYGLSPQQHRSQALSGHAGT"
FT   misc_feature    complement(317664..317693)
FT                   /note="PS00215 Mitochondrial energy transfer proteins
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00215"
FT   CDS_pept        318396..319388
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2941"
FT                   /product="putative secreted protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2941"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67505"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG64"
FT                   /protein_id="CBG67505.1"
FT                   /translation="MKWKRTCGAAALALALFGGGSLPFASAASAASSTFEYEVTRDAAP
FT                   YRDIPGTDVVFTAAAGEKSYLWSRNLSVTNVTDLGSGDNVGTTAAVRCRRSDGTTLPAG
FT                   SEAGAYWAANMVPPGENSAAPALRWVFTAPSAGTYNCRLSVTSYSTIIQNGRTVTMRIP
FT                   AGAELARATFTSTERWTLPAAGTTVIARGTTQTTLGYTYTPGPGDDITVVQDAALTTCA
FT                   PGSTICGGGSTAHSGTQAETWIEAQPQNPDGSRCGGPITGPVAKWNISTAKHHQTAANT
FT                   LHLDRTRLGGCTQIRVSLKVRNVDGNPVNLHAGHASGQIAATHGLAFTH"
FT   misc_feature    318396..318485
FT                   /locus_tag="SCAB_2941"
FT                   /note="Signal peptide predicted for SCAB2941 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.966 between residues 30 and 31"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    318414..318482
FT                   /locus_tag="SCAB_2941"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB2941 by TMHMM2.0 at aa 7-29"
FT   CDS_pept        complement(320129..321100)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2951"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2951"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67506"
FT                   /db_xref="GOA:C9ZG65"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG65"
FT                   /protein_id="CBG67506.1"
FT                   /translation="MRIVIIGGSGHIGTFLVPRLVRAGHEVINISRGTRTAYADAPEWR
FT                   QVRQVVADREHEDREGVFGDRVAALNPDAVVDLVCFTLESATALVERLRGEVGHLLHCG
FT                   TLWRYGPSDKLPISETTGTPPVGEYGIQKDLIARMLKAETASGGLVTTSLHPGHIVGPG
FT                   WDPVNPLGNNDPSVWYALSAGRPLRIPGIGVEPMHHVHADDVAQSFERAVEHREAAAGE
FT                   DFNVVAPTALNVRGYARIAAGWFGQTASLEPVTWEEFRRGTSQEHADRSWDHLHRGHCL
FT                   TIEKARTLIGYAPRYEPEAAVLESVRWLIDHGELEVARPLVA"
FT   misc_feature    complement(320420..321094)
FT                   /locus_tag="SCAB_2951"
FT                   /note="HMMPfam hit to PF01370, NAD dependent
FT                   epimerase/dehydratase family, score 9e-11"
FT                   /inference="protein motif:PFAM:PF01370"
FT   CDS_pept        complement(321324..322184)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2961"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2961"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67507"
FT                   /db_xref="GOA:C9ZG66"
FT                   /db_xref="InterPro:IPR021994"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG66"
FT                   /protein_id="CBG67507.1"
FT                   /translation="MGLQGYLVLWCGVFGTVALVGYARSLAGMTRAQRAVRVMGRMERV
FT                   REPRHGSSQRDGIPVVVSFQDPSTGEEFTVTNDGDHGERITAAWPGREIGVRYPPGRPH
FT                   AFQFVGDLWAGRRGLGWPNFAVFLVYAGLVVFAAIDWAWPWALIGFGAPWTVSGVWYLP
FT                   QNERAVNRRIAALTSRPPVPGRVVAVLTDTSTDEDGHTSTSHTPVITFTTQEGTTVTAY
FT                   CTEGLPDPANSHGRRVTIHYTPDDPAVFTPDLAAEHRSRSLDITCGAVALLLGVAAVVV
FT                   GAVLV"
FT   misc_feature    complement(join(321330..321398,321696..321764,
FT                   321774..321833,322104..322172))
FT                   /locus_tag="SCAB_2961"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SCAB2961 by TMHMM2.0 at aa 5-27, 118-137, 141-163 and
FT                   263-285"
FT   misc_feature    complement(322083..322184)
FT                   /locus_tag="SCAB_2961"
FT                   /note="Signal peptide predicted for SCAB2961 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.637) with cleavage site
FT                   probability 0.407 between residues 34 and 35"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    complement(322140..322184)
FT                   /note="PS00443 Glutamine amidotransferases class-II active
FT                   site."
FT                   /inference="protein motif:Prosite:PS00443"
FT   CDS_pept        complement(322263..323378)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2971"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2971"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67508"
FT                   /db_xref="GOA:C9ZG67"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG67"
FT                   /protein_id="CBG67508.1"
FT                   /translation="MTITTVGPSRRNTPVAVALGVLTGGVIGASPAALVVGAIIENVPL
FT                   FVAGLVLPAVYGLLFFLVGAPRRAREAAVAPRTALASVESLEAVGGEATSDVAVRFDLT
FT                   VAPDDVPAYRVAFTQHINLVDLADYRPGGVVVVQYPPDRPSRVRIVKRPTPEWEERAAG
FT                   ARVDSAPGPALVSETPENGAVGFVRLLALLVAAAGVVLLFRADLFDQSAATQPPSAVGP
FT                   SVSSSSSASVSSSSTTVVSSASGTVTLGPHQSFLDKGELRRAVDSLAKGTDTRAVLTVV
FT                   VQDRLLSVVYAPTGARTPTFDLDSLPYDRFPSLVEEARTGLGAGSPQTWQLTVERLTGS
FT                   LTIRVGVTGAEGTASLEADGQGKVVRRTPAR"
FT   misc_feature    complement(join(322770..322829,323184..323252,
FT                   323262..323330))
FT                   /locus_tag="SCAB_2971"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SCAB2971 by TMHMM2.0 at aa 17-39, 43-65 and 184-203"
FT   misc_feature    complement(323265..323378)
FT                   /locus_tag="SCAB_2971"
FT                   /note="Signal peptide predicted for SCAB2971 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.798 between residues 38 and 39"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(323780..324106)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_2991"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_2991"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67509"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG68"
FT                   /protein_id="CBG67509.1"
FT                   /translation="MPAGSSSKRERQYEHIKKSAEDRGESSERAKEIAARTVNKERARS
FT                   GESKTSSKASTRDRKSSYERGGQRSHSGSQGPTKDQLYEEAKKRNIDGRSSMTKKELEN
FT                   ALGR"
FT   CDS_pept        complement(324712..325494)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3001"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3001"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67510"
FT                   /db_xref="GOA:C9ZG69"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG69"
FT                   /protein_id="CBG67510.1"
FT                   /translation="MTWSTGLLGFAAGLLISVATAPVGVSGAVFLLPVQVSVLGVPSPA
FT                   VTPTNLLFNVVAGPGALLRYARTGRLGGPLTRLLIAGTVPGVVIGAVIRVFAVPGPRVF
FT                   RLFIAALLLPLGLWLWWRTLRPAAQRDIGQPTHRATATLALAVGVAGGIYGIGGGSLLG
FT                   PILVGRGVPVATVAPAALASTFVTSVVGAATYALLSLTATGDVAPDWLLGLSCGTGGLI
FT                   GGYLGAHLQPHLPETALRLLLGALAVAIGTLYAVQLLT"
FT   misc_feature    complement(join(324718..324786,324814..324867,
FT                   324904..324972,325000..325068,325129..325188,
FT                   325201..325263,325297..325365,325408..325476))
FT                   /locus_tag="SCAB_3001"
FT                   /note="8 probable transmembrane helices predicted for
FT                   SCAB3001 by TMHMM2.0 at aa 7-29, 44-66, 78-98, 103-122,
FT                   143-165, 175-197, 210-227 and 237-259"
FT   misc_feature    complement(324730..325476)
FT                   /locus_tag="SCAB_3001"
FT                   /note="HMMPfam hit to PF01925, Domain of unknown function
FT                   DUF81, score 5.9e-17"
FT                   /inference="protein motif:PFAM:PF01925"
FT   misc_feature    complement(325360..325494)
FT                   /locus_tag="SCAB_3001"
FT                   /note="Signal peptide predicted for SCAB3001 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.466 between residues 45 and 46"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(325625..326176)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3011"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3011"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67511"
FT                   /db_xref="GOA:C9ZG70"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG70"
FT                   /protein_id="CBG67511.1"
FT                   /translation="MPDHADHVRPDHVRPERAAPSRMLWRQPSEQWLLSGIYGLVLASA
FT                   MVAALDAAGEEADPGSDALWVLITAVASGAAHGYAHVIAQRASVEGVAVTSRLRSVLAE
FT                   WPLVAAVLPTLGMLLAAVAGWWEEATAADAALLFNTVALFAVGAWAARRAGQGWPSSCR
FT                   AGGLDMLLGLLIIMVNALIH"
FT   misc_feature    complement(join(325631..325687,325724..325792,
FT                   325802..325870,325928..325987,326015..326083))
FT                   /locus_tag="SCAB_3011"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SCAB3011 by TMHMM2.0 at aa 32-54, 64-83, 103-125, 129-151
FT                   and 164-182"
FT   CDS_pept        327145..328149
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3021"
FT                   /product="putative secreted hydrolytic enzyme"
FT                   /note="PMID:8606158"
FT                   /note="PMID:2254271"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3021"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67512"
FT                   /db_xref="GOA:C9ZG71"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR037460"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG71"
FT                   /protein_id="CBG67512.1"
FT                   /translation="MGLTLAVSALVPSGTAGAAEQYEWAALGDSYTAGVFVGDPQPPLG
FT                   DASRDGCDRTSDAYPGVVERELDEFPPGKYVHLTNVSCGNATIADIAENKQSPISPVQP
FT                   PAGGWPAVDTQIQRAKLNDTTDIVTIGVGGNSLPFGGMLFKCLELGATPGKSCREYYTS
FT                   PPEGEESIQDKLARVQDEYIQMLVKVHQAAPNAKVITVGYPAVLPDEGTACNRLSLTEL
FT                   GAIKHADVDWLRDDVLKQLNSSIERVTSFFGDRYVDVYSSSVGHDACQPAGTKWVEGIC
FT                   GDAADYWPAKLAGTLLTCAPINKRVTLVHPNGEGHANAAAHVERAIRIALLDH"
FT   misc_feature    327145..327198
FT                   /locus_tag="SCAB_3021"
FT                   /note="Signal peptide predicted for SCAB3021 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.989) with cleavage site
FT                   probability 0.931 between residues 18 and 19"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(328372..329064)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3031"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67513"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG72"
FT                   /protein_id="CBG67513.1"
FT                   /translation="MNPTVVLVHGAMHTPWIFDALRERLSARGIASRAVQLPSSNPDSA
FT                   AARGLTEDVPEVRAEIAAADGPVVLAAHSYGGVPATWAAAKEDRVAELVHIAAFALEPG
FT                   VSMMEWMGGAFPPTWIRSPDGLAVKAGDAEQSIFSGVDPVLTAEAVKRRQWQGMRAFTE
FT                   KLGAAPADIPLTYVVATEDPSLPPAVQEKWAARAAHRLRLPSGHSPHLSHADQVAELLA
FT                   EAVARVER"
FT   CDS_pept        329551..330330
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3041"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3041"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67514"
FT                   /db_xref="GOA:C9ZG73"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG73"
FT                   /protein_id="CBG67514.1"
FT                   /translation="MNGTVTVLDRGPVRIHSYMSPADTFHTTTQLIETPARIVAIDAQL
FT                   LPVYADEAIAYAKGLGKPIDRLIVTHAHPDHYNGAARFGVPVHALAQVRRQIIARGDSN
FT                   LPTGQVIPVSDFTPSVDIVPGTEVIDGVAFVFEAVSGGEAADELLVKLPEQGVLIAQDL
FT                   VYNDVHLYLGNNDITGWQQAVDALAAESGYDTILAGHGLPTGPEVYADVRRYLTDAREL
FT                   LGDDGDAYKKAIVDKYPAHVGPFIIDIANRSLFPVGD"
FT   misc_feature    329626..330150
FT                   /locus_tag="SCAB_3041"
FT                   /note="HMMPfam hit to PF00753, Metallo-beta-lactamase
FT                   superfamily, score 4.8e-07"
FT                   /inference="protein motif:PFAM:PF00753"
FT   CDS_pept        330611..331885
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3051"
FT                   /product="putative membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3051"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67515"
FT                   /db_xref="GOA:C9ZG74"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG74"
FT                   /protein_id="CBG67515.1"
FT                   /translation="MSLPVPKRSAASAAMMTPTSASRRPRRAPLVLILGSLTALGPLTI
FT                   DLYLPALPQVSGDLHVSAAVTQLTLTTFMIGIALGQLVIGPLSDTLGRRRPLLIGLSAY
FT                   VVAGALCALAPTATVLIGMRLVQGLAGAAGIVIARAVVRDLYDGLGAARLLSSLMLVSG
FT                   TAPILAPVLGAQLLRLTSWRGVFVALTVLGLVVLAATATLLTETLPAHRRRRGGLSDTL
FT                   RTMRDLVADSRFTGYLLTGSLGFAALFAYIAGSSFTLQEVYGASPQTYSLLFALNSIGL
FT                   VVTGQLNCKVLLGRFPSQRILATGLAVLGAAGIALVLLTTSTHAGLPWIALALFLTACP
FT                   VGLILPTTTALSLQRAPHAAGSASALLGTTQFLMAAVAPALTGLGGRGTALPMALSVLA
FT                   LALTATLIFLVICRPWRPTPDPLAR"
FT   misc_feature    330611..330799
FT                   /locus_tag="SCAB_3051"
FT                   /note="Signal peptide predicted for SCAB3051 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.978) with cleavage site
FT                   probability 0.780 between residues 63 and 64"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    join(330698..330766,330794..330862,330899..330967,
FT                   330977..331036,331073..331141,331154..331222,
FT                   331313..331381,331424..331492,331511..331567,
FT                   331595..331663,331682..331750,331778..331846)
FT                   /locus_tag="SCAB_3051"
FT                   /note="12 probable transmembrane helices predicted for
FT                   SCAB3051 by TMHMM2.0 at aa 30-52, 62-84, 97-119, 123-142,
FT                   155-177, 182-204, 235-257, 272-294, 301-319, 329-351,
FT                   358-380 and 390-412"
FT   misc_feature    330710..331771
FT                   /locus_tag="SCAB_3051"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 5.2e-50"
FT                   /inference="protein motif:PFAM:PF07690"
FT   misc_feature    330860..330910
FT                   /note="PS00216 Sugar transport proteins signature 1."
FT                   /inference="protein motif:Prosite:PS00216"
FT   misc_feature    331595..331627
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(332360..335020)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3061"
FT                   /product="phosphoenolpyruvate-utilizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3061"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67516"
FT                   /db_xref="GOA:C9ZG75"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG75"
FT                   /protein_id="CBG67516.1"
FT                   /translation="MNGPYVWNLHEVDEKQIEAVGGKGANLGGLSRIEGVRVPAGFCVT
FT                   TDAFRQIMAQVPSLDDLLDQLSRLSPEDGEATRTVSAEIRRLIEGVVVPDELARAIVAA
FT                   LAGLGEGTACAVRSSATAEDLPTASFAGQQDTYLNIVGPTEVLRHVSRCWASLFTERAV
FT                   VYRRRNGIDHRRVHMAVVVQRMVFPEVSGILFTADPVTGNRKVASVDAGFGLGEALVSG
FT                   LVNPDVFKVRDGDVVTRTIAAKPRALQALPAGGTHEVAVDPQRQEQPSLTDAQVVRLVG
FT                   IGRRIEAYFGRPQDIEWCLVDDDFRIVQSRPITTLFPVPVRETGDPGTNDRGTGDRKAG
FT                   DREAGRENHVYVSVGHGQMMTDPMKPLGLSMWQLTAMVPMHEAGGRLFVDVTPRLASPA
FT                   SRAGLLDVIGRGDPLTRDALETVLERDDFVAPLPATAPGRPPVGGESDPTETDPSVVAE
FT                   LIGRSRASVAALERDIRTKSGPALFDFLAEAFEEHKRVLSDPLNIRAIMVAMEGTWWLN
FT                   DRLQEWLGEKNAADTLTLSAPDNITSEMGLALLDVADVIRPHPEVVAFLQGVRDEDFLD
FT                   ELGRLPGGAEARDAIEAYLDRYGMRCVGEIDITRPRWRERPTTLVPVILDHVRNMEPGA
FT                   AERRFEEGRRKALNKAAEVVSRLRALPDGDRRADETQRMIDQVRAFIGYREYPKYGIIS
FT                   RYFVYKQALMREAGRLVRAGVLAAEEDVFYLTFQEFHQVSRSHQADDRLIQQRKDAFRS
FT                   YHALTPPRVLTSDGEALNGAYRRDDVPPGALPGLPVSAGVVEGRARVVLDMAEADLETG
FT                   DILVTTYTDPSWSPLFVGIAGLVTEVGGLMTHGAVIAREYGLPAVVGVEQATRLIRNGQ
FT                   RIRVHATDGYVELLS"
FT   misc_feature    complement(332381..332641)
FT                   /locus_tag="SCAB_3061"
FT                   /note="HMMPfam hit to PF00391, PEP-utilising enzyme, mobile
FT                   domain, score 4.5e-30"
FT                   /inference="protein motif:PFAM:PF00391"
FT   misc_feature    complement(334001..335011)
FT                   /locus_tag="SCAB_3061"
FT                   /note="HMMPfam hit to PF01326, Pyruvate phosphate dikinase,
FT                   PEP/pyruva, score 8.1e-91"
FT                   /inference="protein motif:PFAM:PF01326"
FT   CDS_pept        335810..337828
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3071"
FT                   /product="putative serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3071"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67517"
FT                   /db_xref="GOA:C9ZG76"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG76"
FT                   /protein_id="CBG67517.1"
FT                   /translation="MSAIGPGGRVQPARPGDPSRIGPYRIIGRLGAGGMGTVHAGVTSD
FT                   GTRVAVKVIHPEQAQEPEFRARFAREVALSSRVTGPYVIPLLAADTDAATPWLATAYVP
FT                   GPTLDQHVRERGPLSEGSLYALAAATAQALAAIHAVGVVHRDVKPQNIILTPTGPRVLD
FT                   FGIAHASDTTSVTRTGVMTGTPGWISPEQYRQGTAGPAGDVFAWGALVAYAATGRLPFG
FT                   AGPPDVVAFRVMSGEPDLDGVAASLRRILEKALSKEPEDRPAATEVAGSCAALLASQAT
FT                   QVVGVHALPTQAGDAVAQVWDVPAGEDPAWQAPPGRSARRRVGAVVVAAAVLGGLVGGV
FT                   TALLPDTTGGGKSGGSASPSASAGSGSQAVKSDEADTAAERGKVVSDGAASAVSWAEAR
FT                   TAQGQGEHDVARSVLHDQSVLSGELSEVRLSPGSVTFHEARREVYFSYNLDTDAHGTLI
FT                   AETEIARAMCLSLRDAVLNVHPDLPYRTYVTVREEAGRDAQVTWQEDFVADERCRSAAE
FT                   DGTARSDGADAEAESEPESEWAPDENGLGEAMIPSTDGDEIRVADRAAKKVIERSNAMR
FT                   PTLGTGQVLGHEEIKVGFDPAHSAMYVWSDYLMWNQGQVETWADMAAGEACRALVRQRQ
FT                   NAGSGWPYKRYAVAEIGGSGYLMIRWGTATSLDACPT"
FT   misc_feature    335879..336622
FT                   /locus_tag="SCAB_3071"
FT                   /note="HMMPfam hit to PF00069, Protein kinase domain, score
FT                   4.2e-46"
FT                   /inference="protein motif:PFAM:PF00069"
FT   misc_feature    335897..335965
FT                   /note="PS00107 Protein kinases ATP-binding region
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00107"
FT   misc_feature    336197..336229
FT                   /note="PS00435 Peroxidases proximal heme-ligand signature."
FT                   /inference="protein motif:Prosite:PS00435"
FT   misc_feature    336233..336271
FT                   /note="PS00108 Serine/Threonine protein kinases active-site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00108"
FT   CDS_pept        338149..338334
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3081"
FT                   /product="hypothetical protein"
FT                   /note="no db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3081"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67518"
FT                   /db_xref="GOA:C9ZG77"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG77"
FT                   /protein_id="CBG67518.1"
FT                   /translation="MVSKTRVLLGMLVLLALAVGAIALLAAAKADATWFTIVPLGILFI
FT                   GASVIQSLGWFNKKSR"
FT   misc_feature    338179..338238
FT                   /locus_tag="SCAB_3081"
FT                   /note="Signal peptide predicted for SCAB3081 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.919 between residues 20 and 21"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    join(338182..338238,338248..338316)
FT                   /locus_tag="SCAB_3081"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SCAB3081 by TMHMM2.0 at aa 2-20 and 24-46"
FT   CDS_pept        complement(338413..339669)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3091"
FT                   /product="putative amidohydrolase/peptidase/deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3091"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67519"
FT                   /db_xref="GOA:C9ZG78"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG78"
FT                   /protein_id="CBG67519.1"
FT                   /translation="MEASALAAVDEAAIGRLLLELLAVPSVTGSAAESELQHVLARRLE
FT                   RLDLDVDLWSMNLPELRAHPRFPGSEAPRTEAWGLVGGTRPQGDGPTLILQGHVDVVPS
FT                   GDLAQWDGDPFRPRITGDVVHARGACDMKAGMVAILAALAAIRQAGARLRGRLAAHFVV
FT                   SEEDGGLGAFGTLQRGHTGDACIITEPTSGALMTANAGALTFRIEVPGRATHGSTRYVG
FT                   VSAIDAYLPIHRALAHLEARRNTDADPLMSAYPIPYPLSVGTVRSGDWASSVPDLLVAE
FT                   GRLGVRLGEDPDRARTELEACVAEACAADPWLRSHPARVTWPGGQFASGRLPAGHPLAT
FT                   LVGDAHADVTSGPRPAERGAPYGSDLRLYSGAGIPTLQYGPGDVRLAHGPQEQVRVSEI
FT                   VTVTRALVLAALRTVGEHQ"
FT   misc_feature    complement(338434..339390)
FT                   /locus_tag="SCAB_3091"
FT                   /note="HMMPfam hit to PF01546, Peptidase family
FT                   M20/M25/M40, score 1.6e-32"
FT                   /inference="protein motif:PFAM:PF01546"
FT   misc_feature    complement(338737..339081)
FT                   /locus_tag="SCAB_3091"
FT                   /note="HMMPfam hit to PF07687, Peptidase dimerisation
FT                   domain, score 5.8e-13"
FT                   /inference="protein motif:PFAM:PF07687"
FT   CDS_pept        339863..340300
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3101"
FT                   /product="putative AsnC-family regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3101"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67520"
FT                   /db_xref="GOA:C9ZG79"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG79"
FT                   /protein_id="CBG67520.1"
FT                   /translation="MDAIDGAIIRCVLHNARATYAEIGKAAGLSAPAAKRRLDRLETTG
FT                   AIRGYTALIDPQALAWHTEAFVEVYCSGNPTPAELRQALEHIPEVIEACTVSGAADAVV
FT                   HMLARDIPHLEQAIQRVRATAPVERTESAIVLSRLLNRPRV"
FT   misc_feature    340055..340276
FT                   /locus_tag="SCAB_3101"
FT                   /note="HMMPfam hit to PF01037, AsnC family, score 1.6e-18"
FT                   /inference="protein motif:PFAM:PF01037"
FT   CDS_pept        complement(340443..341024)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3111"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3111"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67521"
FT                   /db_xref="GOA:C9ZG80"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG80"
FT                   /protein_id="CBG67521.1"
FT                   /translation="MYYVGVSLDGRIAGPGGEFDFFPQGDEQQAAAYATWTNALYPETV
FT                   PTAYRAAVGVADAPNRRFDTVVMGLGSYRPALDHGITSPYAHLRQYVVSSTLAPDTDPA
FT                   VIVVPSDPLALVRELKGEAGTDLDVWLCGGGRLAGALLPEIDELLIKTYPVIAGTGVPV
FT                   VDGAFDPTVFDVAERTSFPNGVTLTRLTRR"
FT   misc_feature    complement(340911..340940)
FT                   /note="PS00019 Actinin-type actin-binding domain signature
FT                   1."
FT                   /inference="protein motif:Prosite:PS00019"
FT   CDS_pept        341097..341684
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3121"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67522"
FT                   /db_xref="GOA:C9ZG81"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041583"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG81"
FT                   /protein_id="CBG67522.1"
FT                   /translation="MMSMVRRNDQRRAALVDAAIEVLAREGARGLTFRAVDAEAAVPAG
FT                   TASNYFSSRDDLFTQAGARVYERLQPDEATIARQREAGRDRETYAELMRELVGRIASFR
FT                   TGYLALLELRLEATRRPELRKVLTARVRADVDANVAYHEASGLPGDTTAVKLLILTLNW
FT                   LIVEQLTLPDVFTEAEREQLITAAVERIVTAE"
FT   misc_feature    341139..341279
FT                   /locus_tag="SCAB_3121"
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 3.6e-08"
FT                   /inference="protein motif:PFAM:PF00440"
FT   tRNA            342062..342136
FT                   /gene="tRNA-Met"
FT                   /product="transfer RNA-Met"
FT                   /note="tRNA Met anticodon CAT, Cove score 71.02"
FT   CDS_pept        complement(342396..342950)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3131"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3131"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67523"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG82"
FT                   /protein_id="CBG67523.1"
FT                   /translation="MVMEFFCYHRDRPGSLALREKLVEEHWSYMDRYAKELIARGPTFA
FT                   DDGETPTGSVHIVDLPDAAAARAFAFDEPSYQAGAYRDVLLRRWRNVLGRTMWDFPGGR
FT                   TGGNRYLVIGLGEGPAADLAPPLDRAELIAYGPLLSDDGDTWLGTGALLRAPDADTARA
FT                   VLTADRYADIEVHDWEFGGRR"
FT   misc_feature    complement(342405..342641)
FT                   /locus_tag="SCAB_3131"
FT                   /note="HMMPfam hit to PF03795, YCII-related domain, score
FT                   1.3e-13"
FT                   /inference="protein motif:PFAM:PF03795"
FT   misc_feature    complement(342672..342920)
FT                   /locus_tag="SCAB_3131"
FT                   /note="HMMPfam hit to PF03795, YCII-related domain, score
FT                   6.2e-30"
FT                   /inference="protein motif:PFAM:PF03795"
FT   CDS_pept        complement(343022..344161)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3141"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3141"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67524"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG83"
FT                   /protein_id="CBG67524.1"
FT                   /translation="MSHAVRRASELALDETTVTALRAALRTTADEVVQAIIDEVPPYAN
FT                   ALSGRMGGTIRRAVRTALGHYLDLASGNATGGDAGDAAYELGRGEVRDGRSMDALLSAY
FT                   RVGARVAWRCLAAGAVPAGLPAAEVAKFAELTFAYIDELSAASAAGHADELAARGRAHE
FT                   RHLEQLVRDLLADASPDVLLASAQRAGWQPPGSLTAVLLPAAQARPAWRMLDQSTLVLD
FT                   DLPDALGVLLVPDADRAHLLRQLTDRSAVVGPARPWTRASASYARAVRARSLSSDIRDT
FT                   EDHLPELVLSADADAFADLRARALAPLRDLPVATARRLEETLRAWLLHQGRRDEVAAEL
FT                   FVHPQTVRYRMAQLRELFPDLASPYRVLELTLAVGLRDG"
FT   CDS_pept        344228..345310
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3151"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3151"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67525"
FT                   /db_xref="GOA:C9ZG84"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG84"
FT                   /protein_id="CBG67525.1"
FT                   /translation="MAHQAGVMTSTTLRSGAWKLLELVTTPLLPSDYLDLVSPLRAGGD
FT                   LRGRIEAVHPETGDAATVVIRPGRGWRGHTAGQYVRIGVDVDGVRLWRAYSLTSPTDRQ
FT                   DGRVTITVKAIPDGKVSNHLVRRAKPGTLIQLDQATGDFVLPEAKPAKVLYLTAGSGIT
FT                   PVMGMLRDTEFDDAVMVHSAPRPHDVIFRSELHDLVAEKKLRLTELHTDTDGMLDISRL
FT                   DELVPDWAERETWACGPAGLLDAAEKHWTEHGLSERLHTERFRPGVVVADDGGGGAVTF
FT                   STTGRTVDADGVTPLLDVGEEAGVLMPSGCRMGICFGCVTPLKAGAVRDLRTGEITEAE
FT                   PGVLIQTCVSAAAGPCDIER"
FT   misc_feature    344366..344662
FT                   /locus_tag="SCAB_3151"
FT                   /note="HMMPfam hit to PF00970, Oxidoreductase FAD-binding
FT                   domain, score 2.2e-11"
FT                   /inference="protein motif:PFAM:PF00970"
FT   misc_feature    344687..344971
FT                   /locus_tag="SCAB_3151"
FT                   /note="HMMPfam hit to PF00175, Oxidoreductase NAD-binding
FT                   domain, score 0.0001"
FT                   /inference="protein motif:PFAM:PF00175"
FT   misc_feature    345062..345289
FT                   /locus_tag="SCAB_3151"
FT                   /note="HMMPfam hit to PF00111, 2Fe-2S iron-sulfur cluster
FT                   binding doma, score 1.5e-05"
FT                   /inference="protein motif:PFAM:PF00111"
FT   CDS_pept        345318..346436
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3161"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3161"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67526"
FT                   /db_xref="GOA:C9ZG85"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG85"
FT                   /protein_id="CBG67526.1"
FT                   /translation="MTAIDPTAHLTAEQIEELGRELDAIRDEVIASRGEKDAAYIRKVI
FT                   SAQRKLELVSRGVLLFSIFPPAWLIGTAGLSVAKIMDNMEIGHNILHGQWDWMRDPKIH
FT                   STTWEWDHVSPSEQWKHSHNELHHTYTNVIGKDNDLGYGIMRVDEDQRWYPFHLGQPLW
FT                   NFINACFFEYGIAAYDLELGKNLHKRRRKDPEFRARARAVGRKIRKQVLKDYVIHPLLS
FT                   GPSFLPTLAATFTANLVRNIWSHSVIMCGHFPEGVQVFERRSIKGETRGQWYLRQMMGS
FT                   ANISGSKAMHFMTGNLSHQIEHHLFPDLPSNRYAEVAVKVRALFEKYELEYVTGPLPKQ
FT                   VFSAWRKVFRLSLPNRKPRVRTPDREQELIAA"
FT   misc_feature    345516..346292
FT                   /locus_tag="SCAB_3161"
FT                   /note="HMMPfam hit to PF00487, Fatty acid desaturase, score
FT                   5e-05"
FT                   /inference="protein motif:PFAM:PF00487"
FT   CDS_pept        complement(346500..346724)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3171"
FT                   /product="hypothetical protein"
FT                   /note="no db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3171"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67527"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG86"
FT                   /protein_id="CBG67527.1"
FT                   /translation="MAGGVFARGTHVDDNLLGREHEPVLTAWEAGGTAVPARPPVAWGD
FT                   SGAHAEVASPPQRPNSTAVTSVVEGAHRP"
FT   CDS_pept        complement(347019..348119)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3181"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3181"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67528"
FT                   /db_xref="GOA:C9ZG87"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG87"
FT                   /protein_id="CBG67528.1"
FT                   /translation="MGAGREPDGSSRSDEEWDQFLRESVAGVADSPKEPSARARDVANR
FT                   LRAEPSRQPEGWRTHTPAQPERRTRWYVVGLLASLVLLVVALAPGRTVDLFGGDDADSS
FT                   PEAAESARPTQAPPTEAAQRPTMDKPFRGSPAAAWASGSAGITVPKAKAVGWMSAAEVE
FT                   RALARSRDFLVESSLDRGVLRGERPKAAIALINAHQKDVQDFLDTAFRSPSEENDPLFL
FT                   FSRFQSSRTRLVGDVVKTRGRLSYREGERGALQVTADVTFVYPVTRAHPSGDDEIVRTI
FT                   VRRELVLNWDDPDKVITKPGTFSIVSYKYDVTNGGCGAATGYFTPPFGSDRRTDETGTE
FT                   VDPYDRSVPVGSAGSSEEECGAATRS"
FT   misc_feature    complement(347841..347909)
FT                   /locus_tag="SCAB_3181"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB3181 by TMHMM2.0 at aa 71-93"
FT   CDS_pept        348913..350376
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3201"
FT                   /product="putative secreted protein"
FT                   /note="contains PF01839 FG-GAP repeats see also SCAB1291,
FT                   SCAB58141"
FT                   /note="TTA-Leu codon(s) 19 may indicate regulation by BldA"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3201"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67529"
FT                   /db_xref="InterPro:IPR013517"
FT                   /db_xref="InterPro:IPR013519"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG88"
FT                   /protein_id="CBG67529.1"
FT                   /translation="MSRAPRTTRRRISSVLLSLPLAASVVLTGSGPASAAPASVPAAED
FT                   FNGDGYADLVVGAPSATVSGKKQAGYVAVVYGSVNGLSTATKKIVSRSTAGVPGAALAR
FT                   QSFGATFARADLDRDGYGDLVIAGGKEGSVILWGSASGLTGGTGIAYGASPQAGDFDGD
FT                   GTTDLALFSAQRVSGDDPSGAPAALWKGPIRRDGRPTAVLPLLDRSLWWGWSEEDDSCE
FT                   TGGGCENGPASITGPVVSGEVADVNGDGRDDILQTAYRGDGNWGNRLLLGGGATGFTKQ
FT                   ETSEINLGEAIGAGDVNGDGYDDVVSGWGAGKAHITYGSAAGLTPGNTHAFTQDLPGFP
FT                   GADEEGDHLGSAVSIADVTGDGYADVALGIMGEDVGSVVDAGSVALLHGSAAGLTGTGA
FT                   QVFHQNTAGVPGVAEENDRFGATTALLDVDGDGHRDLAAASTAENASSGAVWLLRGTGS
FT                   GLTTKSALAFGPKDLSAPSTNALFGSFLR"
FT   misc_feature    348913..349017
FT                   /locus_tag="SCAB_3201"
FT                   /note="Signal peptide predicted for SCAB3201 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.817 between residues 35 and 36"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    348946..349014
FT                   /locus_tag="SCAB_3201"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB3201 by TMHMM2.0 at aa 12-34"
FT   misc_feature    349018..349137
FT                   /locus_tag="SCAB_3201"
FT                   /note="HMMPfam hit to PF01839, FG-GAP repeat, score
FT                   2.1e-05"
FT                   /inference="protein motif:PFAM:PF01839"
FT   misc_feature    349231..349323
FT                   /locus_tag="SCAB_3201"
FT                   /note="HMMPfam hit to PF01839, FG-GAP repeat, score 0.001"
FT                   /inference="protein motif:PFAM:PF01839"
FT   misc_feature    350167..350271
FT                   /locus_tag="SCAB_3201"
FT                   /note="HMMPfam hit to PF01839, FG-GAP repeat, score
FT                   0.00072"
FT                   /inference="protein motif:PFAM:PF01839"
FT   CDS_pept        complement(350479..351087)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3211"
FT                   /product="GdmH-like transport-associated protein"
FT                   /note="GdmH-like proteins also catch PF02698 (DUF218): in
FT                   ABC transporters secreting antimicrobial peptides c.f.
FT                   PMID: 11229936"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3211"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67530"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG89"
FT                   /protein_id="CBG67530.1"
FT                   /translation="MRRGTGLVTAGVAALVWGEWLNWRWSRTLVGSTGQSGSGTEAVVV
FT                   LGYRNPGPTVNPINRWRVRAGIRSVAADGGRATVVIFSGGATGSSAAEAELMADYAQSV
FT                   LGFDGTVLLEGRSTTTWENITNVIPLLEDVDRIKIVSQPAHALKARAYLRRQRPDLAAR
FT                   LVRAEDYRLGEWTMGKPLLALYGFRTLRRLTAEERRGSL"
FT   misc_feature    complement(350536..350961)
FT                   /locus_tag="SCAB_3211"
FT                   /note="HMMPfam hit to PF02698, DUF218 domain, score
FT                   1.7e-10"
FT                   /inference="protein motif:PFAM:PF02698"
FT   CDS_pept        complement(351163..353472)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3221"
FT                   /product="NRPS multienzyme (AMP-binding and pcp)"
FT                   /note="PMID:15112993"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3221"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67531"
FT                   /db_xref="GOA:C9ZG90"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG90"
FT                   /protein_id="CBG67531.1"
FT                   /translation="MPARTTAPPPAWGLADEGPALPHLVALDDGGDEASWLAALAVTLR
FT                   RHDPETAPVIGTDHGAFTVPEAATLGELKPVSADGPVLAGLLFDTAELRGAYVPCLAPP
FT                   FPLTLSVFRDADGWRLRCDHSGGHVSSEIAVQFARYLARVHRMILTAPGTPVDDVDLLD
FT                   EAERVRVAALGRPTRALVTTPVTVPEAFARIAGATPERIAVTEGAVGLTYGDLDERSTR
FT                   LADGLHERGVTAGDRVGVCLERTAELVVTLLAVLKAGATYVPVDPAYPADRIAHTARDA
FT                   GLRVMVTRLPEFPDVEGCDPVTPDELLDTARQFAVAPASPKGAGPDTAAYVIYTSGSTG
FT                   RPKGVEVPHRNVIALIDATREEYGFGADDVWTWFHSGAFDFSVWEIWGCLLTGGRLVVV
FT                   PYFLSREPDLFRDLLVAENVTVLSQTPSAFAQLLDVDHTRVPVRMVVFGGEPLDARMLL
FT                   PWLDRHPESVCRTVNMFGITETTVHVTEQTVTRRLALAATRSVGRALPGWHLYVTDPAG
FT                   RLQPPGVAGEICVGGAGVALGYLGQEELTARRFVPDPYTGGTMYRSGDLGRLRPDGRLE
FT                   HLGRLDSQVKIRGFRIELDEIRSVLLEELDVRAAAVVVRRDDPDDAATARIDAYVVLSA
FT                   GDPATLRKRAAGILPDYMLPSTVTALDTLPLTANGKLDTARLPTPTTPAAPDRGAEPVT
FT                   AEDDLTRRLRQIWGEVLGTPVGPDDDFFELGGNSLFAVRIAAVMRAQGLPSLRMRELYR
FT                   RPTVRGTVNSLATSDG"
FT   misc_feature    complement(351181..351372)
FT                   /locus_tag="SCAB_3221"
FT                   /note="HMMPfam hit to PF00550, Phosphopantetheine
FT                   attachment site, score 1.1e-10"
FT                   /inference="protein motif:PFAM:PF00550"
FT   misc_feature    complement(351637..352839)
FT                   /locus_tag="SCAB_3221"
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
FT                   1e-147"
FT                   /inference="protein motif:PFAM:PF00501"
FT   misc_feature    complement(352444..352479)
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT                   /inference="protein motif:Prosite:PS00455"
FT   misc_feature    complement(352966..353046)
FT                   /note="subthreshold Pfam PF08695 DUF1783; codons 293..319;
FT                   3.70 bits; Evalue=0.54."
FT   CDS_pept        complement(354017..354841)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3231"
FT                   /product="putative oxidoreductase"
FT                   /note="PMID:10473585"
FT                   /note="PMID:15112993"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3231"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67532"
FT                   /db_xref="GOA:C9ZG91"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG91"
FT                   /protein_id="CBG67532.1"
FT                   /translation="MRLHGKSVLVTGAARGLGRATALACATEGADLVLLDICADLPGVP
FT                   YPLGTPGQLEHTAALCRRAGAAVLTTEADIRDLRAVREAVTRAEDRFGRIDVVVNNAGI
FT                   AAPSGKPVHEIGEDEWSLMIDVDLSGVWRVIREVGKAMSARRAGSIVNVASTAGLVGYR
FT                   HFAAYVAAKHAVVGLTKAAALDYAPTKVRVNAVCPGSVRDDAQAEGRMLAEIARALDVP
FT                   VHEHEKTFVEAQPMNALIEPEDVAAAVVFLASDESRQITGSVLTVDGGFSIR"
FT   misc_feature    complement(354281..354826)
FT                   /locus_tag="SCAB_3231"
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase,
FT                   score 4.6e-22"
FT                   /inference="protein motif:PFAM:PF00106"
FT   misc_feature    complement(354293..354379)
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00061"
FT   CDS_pept        complement(354889..355602)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3241"
FT                   /product="putative thioesterase"
FT                   /note="PMID:15112993"
FT                   /note="PMID:10473585"
FT                   /note="many matches in secondary metabolite biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3241"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67533"
FT                   /db_xref="GOA:C9ZG92"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG92"
FT                   /protein_id="CBG67533.1"
FT                   /translation="MTTHDPIKLICLPYAGAGASFYRPWTALAGDTLEIVPLQLPGRER
FT                   LIDEEPYRDVHRAVDGLLAGLREVFGDGRGQRVAVFGHSLGAVLAYELAHRLVDEPGVE
FT                   LLHAFVSGSPEPNQGRERRATGLSDEEFLARVGEFAGYHHPALDDPEMREMILPALRAD
FT                   VEMHENYTPSTGLPLQAPLTVVRGEDDDLVGYDDAESWSKVAGRDFEHVEVPGGHMYLT
FT                   DAAPALVRLIVSTVL"
FT   misc_feature    complement(354895..355584)
FT                   /locus_tag="SCAB_3241"
FT                   /note="HMMPfam hit to PF00975, Thioesterase domain, score
FT                   2.5e-38"
FT                   /inference="protein motif:PFAM:PF00975"
FT   CDS_pept        complement(355599..356753)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3251"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3251"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67534"
FT                   /db_xref="GOA:C9ZG93"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019951"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG93"
FT                   /protein_id="CBG67534.1"
FT                   /translation="MSVPSLRLGLNLGYWVGGNDASNLSLASLAEDLGYSAVWVSEAYG
FT                   SDAVTVMSWIAARTTRIDVGSAVLQIPARSPATTAMTATTLDTLSGGRLRLGLGVSGPQ
FT                   VSEGWHGVRFASPLGRTREYVSLVRRALRREPLAHAGRHFTLPLPDGPGKALTLTIRPP
FT                   RERIPVYLAALGPKNLELTGEIADGWLPVFFSPAHAARQLVPLKAGLAKAGRTLAGFDI
FT                   APGVPLVTGPDWRSCARRVRGYAALYLGGMGGREDNHYTRLAERMGFGEGARAVQERFL
FT                   AGDYPGAMAAVPLAFLDATSLLGPRERIAERMTAFAEAGATTLNLMPVGPGLPGPDRAA
FT                   GALRVAVEAAELAGLLTTPRHARLTGPPVHRTRRTEFPRRDPYP"
FT   misc_feature    complement(355782..356738)
FT                   /locus_tag="SCAB_3251"
FT                   /note="HMMPfam hit to PF00296, Luciferase-like
FT                   monooxygenase, score 2.2e-05"
FT                   /inference="protein motif:PFAM:PF00296"
FT   CDS_pept        complement(356991..357893)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3261"
FT                   /product="putative integral membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3261"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67535"
FT                   /db_xref="GOA:C9ZG94"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG94"
FT                   /protein_id="CBG67535.1"
FT                   /translation="MNAPARVPHTPLPPHRTGRAPGPAAPGTVPAAARRSPVLRVVAES
FT                   TDLALRNLLHLRRSPGLLISCLVEPVVYALLIGYVFGNSLGGPAYRSYMMGGLIAQTVA
FT                   FTTTFTTVGLSRDLEQGMVDRFRALPISRVALPLGRTASDLATCVASLAVTTGCGLLMG
FT                   WRAHTGPVEVAAGVLLVLLFSFAMSWIGVFVALIAPNAQVAGSIGLIWLFPATFISSGF
FT                   VSGSTLPGPLSTVAAWNPITSLADALRRLFGNTPPPGFRVRHDWPAQHPALYTVGCSLL
FT                   LIALFAALSTWRYRTRTDH"
FT   misc_feature    complement(join(357018..357086,357219..357287,
FT                   357306..357374,357402..357461,357549..357617,
FT                   357645..357713))
FT                   /locus_tag="SCAB_3261"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SCAB3261 by TMHMM2.0 at aa 61-83, 93-115, 145-164, 174-196,
FT                   203-225 and 270-292"
FT   misc_feature    complement(357135..357767)
FT                   /locus_tag="SCAB_3261"
FT                   /note="HMMPfam hit to PF01061, ABC-2 type transporter,
FT                   score 1.3e-27"
FT                   /inference="protein motif:PFAM:PF01061"
FT   misc_feature    complement(357420..357452)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(357893..358852)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3271"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3271"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67536"
FT                   /db_xref="GOA:C9ZG95"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG95"
FT                   /protein_id="CBG67536.1"
FT                   /translation="MHVSATSAVIIEGLHKKYRTNRALCGVELEVRTGEIRGLLGPNGA
FT                   GKTTLVKILTTLLEPDHGSVLVNGWNVVEEPEKVRSTIGLAGQYSTVDGLLTGFENLYL
FT                   LAKLRGVGRRTARRVADDLLSRFRLADVAGRPAGTYSGGMRRRLDLAAALVGSPPLVVL
FT                   DEPTTGLDPESRLDTWEAVAELAADGTTILLTTQYLEEADRLADRITVIDRGLVVAEGT
FT                   SDALKASAGHRLVMCVAADHQLDAATRAAARATGTTPTVDRRARRVEAATADGRAALAR
FT                   ALTALEGEDVEVLEIGLGRCTLDDVFLGLTGHARRTAA"
FT   misc_feature    complement(358208..358702)
FT                   /locus_tag="SCAB_3271"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   3.2e-35"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    complement(358391..358435)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        359052..360749
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3281"
FT                   /product="putative NRPS-associated AMP-binding protein"
FT                   /note="PMID:15870461"
FT                   /note="PMID:16208464"
FT                   /note="PMID:15113000"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3281"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67537"
FT                   /db_xref="GOA:C9ZG96"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG96"
FT                   /protein_id="CBG67537.1"
FT                   /translation="MTYVSDFTDLTSTVRNRSELDLHSRRIASWLRERFSSGDRALLLY
FT                   SPGIEFTTAFSACVYAGVIAVPAPLPGRYRHERRRLAAIARDAGVRVVLTQRGDLPDVE
FT                   KWVAEEGILGAVCHTTDTGEGDPDAWTAPEVSPDTLALLQYTSGSTGDPKGVMVTHGNL
FT                   VANVERMAAMFRNDGDTTYGGWIPLYHDMGLIGLMLPGLLNGNGYVQMDPMSFLRRPYH
FT                   WLRMLDACGIGFTAAPDFGYEMCVRRVTDEQLAALDLSRVMFSDGSEPVRHEVVTAFTE
FT                   RFSAAGLRPEALVPAYGLAEATLMVSGTGGRPPLRTTVDATALENREFRPATGTQPSRT
FT                   LVGCGSPTGSDVLIVDPDTGRALPEGRVGEIWLSGPCVTAGYWKNGPVTDATFRAHTDD
FT                   GRGPFLRTGDLGALLDDDLYITGRSKDVLVLHGRNLHPSDIECELRSQHEELEGLHGAV
FT                   FMVGDDGGADVTPAVVVVHEIRAHWGAERLGSIAVDMKQTVVREFGVPVAAVALVRPGG
FT                   VRRTTSGKVQRAAMRALHLAGELDTLHLREDPLLTDALAGQRRRVSGR"
FT   misc_feature    359226..360428
FT                   /locus_tag="SCAB_3281"
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
FT                   5.2e-37"
FT                   /inference="protein motif:PFAM:PF00501"
FT   misc_feature    359478..359513
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT                   /inference="protein motif:Prosite:PS00455"
FT   CDS_pept        360746..362557
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3291"
FT                   /product="putative oxidoreductase"
FT                   /note="cluster 0135 collects two pairs: SCAB3291 and
FT                   SCAB3301, SCAB62911 and SCAB62921"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3291"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67538"
FT                   /db_xref="GOA:C9ZG97"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG97"
FT                   /protein_id="CBG67538.1"
FT                   /translation="MITTADLECLLTAHEDGPFSPETLAGLDEREEFPDGAVRVLDSAG
FT                   LSAHYVLPEGGDLAETVRLLRAVARRDLIVAIAHGKTFLGAAPTWVAGRPEQAARLAER
FT                   VRAGEPVCWGLTERDHGADLLAGELTATPDETAGAAALAGTDGIASTATTTATATATAT
FT                   ATATTDRTRPDHITGAPGGTEARAPRGWLLTGEKWLINNATRAGLACVLARTDPAGGPR
FT                   GFSLFLVDRGQLPEGAWRNLPKVATHGIRGADISGFALDGAPVPADALVGEEGDGIPVV
FT                   LKTLQLTRIACTALSLGAADHALRLARDFAAGRELYGRRLADVPHVRRILGRAAARALT
FT                   AEAVSLLSARSVHTLPGELSAISAITKAYVPTVTQETLGSLGELLGVRGFLTSPPGGGF
FT                   AKLERDHRICGIFDGSTAVNRAALLNQMPRLARQLSRRRTDGDGLGAAADLTAPLPAFD
FT                   PSRLTLLSVTGCSAVQALPDLAARARAHAAPGTGPLIDRVLVELTLLEAESADFVPVTG
FT                   GLPSTAFRLAEAYERAYAAAACLLLWLENPCLRTGRLGTADLWLRSCLTALLGRDGAEP
FT                   GGNVLDTLADVLLRIPSAEFSLLGGSA"
FT   repeat_region   361197..361202
FT                   /note="repeated element CAGCCA"
FT   misc_feature    361197..361250
FT                   /note="low complexity region; indel vs similar cds
FT                   SCAB62911"
FT   misc_feature    361568..362029
FT                   /locus_tag="SCAB_3291"
FT                   /note="HMMPfam hit to PF00441, Acyl-CoA dehydrogenase,
FT                   C-terminal doma, score 3.6e-20"
FT                   /inference="protein motif:PFAM:PF00441"
FT   CDS_pept        362554..364266
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3301"
FT                   /product="putative oxidoreductase"
FT                   /note="cluster 0135 collects two pairs: SCAB3291 and
FT                   SCAB3301, SCAB62911 and SCAB62921"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3301"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67539"
FT                   /db_xref="GOA:C9ZG98"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG98"
FT                   /protein_id="CBG67539.1"
FT                   /translation="MTTTTGLAPKRADELEHLLGPLADPAHPTGARAVLAADERAETLT
FT                   AGESLLHSYGLNAEFVPPELGGRLERADHLAEVMRALYRRDPALGLGYGAGSLIAGVTV
FT                   WTAGDERQREHAARLLLNGRRVAVAFHELAHGNDMAGTEFTATTAGDGSLRLSGRKEVV
FT                   TNIRRAEAMVVLARTDPRPGPRSHSLVLVDRAGADRARLTDLPRFATVGMRGVQLGGLV
FT                   FDDLPVPATAVLGPAGSGLETALKALQITRTVLPTMATGILDTGLRIAVDHLTGRRLYG
FT                   GAATDIPHVRSELAGVFADLLRAEALGAVGARALHLVPRAASVYASAVKFEVSRLLLAA
FT                   MDRLADLLGAHFYLREGPTALFQKLLRDLAPVGFGHIARAACQMSLLPQLPLLARRTWA
FT                   GPGSEPPDGLFALAEALPPLRYDLLALHAAGRDPVAGSLHALADTSWEAGHADLRTAVG
FT                   DDRTDLADLAAVCEGLSPVELGVDARPETYDLVTRYVRLLTRTVCVQVWRHAPSGDFLA
FT                   DPAWLRAVLHRSASGPYGPGPLPAPVEGALLAELLDRRDTGRSFGLTGRPLAL"
FT   misc_feature    362932..363090
FT                   /locus_tag="SCAB_3301"
FT                   /note="HMMPfam hit to PF02770, Acyl-CoA dehydrogenase,
FT                   middle domain, score 5.2e-05"
FT                   /inference="protein motif:PFAM:PF02770"
FT   misc_feature    363265..363699
FT                   /locus_tag="SCAB_3301"
FT                   /note="HMMPfam hit to PF00441, Acyl-CoA dehydrogenase,
FT                   C-terminal doma, score 4.7e-05"
FT                   /inference="protein motif:PFAM:PF00441"
FT   CDS_pept        364406..364687
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3311"
FT                   /product="putative carrier protein for NRPS multienzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3311"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67540"
FT                   /db_xref="GOA:C9ZG99"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZG99"
FT                   /protein_id="CBG67540.1"
FT                   /translation="MTAGNRDVHTWLTARVATYLRRSPQDIDTSLPLAEYGLDSLTALA
FT                   ITADIEDEFEVTVDDALTWDHPTVDALSAALSELVGERPAAGTSEKQV"
FT   misc_feature    364433..364633
FT                   /locus_tag="SCAB_3311"
FT                   /note="HMMPfam hit to PF00550, Phosphopantetheine
FT                   attachment site, score 1.4e-15"
FT                   /inference="protein motif:PFAM:PF00550"
FT   misc_feature    364508..364555
FT                   /note="PS00012 Phosphopantetheine attachment site."
FT                   /inference="protein motif:Prosite:PS00012"
FT   CDS_pept        364765..381309
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3321"
FT                   /product="putative non-ribosomal peptide synthetase"
FT                   /note="PMID:10801488"
FT                   /note="PMID:9006024"
FT                   /note="PMID:16647040"
FT                   /note="PMID:9427658"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3321"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67541"
FT                   /db_xref="GOA:C9ZGA0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGA0"
FT                   /protein_id="CBG67541.1"
FT                   /translation="MYTCGVYYDVPGPVDRALLARAVARTVDETEALRVRFHEVGETVR
FT                   QAVDPSVQGELAYLEFGGAADPEAAARAWIDSDLATPVPVTGERLFRHTLLRLGPDRYW
FT                   LHFRYHHILLDGYGQVLHCRRLLEVYTALAAGEQPSPSGFGTLREVLAEEDAYRRSARR
FT                   ERDGAYWQREFADLPDSTELGATVIDSGSHSDGSGSDSGSGSGSGSGSDEAAPALASGA
FT                   TGLAPSLPSATGRLSGTTAARVRELGGSRWSLPVIAAMVAHTHRVTGAHDVVVRVFMAA
FT                   RLSPRALATPAMLVNDVPLRIRVDSSTTFTALLERVAARLAEATRHQRYPHDELRRDLA
FT                   ATAHPGTLSGPSVNVLSFASAHLPCGPTEATARQLASGPVRDLALHAFGDPDADDGIEL
FT                   TVNAHPGRFTPGTAATHRDRYTRLLAAATEHPELPIGALDLLDDAERERFHARNDTSRT
FT                   ADPRSLVELFEAQDPAAEAVAFEGERLTYGELNARVNRLAHALRAQGVGPESRVAVKLP
FT                   RSLDLIIALWAVLKTGAAHVPVDTGYPDDRIAYLIADSRAALVLDEDSMRSLGEGESDT
FT                   DPGVVPRGDGAAYVIHTSGTTGRPKGTVVTHAGIANMLAWMQDEYRLTPADRVVHKTPV
FT                   GFDVSVWEVFWTLTRGATLVVARPDGHRDPAYLARLVRDEQVTVIHFVPAMLGPFLDEY
FT                   VPTASLRMVSCGGEALPAGLADRFHRECGARLHNSYGPTEFSVTATSHACTPGEPVTIG
FT                   VPTHNSRAYVLDPALQPVPDGVTGELYLAGVQLARGYLDRPGATAERFVADPYGPAAGG
FT                   RMYRTGDLVRRRADGSLEFAGRADDQVKINGQRVEPAEVEAVLASVPGVTQAVVLVHDS
FT                   SAGARQLVGYVTGAPEGDPRSHLARRLPAAMVPVSVFVLPSIPVTPHGKVDRRALPAPA
FT                   LPSSGRAPSTPAERTLHTLAAALLRRPELGVDDDLFALGADSIHAIQLVGRARRQGLRL
FT                   TPQDVFDHPTVARLATVAETASTASAAFSAPLAEDDPVGELPETPMARRLAERGGSTAG
FT                   YAQSLLLAAEPGLSYDRLTAALQRVLDRHDALRTHGTRILPVGAVRAEDCLSRAGDEDV
FT                   AARREAARRALSPEDGVMVRAVWFASGRLLLVLHHLVVDGVSWRILLTDLAEALAGAEL
FT                   SVPGTSLRRRAAPLAAPVDELPLWTDLLSTREPLLGIRPLDPAQDVHGTAGSVTVTVPA
FT                   DLTATVLGALPAAYRATPDDILLAALSAAVQRHRGEGPVLVDLEGHGRDHLPDGMDLST
FT                   TVGWFTRIHPVRLGPGTEADARLIKRTKEELRAIPHGGRGHDMLRDRLTGLAAPQISFN
FT                   YLGRLDATDLGGWRLADGGAAVELLADDDLALTHALQIDAYVRDGELTAEWTYPSGVLT
FT                   ETEVRVLAEAWTGALAELAPYTRGGLTVSDVPLVRITQEELDRFRGATDVLPLSPLQEG
FT                   LLFLALYEPDDPYVGQLVLETDTAFDPARMRAAAAALLHRHPNLRSAFRSRSQGAPVQV
FT                   VPADVKVPWEERDEDDLEAFLARDRARGFSVVRPPLLRFTALGDRRLVLTHHHLLLDGW
FT                   SLPLLVRELFTLYGGTALPPAAPYRDHLAWLDRQDDESSAAVWRERLAGLTAPTLLARA
FT                   DRTAEGHDVHELVLPEALTGALTSTARAHRLTLNTVVQGLWGLLLSAFTGRDDVVFGAT
FT                   VSGRPPELPGAESMLGLFVNTLPVRVLIDRDETLAALLARLQQEQRSLHAHQHASLAEL
FT                   VRASGFDTLFDTVVAFENYPMDEGIEAGGLRLAHAHLVERTHYPVTLSVFPGDRLRLRF
FT                   SFLSGAFAPTAVPRLAELLSALIDGAAAGLGSPAAEFVEVSEEDRLLVMGVAAEGSATA
FT                   PVTPAGGGEPRTPEEQSLCAIVAEVLGVERVGVDDEFFALGGTSILMIRMAHRVRDEFG
FT                   VDLSLRDLFAAPTVAGVAARLAGLAPQAKRITAEERPGRVPLSFAQERMWFLQRLQGSS
FT                   GTYNIPLAIRLTGALDRDALTGALAGLVTRHEALRTVYPEDADGPHQVVLPPETPYATA
FT                   FVQDCAPDLAADAARPFDLTSDVPLRTTLYETGPDSHVLLLVVHHIAADGASLRPLAED
FT                   ITAGYRARTGDTAAGFPELTVQYPDFAIWQRETLAADLPRQIAYWKQHLDGLPPEVTFP
FT                   GDRPRPAVATHRGDHVEFPVAPELYRRMLDLAGRTRTTPFMVLQAAVSLLLTRLGAGED
FT                   IPLGGVIADRPDSVLDDVVGVFINTLVYRMDTSGDPSFEELLVRVRETGLAAYAHQGVP
FT                   FERLVEELNPERSRSRHAFFQVMLAWLDLTEARFDLPEVTADPGPVTSGTAKFDVHFDC
FT                   HVHESGGLLCRLEYATDLFDRRTAESFATRFVRVLEGVTADPAQRLSEVDVLGAEDRAL
FT                   VLHGWNDTDVRFDGEGAAVALLEAHALRTPAAEAVRCEGESVTYGEFNARVNRLAHALR
FT                   ARGVGPESRVAVMLPRSVDLMVALWAVLKSGAAYVPIDTGYPADRIAYILADSGARLLV
FT                   SDRDADGFERIAPDVEGPEENPGVTAHGDNAAYVIYTSGSTGRPKGTVNTYAGMANRLW
FT                   WMQRDHRLAPGERVLQSTPVSFDVSVWEVFWTLMYGGTLVVARPDGHRDPLYLERLMRE
FT                   ESVAVVHLSASMLGAYLAETRLPDPVRLVVSGDEALPAELVRRFHEDSGAVLLNAYGPT
FT                   EAAVDVTAWAAPADTETVLIGAPVANTRAYVLDAALAPVAPGAPGELYVEGVQLARGYL
FT                   DRPGLTAERFVASPYGPPGSRMYRTGDLARWTADGELEYLGRADDQVKLRGFRVELGEI
FT                   EDAMADHPAVARAAAAVHGQWLVGYVVPAAPVDVDDLRDRLAARLPEYMVPAQIVTLDV
FT                   LPLTPNGKLDRKALPAPDLAHTAGRGPRTPQEEILCGLFAEVLRVPEVSVDDDFFALGG
FT                   HSLLVTRLASRIRAALDTDLDLSVLFEATTVARLASRLTGDGPRRSGVTARPRRGRLPL
FT                   SYAQERLWFLHRFEGPSPTYNLPVALRLSGDLDVAALTTALGDLAQRHEPLRTVFAEDG
FT                   EGPHQVILSSGPSPAVVRAAEEELDGLVADAVRTPFDLTAEPPLRATLFALGAGEHVLL
FT                   LVLHHIAGDGASMAPLARDLATAYAARTRDEEPDWSRLPLQYADFAAWQRQALGTADDP
FT                   DSALSRQLDHWRSTLAGLPEQMELPFDRPRPAVPTHRGDTVPFAVEPAVHEALGRLARE
FT                   HHTTVFMVVHAALVTLLHRLGAGDDIVIGSPVANRTDEALTPLVGFFANNLVLRTDLTG
FT                   DPDFAEVLRRVRAADLAAYAHQDVPFERVVEAVNPARSTARHPLFQTGLNFGNADQQAA
FT                   LDLAVDLPGLTARVRPVASPAAKFDLSFFLTELPEGGVNGLLEFATDLFDRGSAARIAE
FT                   RFTRLLTAVTAEPGRPVREFDVVDADERRLLLTEWNSTAHEVPDRTLTDLIEAQAARTP
FT                   DAPAVVFGATILSYAELDARANRLARRLIDLGAGPERYVAVLLPVSEDIPVVLLAALKT
FT                   GAGYLPLDPAHPADRLAFMLADIAPVAVVTTAELTDNIGSLADIPVVATDDPAIAERPS
FT                   GPVTGVVRRPEHAAFVIFTSGSTGRPKAVVVEHRSLVAYLAWATHVYESLRRRVLVHSP
FT                   VSFDLTATGMFGPLVSGGTVELVRWSASGPDPDAAVTRPDLVKATPSHLHLLGVVPEEY
FT                   SPGGQLVLGGESLLGDVLDAWRARHPGVTVLNEYGPTETTVGCSLFRIEPGDPVPPGVV
FT                   TIGTPAWNTRMYVLDALLRPAPVGTAGELYVAGDLVTRGYHGRPGLTAGRFVASPFGPP
FT                   GSRMYRTGDLARWTASGRLEFVSRVDDQVKIRGFRIELGEVEAVLTAQPGIDAAAVVVR
FT                   EDTPGDKRLVAYVVSEPDRPADPSALRAAAARALPDYMVPAAFVVLETLPLTANGKIAR
FT                   RALPAPDLTVGVPRTPAAEGVERRIAEVFAEVLGIPEAGADDDFFRLGGHSLLVARLVN
FT                   RIRTLFGAELSLRDVFEHSTVAGITALVTASGAGSAQPGPVRRERPDRVPLSAAQRRMW
FT                   FLDRLDGPAQTYTIPVVLRMTGPLDQGALRAAFGDLVRRHEVLRTVIAEGPQGPHQVVV
FT                   GTAPLVAVRSCDQAEFDAGVAEAARTPFSLEHHLPVRATLFTDGEREHALLLLLHHIAG
FT                   DGSSMRTLAGDLSTAYAARLTGRAPDWAPLPLQYADYALWERELPARRLDFWTKELAGI
FT                   PDQLELPTDRARPAVASHRGGTVPFAVPAALRERVDALGRDRGASAFMVLHATLVTLLH
FT                   RLGAGDDIVIGTPVEGRPDTALEDLVGLFANTLVLRADTSGDPTFEELLDRVRAVDVAA
FT                   YDHTDVPFEQLVEVLNPERSRSRHPLFQVMLTVNQEPVAPTLPGLAVTVGEAPGDHAKF
FT                   DLSLTLVENGEGGWSGSVEYASDLFDRATAESVATRWLRLLEEVTADPARPVHTLPLLT
FT                   PAEHTDVLVRRNDTGRPLPRMSLPEMFEAQVARTPDAVAVIGSRTRLTYDEVNRRANRL
FT                   ARHLVSLGAGPETVVAVVLPRRPDVLVALLAVLKSGAAYLPVDPANPRARIDALVADAG
FT                   ARIVLDERAFPAGSDRLPDDEDAFAVGPDRLPDGEGAFPVPDRLPDSDLGLPVHPHQAA
FT                   YLIYTSGSTGRPKGVVVEHGSLAAYLGEAVAMYPAASGESLVHTSLAFDMPVTTLFTPL
FT                   VTGGRVRFGDLDADTPSPGLLKVTPSHLRLLESLPDRVSDAANLVIGGEALDGTMLGAW
FT                   RARHPEAVVINEYGPTEATVGCVVHRLEPGDALDAGPVPIGRPLGNARVYVLDGHLQPV
FT                   PDGVWGELYLAGAGLARGYSGRPGQSAERFVADPYGPPGTRMYRVGDRARWNRAGVLEY
FT                   AGRVDEQVKVRGHRIEPGEIEAALTALDGVARAAVIAREDRPGDRRLVAYVVPRRRHGA
FT                   EPGPGDRPLNPHGAVTARPAGRVALDLDALRTRLAATLPAHLVPSAFVEVDEIPLNTNG
FT                   KLDRRALPAPPDAVAGTGRAPRTPVEVRLCALFAEVLDVPEVSADDDFFALGGHSLLAV
FT                   RLAGRIGEALGARFTLSTLLEAPTPAALARRLAESGPQAASWVPDSEAELSPSLRFTYG
FT                   PSPAGPSGAPHTGPYADGPREILLTGATGFVGAFLLAELLHRTSARVHCLVRARTDAEA
FT                   GERLTRALRRHGIALGLTPDDLRLNVVRGDLAEVDLGLAPGQWAELGERVDTIVHSGAH
FT                   VHHLSPYTRLKPANVEGTRTLLWLAAEGRPKAFHHLSTLGVFGLGQESRLVTETSPIEG
FT                   EKHPFGSGYAASKWVADRLVERAFERGAGGAVHRLGRIWAHTSTGAVSQDDMFSRLLTS
FT                   SAALGCHPGGPEAAEALLPVDVLARAVVELLLAGSAPGSDSGLDTGTGIARVHHLHHPH
FT                   RVGAGAFMRAYDRMHGTTSEEVPLAVWLRRLRSANERGRNLPILPYQASLEEYVRTAPD
FT                   PRRPVLRFENDRTLQRLRDLSVAIPDIDETAISRYWEFVTT"
FT   misc_feature    364795..365298
FT                   /note="SCAB3321: match to Pfam PF000668 Condensation:
FT                   codons 11..178; 59.70 bits; Evalue=9.9e-17. Motif HHXXXDG
FT                   thought to be part of active site see 365092..365112"
FT   misc_feature    365092..365112
FT                   /note="motif HHXXXDG thought to be part of active site for
FT                   condensation see PF000668"
FT   misc_feature    365119..365262
FT                   /note="subthreshold Pfam: PF07729 FCD; codons 119..166;
FT                   9.90 bits; Evalue 0.012. C terminal ligand binding domain
FT                   of many GntR-family regulators."
FT   misc_feature    365557..365679
FT                   /note="subthreshold Pfam: PF000668 Condensation; codons
FT                   265..305; 7.80 bits; Evalue 0.042. Peptide antibiotic
FT                   condensation domain. Active site probably includes HHXXXDG
FT                   motif."
FT   misc_feature    365881..365922
FT                   /note="PS00287 Cysteine proteases inhibitors signature."
FT                   /inference="protein motif:Prosite:PS00287"
FT   misc_feature    366220..367362
FT                   /locus_tag="SCAB_3321"
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
FT                   1.3e-165"
FT                   /inference="protein motif:PFAM:PF00501"
FT   misc_feature    366532..366567
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT                   /inference="protein motif:Prosite:PS00455"
FT   misc_feature    367276..367302
FT                   /note="PS00697 ATP-dependent DNA ligase AMP-binding site."
FT                   /inference="protein motif:Prosite:PS00697"
FT   misc_feature    367594..367785
FT                   /locus_tag="SCAB_3321"
FT                   /note="HMMPfam hit to PF00550, Phosphopantetheine
FT                   attachment site, score 4.2e-17"
FT                   /inference="protein motif:PFAM:PF00550"
FT   misc_feature    367663..367710
FT                   /note="PS00012 Phosphopantetheine attachment site."
FT                   /inference="protein motif:Prosite:PS00012"
FT   misc_feature    367678..367710
FT                   /note="PS00639 Eukaryotic thiol (cysteine) proteases
FT                   histidine active site."
FT                   /inference="protein motif:Prosite:PS00639"
FT   misc_feature    367840..368664
FT                   /locus_tag="SCAB_3321"
FT                   /note="HMMPfam hit to PF00668, Condensation domain, score
FT                   4.8e-24"
FT                   /inference="protein motif:PFAM:PF00668"
FT   misc_feature    369109..369942
FT                   /locus_tag="SCAB_3321"
FT                   /note="HMMPfam hit to PF00668, Condensation domain, score
FT                   2.8e-62"
FT                   /inference="protein motif:PFAM:PF00668"
FT   misc_feature    370432..370626
FT                   /locus_tag="SCAB_3321"
FT                   /note="HMMPfam hit to PF00550, Phosphopantetheine
FT                   attachment site, score 1.9e-19"
FT                   /inference="protein motif:PFAM:PF00550"
FT   misc_feature    370669..371547
FT                   /locus_tag="SCAB_3321"
FT                   /note="HMMPfam hit to PF00668, Condensation domain, score
FT                   6.3e-78"
FT                   /inference="protein motif:PFAM:PF00668"
FT   misc_feature    372106..373263
FT                   /locus_tag="SCAB_3321"
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
FT                   1.7e-159"
FT                   /inference="protein motif:PFAM:PF00501"
FT   misc_feature    372433..372468
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT                   /inference="protein motif:Prosite:PS00455"
FT   misc_feature    373492..373686
FT                   /locus_tag="SCAB_3321"
FT                   /note="HMMPfam hit to PF00550, Phosphopantetheine
FT                   attachment site, score 1.1e-19"
FT                   /inference="protein motif:PFAM:PF00550"
FT   misc_feature    373561..373608
FT                   /note="PS00012 Phosphopantetheine attachment site."
FT                   /inference="protein motif:Prosite:PS00012"
FT   misc_feature    373729..374631
FT                   /locus_tag="SCAB_3321"
FT                   /note="HMMPfam hit to PF00668, Condensation domain, score
FT                   4.7e-73"
FT                   /inference="protein motif:PFAM:PF00668"
FT   misc_feature    375202..376395
FT                   /locus_tag="SCAB_3321"
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
FT                   1.2e-136"
FT                   /inference="protein motif:PFAM:PF00501"
FT   misc_feature    375565..375600
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT                   /inference="protein motif:Prosite:PS00455"
FT   misc_feature    376648..376842
FT                   /locus_tag="SCAB_3321"
FT                   /note="HMMPfam hit to PF00550, Phosphopantetheine
FT                   attachment site, score 3.9e-22"
FT                   /inference="protein motif:PFAM:PF00550"
FT   misc_feature    376717..376764
FT                   /note="PS00012 Phosphopantetheine attachment site."
FT                   /inference="protein motif:Prosite:PS00012"
FT   misc_feature    376891..377763
FT                   /locus_tag="SCAB_3321"
FT                   /note="HMMPfam hit to PF00668, Condensation domain, score
FT                   5.5e-65"
FT                   /note="similar to pipecolate-incorporating enzyme"
FT                   /inference="protein motif:PFAM:PF00668"
FT   misc_feature    378316..379518
FT                   /locus_tag="SCAB_3321"
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
FT                   2.4e-131"
FT                   /inference="protein motif:PFAM:PF00501"
FT   misc_feature    378709..378744
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT                   /inference="protein motif:Prosite:PS00455"
FT   misc_feature    379846..380040
FT                   /locus_tag="SCAB_3321"
FT                   /note="HMMPfam hit to PF00550, Phosphopantetheine
FT                   attachment site, score 1.4e-20"
FT                   /inference="protein motif:PFAM:PF00550"
FT   misc_feature    379915..379962
FT                   /note="PS00012 Phosphopantetheine attachment site."
FT                   /inference="protein motif:Prosite:PS00012"
FT   misc_feature    380185..381021
FT                   /locus_tag="SCAB_3321"
FT                   /note="HMMPfam hit to PF01370, NAD dependent
FT                   epimerase/dehydratase fam, score 1.4e-06"
FT                   /inference="protein motif:PFAM:PF01370"
FT   misc_feature    380188..380889
FT                   /locus_tag="SCAB_3321"
FT                   /note="HMMPfam hit to PF01073, 3-beta hydroxysteroid
FT                   dehydrogenase/iso, score 0.0013"
FT                   /inference="protein motif:PFAM:PF01073"
FT   misc_feature    380191..380910
FT                   /locus_tag="SCAB_3321"
FT                   /note="HMMPfam hit to PF07993, Male sterility protein,
FT                   score 3.4e-70"
FT                   /inference="protein motif:PFAM:PF07993"
FT   CDS_pept        381487..381696
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3331"
FT                   /product="MbtH-like protein"
FT                   /note="PMID:11447274"
FT                   /note="PMID:12207020"
FT                   /note="PMID:15113000"
FT                   /note="PMID:12837387"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3331"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67542"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGA1"
FT                   /protein_id="CBG67542.1"
FT                   /translation="MTNPFENPDGIYRVLTNDEGQHSLWPDFTPVPEGWATVFGPDSRT
FT                   ACLEYVEREWTDLRPQSLVRAMGE"
FT   misc_feature    381487..381690
FT                   /locus_tag="SCAB_3331"
FT                   /note="HMMPfam hit to PF03621, MbtH-like protein, score
FT                   3.7e-37"
FT                   /inference="protein motif:PFAM:PF03621"
FT   CDS_pept        381729..382730
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3341"
FT                   /product="putative oxidoreductase"
FT                   /note="PMID:16208464"
FT                   /note="PMID:12062399"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3341"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67543"
FT                   /db_xref="GOA:C9ZGA2"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR014503"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGA2"
FT                   /protein_id="CBG67543.1"
FT                   /translation="MSSVDVTQAPYAPASADGTVRYGARTLARLGHVAAELLDRAGDRV
FT                   DDPAWVALARHAWEDVPSEIRRTVREFRRHSGPGGALVLRRLPIGAAQLPPTPMARGSV
FT                   QHAPSLPAATLLLFAAGLGDPAAFAAEKSGALVQDVVPVPGQEAVQGNVGSVELTFHTE
FT                   NAFHPHRPDYVMLLCLRLDHEGTAELRTSCARRVLPLLTPRSREALGRPEYVTEAPPSF
FT                   GPAGEGTAHAVLTGDPDDPDWCFDEAATKAVTPEGRAALAELAEVAHRTYTGVLLRPGD
FT                   LAVVDNRTTLHGRSAFTPRYDGRDRWLQRTFAFSDLRRSRDHRPGDGTVLVK"
FT   misc_feature    381921..381980
FT                   /note="subthreshold Pfam PF04245 NA37: codons 65..84; 1.30
FT                   bits; Evalue=0.86."
FT   misc_feature    381924..382667
FT                   /note="subthreshold Pfam: PF08943 CsiD; codons 66..313;
FT                   215.90 bits; Evalue=0.69."
FT   misc_feature    381939..382688
FT                   /note="subthreshold Pfam PF02668 TauD; codons 71..320; bit
FT                   -36.70; Evalue=0.00011 (extends trusted fragment see
FT                   382488..382688.)"
FT   misc_feature    382488..382688
FT                   /note="Pfam PF02668 TauD: codons 254..320; 24.10 bits;
FT                   Evalue=1e-06. Oxidoreductase"
FT   CDS_pept        382739..384064
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3351"
FT                   /product="putative aminotransferase"
FT                   /note="TTA-Leu codon(s) 8 may indicate regulation by BldA"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3351"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67544"
FT                   /db_xref="GOA:C9ZGA3"
FT                   /db_xref="InterPro:IPR004637"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR012773"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGA3"
FT                   /protein_id="CBG67544.1"
FT                   /translation="MTPVRDALREPLTGKVRAEMTETGRTPLAVFERHESTVRSYCRDF
FT                   PVVFERAAGHHLWDTSGRRYVDLLCGAGSLNYGHNPPEIVDRVTAYLAAGGPVQSLDLH
FT                   TTAKADFLERFTRLVLEPRGLGDHVVQFPGPAGTLAVEAALKLARKVTGRTEVIAFTGG
FT                   FHGASLGSLAATTSPLLRGAAGVPLTDVTILPYGDAAEPDPFAALEDALGPGATAPPPA
FT                   AVLLETVQGEGGLHTAPRAWLARLRELADASGTLVVVDDIQAGCGRTGTFFSFEDAPGL
FT                   RPDLVCLSKSLSGMGLPMAALLIRRELDRWAPGEHNGTFRGHNLAFVAGSAALDHWADP
FT                   HFTDHVAELAGAIRTSLASITDALPVGTAEVAGRGAMSGLRFPASGTAEWIREALFRTG
FT                   VVAETSGSGHVLKLLPPLTMPLADWKDVADTLGATVQAVATA"
FT   misc_feature    382880..383890
FT                   /locus_tag="SCAB_3351"
FT                   /note="HMMPfam hit to PF00202, Aminotransferase class-III,
FT                   score 1.5e-60"
FT                   /inference="protein motif:PFAM:PF00202"
FT   CDS_pept        complement(384194..385195)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3361"
FT                   /product="putative NT-sugar reductase"
FT                   /note="PMID:16723573"
FT                   /note="PMID:15112997"
FT                   /note="PMID:9353926"
FT                   /note="PMID:10972798"
FT                   /note="PMID:10767533"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3361"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67545"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGA4"
FT                   /protein_id="CBG67545.1"
FT                   /translation="MQSMEYTQLGRTGLKVSRLVLGTMNFGPQTDEADSHVIMDAALDA
FT                   GINFFDTANVYGWGDDKGRTESIIGNWFAKGGDRRDKVVLATKVYGNMGTEDAAWPNHD
FT                   KLSALNIRRAVDASLKRLRTDHIDLYQFHHVDRDTPFEEIWQAVDVLVQQGKILYAGSS
FT                   NFPGYKIAQANETAARRGGTIGLVSEQCLYNLYERRAEMEVIPAAQEYGLGVIPWSPLH
FT                   GGALGGVLKKMVEGGRRSEGRDAGAMSGPEVRAKIQAYEDLLDKHGLEPGEAALAWLLT
FT                   RPGVTGPIVGPRTSEQLASAVRAVELELSEEVLDGLDEIFPGPGPSPEAFAW"
FT   misc_feature    complement(384230..385168)
FT                   /locus_tag="SCAB_3361"
FT                   /note="HMMPfam hit to PF00248, Aldo/keto reductase family,
FT                   score 2e-66"
FT                   /inference="protein motif:PFAM:PF00248"
FT   CDS_pept        385259..386173
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3371"
FT                   /product="putative transposase"
FT                   /note="cluster 0025 8: SCAB3371, SCAB4481, SCAB7601,
FT                   SCAB11701, SCAB20281, SCAB40511, SCAB68181"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3371"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67546"
FT                   /db_xref="GOA:C9YSX6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSX6"
FT                   /protein_id="CBG67546.1"
FT                   /translation="MKTDLDTLATALYARIDDELKASPWLAPYRPVVGIAPTLSDAELV
FT                   TLAVMSALLGYTSERRWLRRVGKDFGRLFPYVPQQSGYSKRLRAASSLLTSMIRILARD
FT                   TSLWSDDVWLVDSTPVGCGCSRETAKRSDLAGWAQYGYCASHSRYFWGLRLHLVCTLGG
FT                   LPVLFALTGAKADERETLRDMLDTAPDVTAARPGQTIIGDKNYYGREFEHDLAERHLEL
FT                   LRPARKGEAERAGAHLFKPLRQVIESINQTLKAQLDLERHGGKSPAGVAARVLCRILAL
FT                   TAAIWHNDKTGQPIKRSLTAYDH"
FT   misc_feature    385592..386107
FT                   /locus_tag="SCAB_3371"
FT                   /note="HMMPfam hit to PF01609, Transposase DDE domain,
FT                   score 2e-15"
FT                   /inference="protein motif:PFAM:PF01609"
FT   CDS_pept        complement(386308..386694)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3381"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3381"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67547"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGA6"
FT                   /protein_id="CBG67547.1"
FT                   /translation="MTDDVFLADCRARLGFDLLSNTWNAVVLWALRDGPRRPVELTERI
FT                   GGISSKVLTETLRRLQFNGLVARQVRADAPSRVEYQLTDLGRTLLAPIGAVGVWAFENG
FT                   DDVMAAQEASCTPGTPASESPPTR"
FT   misc_feature    complement(386371..386643)
FT                   /locus_tag="SCAB_3381"
FT                   /note="HMMPfam hit to PF01638, HxlR-like helix-turn-helix,
FT                   score 1.2e-25"
FT                   /inference="protein motif:PFAM:PF01638"
FT   misc_feature    complement(386416..386646)
FT                   /locus_tag="SCAB_3381"
FT                   /note="HMMPfam hit to PF03551, Transcriptional regulator
FT                   PadR-like family, score 4.7e-05"
FT                   /inference="protein motif:PFAM:PF03551"
FT   CDS_pept        386806..387489
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3391"
FT                   /product="putative reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3391"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67548"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGA7"
FT                   /protein_id="CBG67548.1"
FT                   /translation="MMRIGVLGTGNMAEALATPWVRAGHEVIIGGRDAHKAERLAKRIG
FT                   GGATPAGLRATAATGQVVLAALPFGVGAEVARDLNVALEGKVLVDCSNPIGPGFRLLTQ
FT                   GGPSAAQHLAAAAPGAHVVKAFNLCHEDVWRMRPPVFDGRPLAVPISGNDETALMCVAE
FT                   LVRDMGCEPLAAGGLERAGLLEATAALFIALWVGEGADAQAIAPPLAYAAGPGRREDQE
FT                   AGGGA"
FT   misc_feature    386809..387210
FT                   /locus_tag="SCAB_3391"
FT                   /note="HMMPfam hit to PF01210, NAD-dependent
FT                   glycerol-3-phosphate deh, score 0.0025"
FT                   /inference="protein motif:PFAM:PF01210"
FT   misc_feature    386812..387372
FT                   /locus_tag="SCAB_3391"
FT                   /note="HMMPfam hit to PF03807, NADP oxidoreductase coenzyme
FT                   F420-depe, score 9.4e-37"
FT                   /inference="protein motif:PFAM:PF03807"
FT   CDS_pept        complement(387465..388430)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3401"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3401"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67549"
FT                   /db_xref="GOA:C9ZGA8"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGA8"
FT                   /protein_id="CBG67549.1"
FT                   /translation="MTPDRFFSLMLLLASRDAVTTQELASALGVSLRTITRDLNWLRDA
FT                   GLPVTAQRGRLGGVTMLPGSGVDLTRLTPGERDHLSLIGLDEKQRAELDASAESERALS
FT                   KIAAARSRRADELLPLTDVVHVDSRPWLQAHTAGPTPASLIGAVRRGRRLRIAYDSPRE
FT                   PGPRDLVVDPYGLLAKAGIWYLVADRARTPRMYRLERITTWKEVDQPRRIRESQTLATV
FT                   AAALLEQWERNHGVEVSATVDRTQIERAQRIFGQRLVRDEQEESAAGHKVTIRFLHLGD
FT                   VRTLLPFGSTITVHGPAEARAHLSDLATRLAAHYAPPPAS"
FT   misc_feature    complement(388152..388403)
FT                   /locus_tag="SCAB_3401"
FT                   /note="HMMPfam hit to PF02082, Transcriptional regulator,
FT                   score 8.1e-05"
FT                   /inference="protein motif:PFAM:PF02082"
FT   misc_feature    complement(388245..388418)
FT                   /locus_tag="SCAB_3401"
FT                   /note="HMMPfam hit to PF08220, DeoR-like helix-turn-helix
FT                   domain, score 0.0015"
FT                   /inference="protein motif:PFAM:PF08220"
FT   misc_feature    complement(388251..388418)
FT                   /locus_tag="SCAB_3401"
FT                   /note="HMMPfam hit to PF08279, HTH domain, score 3.5e-11"
FT                   /inference="protein motif:PFAM:PF08279"
FT   CDS_pept        388491..388889
FT                   /transl_table=11
FT                   /gene="ehpR"
FT                   /locus_tag="SCAB_3411"
FT                   /product="putative phenazine antibiotic biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3411"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67550"
FT                   /db_xref="InterPro:IPR026275"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGA9"
FT                   /protein_id="CBG67550.1"
FT                   /translation="MRTHHLREGTTMTTSVVSIVYVNDAPAAARFYGDLLGKSPSFATP
FT                   GYITFDLGPGAELGLWSGQFEDLSPDVPRTGEVCLSLDGGPDEVNAIFKQWQSKDITVL
FT                   REPHDLGFGLTFLAADPDGNLLRVALKG"
FT   misc_feature    388491..388571
FT                   /gene="ehpR"
FT                   /locus_tag="SCAB_3411"
FT                   /note="Signal peptide predicted for SCAB3411 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.902) with cleavage site
FT                   probability 0.757 between residues 27 and 28"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    388533..388874
FT                   /gene="ehpR"
FT                   /locus_tag="SCAB_3411"
FT                   /note="HMMPfam hit to PF00903, Glyoxalase/Bleomycin
FT                   resistance protein/Di, score 7.9e-07"
FT                   /inference="protein motif:PFAM:PF00903"
FT   CDS_pept        388979..389728
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3421"
FT                   /product="hypothetical protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3421"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67551"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGB0"
FT                   /protein_id="CBG67551.1"
FT                   /translation="MLTDPSPVPTGTEFESLPLPRRPCVQGPARSAARPAHERVMGEPQ
FT                   QFRRTAARPEHAEGALRRFGNTTSELPACISGKRRPWGMAGKRYSLMSVHKDAAFTLPR
FT                   GATGMFLPRDGPPPETDQRMFRAALFAAARAARGRVGETEERAYPRTFHMSSVIVGTAE
FT                   CVVLCHAHHPWIACAQERRDWYTEQFLSPPPWARSFADQGFTVLDRAQLTLPFSAIDTS
FT                   VLTPGEWREVRSYGITTLGGLLFNSWD"
FT   CDS_pept        389909..390571
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3431"
FT                   /product="putative adenylate kinase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3431"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67552"
FT                   /db_xref="GOA:C9ZGB1"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGB1"
FT                   /protein_id="CBG67552.1"
FT                   /translation="MLLAAHLSIQHISTGDLFREHIDQGTALGQSAHTHLRAGLLAPDD
FT                   VTIGMIKERLARPDIERGFLLDGFPRNPAQAEALDGILADSGARLDAVLALEIPEAQVV
FT                   RRIAGRRLCRQDREHIFHVEYNPPAVTGVCDVCGGELYQRDDDRESTVRLRLEVYRRET
FT                   APVIDHYRARGQVTTISALGDVQDVRDRVLVAIGQGDVSRAPMSPLPSAGRMRGSRP"
FT   misc_feature    389912..390433
FT                   /locus_tag="SCAB_3431"
FT                   /note="HMMPfam hit to PF00406, Adenylate kinase, score
FT                   1.1e-49"
FT                   /inference="protein motif:PFAM:PF00406"
FT   misc_feature    390098..390133
FT                   /note="PS00113 Adenylate kinase signature."
FT                   /inference="protein motif:Prosite:PS00113"
FT   misc_feature    390236..390346
FT                   /locus_tag="SCAB_3431"
FT                   /note="HMMPfam hit to PF05191, Adenylate kinase, active
FT                   site lid, score 8.2e-13"
FT                   /inference="protein motif:PFAM:PF05191"
FT   CDS_pept        390608..391309
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3441"
FT                   /product="TfxG-like protein"
FT                   /note="PMID:8509324"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3441"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67553"
FT                   /db_xref="GOA:C9ZGB2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGB2"
FT                   /protein_id="CBG67553.1"
FT                   /translation="MNHDGLVRHTGSMRHDAEEPLSGGNVSDGVVRVGDTVRRPAGPWT
FT                   PAVHALLTHLHEVGFDAAPRPLGLDDQGREVLTFMPGDVVWPDRFSLMEPARQLARVAR
FT                   LIRHFHDAVQDFMPPPEARWQTLIPAEGSDIIAHNDLAPWNLVVADEARWAFIDWDAAG
FT                   PGSRLWDVAYAMHGFIPLSAHPDWQSPDAAAQGVQPWARLWAEGHGDAWRNDAEYIEQR
FT                   EDQWMRALLAG"
FT   misc_feature    391013..391051
FT                   /note="PS00109 Tyrosine protein kinases specific
FT                   active-site signature."
FT                   /inference="protein motif:Prosite:PS00109"
FT   CDS_pept        391370..392086
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3451"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3451"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67554"
FT                   /db_xref="GOA:C9ZGB3"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGB3"
FT                   /protein_id="CBG67554.1"
FT                   /translation="MESMKEKRAARDQQAERARFEALAHVAAEPLHRYLLRRADPDQVD
FT                   DVLSDTLLVLWRRIEDVPGLQPATESETEPEVPAAHVPDPDAVLPWCYGVARGCLANAR
FT                   RAERRRRSLLDRLTWTASTASTATEVARSGADHSDLHAALAQLRPLDREIVLLWAYEEL
FT                   APSRIAEVTGLSANAVSIRLHRAKKKLAARLERKTGPRPGHETDEGTGIRTGTGTGNGN
FT                   GTAYGTFGTRKGRSSR"
FT   misc_feature    391778..391939
FT                   /locus_tag="SCAB_3451"
FT                   /note="HMMPfam hit to PF08281, Sigma-70, region, score
FT                   2.8e-12"
FT                   /inference="protein motif:PFAM:PF08281"
FT   misc_feature    391796..391945
FT                   /locus_tag="SCAB_3451"
FT                   /note="HMMPfam hit to PF04545, Sigma-70, region, score
FT                   2.5e-08"
FT                   /inference="protein motif:PFAM:PF04545"
FT   CDS_pept        392083..392679
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3461"
FT                   /product="putative membrane protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3461"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67555"
FT                   /db_xref="GOA:C9ZGB4"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGB4"
FT                   /protein_id="CBG67555.1"
FT                   /translation="MNDDELLAQLKAMDPAVISKAPRPDVPRLVEATMNTTTPTTVTTG
FT                   KPAPRRLLVPALAFAALLLVGGGIAWGPGQGADVDTLDKPDLAMTLRLQPGGAAVKCAA
FT                   PTSESLRQNELAFEGTVTAKKGDAVSLEVDHWYRAPADRSTTTVRLTQDESNSEAVSFQ
FT                   VGEHYLVTAENGTIPICGGTTVATDETRGWFRHAF"
FT   misc_feature    392236..392304
FT                   /locus_tag="SCAB_3461"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB3461 by TMHMM2.0 at aa 52-74"
FT   CDS_pept        complement(392732..393376)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3471"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3471"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67556"
FT                   /db_xref="GOA:C9ZGB5"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGB5"
FT                   /protein_id="CBG67556.1"
FT                   /translation="MGLIHIELFATLDLVGQAPGGPDEDPAGFPFGGWQAPLLDEVTGA
FT                   QVGTAYQDTDALLLGRRTYDIFAGYWPHQKGGEDGEIADLFNRVPKYVASRGNPDLSWA
FT                   GSTRLGPDLAAAVREIRDRHEHVKVVGSLDLVQSLLREKLFDRLDLWVHPIVLGVGKKV
FT                   FDGGEVPTNLTLLEPPAAGTKGTVYLRYGLAGGTPATGDMSAPDRGVGSAD"
FT   misc_feature    complement(392816..393367)
FT                   /locus_tag="SCAB_3471"
FT                   /note="HMMPfam hit to PF01872, RibD C-terminal domain,
FT                   score 1.1e-12"
FT                   /inference="protein motif:PFAM:PF01872"
FT   CDS_pept        393751..396279
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3481"
FT                   /product="putative levanase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3481"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67557"
FT                   /db_xref="GOA:C9ZGB6"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018053"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGB6"
FT                   /protein_id="CBG67557.1"
FT                   /translation="MSSARGGRRARLRTTAAAAAVCALSAALLVPKACAADTAPYAETY
FT                   RPQFHFTPEKNWMNDPNGLVYYKGEYHLFYQYNPSGNGWGDMSWGHAVSKDLVHWEELP
FT                   LALSHDDKEMVFSGSAVVDENNTTGFGTKKNPPMVAIYTRHDKSTGIQSQALAYSTDLG
FT                   RTWTMYQGNPVIDIGSKDFRDPKVQWYAPTQSWLMTVSLSAEHKVRFYSSKNLKDWTRL
FT                   SDFGPTGATGGVWECPDLFPLPVDGDKGNTKWVLVVNINPGGIAGGSAAQYFIGDFDGT
FT                   KFTAEDDGTYTPPAGTVVQGFEDTGFGTWTATGTAFGPGPAAGTLDGQQTVTGFAGKGL
FT                   ANSFHSGDATTGTLTSPSFTVDSPYLNFKVGGGRHPHLPGRTLADFEGGTYGAWTATGD
FT                   AFGPAPATGTLSGQQQVTGFQGSGLVNTFRDGDATTGTLTSPEFTIDKRYVNFLIGGGN
FT                   HPAGSADPTALELLVDGQVVRSATGRDAEALQAASWDVRDLAGRTARIRVVDDNTGRWG
FT                   HINADQITLSDTQVRPGSEETAVHLVVDGQVVRSVTGSDSETLDWASFDMRAYRGKKAQ
FT                   VQLVDLNTGGWGHILADQFTTADAPALSVLQRAGWADYGKDYYAAVSWENAPGSKRHMI
FT                   GWMSNWDYAGATPTTAWRGAQSIPRQMALRTVDGRVRLTSEPVTSVKSLRQDPPATAAT
FT                   TVVTNTSQALIGPAAHGKALDIEATFSLKDAERFGLKVRTGTAGEETVIGYDTTTQELY
FT                   VDRTRSGAVDFNGTFPGVQSAPMKAANGKIKLRILVDWSSVEVFGGSGEAVITDQIFPD
FT                   PASQGVQVFAENGSVKLDKATVWHLDSAHD"
FT   misc_feature    393751..393855
FT                   /locus_tag="SCAB_3481"
FT                   /note="Signal peptide predicted for SCAB3481 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.800 between residues 35 and 36"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    393898..393939
FT                   /note="PS00609 Glycosyl hydrolases family 32 active site."
FT                   /inference="protein motif:Prosite:PS00609"
FT   misc_feature    393898..395781
FT                   /locus_tag="SCAB_3481"
FT                   /note="HMMPfam hit to PF00251, Glycosyl hydrolases family
FT                   32 N termi, score 2.5e-97"
FT                   /inference="protein motif:PFAM:PF00251"
FT   misc_feature    395908..396153
FT                   /locus_tag="SCAB_3481"
FT                   /note="HMMPfam hit to PF08244, Glycosyl hydrolases family
FT                   32 C termi, score 7.1e-23"
FT                   /inference="protein motif:PFAM:PF08244"
FT   CDS_pept        complement(396317..397168)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3491"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar proteins suggested to inhibit
FT                   beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3491"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67558"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGB7"
FT                   /protein_id="CBG67558.1"
FT                   /translation="MFAHAQALAAGRRHSVGRRSDGTVLAVGHDAARECRVEGWSDVVA
FT                   VAAGNVHTARNTGKSHTVALRSDGTVLATGWNGDGQCDVAGWRGVTAVAAGWRYTLGLL
FT                   ATGRVLATGRNTEGQCDVRSWRETVALSCGDWHAVGLRSDGSAQAAGNNRRGQCAVAGW
FT                   RDLTAVAAGYCHTVGLRADGRAVATGDRTTGACEVEEWQDVVGLDAGSHHTVGVTASGR
FT                   ALATGDNSHGQGDVGDWRDIVAVAAGSTHTLGLRTDGTVVSTGNNADGQCAVDTWSGVR
FT                   LP"
FT   misc_feature    complement(396404..396436)
FT                   /note="PS00626 Regulator of chromosome condensation (RCC1)
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00626"
FT   misc_feature    complement(396632..396664)
FT                   /note="PS00626 Regulator of chromosome condensation (RCC1)
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00626"
FT   misc_feature    complement(396746..396778)
FT                   /note="PS00626 Regulator of chromosome condensation (RCC1)
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00626"
FT   CDS_pept        complement(397255..397968)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3501"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3501"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67559"
FT                   /db_xref="GOA:C9ZGB8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGB8"
FT                   /protein_id="CBG67559.1"
FT                   /translation="MIVERAYAHLPSHDEDAWPWSVPCVRQMLHEGLRFTAPVTFLVGE
FT                   NGSGKSTLVEALAEGFGLDSYGGSHDWRYASPRGKSALGERMRFDAASGRGRRMATSWS
FT                   ARKGFFLRAETALDALDREGFSPEEVSHGEGFLAAFRGKFLHAGLYVLDEPEAALSFTS
FT                   CLELIGHIDRLAKQGGQVICATHSPVLTALPGADIIEVGEHGMRRVTWRELDLVDHWRR
FT                   YLADPHAYLRHIVEP"
FT   misc_feature    complement(397816..397839)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(398094..398627)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3511"
FT                   /product="conserved hypothetical protein"
FT                   /note="PMID: 857724"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3511"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67560"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGB9"
FT                   /protein_id="CBG67560.1"
FT                   /translation="MVGSDETRLVVVRGNSASGKSSVAEQLREKFGRGLALVAQDILRR
FT                   TVLRERDRPGAANIGLIDLTARYALDAGYHVVVEGILYADHYGDMLARLRTDHRGPTHG
FT                   YYLDVPFAETLARHATKSFAQDVGEKELREWYRPGDLLPGGVETVIGVDSTLQETVDRI
FT                   MAETGLAHLPAVDR"
FT   misc_feature    complement(398565..398588)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        398774..399352
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3521"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3521"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67561"
FT                   /db_xref="GOA:C9ZGC0"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGC0"
FT                   /protein_id="CBG67561.1"
FT                   /translation="MALTERPAEPAAAQETACCAHRDHHHPTAAEAEAPESARERVNRR
FT                   WNEILQETRVTQTGVQILFGFLLSVAFTPLFHELETLDRTIYVTTVVLGAAATGALIAP
FT                   VSMHRFLSGQRMKDDLVETAARMMMCGMVLLALTIGCTLLLILRFVVPGVLAELLVGAV
FT                   MLWFGVCWYALPLLLRRRAGRRTRSGEDA"
FT   misc_feature    join(398948..399001,399029..399097,399158..399226,
FT                   399239..399307)
FT                   /locus_tag="SCAB_3521"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SCAB3521 by TMHMM2.0 at aa 59-76, 86-108, 129-151 and
FT                   156-178"
FT   misc_feature    399164..399196
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(399381..399905)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3531"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3531"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67562"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGC1"
FT                   /protein_id="CBG67562.1"
FT                   /translation="MEAGGGTVGRMRTYEWEDPQLSAAAVGRVSGLEFLRDVKDGRLPA
FT                   APIAATLDMALDEVEFGRVVFSLTPGEEHYNPIGSVHGGVFATLLDSAAGCAVQSTLPA
FT                   GMGYTSLDLTVKFLRRITVDTGTVRAVGTVLNGGRRTALAEATLIDGEDRLLAHATSSC
FT                   MLIPLPARSQT"
FT   misc_feature    complement(399435..399674)
FT                   /locus_tag="SCAB_3531"
FT                   /note="HMMPfam hit to PF03061, Thioesterase superfamily,
FT                   score 1.7e-13"
FT                   /inference="protein motif:PFAM:PF03061"
FT   CDS_pept        399988..400458
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3541"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3541"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67563"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGC2"
FT                   /protein_id="CBG67563.1"
FT                   /translation="MEWLEASTDNCPVQRTLDVVGEKWSLLILRDAASGVRRFDDFRRH
FT                   MGLSEAVLSDRLRKLTAAGILTTVPYRDPGSRARNEYRLTRKGWDLWPVLIALRQWGET
FT                   YAGDPAGPVLDLHHSDCGAPVRVVVECAAEHSALAPRDVTARPGPGARRRSG"
FT   misc_feature    400042..400317
FT                   /locus_tag="SCAB_3541"
FT                   /note="HMMPfam hit to PF01638, HxlR-like helix-turn-helix,
FT                   score 2.6e-20"
FT                   /inference="protein motif:PFAM:PF01638"
FT   CDS_pept        400865..402214
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3551"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3551"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67564"
FT                   /db_xref="GOA:C9ZGC3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGC3"
FT                   /protein_id="CBG67564.1"
FT                   /translation="MNHSDQRFHVIVLSNFAKGFDKYAYAYGKAGIPESTYPDRFHLLT
FT                   RAELGIGVGKAGRLLDRLAIPGDRLLVLETTVDPDELVPNASTGLGMELRRPRIRLSAL
FT                   YELDELDQEGDDFTLRPTTVEDTMAASLRLHPSVRRRYADSRPRSVSMLPVASACQARC
FT                   SFCFSSASISSDQPPARVPWDAVAHWLERARAAGAERAVITGGGEPTLIPFDQQLRLVS
FT                   ACSAAFPKVVLITNAHTLAKGEHADRAERLAALSTAGLSVLAVSRHHQDDAVNERLMML
FT                   RTPVHSVVDTWRVDRDRWPGLRTRLICVLQHGGVADAAGIAAYLSWAAALGVEEVCFKE
FT                   LYVSTSTESLYFDRAANVWSREHQVSLSLVTRFAERHGFALASRLPWGSPVYDGTWDGR
FT                   PIRIAAYTEPSLLWERANGIARSWNVMADGRCYASLEDRASEIVAEGATA"
FT   misc_feature    401309..401341
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    401321..401839
FT                   /locus_tag="SCAB_3551"
FT                   /note="HMMPfam hit to PF04055, Radical SAM superfamily,
FT                   score 8.2e-06"
FT                   /inference="protein motif:PFAM:PF04055"
FT   CDS_pept        402211..403245
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3561"
FT                   /product="hypothetical protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3561"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67565"
FT                   /db_xref="GOA:C9ZGC4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGC4"
FT                   /protein_id="CBG67565.1"
FT                   /translation="MRFQEFQEFRQRQLSASPSLLDAAETNVYGALAPLRPQLPTGTPT
FT                   VHRCDLARAWLRRYELPEEWSGRAMVSRGVRHGLGVVFPWLRAARGRLWLPGDVYPVYF
FT                   ELARAAGLEPASYPTLPAPALPRAPAVDRPEYLLLANPSKPLGRHLSDAECAELIAWLR
FT                   ESPRRRLLIDTVYDLETPFATGTRRLLDTGRAVLLHSATKGWLWPRTFGVALLGTADAE
FT                   LADAFRADPPAPAQLQLADRLLTEHGDVPRQVVAELAARAERLFERLPEDVLGAISAAS
FT                   RTCPGNYFFPVAIPAQVLRREYGVLAAPVSVFGATQWSGSVLTSLADAFGPAPTPAPHP
FT                   VRRR"
FT   CDS_pept        complement(403332..404027)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3571"
FT                   /product="GntR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3571"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67566"
FT                   /db_xref="GOA:C9ZGC5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGC5"
FT                   /inference="protein motif:GO:0050789"
FT                   /protein_id="CBG67566.1"
FT                   /translation="MRVPIEAVETKSDLAYRQVRDRILSGELEPGSVIQQRELARSIGI
FT                   STTPLREALRRLKGEGLVDLDAHRDARVAPLRAEEARDLLELRRSLDPLAASLAAERRT
FT                   KADIRAIRAAADGLAPLPPHPSVGQLVAHRRFHAAIYTASHNDLLIGTLESLWDKADRY
FT                   RRLALRTDRGQEARDQKAREHDLLVECVALGDSAGAEEIMRGHIDTSLGATAVRRLGHA
FT                   GSAASVREG"
FT   misc_feature    complement(403401..403781)
FT                   /locus_tag="SCAB_3571"
FT                   /note="HMMPfam hit to PF07729, FCD domain, score 1.7e-27"
FT                   /inference="protein motif:PFAM:PF07729"
FT   misc_feature    complement(403809..403997)
FT                   /locus_tag="SCAB_3571"
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family, score 3.8e-13"
FT                   /inference="protein motif:PFAM:PF00392"
FT   misc_feature    complement(403818..403844)
FT                   /note="PS00148 Arginase family signature 2."
FT                   /inference="protein motif:Prosite:PS00148"
FT   misc_feature    complement(403857..403931)
FT                   /note="PS00043 Bacterial regulatory proteins, gntR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00043"
FT   CDS_pept        404302..405414
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3581"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3581"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67567"
FT                   /db_xref="GOA:C9ZGC6"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGC6"
FT                   /protein_id="CBG67567.1"
FT                   /translation="MTTADTPHRYTLGVLYGDGIGPEIVPASVLVADAALAAVGAPGVA
FT                   WKPLPVGSQAIEEHGEAIPTATLAALAETDGWLLGPHDSAAYPEPFRSQLNPSGTIRKH
FT                   FDLYANVRPAKSFPGGKAVVPGTDLVIVRENTEGFYADRNTHRGTGEFMPTPDIALAMG
FT                   IVTRAACERIAREAFELASERRNKVTVVHKANVLRLTTGLFRDVCREIAQDYPEVEVDD
FT                   FHIDAMTVHLVRRAQEFDVVVTENMFGDILSDLAAELAGSLGIAPSLNASQDRAMAQAA
FT                   HGSAPDIAGQDLANPGAMILSTAMLLQWLGARHEDTALVRAASVIEKGVAATLAQGTAT
FT                   RDMGGTAGCRAFTEAVVTSIDRVVASTGRR"
FT   misc_feature    404332..405369
FT                   /locus_tag="SCAB_3581"
FT                   /note="HMMPfam hit to PF00180, Isocitrate/isopropylmalate
FT                   dehydrogenase, score 8e-110"
FT                   /inference="protein motif:PFAM:PF00180"
FT   misc_feature    405037..405096
FT                   /note="PS00470 Isocitrate and isopropylmalate
FT                   dehydrogenases signature."
FT                   /inference="protein motif:Prosite:PS00470"
FT   CDS_pept        405527..406057
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3591"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3591"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67568"
FT                   /db_xref="GOA:C9ZGC7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGC7"
FT                   /protein_id="CBG67568.1"
FT                   /translation="MWPDLSTDVAAVLASLPEEGSIELVLEDAEGRITSTIADDIRFAE
FT                   QAAESTGALAAAALSLYAGVRQPLFTAVLPDNDGVLRARWRTDPTPSDLHWALLKSLYR
FT                   GKVVTGTVSGIADRGVTFVDIDGFTARTRPDHLSDTVPVGREVTAEVLEVDMVRERVLL
FT                   SLTTRRPGPMSGE"
FT   misc_feature    405827..406024
FT                   /locus_tag="SCAB_3591"
FT                   /note="HMMPfam hit to PF00575, S1 RNA binding domain, score
FT                   0.0011"
FT                   /inference="protein motif:PFAM:PF00575"
FT   CDS_pept        complement(406068..409700)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3601"
FT                   /product="putative WD-40 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3601"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67569"
FT                   /db_xref="GOA:C9ZGC8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGC8"
FT                   /protein_id="CBG67569.1"
FT                   /translation="MRAEAGGITYRSLARRAGFSVTTLSQAAAGERLPTLAVTLAYVGA
FT                   CGGDLTEWEARWKETVTQSATDGAGDDDGSPAPYRGLARFETGNSGLFFGREQLTTDLV
FT                   DLLRRRRFAAVFGPSGSGKSSLLRAGLIPVLQNARGRDRRPAAIRILTPGEHPARSHAP
FT                   VLSPAVASDGDGGTDTVILVDQFEEVFTLCHDPDERARFIDLLLTARQPVSRLRVLLAV
FT                   RGDFYGRCAEHRDLADALRDANLLAGPMSPAELRNAVVKPATAAGLTVERALTARLVEE
FT                   VADAPGGLPLLSHALLETWRRRRGKTLTLTGYEAAGCLDGAIAKTAEDVYGRFTPAQAV
FT                   AARRVLLRMVVPGDGTADTRRPVHRAGLPDTDQNDSAGVVEALAKARLLTLDGDTVELA
FT                   HESLITAWPRLSGWIEEDRERLRVLRNLTEGAHTWQDLAREKDALFRGSRLASAREHFD
FT                   DAERGELTDLERAFLKAGRDHQQKGRRRYRWVLTAVTGALCLALVAAGLAIAQRQSAIT
FT                   AQRLAESRQLAAQSGALLRSDPDLAALLAVHAYRTSPTREAGAALYAAAALPLRRRLVT
FT                   GTEPVMSMALSPDGRTLATHGKDGRTGIWDLPEGRLRHSFTAHGSGGVAAFGPGGRVLA
FT                   VATGDTIGVWDATTGTRISTLPAADGAVIGMAFSPDGHTVAAAYPSAVRVWDVATGRVR
FT                   HHLTGLDAPQAVVFAADGRTVAAVGHNGSVRVWDTGSGRTRTVRDGRSEGTTAVAFSPD
FT                   GRTYATVRADGSTRLREVITGTLLRTIRGGFENSRTVVFSPDGRILAVPDSGGTVRRWD
FT                   AATGTELSTLTTGHRGRGITHVALGPDGRTMVTGNNLDPAVRVHDLPADRPRTTLAGRP
FT                   GTSVTDLAFGPDARTVSTVGQGPPGRAAVQLWDARTGDRRATLPLDRNPARRGGDLPIT
FT                   VLRPAALGFAPNKDVLVARVGENGKAEIRDVGTGRLRQSRAVGSLDKPVFSPDGRLLAF
FT                   VGNGGALRMWHLSTGALRTLRTGGTQSVRTVLFAPDSRTLAVLTVEADGDRITLLDAAT
FT                   GRAQRTVEPSVRTSLSLAFSPDGRTLAAASSGGSVKTWDARTGGLQDSFRADGEVRSLA
FT                   FGSDGRTLALGTTTGVGLWDLTTAQKRAAVPTRPVAAVAFGPDGYTLAIATGNSVALWN
FT                   IDLPDPVRAMRIVCEAVDRTLTSQEQARYLHDQSARVGCRPSAR"
FT   misc_feature    complement(407514..407558)
FT                   /note="PS00678 Trp-Asp (WD) repeats signature."
FT                   /inference="protein motif:Prosite:PS00678"
FT   misc_feature    complement(407883..407996)
FT                   /locus_tag="SCAB_3601"
FT                   /note="HMMPfam hit to PF00400, WD domain, G-beta repeat,
FT                   score 0.00082"
FT                   /inference="protein motif:PFAM:PF00400"
FT   misc_feature    complement(408051..408083)
FT                   /note="PS00435 Peroxidases proximal heme-ligand signature."
FT                   /inference="protein motif:Prosite:PS00435"
FT   misc_feature    complement(408168..408236)
FT                   /locus_tag="SCAB_3601"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB3601 by TMHMM2.0 at aa 489-511"
FT   misc_feature    complement(409329..409352)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        409905..411176
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3611"
FT                   /product="putative integral membrane protein"
FT                   /note="TTA-Leu codon(s) 21 may indicate regulation by BldA"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3611"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67570"
FT                   /db_xref="GOA:C9ZGC9"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGC9"
FT                   /protein_id="CBG67570.1"
FT                   /translation="MRFPPLDNAAPTLSPSAIRRLLGTFSPSGPSRLDWPDALRGIAAL
FT                   VVVFDHSSYTFMPEFRRELMPHFNTSRYGIMVFFLVSGYIIPRSLERRGSVRTFWIGRI
FT                   FRVHPLLAAVVTMLLAFDALGIAEIRDFGRQSTVSVMAAHITMLQELLGTPSLLLVLWT
FT                   LSYEMAFYLLVVALFTLRLHQSSASVAVVLAVLASVSVAAGVAVPPSALSGVFDTGPVI
FT                   ACASIALGLAVCCASAGPAVLRLFGGVLGGVLALTLVAFNGTVPLWEGLVILAVMFLGT
FT                   TVHRAENSQCTWRFAAGTTILVAVCAVGSAYWFGGAEHFTRRGWISAFLLALVTFGAGL
FT                   AVRGRGLPRVLTGLGTISYSVYLVHPVLLAVIDSTIGRRRHDSIALEVAFCMALLPLCC
FT                   LTYRWIEAPSQRFGRRWAHRTPRR"
FT   misc_feature    410001..411140
FT                   /locus_tag="SCAB_3611"
FT                   /note="HMMPfam hit to PF01757, Acyltransferase family,
FT                   score 1.8e-15"
FT                   /inference="protein motif:PFAM:PF01757"
FT   misc_feature    join(410094..410162,410223..410291,410370..410438,
FT                   410457..410525,410538..410606,410625..410693,
FT                   410703..410762,410781..410849,410877..410936,
FT                   410955..411023,411051..411119)
FT                   /locus_tag="SCAB_3611"
FT                   /note="11 probable transmembrane helices predicted for
FT                   SCAB3611 by TMHMM2.0 at aa 64-86, 107-129, 156-178,
FT                   185-207, 212-234, 241-263, 267-286, 293-315, 325-344,
FT                   351-373 and 383-405"
FT   misc_feature    410670..410714
FT                   /note="PS00678 Trp-Asp (WD) repeats signature."
FT                   /inference="protein motif:Prosite:PS00678"
FT   CDS_pept        411538..414192
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3621"
FT                   /product="putative serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3621"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67571"
FT                   /db_xref="GOA:C9ZGD0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR007822"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGD0"
FT                   /protein_id="CBG67571.1"
FT                   /translation="MRYEAYSYADATFYDSPVRWASSDEFAAVGEPLPSGWTGSAREVW
FT                   VGRTPAGVELPDQGWKIHVSACLDNAEHILSVVGAYCVEHRMAYKFLRSPALVQTQNAK
FT                   YASRGSSGKFMTLYPVDEPQLERSLNDLDEALAGQRGPYILSDLRWRNGPLYLRYGGFT
FT                   EQFCRSETGELVLALREPSGRLRPDVRRAVFEVPEWAPVPAVLAKALADRATTSMADFP
FT                   YTVERALHFSNGGGIYLARRASGGDEVVLKEARPDAGLDQRGDDAVTRLGREHDILRRL
FT                   EGLPCVPAALDHHTAWEHHFLVQEYISGEPLNRWFGQRYPLIHPDPAPEEIERFRDEAL
FT                   DVLAKIEEGLRAIHARGVVFGDLHPRNLIVRPDGRVCFIDFELASPADEFVRPGLGAAG
FT                   FAAPADLKGYAIDDHALDALRLWIFMPLTQLTALDPDKRRQLSRAASRRFGLPPATDAG
FT                   RSAPPSSLSPPPTPSPTLPSPAHPVRSAPPAQAGTSDFDRLSALFSGDRADWPALRDSL
FT                   AAAIAASATPERTDRLFPGDPSQFTHDGLGLAYGAAGVLWALHSVGAPVAPDHVEWLLE
FT                   AVARRPCRPGLYTGAHGVALTLDRLGQARQAHNLLDRLLKEPLDGQGGDLAGGLPGVGL
FT                   TLLHFAATTSDGSLLAGAVDVADRLAARLMDEPGGPASGRRPGLLHGPSGSALLFLSLY
FT                   DRTGDTGLLDLAEQALRLDLARCVVGADGTLQVDEGSRVLPYLETGSAGIAAVLHAVLR
FT                   HRPDAGLRQSLEQIRLAAEPEFIVQPSLFNGRAGLILLLHLLRDDAPVDDPLVRRHIRR
FT                   LVWHLIPHRGHAAFPGEQLLRLSMDLATGSAGILLALGSALADTPALPFWPGGRRATVP
FT                   APLTGPPTPAPAP"
FT   misc_feature    412243..412755
FT                   /locus_tag="SCAB_3621"
FT                   /note="HMMPfam hit to PF01163, RIO1 family, score 0.00086"
FT                   /inference="protein motif:PFAM:PF01163"
FT   misc_feature    413161..414126
FT                   /locus_tag="SCAB_3621"
FT                   /note="HMMPfam hit to PF05147, Lanthionine synthetase
FT                   C-like protein, score 1.1e-08"
FT                   /inference="protein motif:PFAM:PF05147"
FT   misc_feature    413917..413964
FT                   /note="PS00723 Polyprenyl synthetases signature 1."
FT                   /inference="protein motif:Prosite:PS00723"
FT   CDS_pept        414353..414478
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3631"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3631"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67572"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGD1"
FT                   /protein_id="CBG67572.1"
FT                   /translation="MSILNLQALETPDETVEYLSVLSSLSVVNCTNSTVSTLLCL"
FT   CDS_pept        414789..416414
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3641"
FT                   /product="putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3641"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67573"
FT                   /db_xref="GOA:C9ZGD2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGD2"
FT                   /protein_id="CBG67573.1"
FT                   /translation="MAVAVSSAAALALPATLAAAVDRALSATAGQGILPVAAVLGLLTG
FT                   AEALAQYAGPRATAEATARLRAALVRHAMALGPHPSRRTTTGDLVARLTASAAEAGLSV
FT                   QAAVYAVAQLAMAAGSVLALGLLAPELAAAFLITAPAGWLLLRRHLRRTVRRGEGYQSA
FT                   QAAVATHLLNALAGRRTIAAAGTLECEIERVLRPLPELGRHGRALWDSQRRVSWSTGLL
FT                   APATQITVIAVAGHELLAGSLGPGDLVAALGYATLGLGGFGTAQSLLDLARARAGHQRV
FT                   REVLALTPPSPGLRPLPPGPGRVELRGITVRTPAGDTVLDGLDLVLPARHSVALVGRSG
FT                   AGTSLLAAVAGGLRVPDRGLVLLDGVPLDDVRPADLRAAVSYAFSDPELTGGTILDALS
FT                   TAADRVPEERVHAAARAAQADAFVRRLPAGYDTLLTDAPLSGGQRQRLGLARALARDGR
FT                   LLVLDDAMSSLDSAAEAAVLRALDGPYGDRTRLVVTRRTAAAARADLVAWLHEGRVAAL
FT                   APHHELWQLPAYRALFDSAEDVDD"
FT   misc_feature    414789..414866
FT                   /locus_tag="SCAB_3641"
FT                   /note="Signal peptide predicted for SCAB3641 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.659 between residues 26 and 27"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    415149..415217
FT                   /locus_tag="SCAB_3641"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB3641 by TMHMM2.0 at aa 121-143"
FT   misc_feature    415773..415805
FT                   /note="PS00639 Eukaryotic thiol (cysteine) proteases
FT                   histidine active site."
FT                   /inference="protein motif:Prosite:PS00639"
FT   misc_feature    415785..416324
FT                   /locus_tag="SCAB_3641"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   3.3e-28"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    416103..416147
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        416416..418362
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3651"
FT                   /product="putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3651"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67574"
FT                   /db_xref="GOA:C9ZGD3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGD3"
FT                   /protein_id="CBG67574.1"
FT                   /translation="MDRRRARRPARSPKTLRTHAADRAGDGPGGSSSLTAAHRAAVRLI
FT                   RAALTADRGAALRLTWWTLLSAAPALVCGKALALAVDRGFLLDRPRTAALGLGVFALCA
FT                   LGGAWAGRQSYPWLAEIVEPLRDRLLRDVVTGTLRRAVAPRAAPDDGAAVAVARLTRQV
FT                   EAVRDALAGQLMLLWQFVLTVAAVIAGTAVLAPAAVPLVAVPLLAALVLFAVLAPATVR
FT                   RQRAAFDAEEALAGRTVATFTALRDIVACGAQEHARDEALDAVDRHLRASNALASVSAL
FT                   RRLIVALGAHSPLLLVVLAAPGLHARGVSAGEIVGILAYVLATLEPAVRLLVQGLGASW
FT                   LRLAVAAERLAEAAHHPVPGPDPDPALIPSDGSAALSGIVFAYGPGAEPVLDGLDLSLA
FT                   DGEHLAVVGPSGIGKSTLADVLAGMLPPDRGRVVLGGVPLERVTRDDLARARVLAPQTP
FT                   YVVTATLRENLRYLAPDTSDAVLTATMTELGMDALAERLGGLDGPVDPAALSSGERALV
FT                   ALARVHLSDARLVILDEATRHLDATAERRVEEAFRRRPGTVVTVAHRMSVARRADRVLL
FT                   LDGTRPAIGTHDTLLARVPLYADLMGHWHDGATGTGRPQTGRSGPGRTGDGLSTPGAAS
FT                   RRSSSRPAADPAP"
FT   misc_feature    join(416590..416658,416686..416745,416923..416991,
FT                   417004..417072,417265..417333)
FT                   /locus_tag="SCAB_3651"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SCAB3651 by TMHMM2.0 at aa 59-81, 91-110, 170-192, 197-219
FT                   and 284-306"
FT   misc_feature    417616..418155
FT                   /locus_tag="SCAB_3651"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1e-46"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    417637..417660
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(419045..419485)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3661"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3661"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67575"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGD4"
FT                   /protein_id="CBG67575.1"
FT                   /translation="MAVQRMDNVGIVVEDMDAAIAFFVELGMELEGRGQVEGSFADRCT
FT                   GLDGVRCDIAMMRTPDGHSRLELAKYRSPAAIDAGARDRPHNIVGTHRVMFAVDDIEDT
FT                   VARLRPHGAELVGGIARFEDSYLLCYLRAPEGFIVGLAEQLH"
FT   misc_feature    complement(419063..419473)
FT                   /locus_tag="SCAB_3661"
FT                   /note="HMMPfam hit to PF00903, Glyoxalase/Bleomycin
FT                   resistance protein/Di, score 2.5e-06"
FT                   /inference="protein motif:PFAM:PF00903"
FT   CDS_pept        419812..421833
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3671"
FT                   /product="putative glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3671"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67576"
FT                   /db_xref="GOA:C9ZGD5"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR000933"
FT                   /db_xref="InterPro:IPR011024"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR016286"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGD5"
FT                   /protein_id="CBG67576.1"
FT                   /translation="MKAAALAGGVAAVGLPQALWPATAEAYAVPSKMDWWYQARFGMFI
FT                   HFGSYSQLGQGEWAFDSQQWSKANYQTQVTRTFDPARFNAATIAELAENAGMKYVVITA
FT                   KHHEGYAMWNSDVASFTDTTAAKLYNLHDYNGIQSDPLRDLKSECENRGIKFCLYYSIL
FT                   DWNHPSQTDRHEGGLTTMSSQAARTAYIADMKAQLQELLDRYDPALLWFDGDWFDNPAG
FT                   PTLEDWWLDSDGVDLYNWLIARKPGLIVNERVKRDHGLGDYAVAEFGIPSAPMGRPWER
FT                   CSTMNGAWGYNASSENAYRSLKDIVQELVTVVSRDGNLLLNIGPKGDGSVTAGTQTVLN
FT                   GLASWMSTYSDSIHGTSGSPFAAEPSWGKVTRKSGKLFAHVFTWPANGRLRIPMVDNTI
FT                   SRVHLLDNPSVSLPYTVTDQIDVTVPATAPNANDAVVCVEVQGMPVRASALVFQNVDYD
FT                   AGRAVLPLGGYTSAQLSAAGLAPATASSILLPPGFQLTGYSGDNFTGTAWTFTADTRDL
FT                   RVTGNNDAIRSLRVTFRPDKYFRLTNVTNHLALDGGGNAASGSNLKLWEAVVHSNLQWQ
FT                   AIELGNGYYRLVNRTNGMVADGWGATANGDPARQKSWDGGNTQQWQITHRGQGRYSIAN
FT                   RSTGLVLDGGGTVASGSTAKQWTWQQNNNLLWTFDAVT"
FT   misc_feature    419812..419889
FT                   /locus_tag="SCAB_3671"
FT                   /note="Signal peptide predicted for SCAB3671 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.995) with cleavage site
FT                   probability 0.516 between residues 26 and 27"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    419812..420990
FT                   /locus_tag="SCAB_3671"
FT                   /note="HMMPfam hit to PF01120, Alpha-L-fucosidase, score
FT                   2.7e-15"
FT                   /inference="protein motif:PFAM:PF01120"
FT   misc_feature    421420..421812
FT                   /locus_tag="SCAB_3671"
FT                   /note="HMMPfam hit to PF00652, Ricin-type beta-trefoil
FT                   lectin domain, score 5e-09"
FT                   /inference="protein motif:PFAM:PF00652"
FT   CDS_pept        complement(422012..422773)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3681"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3681"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67577"
FT                   /db_xref="GOA:C9ZGD6"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGD6"
FT                   /protein_id="CBG67577.1"
FT                   /translation="MENAASDGTPSAEGILSGPEIVFTADFASTRQWVAGRSWAYPNGG
FT                   PVNPGDNKLDYLTADPSYSRSGTFRATRRRDGRWNAGLLTTEESEEGFTVRAGDVLEAR
FT                   VRLPYEAGAWPAIWTWRDGDQEIDIFEYHPDNPDLLELTNHVRGSNLYYRDPAIGPGAW
FT                   VDLRVEFGVRSVIWWVNGSRVFADRRGVGRSWHAYLIVNLSVCAGRYHPPPNLHVKEMS
FT                   YTVQHLVVRRPAALLEELSEELEEVADIDGP"
FT   CDS_pept        complement(423000..423146)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3691"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3691"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67578"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGD7"
FT                   /protein_id="CBG67578.1"
FT                   /translation="MPRMMERIKQFASSPQGRRVAEQARRAAADPRRRSQAKSLLSKLR
FT                   GRR"
FT   CDS_pept        423369..424811
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3701"
FT                   /product="putative hypothetical protein (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3701"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67579"
FT                   /db_xref="GOA:C9ZGD8"
FT                   /db_xref="InterPro:IPR000413"
FT                   /db_xref="InterPro:IPR013517"
FT                   /db_xref="InterPro:IPR013519"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="UniProtKB/TrEMBL:C9ZGD8"
FT                   /protein_id="CBG67579.1"
FT                   /translation="MTVRARTFAATAAVVALTATGLTLPLAGSAAAATTVRFDFNGDGY
FT                   LDIAVGMPDSTVKGKAKAGYVSVIYGGSGAPYQSHGEIGQDEPGIPGTPEAGDRFGSSV
FT                   TPVDVDGDGDFELAVGASGESLTSDQYKDEGIITVLDYSNGDIKGTTVARGTTEYSGIG
FT                   STVAAGDYDGDGDADLAYGENSEEDGTLRFRPGPLTSDRVAGTSLRRYSMGGRTLDLAT
FT                   GDFDGDGRDDLATTWRALEDSGTFITRWNDRAEPAQWWSDPDRGSALAVADFDRDGTDD
FT                   LAVGPVQPNSESDTTHCQDRLGGAVLLFKGSRGTAFGTENECFTQSSPDVGGNAEEGDD
FT                   FGAALAAGDLNGDDLPELVVGVPGEDVGTLKDAGGYVVLNGTEHGLRGGLARSQSTPNM
FT                   QGAAEAGDRFGAQVAVGDYNSDGLRDTAVSAPGENAGGPTSGGVWFVPSSTVETYTPGK
FT                   ALTPFGFALVKGVYKYGEVLGL"
FT   misc_feature    423369..423464
FT                   /locus_tag="SCAB_3701"
FT                   /note="Signal peptide predicted for SCAB3701 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.722 between residues 32 and 33"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    423405..423473
FT                   /locus_tag="SCAB_3701"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB3701 by TMHMM2.0 at aa 13-35"
FT   misc_feature    423666..423788
FT                   /locus_tag="SCAB_3701"
FT                   /note="HMMPfam hit to PF01839, FG-GAP repeat, score 0.0019"
FT                   /inference="protein motif:PFAM:PF01839"
FT   misc_feature    423852..423950
FT                   /locus_tag="SCAB_3701"
FT                   /note="HMMPfam hit to PF01839, FG-GAP repeat, score
FT                   0.00032"
FT                   /inference="protein motif:PFAM:PF01839"
FT   misc_feature    424389..424502
FT                   /locus_tag="SCAB_3701"
FT                   /note="HMMPfam hit to PF01839, FG-GAP repeat, score 3e-05"
FT                   /inference="protein motif:PFAM:PF01839"
FT   misc_feature    424593..424706
FT                   /locus_tag="SCAB_3701"
FT                   /note="HMMPfam hit to PF01839, FG-GAP repeat, score
FT                   3.9e-06"
FT                   /inference="protein motif:PFAM:PF01839"
FT   CDS_pept        424867..425286
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3711"
FT                   /product="hypothetical protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3711"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67580"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSQ5"
FT                   /protein_id="CBG67580.1"
FT                   /translation="MFHRTMPTTSAVEDRVIPPADCWYTPQWRAGAAVDFVRPDSPGLD
FT                   SCRLVHASSLHLLDAAGAARLAARVEGSGGRRHAGGVELLTRTAVFGKVAVPAGGVAVV
FT                   REARSASGGACGDARGRPVRGRPVGGVSRVRSPGS"
FT   CDS_pept        complement(425258..426673)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3721"
FT                   /product="putative hypothetical protein (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3721"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67581"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSQ6"
FT                   /protein_id="CBG67581.1"
FT                   /translation="MSMWLCVTTLLATGCSADGGGPAPSPPSPARRDAGAVNRDDVNGD
FT                   GHADVVVNGWYKKPKSGGDWHNNRFVALAAPGGPEPAAAFRLADRYAKPDPRLTSSPIT
FT                   NDRSVQFTADLDDDGYADIVVRNPLSHPKGTHTLEQCIVWGGPKGPTGATELPADLLRA
FT                   TAAGDFDGDGALDLLTLAQPGSEYDRKPQPAVVLYGPLSRDGGVPRGTSSVDVGHEGWA
FT                   TVAHTVVGDFDGDGRDDLVTRAVYDEEDVRLEEEMPEDVVDAVYYRGTAHGLQPAGSVP
FT                   GIRSRAPGLADGAVPVAVGDFDGDGHADILAREGYRDAVVVHGSDEGPGRGRTGSELGR
FT                   LDTVGARAVGDVDGDGRDDIATQSPGDDRRIGRVVVVLSGKDGPGTPRSVEIDRYAIGL
FT                   GGSPQHVGDRDFFGWDLHLADLDTDGRAELLIGTFGFNKPRKDAGYWILRGTKDGPSTT
FT                   DRSFIRTRDFGPG"
FT   misc_feature    complement(425705..425797)
FT                   /locus_tag="SCAB_3721"
FT                   /note="HMMPfam hit to PF01839, FG-GAP repeat, score
FT                   8.6e-06"
FT                   /inference="protein motif:PFAM:PF01839"
FT   misc_feature    complement(425918..426007)
FT                   /locus_tag="SCAB_3721"
FT                   /note="HMMPfam hit to PF01839, FG-GAP repeat, score 0.0005"
FT                   /inference="protein motif:PFAM:PF01839"
FT   misc_feature    complement(426578..426673)
FT                   /locus_tag="SCAB_3721"
FT                   /note="Signal peptide predicted for SCAB3721 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.924 between residues 32 and 33"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    complement(426629..426661)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        426906..427265
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3741"
FT                   /product="putative integral membrane protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3741"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67582"
FT                   /db_xref="GOA:C9YSQ7"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSQ7"
FT                   /protein_id="CBG67582.1"
FT                   /translation="MASPPRDDQDAPVAPRGRRRRSWPLDLAVALLFLIMDTVIVMTAG
FT                   YLLLVLGHGITASATHSGDVPVLTWLIVWGVPAVGAASAVTHGLLRMPITCVVQGLFTL
FT                   ACTILAVNGTRMILL"
FT   misc_feature    join(426993..427061,427104..427172,427191..427259)
FT                   /locus_tag="SCAB_3741"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SCAB3741 by TMHMM2.0 at aa 30-52, 67-89 and 96-118"
FT   misc_feature    complement(427353..431027)
FT                   /note="putative ABC transport system"
FT   CDS_pept        complement(427360..428184)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3751"
FT                   /product="putative ABC transport ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3751"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67583"
FT                   /db_xref="GOA:C9YSQ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSQ8"
FT                   /protein_id="CBG67583.1"
FT                   /translation="MSATANPSEPGAAAPLLRVEDLTVELGHGVAARKVLKSVSFDIAR
FT                   GSTLALVGESGSGKTTLARTLVGVHRPSGGRILVDGAPLRPARGRAGAATVQMIPQDPY
FT                   SSFDPRRTVAQSLAEALDPVRARVGPARARIAELLGQVSLDPDGMDRYPHEFSGGQRQR
FT                   LAIARALAPGPRFVIADEITSALDLTTQAEILNLLADLRRRLSLTMLFISHDLAVVRHV
FT                   SDSVAVLLHGDLVELGPTGATFAAPSHPYTAQLLASVPGDPRFRLDEEPATV"
FT   misc_feature    complement(427489..428049)
FT                   /locus_tag="SCAB_3751"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   4.7e-55"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    complement(427675..427719)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(428005..428028)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(428184..430034)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3761"
FT                   /product="putative oligopeptide transport system (integral
FT                   membrane and ATP-binding proteins)"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3761"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67584"
FT                   /db_xref="GOA:C9YSQ9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSQ9"
FT                   /protein_id="CBG67584.1"
FT                   /translation="MATDTTTRRWRRNPSLTSGAVILGLLVLVALVAPLLLRGPAETLT
FT                   GDTRLGPGAGHLLGTDAFGRDVLARALVATRLTLLMAAAATAVSFVVGVAIGALVHLAP
FT                   GWLRETSLRLIDSAVAFPSLVLALVIAAVLGPGTMSAIVAIAVAGVPGFARLTANLAAT
FT                   VADKDYVLTARLLGVPGLRILARHVLPNISGPLLVLLSSSFTLSLLDISSLSFVGLGVQ
FT                   NPQYDWGRLLNEALPSIFAQPSLVLAPSIMLIVTGVGAMLLGDGVASLVDPRTRPTAPA
FT                   PAKSADPAGRAVPAQKGRTPAPAADGAAAAAVPDPDGLLTVDGLTVRAGDRTLVDDVSF
FT                   TIAAGQIVGLVGESGSGKSTIAMAVAGLLPEGVRADAARLALDDLDLLAAPSERRLATE
FT                   IGIVYQDPIGTFNPALRLGTQLTEVTRVHQGTSRRQAAQDMVRALADIRVTEPERRLRQ
FT                   HPHELSGGMLQRASIASATTTNPRLLIADEPTTALDVTVQAEVLRQFRRINREHGTAML
FT                   FISHDIGVVGVLCDTVLVLHGGRVVDRTTGADLRRGTVTHPYTRALLAATPAAVEAGGT
FT                   LTAVRWTADAHAAPPGGAPTDDCDLSDTAADRSPAAEGSH"
FT   misc_feature    complement(428418..429002)
FT                   /locus_tag="SCAB_3761"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.6e-43"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    complement(428604..428648)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(428958..428981)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(429204..429812)
FT                   /locus_tag="SCAB_3761"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 5e-36"
FT                   /inference="protein motif:PFAM:PF00528"
FT   misc_feature    complement(join(429597..429665,429726..429794,
FT                   429930..429998))
FT                   /locus_tag="SCAB_3761"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SCAB3761 by TMHMM2.0 at aa 13-35, 81-103 and 124-146"
FT   misc_feature    complement(429912..430034)
FT                   /locus_tag="SCAB_3761"
FT                   /note="Signal peptide predicted for SCAB3761 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.986) with cleavage site
FT                   probability 0.788 between residues 41 and 42"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(430024..431055)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3771"
FT                   /product="putative ABC transporter integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3771"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67585"
FT                   /db_xref="GOA:C9YSR0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSR0"
FT                   /protein_id="CBG67585.1"
FT                   /translation="MSAGSAAPAGPLPAAAVRRAPRLRLRGGWAGFAVRRAGGLLMSML
FT                   LLVVVTFLIVPLLPGDPARAIAGTSSSPATLAAIRDRLGLDEPLTTRFVHYLGDIASGR
FT                   LGTSFRFDTPVADIIATRLPYTVQLVIPAVLLSLFIAVPLGMTVGVLTRDGRRRRLGVG
FT                   FGTLAGLLASAPVYVVATLLIVLFSISLGLLPSGGATTPSALVLPIAALCIGPAFAIAR
FT                   VVRQETASVLAQDYMRTARGHRLGSVRLHLRHALPNLVTSVLTLSGLVLTSLLGGTIIL
FT                   ENVFTYPGLGTEVVQAIIYKDYPVIQGIILVVGMLALLVNLLVDVVLGIVDPRTLEGGR
FT                   RGH"
FT   misc_feature    complement(430045..430689)
FT                   /locus_tag="SCAB_3771"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 5.7e-42"
FT                   /inference="protein motif:PFAM:PF00528"
FT   misc_feature    complement(join(430063..430131,430213..430281,
FT                   430384..430452,430495..430563,430600..430668,
FT                   430894..430962))
FT                   /locus_tag="SCAB_3771"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SCAB3771 by TMHMM2.0 at aa 32-54, 130-152, 165-187,
FT                   202-224, 259-281 and 309-331"
FT   CDS_pept        complement(431052..432482)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3781"
FT                   /product="putative amidase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3781"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67586"
FT                   /db_xref="GOA:C9YSR1"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSR1"
FT                   /protein_id="CBG67586.1"
FT                   /translation="MVIDPFSTAQQIADLIRTKEVSPVEVAETYLDRIERINPAVNAVV
FT                   WLDTDAVRAAAVRAERAVLRGDRLGPLHGVPVPIKDLSSVAGQPNTMSSLAIRDTPQTV
FT                   TDPDVQLLLDAGAIPLGRTNSPEFGALTVSENARHGKTRNPWNPAHTSGGSSGGASAAV
FT                   AAGLAPVAHAGDGGGSIRVPASVTGLVGLKPSRGRVPALVRGWEHSTTEGAITRTVRDA
FT                   ALMLDVMGRPDRLAWYSAPDPGRPYIEEIGADPGRLRIGLLLDAPTGLPVDEECRTAAL
FT                   TAAQALRDLGHDVVEARPRMFSYEAIMGFTWTIISASTYAIEVDDPDAVDPYIRRRRET
FT                   ALEVSAGDYARTAARLQAESRDVVAQWGTDFDVLLTPTTAVVAPPVGPVYDEANSDPDG
FT                   PRATETRMVSFTAFVNIAGLPAISLPVHTTADGLPVGAQLIGAPYDEATLLRLSAQLEP
FT                   RFRWHERRPDDAALAAAL"
FT   misc_feature    complement(431133..432410)
FT                   /locus_tag="SCAB_3781"
FT                   /note="HMMPfam hit to PF01425, Amidase, score 1.5e-108"
FT                   /inference="protein motif:PFAM:PF01425"
FT   misc_feature    complement(431931..432026)
FT                   /note="PS00571 Amidases signature."
FT                   /inference="protein motif:Prosite:PS00571"
FT   CDS_pept        complement(432604..434184)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3791"
FT                   /product="putative oligopeptide ABC transporter,
FT                   substrate-binding lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3791"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67587"
FT                   /db_xref="GOA:C9YSR2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSR2"
FT                   /protein_id="CBG67587.1"
FT                   /translation="MRQTRTRAVPVTAAVAMTAVLAGCTTTGSTSGDASGGDAATTTKI
FT                   RTTIDVPAGFDPAKALSLPDYQLARNSYDTLVRKDDGGLVGGLATKWTSTPTAATFTLR
FT                   ADATCADGTPITPKVVKASLDRFVDPKTAAPDLPTIFGPGNTVKVTADDAARTVKVTLA
FT                   RPWGDMVTGLSVASTGIVCPAGLKDLKALAAGKAKGSQSGPYVLAKSQSGVSYSYTLRP
FT                   EYKAWPAWRTKIPGKVAATTEYLVSPDPTATGNLVTSGQLDIGKIDASGIPRFDGVDGR
FT                   SVSVSRFSDFYLLFNERPGTVFADIDTRRAVAQAVDRAAFTKVVSKDTGEPSTMFVQKG
FT                   IPCNDPATSFLVPKDKAAAADVLKGKKIRLVGPQVVGPAGAGNQYIQEALRAAGADVTL
FT                   ANVDVGAWVGTLFGKPDAWDLTVFADLNFLGSLANPLAHFVGPTVPEGGGNLGAVKNPA
FT                   LDKAFTQGTEATTSKARCAAYQKAAKAVISQVDAVPLVNDPFIYALRKGFSARMLGGSL
FT                   DDPILRITG"
FT   misc_feature    complement(432844..433938)
FT                   /locus_tag="SCAB_3791"
FT                   /note="HMMPfam hit to PF00496, Bacterial extracellular
FT                   solute-binding prot, score 2.3e-33"
FT                   /inference="protein motif:PFAM:PF00496"
FT   misc_feature    complement(434089..434184)
FT                   /locus_tag="SCAB_3791"
FT                   /note="Signal peptide predicted for SCAB3791 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.315 between residues 32 and 33"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    complement(434113..434145)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(434704..435321)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3801"
FT                   /product="putative tetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3801"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67588"
FT                   /db_xref="GOA:C9YSR3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSR3"
FT                   /protein_id="CBG67588.1"
FT                   /translation="MATALRILDEDGPDALTFQRLGKELSSSATAVYRYFASRDHIMVG
FT                   VADELDRISLEGYEPHESWTESLRDLATRAWDTALDHPAAAALCMGRVTRGVHELRAVD
FT                   ALLEAFHRGGWRGRAAVLHYQAFSNFLLSVASNNAWRLVNQRFGTEVNWVQEYQPANPD
FT                   AYPFAEAAKDHLRSIDMTDVFHRQTDLVLTALVAESATLPRD"
FT   misc_feature    complement(435184..435321)
FT                   /locus_tag="SCAB_3801"
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 0.00011"
FT                   /inference="protein motif:PFAM:PF00440"
FT   CDS_pept        435706..436146
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3811"
FT                   /product="putative transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3811"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67589"
FT                   /db_xref="GOA:C9YSR4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSR4"
FT                   /protein_id="CBG67589.1"
FT                   /translation="MDDIDRAILRELQVDGRIPYADLGPKVGLSPSAARHRLQRLIDSH
FT                   AVQVVGVTDPMTMGQQAMALLGLRVDGDARGVADELSRHDEVVYTVLTAGGFDLFVEVV
FT                   CARPRDLLDFVNDVVRPVEGVTSVENFPYFAIHTHRFLWHVD"
FT   misc_feature    435895..436119
FT                   /locus_tag="SCAB_3811"
FT                   /note="HMMPfam hit to PF01037, AsnC family, score 1.2e-08"
FT                   /inference="protein motif:PFAM:PF01037"
FT   misc_feature    435964..436017
FT                   /note="PS00214 Cytosolic fatty-acid binding proteins
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00214"
FT   CDS_pept        436205..439204
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3821"
FT                   /product="putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3821"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67590"
FT                   /db_xref="GOA:C9YSR5"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSR5"
FT                   /protein_id="CBG67590.1"
FT                   /translation="MLPDEYRTIDFFAEGALPAPRTTAAQAELIAAEHLGTTARARELG
FT                   SQQDANFLLHATDGTPAAVLKIANPAFGTVEIEAQDTAADLIARACPELRIATVLRDPD
FT                   GSPRRTTVDTENGPAVARLLRHLPGGTLSGPRHLSPGTVAGMGTIAGKVSSALRDFRHP
FT                   GLDRVLQWDPRHADRVVARLAGHIGEPERRTAVRTATAEAWAHVRRLAPSLPSQAVHLD
FT                   LTDDNLVRRPGSPTPLPDGIIDFGDVTTSWAVCELAVSVSSILHHDGAEPHHVLPAVRA
FT                   FHAVRPLSAEEAEAVWPIVVLRAAVLVASGHHQAAVDEDNAYATGALDHEWRIFEQATS
FT                   LPLSVMTGLVRDATGTTDAPVRTAATTTTTTEAEAETPVRPLLRDLAPEDIALLDLSTD
FT                   AGSLDRGAWTDPGAEDRLAASALAAGAAAVATRYADPRLTRASTLSAVSPATVPTGVDV
FT                   RLGRDAVVQAPAPGKVLTAAPGHVELAYGARTLSVVLPDMVQPLVTTGATVRAGDDIAR
FT                   LGSGARVHLALRDTDGPAVPHLVRPEYAAGWLALTADPAPLLGLPATIRDRTDDSGLLD
FT                   RRDAAFATVQGHYYADPPRIERGWRHHLLSTEGRSYLDIVNNVTPLGHAHPRVEEAVTR
FT                   QLRRLNTNSRFHYASVVEFTERLAALLPDPLDTVFLVNSGSEAVDLGLRLAMGASGRHD
FT                   VVALREAYHGWTYASDAVSTSLQDNPNALATRPSWVHTVDSPNSYRGRHRGTDAVRYAP
FT                   EAVAMIDELAATGRPPGAFLGETFYGNAGGVALPDGYLAQVYAAVRRHGGLAVADEVQV
FT                   GYGRLGHWFWGFEQQGVVPDIVCVAKAMGNGHPLGAVITSREVADRYRDQGYFFSSTGG
FT                   SPVSSVVGLTVLDALRDEDLQGNAARVGALLKGRLQALADRHGIIGAVHGSGLYLGLEL
FT                   VRDRASLAPATEETAELCDRMLDLGVIVQPTGDHLNILKIKPPLCLDTAAADFFADMLD
FT                   LALTQLGHSR"
FT   misc_feature    436322..437095
FT                   /locus_tag="SCAB_3821"
FT                   /note="HMMPfam hit to PF01636, Phosphotransferase enzyme
FT                   family, score 1.7e-10"
FT                   /inference="protein motif:PFAM:PF01636"
FT   misc_feature    437555..437815
FT                   /locus_tag="SCAB_3821"
FT                   /note="HMMPfam hit to PF01551, Peptidase family M23, score
FT                   0.00073"
FT                   /inference="protein motif:PFAM:PF01551"
FT   misc_feature    437987..439000
FT                   /locus_tag="SCAB_3821"
FT                   /note="HMMPfam hit to PF00202, Aminotransferase class-III,
FT                   score 3.6e-46"
FT                   /inference="protein motif:PFAM:PF00202"
FT   CDS_pept        complement(439506..440936)
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="SCAB_3831"
FT                   /product="putative succinate-semialdehyde dehydrogenase
FT                   [NADP+]"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3831"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67591"
FT                   /db_xref="GOA:C9YSR6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSR6"
FT                   /protein_id="CBG67591.1"
FT                   /translation="MSDTAAPAAIELDTDTTPVHNPYTGEVIASVPTVDEAAVGGILQQ
FT                   ARCGRRTAAALSRASRAAILERAAHLIERRTESFARLIVSEAGKTITQARKEVARAVNT
FT                   LSLSAAEARRNAGEVIPFDSFEGSEKRQGWFTREPLGIIAAVTPFNDPLNLVAHKLGPA
FT                   VAGGNAVILKPSALTPLSALRLVDTLIEAGLPEEIVTVVNGDAGIGAAIVAAPDVRMVS
FT                   FTGGFATGEAIARTAGLKKLAMDLGGNAPVIVMDDADLDEAVASCVSGAFWAAGQNCIG
FT                   TQRILIAAEVYERFRDAFVARTGLLRTGDPLDERTDVGPMITPRAAAATRAKVDAAVAE
FT                   GAVLLCGNEATGALYTPTVLEDVPAACSIWQEEVFAPVVVLQPFTSFEDAVEQANAIDY
FT                   SLHAGIFTSRLDHALNAARLLQAGGVMINDSSDYRFDAMPFGGFKYGSMGREGVRFAFE
FT                   EMTQPKVVCVNHIGEATR"
FT   misc_feature    complement(439539..440909)
FT                   /gene="gabD"
FT                   /locus_tag="SCAB_3831"
FT                   /note="HMMPfam hit to PF00171, Aldehyde dehydrogenase
FT                   family, score 2.4e-177"
FT                   /inference="protein motif:PFAM:PF00171"
FT   CDS_pept        complement(440929..442008)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3841"
FT                   /product="putative homoserine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3841"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67592"
FT                   /db_xref="GOA:C9YSR7"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR022697"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSR7"
FT                   /protein_id="CBG67592.1"
FT                   /translation="MGRYDLALIGFGGVNRALAELIAHSGERLAKELGFALRVVAITDL
FT                   RAGSLVDTDGIDLVPLLAAEPGELSFADLAGGSAEPRNEWVIREVPADIVVEATFTNPT
FT                   DGEPALSHVRWALESGKHVTTTNKGPVALAGRTLKRLAAERGLGFEYEGSVLSGTPVLR
FT                   TAERMFGGLQISGVEGVMNGTSNYILGRLEEGVDLAAAIAEAQAHGYAEADPTADVEGH
FT                   DVRLKVMILANEVLGANLRREDVFCEGIRAITPDVVRDAASKGLRWKLVGSATRHEDGS
FT                   VDARVAPVALPAHHPLAGVSGPANAVAFHTDLLGTVTVSGPGAGRVETAYALLSDIIAI
FT                   HQRHAGDDARPALQETHRV"
FT   misc_feature    complement(440995..441531)
FT                   /locus_tag="SCAB_3841"
FT                   /note="HMMPfam hit to PF00742, Homoserine dehydrogenase,
FT                   score 2.8e-48"
FT                   /inference="protein motif:PFAM:PF00742"
FT   misc_feature    complement(441328..441396)
FT                   /note="PS01042 Homoserine dehydrogenase signature."
FT                   /inference="protein motif:Prosite:PS01042"
FT   misc_feature    complement(441553..441981)
FT                   /locus_tag="SCAB_3841"
FT                   /note="HMMPfam hit to PF03447, Homoserine dehydrogenase,
FT                   NAD binding d, score 7.9e-05"
FT                   /inference="protein motif:PFAM:PF03447"
FT   CDS_pept        complement(442157..444109)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3851"
FT                   /product="putative exported fucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3851"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67593"
FT                   /db_xref="GOA:C9YSR8"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR000933"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSR8"
FT                   /protein_id="CBG67593.1"
FT                   /translation="MSFGSLSRRSLLGAAGAAAAATALPVVPALSPLLAKAAAADPQSS
FT                   LEKLVDMRFGMFNHFSLGTFTDEEWAEPNQNPALFAPTAVDCAQWAAAAAAAKMSYGIL
FT                   TTKHHDGFALWPSAYGTQNVANSPYKQDVVKAYCDAFRAKGLRVAFYYSIWDRTFGVEA
FT                   WENRHRVSGLEITDAIQPADMTFILGQITELLSNYGTIDMFITDGYAWQMGQQAAPYQR
FT                   IRRHVKSLQPDIVMIDHGALSVPWLGDAIYFEEPLGVSAPAGNTYAATQGQTISNGWFW
FT                   HPSTPTEGLMSKNAILSHLADLEPKYTSFILNCPPNRNGRLDTNIVNRLAEVGAAWSPD
FT                   TSRPSLPAQPLRAEHPVTPVNAYATAFRTGEGPLHAIDGLSDKGYETCWSTWGLPTPLP
FT                   HSITIDLGGVWSKVSTLEYLPKQWNRTGTTDGDITSYTISTSTDGTNFTQVATGTWAGD
FT                   RAPKVAEWPARNAGFVRIQANAATGGYANMGGVHIGGRTAEPALVSRVLPGDGTVYRLV
FT                   NRKSGKVVDVYDFGTADGARIQQWPWLDNTAQKWTFASTGDGYYEIKNVNSRKLMEVAG
FT                   LSRADGGNVALYTDHDVPQQHWAVTPTGDGAYYLTNRFSGLALSVDAGSTADGADIEQF
FT                   TYRRLPEQQWQIIAL"
FT   misc_feature    complement(442175..442582)
FT                   /locus_tag="SCAB_3851"
FT                   /note="HMMPfam hit to PF00652, Ricin-type beta-trefoil
FT                   lectin domain, score 1.9e-21"
FT                   /inference="protein motif:PFAM:PF00652"
FT   misc_feature    complement(442637..443029)
FT                   /locus_tag="SCAB_3851"
FT                   /note="HMMPfam hit to PF00754, F5/8 type C domain, score
FT                   1.6e-09"
FT                   /inference="protein motif:PFAM:PF00754"
FT   misc_feature    complement(443990..444109)
FT                   /locus_tag="SCAB_3851"
FT                   /note="Signal peptide predicted for SCAB3851 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.559 between residues 40 and 41"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        444782..447088
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3871"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3871"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67594"
FT                   /db_xref="GOA:C9YSR9"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012878"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSR9"
FT                   /protein_id="CBG67594.1"
FT                   /translation="MTSPVSRRRLLQAAGASAAASAAGSLIGPSAAHAAVPPARADIGV
FT                   LAHPFGLGQVRLTASRWLDNQDRTRNYLRFVDVDRLLYNFRANHRLSTAGAAATGGWDA
FT                   PTFPFRTHVQGHFLTAWAQLYAVTGDTTCRDKATRMVAELAKCQANNGAAGFNTGYLSG
FT                   YPESDFTALEQRTLSNGNVPYYTIHKTLAGLLDVWRHIGSTQARDVLLALAGWVDWRTG
FT                   RLTGQQMQAMLQTEFGGMNAVLTDLYQQTGDARWLTAARRFDHAAVFDPLASNQDRLSG
FT                   LHANTQVPKWIGAAREYKATGTTRYRDIATNAWSITVAAHTYAIGGNSQAEHFRAPNAI
FT                   AGFLNQDTCESCNTFNMLVLTRELFALDPNRAALFDYYERAWLNQMIGQQNPADDHGHV
FT                   TYFTPLRPGGRRGVGPAWGGGTWSTDYGTFWCCQGTGLEMHTRLMDSVYYRSDTTLIVN
FT                   MFVPSVLTWSERGITVTQTTDYPAGDTTTLRVTGSVGGTWAMRLRIPGWTSGATISVNG
FT                   TAQDIATTPGSYATLTRSWTSGDTVTVRLPMRIVMRAANDNANIAAITYGPVVLSGDYG
FT                   DSALGSPPSLKTSSITRTSTGSLAFTATANGSTVGLGPFHDAHGHNYAVYWSTGDTVRL
FT                   TNVGSGLVLGIQNMSTADGGRALQWNDSGTADHDWQMITDGSAVRLRNAHSGKVLGVQD
FT                   MSTADNATVLQWSDTGTADHRWTLLDQGDGTYKIRNVNSGKLLAIANNSTAVGAFAVQA
FT                   PDDGTADNRWRVVKN"
FT   misc_feature    444782..444883
FT                   /locus_tag="SCAB_3871"
FT                   /note="Signal peptide predicted for SCAB3871 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.969 between residues 34 and 35"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    444941..446497
FT                   /locus_tag="SCAB_3871"
FT                   /note="HMMPfam hit to PF07944, Putative glycosyl hydrolase
FT                   of unknown, score 7.8e-189"
FT                   /inference="protein motif:PFAM:PF07944"
FT   misc_feature    446672..447070
FT                   /locus_tag="SCAB_3871"
FT                   /note="HMMPfam hit to PF00652, Ricin-type beta-trefoil
FT                   lectin domain, score 3.1e-06"
FT                   /inference="protein motif:PFAM:PF00652"
FT   CDS_pept        447272..448648
FT                   /transl_table=11
FT                   /gene="abfB"
FT                   /locus_tag="SCAB_3881"
FT                   /product="arabinofuranosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3881"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67595"
FT                   /db_xref="GOA:C9YSS0"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR005193"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSS0"
FT                   /inference="protein motif:GO:0000272"
FT                   /protein_id="CBG67595.1"
FT                   /translation="MLLAALVASAATLVATPAQAATTGALRGTGSGRCLDVSGANQADG
FT                   TNVQIWDCWSGTNQQWTLTDDNRLTVYGTKCLDVPGHATTPGTRPVIRACNGGTNQEWR
FT                   VNADGAVVGVESGLCLDMAGGATANGTAVQLATCNGSAGQKWTGLSGSGSACTLPSTYR
FT                   WSSTGPLAQPSNGWYSLKDFTTVTYNGKHLVYATNSSGSGWHSMMFSPFTNWSDMASAP
FT                   QTQMNQGAVAPTLFYFAPKNIWVLTSNGWGTQWPFVYRTSSDPTNPNGWSAAQPLFTGS
FT                   VPNGTAIDPTLIADGQNMYMFFAGDNGQIYRSAMPIGNFPASFGSSYTTIMSDTVKNLF
FT                   EAPQVYKVQGQNQYLMIVEARGANEQRFFRSFTASSLNGTWTPQAATESNPFAGKANSG
FT                   ATWTNDISHGDLVRDNPDQTMTVDPCNLRLLYQGLSPGTPSNTPYAQLPYRPGLLTLQR
FT                   "
FT   misc_feature    447272..447331
FT                   /gene="abfB"
FT                   /locus_tag="SCAB_3881"
FT                   /note="Signal peptide predicted for SCAB3881 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.988 between residues 20 and 21"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    447335..447709
FT                   /gene="abfB"
FT                   /locus_tag="SCAB_3881"
FT                   /note="HMMPfam hit to PF00652, Ricin-type beta-trefoil
FT                   lectin domain, score 2.6e-41"
FT                   /inference="protein motif:PFAM:PF00652"
FT   misc_feature    447707..447739
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    447737..448549
FT                   /gene="abfB"
FT                   /locus_tag="SCAB_3881"
FT                   /note="HMMPfam hit to PF03664, Glycosyl hydrolase family,
FT                   score 1.7e-164"
FT                   /inference="protein motif:PFAM:PF03664"
FT   CDS_pept        448735..450381
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3891"
FT                   /product="probable secreted alpha-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3891"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67596"
FT                   /db_xref="GOA:C9YSS1"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR002241"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="InterPro:IPR041233"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSS1"
FT                   /inference="protein motif:GO:0000272"
FT                   /protein_id="CBG67596.1"
FT                   /translation="MVPLHKRLLRLLTATALTFAACVTASAGTSAEAAPGSPALTPPLG
FT                   WNSWNSFGCGITEAQVRQATDAMVSSGMREAGYRYVVVDDCWFDPQRDAAGNLRANPTK
FT                   FPSGMKALGDYIHGKGLKFGIYQAPNEKTCAQGVGTYPGSTGSKGHEAQDAAIFASWGV
FT                   DYLKYDWCSGSGTLDQQIAQFTVMRDALRATGRPIVYSINPNSFHAPTGHTYDWGQVAD
FT                   LWRTTEDLLDIWQNGNTNSYPMGVGNVLDITAPLAAQSGPGHWNDPDMLVVGRPGLSLT
FT                   ESRSHFALWSLLSAPLMAGNDIRTMSADVSAVLRNPRLLAVNQDSLGAGGRRVRDDGDT
FT                   EVFAKPLSDGSVAVGLLNRGGSATTVTATAAQVGLTGGPFTLTDLWTGGTSSTSGQISA
FT                   SVPAHGVAVFKMTGGSPVTSTTARLRGTGSGRCLAVDRSSTAAGSAAVIWDCRTSADQQ
FT                   WTTWAGGEIRVYGDKCLDAYNQGTANNTRVIVWQCNGQNNQKWTPQADGSIRNVHAGLC
FT                   LDAQQGATANGTPAVLWTCNGQNNQRWTTLR"
FT   misc_feature    448735..448833
FT                   /locus_tag="SCAB_3891"
FT                   /note="Signal peptide predicted for SCAB3891 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.945 between residues 33 and 34"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    448768..448800
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    448786..449751
FT                   /locus_tag="SCAB_3891"
FT                   /note="HMMPfam hit to PF02065, Melibiase, score 5e-11"
FT                   /inference="protein motif:PFAM:PF02065"
FT   misc_feature    448963..449013
FT                   /note="PS00512 Alpha-galactosidase signature."
FT                   /inference="protein motif:Prosite:PS00512"
FT   misc_feature    449986..450366
FT                   /locus_tag="SCAB_3891"
FT                   /note="HMMPfam hit to PF00652, Ricin-type beta-trefoil
FT                   lectin domain, score 1.1e-37"
FT                   /inference="protein motif:PFAM:PF00652"
FT   CDS_pept        complement(450394..451641)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3901"
FT                   /product="putative multidrug efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3901"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67597"
FT                   /db_xref="GOA:C9YSS2"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSS2"
FT                   /protein_id="CBG67597.1"
FT                   /translation="MTLLKDRNFLLLFAGQGISRFGDGMFTATTAWLAWSLTRDPAAVA
FT                   LVTVAAHAPAFLTTFVAASYADRYDRRRLMILTDVLRAALVAVAVGIFASGSMNLTVLV
FT                   TATALLALVGAPFAPARNAIVPQIVPPALLQQANGLLQVAFRAAFFVGPLVLAPVLAFA
FT                   SLTVAVALNGVTFLLSAAAVAALRVRAPDRRDRPTGLRSDLVAGLRAVRSEPDVLLVIL
FT                   TFVLALTLTSGFLTVGLVALVGQGGQYGLLLGIAGLAEVAGALLLARIPIRRLALVALL
FT                   AWALLGVFRLPLGLATSPVVAAALLALTGLASALTDIPLIALVQQRIPDGHLAKALGLW
FT                   EAGIAGALAVSPFIASTVISLVGVRAAFVLSGAALVTLALVASVILAATTGKLPRPARR
FT                   GYSRAGGDVKAAEPLR"
FT   misc_feature    complement(450400..451632)
FT                   /locus_tag="SCAB_3901"
FT                   /note="HMMPfam hit to PF05977, Bacterial protein of unknown
FT                   function (DUF89, score 0.00049"
FT                   /inference="protein motif:PFAM:PF05977"
FT   misc_feature    complement(join(450469..450537,450565..450633,
FT                   450670..450738,450751..450819,450838..450897,
FT                   450925..450993,451084..451152,451321..451389,
FT                   451450..451518))
FT                   /locus_tag="SCAB_3901"
FT                   /note="9 probable transmembrane helices predicted for
FT                   SCAB3901 by TMHMM2.0 at aa 42-64, 85-107, 164-186, 217-239,
FT                   249-268, 275-297, 302-324, 337-359 and 369-391"
FT   misc_feature    complement(450562..451608)
FT                   /locus_tag="SCAB_3901"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 8.3e-25"
FT                   /inference="protein motif:PFAM:PF07690"
FT   CDS_pept        complement(451694..452806)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3911"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3911"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67598"
FT                   /db_xref="GOA:C9YSS3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSS3"
FT                   /protein_id="CBG67598.1"
FT                   /translation="MTITFRIPASGAELVGFSYSPSMEAVLSLHVLVEPKHHPVQHAWV
FT                   RAMRRLSPALKREIDVFSFAFRSYFPEFFFPSPTGELLGFEDEVRRLRSLDPDLVRLEF
FT                   AVALGGEPFGGGSGRNPAALDEPAVRRRLDERAAAAGDQGLAGLLLDDPAALLERFLRM
FT                   LERYWEEAFSHEWRRIEPDLAEGVAEAGRRIAEHGLYALFRGLWPEVRSDPGAGRVWLE
FT                   RPHDHDVEITPDHPLVLAPSAYAWPHVRVNCDGPWPLGLVFPVSSIVREARPRIPPARL
FT                   TGILRALADDTRLRTLRLISEQPRSTQELAPLVGITEAGLSKQLRVLSEAGLVERRREG
FT                   YYVLYRMIPEQVAALAPSLEAFLHAGDPTD"
FT   misc_feature    complement(451799..451939)
FT                   /locus_tag="SCAB_3911"
FT                   /note="HMMPfam hit to PF01022, Bacterial regulatory
FT                   protein, arsR family, score 9e-08"
FT                   /inference="protein motif:PFAM:PF01022"
FT   CDS_pept        452976..453920
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3921"
FT                   /product="putative sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3921"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67599"
FT                   /db_xref="GOA:C9YSS4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSS4"
FT                   /inference="protein motif:GO:0016987"
FT                   /protein_id="CBG67599.1"
FT                   /translation="MALTTHDVDRFEATRPRLEAIAYRLLGSAVEAEDAVQETFLRWQA
FT                   ADPDRIEVPEAWLTKVLTNLCLNQLTSARARRETYVGQWLPEPLLAGDPMLGPADTAEQ
FT                   RESVSYAVLTLLERLSPNERAVYVLKEAFDYPHREIAEILDISEAASQQIFHRAKKHVA
FT                   AGKARTEIDEAAARLIVEEFLAAATSGRTEPLVRLLTADAIAVGDGGGKVPARARAFEG
FT                   AVAVATFMRGLFKPAPVKRALVGGSPEIHISTANGGPAILAVVDGRVVGIICLEIGADG
FT                   ILAFRSQVNPDKLERATEVWAAGEHGEPLFHAF"
FT   misc_feature    453003..453203
FT                   /locus_tag="SCAB_3921"
FT                   /note="HMMPfam hit to PF04542, Sigma-70 region, score
FT                   1.6e-17"
FT                   /inference="protein motif:PFAM:PF04542"
FT   misc_feature    453300..453461
FT                   /locus_tag="SCAB_3921"
FT                   /note="HMMPfam hit to PF08281, Sigma-70, region, score
FT                   1.3e-15"
FT                   /inference="protein motif:PFAM:PF08281"
FT   misc_feature    453330..453467
FT                   /locus_tag="SCAB_3921"
FT                   /note="HMMPfam hit to PF04967, HTH DNA binding domain,
FT                   score 0.004"
FT                   /inference="protein motif:PFAM:PF04967"
FT   CDS_pept        454077..455303
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3931"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3931"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67600"
FT                   /db_xref="GOA:C9YSS5"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSS5"
FT                   /protein_id="CBG67600.1"
FT                   /translation="MQHRIIVLGAGYTGASAAGRLAKRLHRADVAITLVNSEPDFVERV
FT                   RMHQLAAGQELTSRPFAEMFAGTGVEVRVAEVAGVDADRRTVTVSDAHGAGPQELEYDT
FT                   LVYALGSGWNPQGVPGTAEHAHEISSRPGALRLRERLARLDAGQPVVIVGGGLTGLEAA
FT                   TEIAESRPDLDVALVARGGFGDWLSDKGRAHLRKVFAGLGITVHEHTAVTAVEADHVLT
FT                   DGASLPAAVTVWATGFAVHPIAGASTLEVSGTGQIVVDANLRSVSHPEVYAIGDAALVQ
FT                   GPGDKPLRMSCASGVPGAWLAADTVAARLTGAKPPENSIRYFQQCISLGRKEGLIQFVT
FT                   ADDRTLPKALTGRLAALYKEIICKGAAWAVAHPTVGMPVRRRRTVRPADQAGAYAPQGQ
FT                   AESAVKAAA"
FT   misc_feature    454086..454922
FT                   /locus_tag="SCAB_3931"
FT                   /note="HMMPfam hit to PF07992, Pyridine
FT                   nucleotide-disulphide oxidoreduc, score 2.1e-11"
FT                   /inference="protein motif:PFAM:PF07992"
FT   misc_feature    454521..454787
FT                   /locus_tag="SCAB_3931"
FT                   /note="HMMPfam hit to PF00070, Pyridine
FT                   nucleotide-disulphide oxidoreduc, score 7e-06"
FT                   /inference="protein motif:PFAM:PF00070"
FT   CDS_pept        complement(455370..455996)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3941"
FT                   /product="putative ArsR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3941"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67601"
FT                   /db_xref="GOA:C9YSS6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSS6"
FT                   /protein_id="CBG67601.1"
FT                   /translation="MSNNTRLPDYDLADVTEVTAPAQLRALANPLRNAILELLLERAAT
FT                   VSELAAALGRPKSTVAHHVSALADARLLKVVRTRRVRAIEERYYGRTARIFRVGTISPA
FT                   DGGAPPYCNNDLATAATESAPAHQADRLFSIVRHVRIPREQAREFWLRVLDLANDYAQL
FT                   PRGGDVVYGFAAGLYPTDHPALPEAEPMDQPATPPDQPATTRGST"
FT   misc_feature    complement(455772..455912)
FT                   /locus_tag="SCAB_3941"
FT                   /note="HMMPfam hit to PF01022, Bacterial regulatory
FT                   protein, arsR family, score 5.8e-09"
FT                   /inference="protein motif:PFAM:PF01022"
FT   CDS_pept        456049..456618
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="SCAB_3951"
FT                   /product="putative serine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3951"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67602"
FT                   /db_xref="GOA:C9YSS7"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSS7"
FT                   /inference="protein motif:GO:0009152"
FT                   /protein_id="CBG67602.1"
FT                   /translation="MTEVVLFHHSQGLTPGIAAFADELRAAGHTVHTPDLFEGRTFGSV
FT                   EEGMGYVKEVGFGEITERAVRAAGLLPQDAVYVGFSLGVVPAQKLAQTRAGARGALLFH
FT                   ACIPVSEFGAVWPAHVPVQVHAMEADPFFTEDIDAARALVSECADAEMFLYPGDQHLFA
FT                   DNSLPSYDPDAAKLLTRRAIEFLGAR"
FT   misc_feature    456052..456612
FT                   /gene="glyA"
FT                   /locus_tag="SCAB_3951"
FT                   /note="HMMPfam hit to PF01738, Dienelactone hydrolase
FT                   family, score 0.00019"
FT                   /inference="protein motif:PFAM:PF01738"
FT   CDS_pept        456951..458573
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3971"
FT                   /product="putative MerR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3971"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67603"
FT                   /db_xref="GOA:C9YSS8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017520"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSS8"
FT                   /protein_id="CBG67603.1"
FT                   /translation="MKGESKVERMRTDDGSRPTWSIGAVARQVGLPVKVIRHWSDRGVV
FT                   APVGRTAGGYRRYDTSAVARLHLARTLRDLGLGLGEIRAALDRGDGLAEVAAAHADALE
FT                   TQIRRLRARQAVLRTVTRRTTAEGLARMTRTAHMSPDERHRLVHGFLTETLGDLDVPHF
FT                   REGLLSAGADLPDRPSDEQAEAWLELGELVADGELGRAVRRVAEYSARHARGAQDPAMA
FT                   EEMRALTDTWTGRVSTAMRAGTAADSPAADPVVADVVAAWLPSRSNTDAALTSDGATAR
FT                   ARLLDQLTAAAEPTVERFWHLLCVLGGRPAPAGIAEEGRWLTTALRANPVPGEREARLD
FT                   ALYEDGTDPWPGGVLDAFARVQDTVGTLVHATTPGHFGLPTPCEDWTVRDLLDHLVWEH
FT                   LIWGGLAQGAPPAVGHTEDHLGDDHVAAFGTAAAGARDAFRQPGLLERSFGPAPGRRVV
FT                   EQLLIELLVHGWDLATALGRDRDLEPHIARAALPVVRDIYGTLPRTAGGSFAQARPVPE
FT                   HAPALDRVAAFLGRDVPGGGRPA"
FT   misc_feature    457011..457124
FT                   /locus_tag="SCAB_3971"
FT                   /note="HMMPfam hit to PF00376, MerR family regulatory
FT                   protein, score 3.1e-09"
FT                   /inference="protein motif:PFAM:PF00376"
FT   CDS_pept        complement(458583..459101)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_3981"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_3981"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67604"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSS9"
FT                   /protein_id="CBG67604.1"
FT                   /translation="MRGVPARRVRSRAAGSGAPGSAGSGRGALPARKSSPTWVTDAHEQ
FT                   ATATEDPWQALSGFFEQMLTTQAHNRAVVESYAARGGPTSSCAQRCYSFIDELRTRCMD
FT                   AGLLRPDVTTDDLVLLSGSLSQAVLTAGESHPGQWRRLLRISLDGLSSRNTEPLPEPAV
FT                   GEEQFLTVR"
FT   CDS_pept        complement(459208..460077)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4001"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4001"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67605"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:C9YST0"
FT                   /protein_id="CBG67605.1"
FT                   /translation="MEPVVTVGLDGSPESLAAARWAAEEAEKRRLTLRLMHAWPLLAPE
FT                   PAGARAEVDQNYWAKRLVHTAQAELSTRHPGLSVVGSLVADDAREALLRAASESEMLVL
FT                   GSRGLGSTESYLMGDVSLPVVARAVRPVILVRSEPDGNQPAPTAGDKVVVAMEAHGSRD
FT                   ELLDFAFHSAAARDIPLLAVQGHSVPLHARMPWGADHGVTEELTRKAREELSRALKPWR
FT                   EKYPQVEAEDSIRLTSPAKAVVHAAEGAALLVVGRRTHQHGATHHLDHVAHAAIHHARC
FT                   PVAVVAHD"
FT   misc_feature    complement(459670..460077)
FT                   /locus_tag="SCAB_4001"
FT                   /note="HMMPfam hit to PF00582, Universal stress protein
FT                   family, score 1e-12"
FT                   /inference="protein motif:PFAM:PF00582"
FT   CDS_pept        complement(460243..460860)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4011"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4011"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67606"
FT                   /db_xref="GOA:C9YST1"
FT                   /db_xref="InterPro:IPR019545"
FT                   /db_xref="UniProtKB/TrEMBL:C9YST1"
FT                   /protein_id="CBG67606.1"
FT                   /translation="MGHTPRKRLITGLVMVTVMGVAAGLYWFQPWKLWQDRTVTESLPG
FT                   TVVETSPLPEATPEADAGVADAGASTAGASTAGASPSPSAPSGPLTVASGGLISHEHTT
FT                   TGTAKLVRLADGTHVVRLEHLDTSNGPDLRVWLTDAPVKEGRAGWHVFDDGAYVSLGRL
FT                   KGNKGSQNYPLPDDVDPSAYTSVTIWCDRFDVSFGAAELTAT"
FT   misc_feature    complement(460768..460836)
FT                   /locus_tag="SCAB_4011"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB4011 by TMHMM2.0 at aa 9-31"
FT   misc_feature    complement(460795..460860)
FT                   /locus_tag="SCAB_4011"
FT                   /note="Signal peptide predicted for SCAB4011 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.883) with cleavage site
FT                   probability 0.417 between residues 22 and 23"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        461047..462057
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4021"
FT                   /product="putative epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4021"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67607"
FT                   /db_xref="GOA:C9YST2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9YST2"
FT                   /protein_id="CBG67607.1"
FT                   /translation="MARIRVLVTGGAGFIGSHVVDALAEHGHEPLVFDSAVDPGADVRD
FT                   GAAVLRALDGVDAVCHQAAMVGLGTGFADAPAYVSHNDLGTAVLLTAMAEAGVRRLVLA
FT                   GSMVVYGEGRYACVRHGVVRPGPREVADLEAGRFEPLCPRCGDALSPSLVAEDAPVDPR
FT                   NVYATTKLAQEHLAAAWARATDGTVVSLRYHNVYGPRMPRDTPYAGVASFFRSALARGE
FT                   APRVFEDGRQRRDFVHVRDVAAANVAALEAGAAPGALTAYNAGSGEPHTVGEMAGALAA
FT                   ACGGPEPVVTGEYRLGDVRHITADSSRLRAEQGWKPEVGFVEGVREFARAGMRGS"
FT   misc_feature    461047..461118
FT                   /locus_tag="SCAB_4021"
FT                   /note="Signal peptide predicted for SCAB4021 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.946) with cleavage site
FT                   probability 0.939 between residues 24 and 25"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    461059..462048
FT                   /locus_tag="SCAB_4021"
FT                   /note="HMMPfam hit to PF04321, RmlD substrate binding
FT                   domain, score 2.1e-05"
FT                   /inference="protein motif:PFAM:PF04321"
FT   misc_feature    461062..461841
FT                   /locus_tag="SCAB_4021"
FT                   /note="HMMPfam hit to PF01370, NAD dependent
FT                   epimerase/dehydratase fam, score 2.3e-55"
FT                   /inference="protein motif:PFAM:PF01370"
FT   misc_feature    461065..461934
FT                   /locus_tag="SCAB_4021"
FT                   /note="HMMPfam hit to PF01073, 3-beta hydroxysteroid
FT                   dehydrogenase/iso, score 2.3e-06"
FT                   /inference="protein motif:PFAM:PF01073"
FT   misc_feature    461068..461784
FT                   /locus_tag="SCAB_4021"
FT                   /note="HMMPfam hit to PF07993, Male sterility protein,
FT                   score 0.0026"
FT                   /inference="protein motif:PFAM:PF07993"
FT   CDS_pept        complement(462086..463198)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4031"
FT                   /product="putative histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4031"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67608"
FT                   /db_xref="GOA:C9YST3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C9YST3"
FT                   /inference="protein motif:GO:0000155"
FT                   /protein_id="CBG67608.1"
FT                   /translation="MSDTLLIALYAFLGAVAAGLLGALALWPLRRRSLTASLTVVAAVA
FT                   VTAMLAGTLAVAWAMFLSPHDLSVVTTVVAMAAVVSLATALLLGRWVVARSRALQTAAR
FT                   SFGDGGDFTAPDGPVTAELAALGEELAATSAKLAASRERERALESSRRELVAWISHDLR
FT                   TPLAGLRAMAEALEDGVAADPYRYLRQIRTEVENLDGMVGDLFELSRIHAGSLTLTLSR
FT                   MSLYDLVGDALAGADPLAREHGVRLVGARVEPVPVEVDGREMSRVLANLLVNAIRRTPA
FT                   DGTVAVAAERSPHGVVLSVTDGCGGIAEEDLPRVFDTGWRGTHARTPPAGAGLGLAIVR
FT                   GIVEAHRGHTTVHNIPGGCRFEVVLPAPAS"
FT   misc_feature    complement(462095..462424)
FT                   /locus_tag="SCAB_4031"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 2.7e-31"
FT                   /inference="protein motif:PFAM:PF02518"
FT   misc_feature    complement(462557..462751)
FT                   /locus_tag="SCAB_4031"
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain, score 2.3e-17"
FT                   /inference="protein motif:PFAM:PF00512"
FT   misc_feature    complement(462782..462991)
FT                   /locus_tag="SCAB_4031"
FT                   /note="HMMPfam hit to PF00672, HAMP domain, score 1.3e-06"
FT                   /inference="protein motif:PFAM:PF00672"
FT   misc_feature    complement(join(462917..462985,463013..463081,
FT                   463118..463186))
FT                   /locus_tag="SCAB_4031"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SCAB4031 by TMHMM2.0 at aa 5-27, 40-62 and 72-94"
FT   misc_feature    complement(463073..463198)
FT                   /locus_tag="SCAB_4031"
FT                   /note="Signal peptide predicted for SCAB4031 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.930) with cleavage site
FT                   probability 0.320 between residues 42 and 43"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(463202..463921)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4041"
FT                   /product="putative response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4041"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67609"
FT                   /db_xref="GOA:C9YST4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C9YST4"
FT                   /inference="protein motif:GO:0000156"
FT                   /protein_id="CBG67609.1"
FT                   /translation="MLVVDDDPTVAEVVTGYLDRAGYTVDRAGDGPAALARAAAHRPDL
FT                   VVLDLMLPGMDGLEVCRRLRARGPVPVIMLTARGDEDDRILGLEVGADDYVTKPFSPRE
FT                   LVLRVESVLRRARPASDARQLTAAGLRLDPAARHATRDGAELALTLREFDLLAFFLRNP
FT                   GRAHSREDLMREVWGWDFGDLSTVTVHVRRLRGKIEHDPAQPRLIRTVWGVGYRFESAD
FT                   TTADDDAEHAPAEDRKD"
FT   misc_feature    complement(463268..463495)
FT                   /locus_tag="SCAB_4041"
FT                   /note="HMMPfam hit to PF00486, Transcriptional regulatory
FT                   protein, C te, score 9.5e-26"
FT                   /inference="protein motif:PFAM:PF00486"
FT   misc_feature    complement(463592..463921)
FT                   /locus_tag="SCAB_4041"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 4.2e-45"
FT                   /inference="protein motif:PFAM:PF00072"
FT   CDS_pept        464072..464785
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4051"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4051"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67610"
FT                   /db_xref="GOA:C9YST5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C9YST5"
FT                   /inference="protein motif:GO:0009103"
FT                   /protein_id="CBG67610.1"
FT                   /translation="MKAVTTSPPPSGVDVVLPCLDEAEALPWVLSRIPAGWRALVVDNG
FT                   SADGSADIARELGATVVHESRRGFGAACHAGLVAATADIVCFCDCDASLDPSLLVPFVT
FT                   EVAHGHADLVLGRRRPREWGAWPAHARAGNLALARMLRRRTGLRLHDLGPLRAARREAL
FT                   LGLALTDRRSGYPLQMVVRAADAGWRVTEHDVPYLPRKGTSKVTGTWRGTWQAVRDMSR
FT                   VLGEAPEPARAGVRR"
FT   misc_feature    464111..464563
FT                   /locus_tag="SCAB_4051"
FT                   /note="HMMPfam hit to PF00535, Glycosyl transferase family,
FT                   score 3.2e-22"
FT                   /inference="protein motif:PFAM:PF00535"
FT   misc_feature    464675..464710
FT                   /note="PS00213 Lipocalin signature."
FT                   /inference="protein motif:Prosite:PS00213"
FT   CDS_pept        464782..465399
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4061"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4061"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67611"
FT                   /db_xref="InterPro:IPR018641"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C9YST6"
FT                   /protein_id="CBG67611.1"
FT                   /translation="MTTLLVIAKEPRPGRVKTRLTPPFSPREAAALAEAALVDTLSAVA
FT                   AAPADRRVLVLAGKPGPWLPPGFDVVPQGDGGLDERLAAAFALCDGPALLIGMDTPQVT
FT                   PELLAVEPGGCDAYFGAAEDGGFWALGLTRPDPALLRGVPMSTPVTGAVQRARLVSAGL
FT                   RVRDLPVLRDVDTAADAEAVAAVAPHSRFAAELSRLRAVSSR"
FT   CDS_pept        465396..466166
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4071"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4071"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67612"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C9YST7"
FT                   /protein_id="CBG67612.1"
FT                   /translation="MSGPGQDTVARPDWSSDPYADALRSGRGPLFLRRGDGWLLPLEVE
FT                   RWCARADTVDLQVLERCEGAVLDVGCGPGRLVAELAARGRPVLGVDISPAAVARTQRLG
FT                   GQALTRSVFDPLPGEGRWDTVLLLDGNLGIGGDPSALLRRMAQLLRTEGLLIVETVPMD
FT                   VDERAEVRLVSGVGTEAEGEAAFPWARLGTPALLRHARPQGWRAADQWTAGGRSFVALR
FT                   TRSASSRAEPAKSRAVISSQRPRKPLAGIPVADS"
FT   misc_feature    465594..465860
FT                   /locus_tag="SCAB_4071"
FT                   /note="HMMPfam hit to PF08242, Methyltransferase domain,
FT                   score 3.1e-11"
FT                   /inference="protein motif:PFAM:PF08242"
FT   misc_feature    465594..465866
FT                   /locus_tag="SCAB_4071"
FT                   /note="HMMPfam hit to PF08241, Methyltransferase domain,
FT                   score 2.8e-09"
FT                   /inference="protein motif:PFAM:PF08241"
FT   CDS_pept        complement(466516..467778)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4081"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4081"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67613"
FT                   /db_xref="GOA:C9YST8"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:C9YST8"
FT                   /protein_id="CBG67613.1"
FT                   /translation="MQRSPSSPAFWRSPLRGPWFTSLLGLVLLAGITVLFVTGLLSYAA
FT                   YNPDLSPVNDKTPDKGLLGFYLFPWPTNPHWLYRLTQGVHVTLGIALVPVLLAKLWSVV
FT                   PRLFQLPPARSVAHALERISLLLLVGGVLFEFVTGVLNVQLDYVFPGSFYPLHFYGAWV
FT                   FVAAFVVHVVLRGPAAVRNLRRMRAGEAAGVPPVESPEEPSLVSPDPAEPTVSRRGAVW
FT                   LVGGGSLLLLGTTVGQTVDGPLRRTALLAPHGGPEPGGGPNGFQINKTAASRGISPAET
FT                   SEEAWRLVVTGPSGTVRLSRAELLELPQHSAALPIACVEGWSTSDQWWRGVRLADLAAL
FT                   VGHPVGAAPDVLVESLQRHGAFRRAALRANQVRDPRSLLALDVNGERLSPDHGHPARII
FT                   VPAAPGVLNTKWVARMTFGDL"
FT   misc_feature    complement(466522..466965)
FT                   /locus_tag="SCAB_4081"
FT                   /note="HMMPfam hit to PF00174, Oxidoreductase molybdopterin
FT                   binding d, score 1.1e-13"
FT                   /inference="protein motif:PFAM:PF00174"
FT   misc_feature    complement(join(467059..467118,467248..467316,
FT                   467344..467412,467470..467538,467653..467721))
FT                   /locus_tag="SCAB_4081"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SCAB4081 by TMHMM2.0 at aa 20-42, 81-103, 123-145, 155-177
FT                   and 221-240"
FT   misc_feature    complement(467647..467778)
FT                   /locus_tag="SCAB_4081"
FT                   /note="Signal peptide predicted for SCAB4081 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.987) with cleavage site
FT                   probability 0.876 between residues 44 and 45"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        467895..469217
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4091"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4091"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67614"
FT                   /db_xref="GOA:C9YST9"
FT                   /db_xref="UniProtKB/TrEMBL:C9YST9"
FT                   /protein_id="CBG67614.1"
FT                   /translation="MNRDLRRDLYAVAAAALLVVTAATVGIAVKRAEDVLHVGWPPLYA
FT                   VWLPHTGPGTPAAIAVAVAVVAYGPPLAARLPWRPLLWSVWAAALAWTFSLALVDGWHR
FT                   GIARRLTTRYEYLQVIDRFDDIPATLRSFTDHILLGTADHWPPHVAGHPPGATLTFVLL
FT                   DRIGLAGGGWAGAFVITVGATGTVAVLLTVRTLASEALARRAAPFLVLAPAAVWMGTSA
FT                   DGYFAAVAAWAVAFLALAVTGHRPRPTAFLSGLLFGLVLYLSYGLTLFAVIAAAVLLLG
FT                   SRRAAVLPFALAGLAVVPLAFTLAGFDWWEAYRLLVERYHQGAGGFRPYVYFVWANLAC
FT                   TVLVVGPATVAGLRRTGALLGRWHASPVPERRTGLLLAAALLMLLVADLSGMSKAETER
FT                   IWLPFALWLLASGAFLDRPRVWLVSQAALGLLLNHLLLTGW"
FT   misc_feature    467895..467987
FT                   /locus_tag="SCAB_4091"
FT                   /note="Signal peptide predicted for SCAB4091 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.964 between residues 31 and 32"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    join(467919..467987,468030..468098,468135..468203,
FT                   468405..468473,468564..468623,468666..468734,
FT                   468747..468815,468885..468953,469011..469070)
FT                   /locus_tag="SCAB_4091"
FT                   /note="9 probable transmembrane helices predicted for
FT                   SCAB4091 by TMHMM2.0 at aa 9-31, 46-68, 81-103, 171-193,
FT                   224-243, 258-280, 285-307, 331-353 and 373-392"
FT   CDS_pept        complement(469281..470063)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4101"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4101"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67615"
FT                   /db_xref="GOA:C9YSU0"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSU0"
FT                   /protein_id="CBG67615.1"
FT                   /translation="MPPAHPCPLSPWEVAMAEPSAPSTGNSYRFDDLRALFINCTLKPS
FT                   PQVSHTEGLVARSRAIMEAQGVATDFVRAVDEDIAPGVYPDMTEHGFATDAWPALYERV
FT                   MAADILVLAGPIWLGDNSSVTKQVIERLYSCSSLLNPQGQYAYYGRAGGCLITGNEDGV
FT                   KHCAMNVLYSLQHLGYAIPPQADAGWIGAAGPGPSYLDPGSGGPENDFTNRNTAFMTWN
FT                   LMHLAAMLKRAGGFPAHGNQRTEWDAGCRPGADNPEHR"
FT   CDS_pept        470360..470977
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4111"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4111"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67616"
FT                   /db_xref="GOA:C9YSU1"
FT                   /db_xref="InterPro:IPR025498"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSU1"
FT                   /protein_id="CBG67616.1"
FT                   /translation="MTAICDPQLSRWLWLVKWLLAIPHYVVLVFLWVAFTVVGVVAFFA
FT                   ILFTGRYPRTLFDFTTGVLRWSWRVAFYTYGALGTDRYPPFTLAEVPDYPAHLDVAYPE
FT                   QLSRGLVLVKWWLLAIPQYLVLGIIGGGIHVTWSSGGLIALLTFFAGVALLFTGVYPRG
FT                   IFDLVIGLDRWVLRVAAYAALLTDVYPPFRLDQGGGEPASRP"
FT   misc_feature    join(470435..470503,470702..470770,470783..470851)
FT                   /locus_tag="SCAB_4111"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SCAB4111 by TMHMM2.0 at aa 26-48, 115-137 and 142-164"
FT   CDS_pept        471250..471708
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4121"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67617"
FT                   /db_xref="GOA:C9YSU2"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSU2"
FT                   /protein_id="CBG67617.1"
FT                   /translation="MMPISNHQGAAVARRSVDLDSDEALRLLGTVSFGRIVFTRHALPT
FT                   VRPVNHVLDRGEIVIRTLEGAALTARAQEADDRGVVVAYEADVIDPDTHLGWSVVVTGY
FT                   ARPVTDPEELARYRAMLRPWVSGTMDHAVRIRPDLVTGIRLMTVDRGG"
FT   CDS_pept        471847..473808
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4131"
FT                   /product="conserved hypothetical protein"
FT                   /note="PAS domain may indicate role in signal detection"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4131"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67618"
FT                   /db_xref="GOA:C9YSU3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSU3"
FT                   /protein_id="CBG67618.1"
FT                   /translation="MDNFVPVAQARRAEATDRECCHCGARPDHEGGPSVVEERFRGLLE
FT                   AAPDAMVIVDDTGTIRLVNAQTEALFGYRREELLGRPVELLIPHRFREHHTRHRVGYAA
FT                   NRQVRPMGAGLELHGLRRDGTEFPVEISLSPLETADGLLVSAAVRDVSDRKAAERRINE
FT                   LAALVESSQDAILAKTLDGHITYWNAAAHRLYGYTAEQAIGRHMSFLAPADRRDEISAL
FT                   MERLRRGEKVEHFETLRVTRAGGLLDVDVTLWPTRDTDGTVVGACAIVRDISDRKRAEA
FT                   ELTALYEQQRHIALTLQRSLMGTPPAIAGLATASRYRPATQGAGVGGDWFDLVPLGAGR
FT                   VGVLIGDVMGRGLEAAAVMGQLRSAAHALAKTGMQPRQLMQALDTCVADLDVPDQLVTC
FT                   CYLVVAPDTGTVTACSAGHLPTLVASPGDGVRRLTTPVNAPLGVGGILYQQSCEEIPPG
FT                   ATLVLYTDGLVETPGSDIDDHIGELVSCLDGFFLRDSCLEAAADHVLARLLPDVVSHND
FT                   DVTLLLAQLPAAPLASVTTDLPAVPSSVPEGRAFLTKALASWEVAEPADHALLLLSETL
FT                   TNAVQHAEGPVGLRVCRTATDLTVEVSDSSPQLPQPRLAAEDEESGRGLHLVRALSDNW
FT                   GVRPTDDGKTTWFTVKLA"
FT   misc_feature    471958..472299
FT                   /locus_tag="SCAB_4131"
FT                   /note="HMMPfam hit to PF00989, PAS fold, score 4e-20"
FT                   /inference="protein motif:PFAM:PF00989"
FT   misc_feature    471976..472314
FT                   /locus_tag="SCAB_4131"
FT                   /note="HMMPfam hit to PF08448, PAS fold, score 1.4e-08"
FT                   /inference="protein motif:PFAM:PF08448"
FT   misc_feature    472330..472665
FT                   /locus_tag="SCAB_4131"
FT                   /note="HMMPfam hit to PF00989, PAS fold, score 4.1e-20"
FT                   /inference="protein motif:PFAM:PF00989"
FT   misc_feature    472348..472680
FT                   /locus_tag="SCAB_4131"
FT                   /note="HMMPfam hit to PF08448, PAS fold, score 1.7e-22"
FT                   /inference="protein motif:PFAM:PF08448"
FT   misc_feature    472396..472674
FT                   /locus_tag="SCAB_4131"
FT                   /note="HMMPfam hit to PF08447, PAS fold, score 3.4e-07"
FT                   /inference="protein motif:PFAM:PF08447"
FT   misc_feature    472855..473427
FT                   /locus_tag="SCAB_4131"
FT                   /note="HMMPfam hit to PF07228, Stage II sporulation protein
FT                   E (SpoIIE), score 1.6e-48"
FT                   /inference="protein motif:PFAM:PF07228"
FT   misc_feature    473533..473805
FT                   /locus_tag="SCAB_4131"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 5.6e-09"
FT                   /inference="protein motif:PFAM:PF02518"
FT   CDS_pept        complement(473795..475276)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4141"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4141"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67619"
FT                   /db_xref="GOA:C9YSU4"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSU4"
FT                   /protein_id="CBG67619.1"
FT                   /translation="MMSSLVPTAAPSNLPHGPIASPGHGTRTPTAVHPLGAPGWRTARR
FT                   ANLLVTMSDTGGEELSARERSELDQLRHRVTALEGTRSGRHHPFRSFGAFLLILLAAIL
FT                   SLLSVVAVWANSIVQDTDRYVATVGPLASNPDVQRAVTNRVTDAVLDRVDVDALVAQLT
FT                   DAASQQGVPPKAADLLKNLDGPIESGLRQLVSSTVERVVSSSAFEKVWVQANRRAHAAV
FT                   DEALTGESGGAVALKDNQVVVDVGPIVQQVKEKLVDAGFAPAAKIPDVKTDFVVFASKD
FT                   IGEIKSYVRVLEILGGWLPVIALLVAAAGVYVAFNRRHAVIGAGLAVFLAMLVLGISLT
FT                   VFRDIYLDRLPPGTSQAAAGAVYDAVVKFLRAGTRALGATALFVAVAAFLAGPSRPAVL
FT                   ARTGCRRSIGALRDVAASAGFRTGPVGRFVHRFKHWIGVAILLIAAVVLFTWTYPTTAV
FT                   VVWTAVITLAGFAIREFLDDSSAPQARPDRPATPA"
FT   misc_feature    complement(join(473849..473908,473918..473974,
FT                   474080..474148,474251..474319,474338..474397,
FT                   474935..475003))
FT                   /locus_tag="SCAB_4141"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SCAB4141 by TMHMM2.0 at aa 92-114, 294-313, 320-342,
FT                   377-399, 435-453 and 457-476"
FT   CDS_pept        475275..475721
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4151"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4151"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67620"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSU5"
FT                   /protein_id="CBG67620.1"
FT                   /translation="MSDALEEEVGPIDYLVVEFPGSRMTGEGLPLLVDLVDRGLIRILD
FT                   LVFVRKNDDGSVTGLEIADFTGDGELDLSVFEGASSGLLGQDDVEEAAVALRPGSSAGI
FT                   LVYENRWAAPFAAALRRGGAELVASGRIPVPALVAALDATESTP"
FT   CDS_pept        475718..476041
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4161"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4161"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67621"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSU6"
FT                   /protein_id="CBG67621.1"
FT                   /translation="MRAAGRSTGRRRTVMPGLIRGVARTAVVAGTATAVSNRVNRRQQG
FT                   RWAAQQQYAYDAPAPAPAPPAGSAAPDMGDRIEQLKQLGELKTQGVLTETEFEEQKRRL
FT                   LEA"
FT   misc_feature    475718..475819
FT                   /locus_tag="SCAB_4161"
FT                   /note="Signal peptide predicted for SCAB4161 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.913) with cleavage site
FT                   probability 0.690 between residues 34 and 35"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(476349..478082)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4171"
FT                   /product="putative two component sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4171"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67622"
FT                   /db_xref="GOA:C9YSU7"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSU7"
FT                   /protein_id="CBG67622.1"
FT                   /translation="MASGERSGEARVRLPQLRLDELLEELQARLDAARGTRDRVHSLLE
FT                   AVLSVGRELELQQALRSIVEAAAVLVDAEFAALGVIGPDGRRLSAFHTVGVSEEQIARI
FT                   GAYPEGHGILGELIRHPEPLRLASLSEHPASYGFPPNHPPMSTFLGVPIRVREQVFGNL
FT                   YLTEKRGGAQFDEEDESVLSTLAVAAGVAIDNARLYEESRLRERWLRATAEITHSLMSG
FT                   DGPGEVLRLIAERAREIMTAALAVVAVPMEGTESLTVDLAIGEGARAHRGLVLSRTDPL
FT                   IGRAFTSASPVTSVDVSREETGTTGAPRFTGLGPAVAVPIGSGEGTRGILLLARAAGRT
FT                   EFTEPEIERLQGFAAQAAVVMELTERRRDAEQIALLEDRDRIARDLHDLAIQRLFATGM
FT                   TLQSAGRFIEHPEASERVLRAVDDLDETIKIIRSTIFGLRSREGAAGAGLRARAVRAVG
FT                   EAAQVLGFAPSLRLEGLLDTGVSKGLADHVVAVLSESLTNVARHAHASRVDVVLEADAS
FT                   HLCLTVSDNGVGIPAGGRRSGLRNMAERAREAGGALETSGPPGGGTTLVWRVPSAHGRK
FT                   G"
FT   misc_feature    complement(476367..476636)
FT                   /locus_tag="SCAB_4171"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 2.1e-21"
FT                   /inference="protein motif:PFAM:PF02518"
FT   misc_feature    complement(476754..476951)
FT                   /locus_tag="SCAB_4171"
FT                   /note="HMMPfam hit to PF07730, Histidine kinase, score
FT                   1.9e-12"
FT                   /inference="protein motif:PFAM:PF07730"
FT   misc_feature    complement(477000..477413)
FT                   /locus_tag="SCAB_4171"
FT                   /note="HMMPfam hit to PF01590, GAF domain, score 2.9e-09"
FT                   /inference="protein motif:PFAM:PF01590"
FT   misc_feature    complement(477504..477920)
FT                   /locus_tag="SCAB_4171"
FT                   /note="HMMPfam hit to PF01590, GAF domain, score 5.1e-21"
FT                   /inference="protein motif:PFAM:PF01590"
FT   CDS_pept        complement(478225..478917)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4181"
FT                   /product="putative luxR family two-component response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4181"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67623"
FT                   /db_xref="GOA:C9YSU8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSU8"
FT                   /inference="protein motif:GO:0000156"
FT                   /protein_id="CBG67623.1"
FT                   /translation="MPVSEQPGPDGPIRVFLLDDHEVVRRGVRDLLNDEPDISVTGEAG
FT                   TVEQALVRVPALRPQVAVLDVRLPDGDGITVCRELRSRMPELACLMLTSFDDEEALLDS
FT                   IMAGASGYVLKQIRGSDLVSAVRTVAAGQSLLDPSATARLMARLRQGPQEEREPEALPG
FT                   LTGREREILALIGEGLTNRQIGQRLFLAEKTVKNHISRLLAKLGVERRVQAAVIATQAQ
FT                   DRLRQDRP"
FT   misc_feature    complement(478264..478437)
FT                   /locus_tag="SCAB_4181"
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR fami, score 7e-22"
FT                   /inference="protein motif:PFAM:PF00196"
FT   misc_feature    complement(478294..478440)
FT                   /locus_tag="SCAB_4181"
FT                   /note="HMMPfam hit to PF04545, Sigma-70, region, score
FT                   2.2e-05"
FT                   /inference="protein motif:PFAM:PF04545"
FT   misc_feature    complement(478300..478458)
FT                   /locus_tag="SCAB_4181"
FT                   /note="HMMPfam hit to PF08281, Sigma-70, region, score
FT                   4.2e-07"
FT                   /inference="protein motif:PFAM:PF08281"
FT   misc_feature    complement(478303..478386)
FT                   /note="PS00622 Bacterial regulatory proteins, luxR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00622"
FT   misc_feature    complement(478537..478881)
FT                   /locus_tag="SCAB_4181"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 6.2e-31"
FT                   /inference="protein motif:PFAM:PF00072"
FT   CDS_pept        complement(479060..480127)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4191"
FT                   /product="putative zinc-containing dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4191"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67624"
FT                   /db_xref="GOA:C9YSU9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSU9"
FT                   /protein_id="CBG67624.1"
FT                   /translation="MKGFVFHGPGQSSWQDVPDPGIKDPTDVIVRVDTVTICGTDLHIL
FT                   KGDVPDVRPGTVLGHEAVGEAVEVGGGVRTVRPGDRVLVSCITACGRCRFCREGAYGQC
FT                   LGGGGWILGHLIDGTQAEYVRVPFADLSVHPLPSTLAGEEAVLLADIFPTSYEVGVVNG
FT                   HVGPGDTVAVVGAGPIGLAAIATARLYSPERIVAVDLAPARLEAARRLGADAVADAREA
FT                   PEQLVSDLTDGLGADVVIEAVGVPETFELCTRMVRPGGHVANIGVHGEPATLHLEDLWI
FT                   KNVTITTGLVDTRSTPMLLRMAAAGRLPTSSLVTHTFPLDGMEEAYDVFSRANDTGALK
FT                   VVLGGPRHDVLAVPA"
FT   misc_feature    complement(479213..479629)
FT                   /locus_tag="SCAB_4191"
FT                   /note="HMMPfam hit to PF00107, Zinc-binding dehydrogenase,
FT                   score 2.4e-37"
FT                   /inference="protein motif:PFAM:PF00107"
FT   misc_feature    complement(479597..479650)
FT                   /note="PS01076 Acetate and butyrate kinases family
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS01076"
FT   misc_feature    complement(479720..480055)
FT                   /locus_tag="SCAB_4191"
FT                   /note="HMMPfam hit to PF08240, Alcohol dehydrogenase
FT                   GroES-like domain, score 4.7e-42"
FT                   /inference="protein motif:PFAM:PF08240"
FT   misc_feature    complement(479909..479953)
FT                   /note="PS00059 Zinc-containing alcohol dehydrogenases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00059"
FT   CDS_pept        complement(480316..482694)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4201"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4201"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67625"
FT                   /db_xref="GOA:C9YSV0"
FT                   /db_xref="InterPro:IPR005593"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR018969"
FT                   /db_xref="InterPro:IPR018970"
FT                   /db_xref="InterPro:IPR019789"
FT                   /db_xref="InterPro:IPR019790"
FT                   /db_xref="InterPro:IPR023962"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSV0"
FT                   /protein_id="CBG67625.1"
FT                   /translation="MTQVEHQNVTVLSDDELRTLDAHWRAANYLAAGQIYLRANPLLTE
FT                   PLLPEHIKPRLLGHWGTSPGLNLVYTHLNRVISARDLDALCVWGPGHGGPSVLAGSWLD
FT                   GSYSETYPDVTRDAPGMARLFRQFSFPGGVPSHVAPEVPGSIHEGGELGYSLAHAYGAA
FT                   FDNPGLLVTCVIGDGEAETGPLAASWHSNKFLDPVHDGAVLPILHLNGYKIANPTVLSR
FT                   LPQAELDALLRGYGHTPLHVTGDDPATVHRALAHAFDEALDRIARLQRTAREDGVAERA
FT                   HWPMIVLRTPKGWTGPAEVDGLPVEGTWRAHQVPLAGVRENPEHLRQLETWLRSYRPQE
FT                   LFGPDGRPVADVLAHIPSGTRRLGATPHANGGLLLRDLPIRPLDDFAVPVDKPGTTLHE
FT                   PTRVLGDLLARIMRDTRSRRDFRVVGPDETASNRLQAVFDASGKAWQAEHLPVDEHLDR
FT                   HGRVLEILSEHLCQGWLEGYLLTGRHGLFSCYEAFVHIVDSMVNQHIKWLRTSRELSWR
FT                   APVASLTYLLTSHVWRQDHNGFSHQDPGFVDHVLNKSPEVVRVYLPPDANTLLSVADHA
FT                   LRSRDLVNVIVAGKQPCFDWLSMDQARAHCARGAGIWEWAGSENGGEPDVVLACAGDVP
FT                   TQEILAAAQLLRRHLPQLAVRVVNVVDMTRLLPREEHPHGMSDFEYDGLFTTDKPVIFA
FT                   YHGYPWLVHRLAYRRTGHRNLHVRGYKESGTTTTPFDMVVRNDLDRYRLVMDVIDRVPG
FT                   LAVRAAAVRQQMADTRTRHHAWIREHGTDLPEVADWHWA"
FT   misc_feature    complement(480319..482664)
FT                   /locus_tag="SCAB_4201"
FT                   /note="HMMPfam hit to PF03894, D-xylulose
FT                   5-phosphate/D-fructose 6-phosphat, score 0"
FT                   /inference="protein motif:PFAM:PF03894"
FT   CDS_pept        482697..483548
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4211"
FT                   /product="putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4211"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67626"
FT                   /db_xref="GOA:C9YSV1"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSV1"
FT                   /protein_id="CBG67626.1"
FT                   /translation="MTPELIDGGRRAVEDGMAGKKATKVSRAAYEQELLRLQTELVKLQ
FT                   EWVRAEGARLVVVFEGRDAAGKGGTIKRVAEHLNPRVARIAALPKPTERERTQWYFQRY
FT                   VEQLPAAGEIVLFDRSWYNRAGVEHVMGFCTQEEYQLFLRQCPLFERMLVEDGILLRKY
FT                   WFSVSDTEQQERFRRRLEDPLRRWKLSPMDLESLTHWEAYSRAKDEMMVHTDLTEAPWY
FT                   VVESDDKRRARLNMIAHLLASVPYHEVPPPVLELPERPASTGYERPPRDLRTYVPDHAA
FT                   GL"
FT   misc_feature    482766..483452
FT                   /locus_tag="SCAB_4211"
FT                   /note="HMMPfam hit to PF03976, Polyphosphate kinase, score
FT                   4.4e-160"
FT                   /inference="protein motif:PFAM:PF03976"
FT   CDS_pept        complement(483566..484453)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4221"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4221"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67627"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSV2"
FT                   /protein_id="CBG67627.1"
FT                   /translation="MSGMTKDLPVVVGVDGSGPSLRAVDWAADEAALRGAPLRLVFASL
FT                   WERYEGDALADDLGEPSERTRIDAIMETAARRARLRRPEVRVTTDVVPEEPEYTLLRES
FT                   RTASLLVTGTRGRSSLTEALVGSVSLTVAAHAHCPMVVVRGSHDNRALPAAHGRIVVGV
FT                   GEGPASAAAVDFAFGEARRRGAEVEAVRAWRRPAHTTTDHPLLAGEASRPHEERAAHGL
FT                   EAALQDAPDDVRLHRRTVEGHARTVLAGASRDADLLIVGARRRPRHFGLQLGRVTHGVL
FT                   HHSACPVVIVPERE"
FT   misc_feature    complement(483578..483991)
FT                   /locus_tag="SCAB_4221"
FT                   /note="HMMPfam hit to PF00582, Universal stress protein
FT                   family, score 2.1e-21"
FT                   /inference="protein motif:PFAM:PF00582"
FT   misc_feature    complement(484022..484432)
FT                   /locus_tag="SCAB_4221"
FT                   /note="HMMPfam hit to PF00582, Universal stress protein
FT                   family, score 2.1e-16"
FT                   /inference="protein motif:PFAM:PF00582"
FT   CDS_pept        complement(484450..484614)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4231"
FT                   /product="hypothetical protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4231"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67628"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSV3"
FT                   /protein_id="CBG67628.1"
FT                   /translation="MKTAVVGARHEPLARHEPLAVRAPRPPSAVADRLDEVPRGRVRDR
FT                   IGFDLGAGR"
FT   CDS_pept        complement(484642..485556)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4241"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4241"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67629"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSV4"
FT                   /protein_id="CBG67629.1"
FT                   /translation="MEIMNRTVTVGLDGSHESRSAVEWAAREAQLLGVPLKLVHVWEPV
FT                   PDPIAQAPLLGTETQQHWTGRIPREAAEGIRLRHPGLEVVSEHVSGRPSEVLHDEAEDA
FT                   ALLVLGSRGLSGIGGFLVGSVALAVVARAERPVVLVRAEELASDEHETDPAGIPSATAP
FT                   FRPVVLGLDTDSPDAELIEFAFAAAARRGTTLRVIHGWNPPPYYAYGLAADLELHRALA
FT                   RQERTALTEALRPWREKHPDIEVSEECPFGTPGHHLADASREASLVVVGRRIRRSPFGS
FT                   HIGPVTHAVLHHSSAPVAVVPHH"
FT   misc_feature    complement(484651..485070)
FT                   /locus_tag="SCAB_4241"
FT                   /note="HMMPfam hit to PF00582, Universal stress protein
FT                   family, score 7.6e-19"
FT                   /inference="protein motif:PFAM:PF00582"
FT   misc_feature    complement(485134..485547)
FT                   /locus_tag="SCAB_4241"
FT                   /note="HMMPfam hit to PF00582, Universal stress protein
FT                   family, score 1.4e-22"
FT                   /inference="protein motif:PFAM:PF00582"
FT   CDS_pept        485919..487655
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4261"
FT                   /product="putative sulfate ABC transport system,
FT                   transmembrane component"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4261"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67630"
FT                   /db_xref="GOA:C9YSV5"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSV5"
FT                   /protein_id="CBG67630.1"
FT                   /translation="MGSGEGHGMKLGGDLRVGPVWRGLAPGLVALLGYRRAWLKGDLIA
FT                   GATVAAYLVPQVMAYAGVAGLPPVAGLWAILPALALYAVFGSSRLLSIGPESTTALMTA
FT                   TVVAPLAAGDPGRYAVLAATLAMTVGLLCLLARAVRLGFLADLLSRPVLIGYLAGVALI
FT                   MTVDQLPKLTGVDTTGSAFFAQLWSFLTDLGEADVPTVLFSAAILVLLFSVARFRAVPG
FT                   PLLAVVLGTAAVVVLNLDGRYGLAVIGEVPSGLPGLAAPDLGALPELVLPALGVLLVAY
FT                   TDCILTARAFDGPRGEGPALDANQEFLALGAVNLGAGAVHGFPVSSSASRTALASSAGA
FT                   GSQAYSLVAGAAVLAVLLLLSPLLTRTPAAVLGALVVYAAVRMVDLAGFRRLAAFRRRE
FT                   LLLALGCLAGVLALDILYGVLVAVGLSVAELLTRVARPHDAVQGLVPGLAGMHDVDDHP
FT                   TARTIPGLLVYRYDSPLFFANAEDFLRRALAAVDDQTDEVHWFVLNTEANVEVDITALD
FT                   AVDELRRELGRRGIVFALARVKQDLLDDLKAYGLLDSVGTEHIFPTLPTAVAAYRDRNP
FT                   DQ"
FT   misc_feature    485919..485951
FT                   /note="PS00626 Regulator of chromosome condensation (RCC1)
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00626"
FT   misc_feature    join(485976..486035,486096..486164,486270..486338,
FT                   486357..486416,486510..486563,486582..486650,
FT                   486693..486761,486930..486998,487008..487061,
FT                   487119..487187)
FT                   /locus_tag="SCAB_4261"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SCAB4261 by TMHMM2.0 at aa 20-39, 60-82, 118-140, 147-166,
FT                   198-215, 222-244, 259-281, 338-360, 364-381 and 401-423"
FT   misc_feature    486324..487220
FT                   /locus_tag="SCAB_4261"
FT                   /note="HMMPfam hit to PF00916, Sulfate transporter family,
FT                   score 1.6e-60"
FT                   /inference="protein motif:PFAM:PF00916"
FT   misc_feature    486861..486893
FT                   /note="PS00626 Regulator of chromosome condensation (RCC1)
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00626"
FT   misc_feature    487287..487619
FT                   /locus_tag="SCAB_4261"
FT                   /note="HMMPfam hit to PF01740, STAS domain, score 3e-23"
FT                   /inference="protein motif:PFAM:PF01740"
FT   CDS_pept        487829..488293
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4271"
FT                   /product="putative possible regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4271"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67631"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSV6"
FT                   /protein_id="CBG67631.1"
FT                   /translation="MITTPTPSMLRALPAEDRQRLMRVAREVAFTQGERLFEEGSRADR
FT                   FWIVRTGTVDLDMRVPGRRPAVIESLRHNELVGWSWLFSPHVWHLGAEATTPVRAYEFD
FT                   ATAVRLMCQEDPAMGRAVGLWVGEVLAHRLQAARTRLLDLYAPYGGGGAR"
FT   misc_feature    487907..488179
FT                   /locus_tag="SCAB_4271"
FT                   /note="HMMPfam hit to PF00027, Cyclic nucleotide-binding
FT                   domain, score 1.5e-16"
FT                   /inference="protein motif:PFAM:PF00027"
FT   CDS_pept        488424..488990
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4281"
FT                   /product="putative membrane protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4281"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67632"
FT                   /db_xref="GOA:C9YSV7"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSV7"
FT                   /protein_id="CBG67632.1"
FT                   /translation="MHIAAGFWDGSGSALLGSMLSGALAVGTFYGTRRHERNVAREQLA
FT                   YEAAEAIGHALLVLEDALRPHPWETPRGDWRALWQSAGAFGHICIVRISALTEPPIFHA
FT                   VKDFYNLLHEALRIMRDQDQNQQGPAASVNVDVMLLDVVQYLQAVLNALLDWRNKEAAR
FT                   RPPVPDYPWRGLLPAGPPRMVYPDP"
FT   misc_feature    488451..488519
FT                   /locus_tag="SCAB_4281"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB4281 by TMHMM2.0 at aa 10-32"
FT   CDS_pept        complement(489004..489291)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4291"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4291"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67633"
FT                   /db_xref="GOA:C9YSV8"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSV8"
FT                   /protein_id="CBG67633.1"
FT                   /translation="MTTAETVITAAGWCGAGLLLAAYAMASTERIAGGGRAFQLLNLFG
FT                   ATALTVNSGYHQAWPSALLNTAWIAIGLTVLVRRPPQATETPPGRAPEVP"
FT   misc_feature    complement(join(489061..489129,489214..489273))
FT                   /locus_tag="SCAB_4291"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SCAB4291 by TMHMM2.0 at aa 7-26 and 55-77"
FT   misc_feature    complement(489220..489291)
FT                   /locus_tag="SCAB_4291"
FT                   /note="Signal peptide predicted for SCAB4291 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.873) with cleavage site
FT                   probability 0.418 between residues 24 and 25"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(489427..489843)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4301"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4301"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67634"
FT                   /db_xref="GOA:C9YSV9"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSV9"
FT                   /protein_id="CBG67634.1"
FT                   /translation="MMSPLHEAAADRPFAGVAVPVTVDDHERCPATALLRRIGDKWSPV
FT                   LLSLLAERSHGFNELDRSVEGLSRRMLVRTLRSLEREGLISRTLHDETPPRAEYALTDL
FT                   GRSLRELLVTMGQWAVAHEAELLTARARYDAAHV"
FT   misc_feature    complement(489463..489711)
FT                   /locus_tag="SCAB_4301"
FT                   /note="HMMPfam hit to PF01638, HxlR-like helix-turn-helix,
FT                   score 1.9e-19"
FT                   /inference="protein motif:PFAM:PF01638"
FT   CDS_pept        489871..490776
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4321"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67635"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSW0"
FT                   /protein_id="CBG67635.1"
FT                   /translation="MTDPQATHTTEEPLLIAVSGASGNLGSSTVRHLVRRTDAGRVLAL
FT                   SRTPDRCADLGVRTRHADFDEPDALARALDGVERLLIVSIGTDDRLPKHVRAIDAAVKA
FT                   GVGHVVFTSLTRAGDPGHPNPLVPDYGATERLLVESGLPFTVLRFNVWAEMLNLVGVAP
FT                   RAVATGVLPSNSRDGRIGHLTRDDSAAAAAAVLAEGGSRGEILEVTGPQAVTDADIAAA
FT                   LSEATGRPVRHEEVPDAAHPQRLMDQGFPEHFAHAWSAAGRAKRDGWYDMTTHAVQRLT
FT                   GRPATPVVDYFAAHRAELIG"
FT   misc_feature    489916..490575
FT                   /locus_tag="SCAB_4321"
FT                   /note="HMMPfam hit to PF05368, NmrA-like family, score
FT                   2.1e-07"
FT                   /inference="protein motif:PFAM:PF05368"
FT   CDS_pept        complement(490863..491237)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4331"
FT                   /product="hypothetical protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4331"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67636"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSW1"
FT                   /protein_id="CBG67636.1"
FT                   /translation="MTAPFASGARTTLAAKVAATVESVPGVAFLRPGLADRLRSALSSS
FT                   APDAGRPAPDTGSVPPAGVRMTRPEADGPWHVEIHVVVLRQARTVEVARAVRDGVERHL
FT                   DALQPAHPTPVVTVTVTGMV"
FT   CDS_pept        complement(491234..491863)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4341"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4341"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67637"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSW2"
FT                   /protein_id="CBG67637.1"
FT                   /translation="MTDRTDPRPSASPHGDDDELLPCGRLLSRVWNDWEQQVDDTHLRA
FT                   CPHCGQAVSGLDRLESAVRDLDAETAAPSADDTESLTRRIMDVVRLELRPGRPVPLGDP
FT                   GEDLWIMETVAARTLRAAAETVPGVRAGSCRLLERGADDDAGAVGVRLDIHAPVGVPLP
FT                   PLTARVRERVREAADLELGLAVGAVDIRVTDLDHLSADGGQEGRTP"
FT   CDS_pept        complement(491860..492444)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4351"
FT                   /product="putative sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4351"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67638"
FT                   /db_xref="GOA:C9YSW3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSW3"
FT                   /inference="protein motif:GO:0016987"
FT                   /protein_id="CBG67638.1"
FT                   /translation="MAGARTPSAPPDTPADTDDTLLVVRAAEGDEEAFAVLVRRHAPML
FT                   TQLATRLLGTRTEAEDAVQDAFISAWRRLPEFQGRSSFGTWMYRIVTNRCLNVLRARRP
FT                   AAPLEAAGDLPAAEHTTSPARITEGRDAVRELREALDLLSAEQRACWILRELDGRSYEF
FT                   VAEAVGISQEAVRARVFRARRCLTQALGAWR"
FT   misc_feature    complement(491881..492030)
FT                   /locus_tag="SCAB_4351"
FT                   /note="HMMPfam hit to PF04545, Sigma-70, region, score
FT                   4.8e-10"
FT                   /inference="protein motif:PFAM:PF04545"
FT   misc_feature    complement(491887..492048)
FT                   /locus_tag="SCAB_4351"
FT                   /note="HMMPfam hit to PF08281, Sigma-70, region, score
FT                   6.2e-11"
FT                   /inference="protein motif:PFAM:PF08281"
FT   misc_feature    complement(492130..492336)
FT                   /locus_tag="SCAB_4351"
FT                   /note="HMMPfam hit to PF04542, Sigma-70 region, score
FT                   2.6e-23"
FT                   /inference="protein motif:PFAM:PF04542"
FT   CDS_pept        492651..493166
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4361"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4361"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67639"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSW4"
FT                   /protein_id="CBG67639.1"
FT                   /translation="MTTQTTRETPAPVARDLSGPQGAPRTVTAVSSGTTGADQPAADRG
FT                   RTSIADVVVVKVAGIAAREIPGVYDMGGSLSRTLGAVRDRVPGGRPNVGRGVKVEVGER
FT                   RTAIDLDLVVEYGVPIADVARDVRENVISAVERVTGLEVVEVNITVNDVRLPEDEDDPT
FT                   ATTETRVA"
FT   misc_feature    492777..493112
FT                   /locus_tag="SCAB_4361"
FT                   /note="HMMPfam hit to PF03780, Protein of unknown function
FT                   (DUF322), score 2.3e-24"
FT                   /inference="protein motif:PFAM:PF03780"
FT   CDS_pept        493243..493407
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4371"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4371"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67640"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSW5"
FT                   /protein_id="CBG67640.1"
FT                   /translation="MIAGMALAFAGFFGGFGAFLLVAALGGLGWALGRWVEAGGGVQDV
FT                   RDAFERSRR"
FT   misc_feature    493243..493329
FT                   /locus_tag="SCAB_4371"
FT                   /note="Signal peptide predicted for SCAB4371 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.908) with cleavage site
FT                   probability 0.234 between residues 29 and 30"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    493261..493329
FT                   /locus_tag="SCAB_4371"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB4371 by TMHMM2.0 at aa 7-29"
FT   CDS_pept        493404..494408
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4381"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4381"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67641"
FT                   /db_xref="GOA:C9YSW6"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSW6"
FT                   /protein_id="CBG67641.1"
FT                   /translation="MTAAAQRGTTTVSERAVRTIAQRAAGETLPRPGGTRSVPSARAAA
FT                   SVRGGRADLTLGVTLPYPLPLAETVGHVQRHVVERTRELTGLDVPAARLTVTALTPSPQ
FT                   PPEPPSPESGPTVRTPRRRWSRRRLPVALLTAATAVGSGALALDLVRVHLADRAPAAWR
FT                   TAAVHWLSGHGPGDPAVVAGGALMGLAGVWMVVLALTPGGRRRSSVLSMAPRVDAAMDR
FT                   SAVAALLRDVLGSIEGVGAVRVTVRRHRVAVRVGLAYGDPGQARAAVTATARHTLAACR
FT                   LRRVPRLRVAVVPEPVWRPPVPDTTTPPNAPGSPVPAHGAQLPTTAPAAGGEG"
FT   misc_feature    join(493785..493853,493935..494003)
FT                   /locus_tag="SCAB_4381"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SCAB4381 by TMHMM2.0 at aa 128-150 and 178-200"
FT   CDS_pept        494405..494995
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4391"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4391"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67642"
FT                   /db_xref="GOA:C9YSW7"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSW7"
FT                   /protein_id="CBG67642.1"
FT                   /translation="MTRRTRTAVDRTVLGLGGLVLALAGSWLAATDRTLTDRLPSWWPP
FT                   ASAGSVLLDRDRLAHLRVEGWWTPTVTAAAIILTVLCAYGTLARFRSGRTRPITLPSPG
FT                   GTVRPGALAEALSARVEALPGVARGRGRVLPRPGRRLEIGLRVWLEPGTAPETVLPALC
FT                   AVAAEAERAAAPYTAHTRVRLSAAAPRRSAHVR"
FT   misc_feature    494405..494488
FT                   /locus_tag="SCAB_4391"
FT                   /note="Signal peptide predicted for SCAB4391 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.934) with cleavage site
FT                   probability 0.482 between residues 28 and 29"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    join(494441..494494,494600..494668)
FT                   /locus_tag="SCAB_4391"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SCAB4391 by TMHMM2.0 at aa 13-30 and 66-88"
FT   CDS_pept        494985..495929
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4401"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4401"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67643"
FT                   /db_xref="GOA:C9YSW8"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSW8"
FT                   /protein_id="CBG67643.1"
FT                   /translation="MSADPCVGGVRRLLRLRRPRLPASWWPALRRTPVALWRDDVTDYA
FT                   AALTYYAILAVLPAMLATVLAFGMISPDTAEEFVTHVAAYAPAGSGADLHAVLARMLGA
FT                   GSTAWPLLAAGAASALWSASSYLAVFRRALHRMHRVADRRSPWRKAHRIVLTALAQLGL
FT                   LLVGSLTLLLSGPLAEALGRTLGLNSTAAWVWGLVRWPVLLCLVALLVVVVFHTGPAPA
FT                   RHSGRSLPGGVLAAALWLVVSAGFSSYASALGAYSRLYGSLAGVVVFLVWLWLSNLALL
FT                   TGAQFAAELGGDRVEGVDGVETNGGNTEKSPAP"
FT   misc_feature    495093..495866
FT                   /locus_tag="SCAB_4401"
FT                   /note="HMMPfam hit to PF03631, Ribonuclease BN-like family,
FT                   score 9.1e-39"
FT                   /inference="protein motif:PFAM:PF03631"
FT   misc_feature    join(495126..495194,495306..495374,495435..495503,
FT                   495561..495629,495666..495734,495762..495830)
FT                   /locus_tag="SCAB_4401"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SCAB4401 by TMHMM2.0 at aa 48-70, 108-130, 151-173,
FT                   193-215, 228-250 and 260-282"
FT   CDS_pept        496004..496573
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4411"
FT                   /product="putative tetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4411"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67644"
FT                   /db_xref="GOA:C9YSW9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSW9"
FT                   /protein_id="CBG67644.1"
FT                   /translation="MTTEVKPGPRERLLEAAATLTYRDGVGIGVEALCKAAGVSKRSMY
FT                   QLFESKDELLAASLQERASAYVTTLLPAADDGRSPRERILHVFEQVESQAGAPEFRGCP
FT                   YLAVQIELKDRSHPASRVAHRIKADLTAFFHGEAERGGAGDPALLARQLSLVFDGASAR
FT                   AGIQADDLTGLVAPTVTTLLDSAGMH"
FT   misc_feature    496040..496177
FT                   /locus_tag="SCAB_4411"
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 4.9e-07"
FT                   /inference="protein motif:PFAM:PF00440"
FT   CDS_pept        complement(496600..497733)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4421"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4421"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67645"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSX0"
FT                   /protein_id="CBG67645.1"
FT                   /translation="MFNIADTLHRWCRAARPFALATVVDVHGSAPLPIGTSVAVDLDGN
FT                   AIGSISGGCVEGAVYELCRQVLADGAGPQRVWFGYSDDDAFAVGLTCGGELDVLVQRVD
FT                   PATRPDLTAAFEEIRRGGPTALAQVVDGPGRFLGRAVCVRGDGSAAHGTPDGGEVDRAM
FT                   TAQAVALLRAGRTARVRIGGEADTCPDALSVLVHVHASRPRMLVFGAVDFAAALSRAGH
FT                   ALGYRVTVCDARPVFATAARFPEADEVVADWPHRYLEGTEVDARTAICVLTHDAKFDIP
FT                   LLRLALALPVGYVGAMGSRRTHEARLLRLREAGVPEDRLARLRSPIGLDLGARTPEETA
FT                   VSITAEIIAHANRATGLPLTRGTGPIHGSLVRPRAVR"
FT   misc_feature    complement(497485..497709)
FT                   /locus_tag="SCAB_4421"
FT                   /note="HMMPfam hit to PF02625, XdhC and CoxI family, score
FT                   1.2e-21"
FT                   /inference="protein motif:PFAM:PF02625"
FT   misc_feature    complement(497572..497604)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(497900..500095)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4431"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4431"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67646"
FT                   /db_xref="GOA:C9YSX1"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSX1"
FT                   /protein_id="CBG67646.1"
FT                   /translation="MSPQPRAAVGAPLSRVDGRLKVTGQALYAAEHDVEGVLHAVIVDS
FT                   SVGAGRITSVDTDAALAHPGVLRVLHHRNAPKLPYLDNPGSNNPEGRRLRVFQDDKVLF
FT                   HGQPVAVVVATTLEAAQHGASLVKVGYDARKPSTDMAKAEPDPPTRYARGDAAAGLRDA
FT                   AVRMDLHYRMARNHQNPMEPHATIARWKGDRLTVWDKTQWVVGTQTELSTVFDLPLKSV
FT                   RVISPFVGGGFGSGLRCWPHTVVAALAARELKRPVKLVLSRKQMYLGTGFRPSYDYRLR
FT                   LGSDRRGRLAAMVHEMDAETSSYEKFEEAIMLAGQMFYSTPNVSQEYRKVPLDVNTPLW
FT                   MRGPGFANASFAIESAMDELANKLVVDPIELRLRNEPAEDESNGLPWSTRKVRECYTVG
FT                   AREFGWARRNPKPRSTRDGDWLIGLGMAAGVYDPGRFPAQARVRLDADGTAVAEAATID
FT                   MGPGTYTSQTQVAADALGLNMRAVTFRLGDSLYPPTPPHGGSMTMTVVGSAVLDGCNKV
FT                   RTQAIKLAVEDDESPLYGVRAEDVIVRGGRLHVPDDPARGETYQRLLTRNRLTHLEADG
FT                   AYAGAPEPARHSYFSYGAVFTEVGVDATLGLVRVRRMLGVYDVGRIVSPKLADSQALGG
FT                   MVGGIGQALLEHTVTDHRDGRIVNASLADYLVPVNADISDLRAIYLESEDPRANPLGVK
FT                   GIGEIVQVGVAAAVANAVFNATGRRVRELPITAEALI"
FT   misc_feature    complement(498074..499699)
FT                   /locus_tag="SCAB_4431"
FT                   /note="HMMPfam hit to PF02738, Aldehyde oxidase and
FT                   xanthine dehydroge, score 2e-89"
FT                   /inference="protein motif:PFAM:PF02738"
FT   misc_feature    complement(499691..500029)
FT                   /locus_tag="SCAB_4431"
FT                   /note="HMMPfam hit to PF01315, Aldehyde oxidase and
FT                   xanthine dehydroge, score 1.9e-24"
FT                   /inference="protein motif:PFAM:PF01315"
FT   CDS_pept        complement(500092..501072)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4441"
FT                   /product="putative oxidoreductase, molybdopterin binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4441"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67647"
FT                   /db_xref="GOA:C9YSX2"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSX2"
FT                   /protein_id="CBG67647.1"
FT                   /translation="MFPFSYTRVSDTRAALDAGRRGGRFIAGGTTLVDLMRETVERPGK
FT                   LVDISGLPLDEVTVTERGGLRIGALVTMSGAAAHPKVRTLYPVVSEALELSASAQLRNM
FT                   ATIGGNIMQRTRCTYFRDVTAACNKREPGSGCAALQGHNRTHAILGTSDACVATHPSDV
FT                   AVAFAALEATVHLLGPDGGRRVPFAVFLLRPGRTPDREQALKQGELITAVEIPALPRPL
FT                   RSGYLKVRDRQSYEFALTSAAVALHLRAGVIREARVAAGGVGTVPWKLPAVERALIGER
FT                   PSAALWAAAAAKAADGARTLQYNGFKPELLKRTVERQLRVVGGTK"
FT   misc_feature    complement(500419..501069)
FT                   /locus_tag="SCAB_4441"
FT                   /note="HMMPfam hit to PF00941, FAD binding domain in
FT                   molybdopterin deh, score 3.6e-91"
FT                   /inference="protein motif:PFAM:PF00941"
FT   CDS_pept        complement(501086..501730)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4451"
FT                   /product="putative oxidoreductase, iron-sulphur binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4451"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67648"
FT                   /db_xref="GOA:C9YSX3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSX3"
FT                   /protein_id="CBG67648.1"
FT                   /translation="MSTEPVSALPPPTEPDASPADPTRRTFIATTSAVGGVAVVGGVIG
FT                   APLLVGTEEEPAATPPSGRVSLTLNGTRRTVTVDNRTSLLDLLRERFGLTGSKKGCNAG
FT                   ACGACTVLVDGRRVNACLTLAVRLEGAEVTTIEGLADGDELHPLQQAFIDEDAFQCGYC
FT                   TPGQIMSGVGCIEEGHTGSPAEIREWMSGNICRCGCYVKIARAVDKTAARK"
FT   misc_feature    complement(501104..501328)
FT                   /locus_tag="SCAB_4451"
FT                   /note="HMMPfam hit to PF01799, [2Fe-2S] binding domain,
FT                   score 5.2e-34"
FT                   /inference="protein motif:PFAM:PF01799"
FT   misc_feature    complement(501209..501241)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(501350..501532)
FT                   /locus_tag="SCAB_4451"
FT                   /note="HMMPfam hit to PF00111, 2Fe-2S iron-sulfur cluster
FT                   binding domain, score 5e-11"
FT                   /inference="protein motif:PFAM:PF00111"
FT   misc_feature    complement(501404..501430)
FT                   /note="PS00197 2Fe-2S ferredoxins, iron-sulfur binding
FT                   region signature."
FT                   /inference="protein motif:Prosite:PS00197"
FT   CDS_pept        502054..502959
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4461"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4461"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67649"
FT                   /db_xref="GOA:C9YSX4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSX4"
FT                   /protein_id="CBG67649.1"
FT                   /translation="MEQRPDNRADIRDFLASRRAKITPEEVGLPSGGRRRVPGLRREEV
FT                   AVLAGVSTEWYTRLEKGHISGVSEEVVEAVARALRLNEEERTYLFDLARAARPAHRAPA
FT                   RRKDVPAPPRVQWLLDSMTMASATVQNGRQDVVVDNPLARALFAPLFDSSTTDRRGRAN
FT                   FARYIFLDPGSRHFFVDWEKAAATTTALLRAEAGREPHDRALRDLVGDLSTLSSAFRAL
FT                   WAAHDVRLHHEGIKRLRHPEVGTLELTYHSLSLPLSDRAVHDLTIYTAEPGTTSEDRLK
FT                   LLTSLAATRPPTTDTTNDPR"
FT   CDS_pept        complement(503005..503796)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4471"
FT                   /product="putative TetR-family regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4471"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67650"
FT                   /db_xref="GOA:C9YSX5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSX5"
FT                   /protein_id="CBG67650.1"
FT                   /translation="MGFRPVRRECVHGVARQAGLSQHALSCGCVPRTPGRSVRRQSMGA
FT                   RTEPARRPGRPSADSRAVPDEDSILTRGLEAFAELGYEGGSARELARRLGVSHNFINDR
FT                   YGSKAAFWRAVVDHALGGRMASLADIDPSLDDAEQLRLIIAGFYLRAVDTPLVGRVLVG
FT                   EFSRDTERLDYLYEHYISQTLQLMVPSIERLIAAGRMAPIPMDVLFFAVVPPVSGMLDG
FT                   PLARRLGREDPASPEQLTATAEWLSRLVVNGLLATGARNDG"
FT   misc_feature    complement(503452..503592)
FT                   /locus_tag="SCAB_4471"
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 1e-05"
FT                   /inference="protein motif:PFAM:PF00440"
FT   CDS_pept        complement(503931..504845)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4481"
FT                   /product="putative transposase"
FT                   /note="cluster 0025 8: SCAB3371, SCAB4481, SCAB7601,
FT                   SCAB11701, SCAB20281, SCAB40511, SCAB68181"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4481"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67651"
FT                   /db_xref="GOA:C9YSX6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSX6"
FT                   /protein_id="CBG67651.1"
FT                   /translation="MKTDLDTLATALYARIDDELKASPWLAPYRPVVGIAPTLSDAELV
FT                   TLAVMSALLGYTSERRWLRRVGKDFGRLFPYVPQQSGYSKRLRAASSLLTSMIRILARD
FT                   TSLWSDDVWLVDSTPVGCGCSRETAKRSDLAGWAQYGYCASHSRYFWGLRLHLVCTLGG
FT                   LPVLFALTGAKADERETLRDMLDTAPDVTAARPGQTIIGDKNYYGREFEHDLAERHLEL
FT                   LRPARKGEAERAGAHLFKPLRQVIESINQTLKAQLDLERHGGKSPAGVAARVLCRILAL
FT                   TAAIWHNDKTGQPIKRSLTAYDH"
FT   misc_feature    complement(503997..504512)
FT                   /locus_tag="SCAB_4481"
FT                   /note="HMMPfam hit to PF01609, Transposase DDE domain,
FT                   score 2e-15"
FT                   /inference="protein motif:PFAM:PF01609"
FT   CDS_pept        complement(504968..505939)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4491"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4491"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67652"
FT                   /db_xref="GOA:C9YSX7"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSX7"
FT                   /protein_id="CBG67652.1"
FT                   /translation="MRDIRRSSRSLRTSRPVLAALLTAAATIGTAVSATPAVAAPADPA
FT                   AFWTAERMRQAAPLELPVMEPGRLKASSLARGAERTVAPTLPGTASAAGALAFPNGGGA
FT                   WTGGGAVVSTAGRVFFTYQGRTASCSGNAVTSANKSTVLTAGHCVKLEGAWHTNWVFVP
FT                   GYHDGQAPYGRWSATKTLSTPQWTASEDINYDIGAAVVAPLDGKLLTDVVGGQGLAFNT
FT                   GYNRAMYAFGFPAAAPYDGEKFVYCSGNTNRDFLLSDDHGMNCNQTGGASGGPWFTQFD
FT                   EATGTGLQSSVNSFKYNFLPNRMYGPYFGTDAQNLYRTAQSS"
FT   misc_feature    complement(505496..505513)
FT                   /note="PS00134 Serine proteases, trypsin family, histidine
FT                   active site."
FT                   /inference="protein motif:Prosite:PS00134"
FT   misc_feature    complement(505823..505891)
FT                   /locus_tag="SCAB_4491"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB4491 by TMHMM2.0 at aa 17-39"
FT   misc_feature    complement(505823..505939)
FT                   /locus_tag="SCAB_4491"
FT                   /note="Signal peptide predicted for SCAB4491 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.675 between residues 39 and 40"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    complement(505928..505939)
FT                   /note="PS00228 Tubulin-beta mRNA autoregulation signal."
FT                   /inference="protein motif:Prosite:PS00228"
FT   CDS_pept        complement(506171..509368)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4501"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4501"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67653"
FT                   /db_xref="GOA:C9YSX8"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSX8"
FT                   /protein_id="CBG67653.1"
FT                   /translation="MRRLGQRRSASRRLLHGITRTLLPLTVMAGLTTAIAAPASAATPT
FT                   LTVDLGTSTGAFHGGASGVLYGLYGPDVPTGNLIEGMGVRTTNTKYQDGQQHPGSDALE
FT                   IAEPFVDSGGKDIYIYMTDVYRTFSYERTSYAAYRTAMKKQIDQVLATPYKDRVVLVPY
FT                   NEPDGMWYPGMRTQATALADFNAEWRQTYTFIKGLWPEARIAGPNTSSYTESSLKGFLT
FT                   YCKANNCLPDIATWHTLGSPAEVSSTVDNYRAAETAVGLPSHLPINLNEYAFRYHLTDP
FT                   GQMVQWIAALEDKKIDGNLPYWNINGNLGDSAAGQNIPNAQWWLYHWYSSMKGGNTVKV
FT                   TSSGADAAYTLQGLASLDTAKKQARVILAGGGTSGASDTVIKNIDPAVFGSTVHVSVFQ
FT                   DRYSGYIGAAATPTRLSDADVAVGSDGSITVPLDLDAMSAYQVIVSPGGNGSATASDST
FT                   WTRSYEAENATLSGSGYNINTEGTPSRLDKFATSGTKDVGGLRTGSTTVISFPVTVPTT
FT                   GDYDLSVFGNSYAKDADVKGPTNVYLRVDGGASKRIDIPVGFQWVVWGHSDTTVNLTAG
FT                   THTLTLATTGDNGAATVGDAIIDKIDLRYRDTGVQATTLYEAEQAALSDSGSTTYTSQG
FT                   QSGAGAVNLTSGRSATFWVYAARDGYADLTARFRNTGQADLTVNGRAADDQVLSGATTA
FT                   AWSTSTNRFFLKAGINKIKVTGTGGTLALDDLAVTPFSTTSAVTTGNVVTYQAEAGTLT
FT                   GTAEVSNSYDQATGGVVTGIGNGTANSLTLDVDAPSAGTYAMTMRYANAEELPSNHYNP
FT                   DLYAEHADVGVNGGDATRVDFAGTLHWNQFADYTAHVTLKKGANKVKFTSSQLYDWDGT
FT                   TVGKVYSGGGSDIGQPLRSSSAPHLDQVSFAPASLHIGAPAAFSSTAVAQHSGLCLEDP
FT                   ARSSANGTQYRQNTCGSGQEQLFDFRRVSGTTDTYTVVNHSSGKCLDVSAYSTADGAAV
FT                   QQWTCHGDTNQRFRLAPVTALGNSHDYQLVAVHSGKCVDVSTISTAPGALVHQWPCDGA
FT                   GALTTKKNQIWRLTGKD"
FT   misc_feature    complement(506192..506635)
FT                   /locus_tag="SCAB_4501"
FT                   /note="HMMPfam hit to PF00652, Ricin-type beta-trefoil
FT                   lectin domain, score 7.5e-28"
FT                   /inference="protein motif:PFAM:PF00652"
FT   misc_feature    complement(509240..509308)
FT                   /locus_tag="SCAB_4501"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB4501 by TMHMM2.0 at aa 21-43"
FT   misc_feature    complement(509246..509368)
FT                   /locus_tag="SCAB_4501"
FT                   /note="Signal peptide predicted for SCAB4501 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.992 between residues 41 and 42"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(509449..511206)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4511"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4511"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67654"
FT                   /db_xref="GOA:C9YSX9"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR004888"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSX9"
FT                   /protein_id="CBG67654.1"
FT                   /translation="MTAARSGPAFSVHDIPFSAYGSWFDISPVVAEKTYAEDLHLVSHQ
FT                   NGMHGVLRLVPLDAASGERAVTRVEATPDLLTWTGGSGRVELAYETPDTVRLRGSGPGL
FT                   GVLAAARTLTPFSGTYFFHDPAADAHVFTSYETGRRYRVTLLSGALAGTAGTQALGSAE
FT                   RGVTVTAAADGHWEIAIEELDAARPPYAPSAPFDAVVASARAAFADFVDAVAPWRSAAT
FT                   PAAELAAYVVWSATVAAKGLVTRPGVLMSKHWMDKVWSWDHCFNALALAGGSPELARDQ
FT                   FHLPFDHQDASGALPDSVTHSEVLYNFVKPPIHGWAYGRLRRTLPSPPDRTELTEVYER
FT                   LERWTGFWLTARRAPGADLPYYQHGNDSGWDNATTFDPERVVVTADLAAFLTLQLHELA
FT                   SLAEELGETDEAARWTRTAEEMQTALLDQLWTGDRFVARSAGTGDTWSSAGLLDLMPIA
FT                   LGEHLPAEVAGTLADHIKAHLTPYGLATELPTSPHYLADGYWRGPIWAPATVLVEDGLR
FT                   RAGHQRLADDISARFRALCEAHGFAENFDALTGTGLRDRAYTWTASSYLLLARDHHLRE
FT                   QAGTGEPVV"
FT   CDS_pept        complement(511288..512112)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4521"
FT                   /product="putative integral membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4521"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67655"
FT                   /db_xref="GOA:C9YSY0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSY0"
FT                   /protein_id="CBG67655.1"
FT                   /translation="MNRSASRSWWKTAVGLLLTGVMLFPVYWMVNVSLTRDQDMRKSPP
FT                   DLFPAHGTLSGYRTVLAEQLPYLGTSLVVALGTVVLTVALAAPAGYALAKLRPRGGGLL
FT                   SFALLAAQMIPGIIMAMGFYAIYLQLGLLQSVPGLIVADSTLAVPFAVLIFTAFMSGIP
FT                   GELLQAAQMDGARPLRTFWSIVLPMSRNAVVTVSLFAFLWSWSDFVFANTLVNGGTHEP
FT                   ITLGIYHYIGNNNQEWNAIMATAVVASLPAAVILVLAQRYVAAGVTTGAVKD"
FT   misc_feature    complement(511306..511911)
FT                   /locus_tag="SCAB_4521"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 6.5e-13"
FT                   /inference="protein motif:PFAM:PF00528"
FT   misc_feature    complement(join(511336..511395,511504..511572,
FT                   511633..511701,511744..511812,511831..511899,
FT                   512008..512076))
FT                   /locus_tag="SCAB_4521"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SCAB4521 by TMHMM2.0 at aa 13-35, 72-94, 101-123, 138-160,
FT                   181-203 and 240-259"
FT   misc_feature    complement(511552..511638)
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS_pept        complement(512109..513107)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4531"
FT                   /product="putative sugar transport integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4531"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67656"
FT                   /db_xref="GOA:C9YSY1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSY1"
FT                   /protein_id="CBG67656.1"
FT                   /translation="MRGPSMNDTKQVPDRRSAHDRSGAATAAPARPSARPRRRPTSPQW
FT                   TAWAFLAPVTCYLLLFYAYPLYRNLDLSLRDYTVRSFVQGDAPFTGLANYQKVFDDPTF
FT                   APALLHTVVFTAVCLVFQYAIGLALAVFFHQHFRLSATLRALFLVPWLLPLIVSASTWS
FT                   WMFNSDSGIVNAALHAVGVGPVNWLTSPDWSLTSVIIANIWIGVPFNLVVLYSGLQSVP
FT                   GSLYEAAALDGANAWQRFWRITFPLLRPVSAITLLLGLVYTLKVFDIIWIMTKGGPADS
FT                   STTFATWSYQLGFGNLLPAFGPGAAVGNLLVVAALVFGLVHVRVQRKQAPS"
FT   misc_feature    complement(512115..512798)
FT                   /locus_tag="SCAB_4531"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 2.9e-14"
FT                   /inference="protein motif:PFAM:PF00528"
FT   misc_feature    complement(join(512145..512213,512292..512360,
FT                   512463..512531,512607..512675,512709..512777,
FT                   512907..512975))
FT                   /locus_tag="SCAB_4531"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SCAB4531 by TMHMM2.0 at aa 45-67, 111-133, 145-167,
FT                   193-215, 250-272 and 299-321"
FT   misc_feature    complement(512370..512456)
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS_pept        complement(513114..514361)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4541"
FT                   /product="putative sugar binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4541"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67657"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSY2"
FT                   /protein_id="CBG67657.1"
FT                   /translation="MHSTPRQRRLTAAALTALAVTVGATACSSGSGSTGAKDADSGTYT
FT                   VWDPYPQFAKGSAWTKLLDKCGTDAGVKIKRTGFDTSDLANKTLLAAQQGNSPDVLIVD
FT                   NPVVSTLAEAGVLTTTEDNKLDTSKADPNLLAAGQSGGKTYGTPIGANTLALYYNKEVL
FT                   KKAGVDIASVKDWKSLTAALAKVKKAGKKGITFSAIGTEEGSFQFLPWFWGAGAQLTAL
FT                   DSPQSVSALSLWKGWLDKGYAPNSVLNNTQTTSWQEFATGDYAFSENGTWQLANAEKAG
FT                   FDYGVIPVPATTGGNAAAPTGGEFVTVPVQKDTGRYATSQKLVTCLTSTDNLYDTDTTL
FT                   SYVAPTAEVQDKQVAANAALKPWVEAVKAAKGRTSDDLGTKYPKISEQLWKAVQSALSG
FT                   AESPKDALAKAQSAVK"
FT   misc_feature    complement(513360..514319)
FT                   /locus_tag="SCAB_4541"
FT                   /note="HMMPfam hit to PF01547, Bacterial extracellular
FT                   solute-binding prot, score 2.9e-22"
FT                   /inference="protein motif:PFAM:PF01547"
FT   misc_feature    complement(513930..513953)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(514254..514361)
FT                   /locus_tag="SCAB_4541"
FT                   /note="Signal peptide predicted for SCAB4541 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.553 between residues 36 and 37"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    complement(514281..514313)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(514611..515798)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4551"
FT                   /product="putative LacI-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4551"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67658"
FT                   /db_xref="GOA:C9YSY3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSY3"
FT                   /protein_id="CBG67658.1"
FT                   /translation="MSGNPDSGVDSRPACSYLHFTRTGSTTGRRILLTRLRTRLGRTAR
FT                   RERRTGSSKEFSVNIGEIARRAGVSRSTVSYALSGKRPVSDDTRRKIQQVIDELGYRPN
FT                   ASARALANGRTSTIGLVFPPAGNHYTGMQLDFIGSVVEAAAAYDYDVLLSPSGVDSDRS
FT                   FQRLLGERRVDGAILMEIRLADDRVDHLAELDFPSVAIGRTARPEGSWWVGLDHTALAE
FT                   ACVHHLADLGHRRVAFVNRPEQLLRAGYESAHRGLDGFTKAAAERGLTVRSYTCGDDAA
FT                   SGQACLERILHDDPATTGLVTLNEAALGGLYRGLAQAGRHVPRDFSVTGIVAGRWAETV
FT                   TPQLTAADVPAAEMGRLAVDLLVERLDSPGAPARHHLLVPPISLRASTGPALGAS"
FT   misc_feature    complement(514635..515456)
FT                   /locus_tag="SCAB_4551"
FT                   /note="HMMPfam hit to PF00532, Periplasmic binding proteins
FT                   and sugar b, score 1.7e-07"
FT                   /inference="protein motif:PFAM:PF00532"
FT   misc_feature    complement(515550..515627)
FT                   /locus_tag="SCAB_4551"
FT                   /note="HMMPfam hit to PF00356, Bacterial regulatory
FT                   proteins, lacI fami, score 1.4e-06"
FT                   /inference="protein motif:PFAM:PF00356"
FT   misc_feature    complement(515565..515621)
FT                   /note="PS00356 Bacterial regulatory proteins, lacI family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00356"
FT   CDS_pept        516125..519778
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4561"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4561"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67659"
FT                   /db_xref="GOA:C9YSY4"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011081"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSY4"
FT                   /protein_id="CBG67659.1"
FT                   /translation="MPSADRSARRRAPAAVALALGAGALVAPAVPAQAADTPRPTAHYT
FT                   FDEDDLASGKITDSSGNGLTASLVNAATAKAVEGAGGGRALSLPGGAPTSDGAYVRLPR
FT                   AVLGDATDLTVSARVKWGGDKSSWQRIFDLGTDTTKYLFTTPSNNGGLLRTAVTAGGGG
FT                   AEAQVSGYAALPADAWRTVTVTLDTAAGRVTTYLDGVAVSSAATNVKARELLDGSATAA
FT                   GYIGKSFYPDPLLKGAIDDFTVWHAALSPEQVAGTVADVPTLRELSKTSFEVRTTTGTA
FT                   PSLPVAVRASFSDGYDRDTPVTWDAVPAGTYERPGTFTVAGTAAGRAVRATVTVVREGQ
FT                   LTVDLGSDTGAFHGGASGTLYGVYGPDVPTNNLIEGMGLRTVSTKAQDGPQHPGADALE
FT                   VVKPLADSTDGDVYIYMTDIHRGFPYEWPGDTPAEKLRLYEQKMAKQVDQVLRMPKQYQ
FT                   DNIVFVPFNEPEGNMFGTGQWSYDKVSWLDDPDAYFAAWDSAYKLIKDRMPDARIAGPN
FT                   TSILYDQVKGFLAHALAAGTLPDVVTWHELSHPEAVRDSVATYRGWEKDLFKGTSRAGT
FT                   RLPININEYAFNYHTSVPGQMIQWVSAIEESKVDADIAYWNIDGNLSDSAVQSNRGNGQ
FT                   WWLLNAYASMTGHTVKVNPPSPGENYTMQGVGTLDEKKKQARLIFGGSTGKGHITFADV
FT                   PRKVFGKSVHAWVREIEWSGQVGDSSGPRLLTETNLDVGADGTVSVDFGDGTLPRLKES
FT                   SAYEIVLSPAGKAQATRTAPVRWQDSYEAEDAAHTGSGYSKNGPEGSPRDVSKFYTSGG
FT                   YDVGGLRTGSDMALDFTVDVPEDGTYDLSVFANSLNTFDKVKEQGPTNVFLRVDGKADS
FT                   ERELHLPLGYKWVVWDHTDTTVKLTKGRHTLTLAAKSLDGRSATKGDAIVDRLTLSLPD
FT                   ASARTQVYEGELAWLGGRARTAYDPPRRAATGSGAARLPKDGTATFWVYSPADREATLR
FT                   VDTLKGSGARVSVNGQDVLRLDEGGNSVVVSLSGGVNKVTVTGTSHTTMVDRLSVTPTQ
FT                   GTLPARTYEGKSAELAGSAALAPLSLATDGTAITGIGGAPGNGNTATFTVTADEAGTHA
FT                   LRIRYSNPEQSPATHYNPDPLARHADIAVNGGESKRVTFPHTFHQNNFWELTVPVQLKK
FT                   GQNTITFRSEELPNFDGTTYASDTFPGVLLRSRYAPLIDRITVAPYAKAVR"
FT   misc_feature    516125..516226
FT                   /locus_tag="SCAB_4561"
FT                   /note="Signal peptide predicted for SCAB4561 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.998 between residues 34 and 35"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    516161..516229
FT                   /locus_tag="SCAB_4561"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB4561 by TMHMM2.0 at aa 13-35"
FT   misc_feature    516785..516808
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    516929..517105
FT                   /locus_tag="SCAB_4561"
FT                   /note="HMMPfam hit to PF07532, Bacterial Ig-like domain
FT                   (group 4), score 3.9e-15"
FT                   /inference="protein motif:PFAM:PF07532"
FT   misc_feature    517754..517825
FT                   /note="PS00334 Myb DNA-binding domain repeat signature 2."
FT                   /inference="protein motif:Prosite:PS00334"
FT   misc_feature    519281..519304
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        519889..520476
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4571"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4571"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67660"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSY5"
FT                   /protein_id="CBG67660.1"
FT                   /translation="MDSRTARIRSKLAKIPYQARRSHSAGAERHEFRPGPRVGAARVDT
FT                   FEAEHHIVLPWAYRTFLVELGVGAGPFYGLLPLEECRLFTMDRQPPDGSPRGFHHALHP
FT                   DAARGDLFLHIIEMGCTDLCLIGVTGPLTGRVLTGNADGFRPPNVSSAPDFLSWYERWL
FT                   DHMREGKDNRALGLTSPATVATAPWGPRARGR"
FT   CDS_pept        complement(520510..521307)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4581"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4581"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67661"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSY6"
FT                   /protein_id="CBG67661.1"
FT                   /translation="MNAPDTIVLIHGFWVTPRSWEHWIDRYEKQGYRVLAPAYPGFEAE
FT                   VESLNADPSPIEAITAPRIVESLANVIRGLDKPPVLIGHSAGGAFTQVLLDHGFGAAGV
FT                   ALNSAPTEGVRVAPLSQLKATFPVLKNPANHHKAVGLTHEQWHYAFTNTFSEEESRALY
FT                   ERYAVPASGRILWNSVLANLQPGHQDIWVNYHNDDRAPLLFLSGELDHLMPPRIQQSNV
FT                   KHYKSKTVTEIEVYPGQPHLMPASPGWEEIADHALSWALSHAR"
FT   CDS_pept        complement(521327..522151)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4591"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4591"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67662"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSY7"
FT                   /protein_id="CBG67662.1"
FT                   /translation="MTSEGQPRRRVLGGLLAAGAVTLTAAPAAAAAPSGSGSKPTVVLV
FT                   HGVFADSSGWNDVIARLLKAGFPVIAPANPLRDLADDSAYVSSVVGSISGPVILVGHSY
FT                   GGEVVTNAGRGHAHVKALVYVGAFAPDEGESALQLAGMFPGSELPDALVTRPFPLPDGT
FT                   TGTDGYIDPAKFHRVFAADLPVSVTRLMAATQRPGSVGGLASASGVPAWKSLPSWYVIP
FT                   TADKVIPAAAQRFMAKRARSSAVEVKGASHVVMMSHPDVVVRQITTAYRATR"
FT   misc_feature    complement(521348..522037)
FT                   /locus_tag="SCAB_4591"
FT                   /note="HMMPfam hit to PF00561, alpha/beta hydrolase fold,
FT                   score 0.00063"
FT                   /inference="protein motif:PFAM:PF00561"
FT   misc_feature    complement(521834..521863)
FT                   /note="PS00120 Lipases, serine active site."
FT                   /inference="protein motif:Prosite:PS00120"
FT   misc_feature    complement(522050..522118)
FT                   /locus_tag="SCAB_4591"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB4591 by TMHMM2.0 at aa 12-34"
FT   misc_feature    complement(522059..522151)
FT                   /locus_tag="SCAB_4591"
FT                   /note="Signal peptide predicted for SCAB4591 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.766 between residues 31 and 32"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(522170..522994)
FT                   /transl_table=11
FT                   /gene="cpo"
FT                   /locus_tag="SCAB_4601"
FT                   /product="non-heme chloroperoxidase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4601"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67663"
FT                   /db_xref="GOA:C9YU91"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C9YU91"
FT                   /inference="protein motif:GO:0006805"
FT                   /protein_id="CBG67663.1"
FT                   /translation="MPYVTANDGAQIFYKDWGTGRPVVLSHGWPLNSDSWEAQALFLAS
FT                   NGFRVVAHDRRGHGRSSQTWHGNEMNTYADDLAALIDTLDLRDATLVGFSTGGGEVARY
FT                   VGRHGTARIAQLVLVSAVPPFMLRTDDNPGGLPVEVFDAIRAGSLADRSQLYHDLADGP
FT                   FFGHNRPGSDVSQGIRDAFWLQSMQAGHRGAYECVAAFSATDFRADLDAFDVPTLVVHG
FT                   DDDQVVPFEVGGKASAARIKNATLKVYPGAPHGITDTHKVQLGADLLDFLNS"
FT   misc_feature    complement(522185..522853)
FT                   /gene="cpo"
FT                   /locus_tag="SCAB_4601"
FT                   /note="HMMPfam hit to PF00561, alpha/beta hydrolase fold,
FT                   score 6.4e-34"
FT                   /inference="protein motif:PFAM:PF00561"
FT   CDS_pept        complement(523104..525857)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4611"
FT                   /product="probable transcriptional regulator"
FT                   /note="TTA-Leu codon(s) 22 may indicate regulation by BldA"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4611"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67664"
FT                   /db_xref="GOA:C9YU92"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:C9YU92"
FT                   /protein_id="CBG67664.1"
FT                   /translation="MGVVLKGRVREREALDRFVGELREGLSGVVLLCGDAGIGKTVLLD
FT                   HAASEAADLRVLRVAGVEAESGFPFAALHRVLLPFLDDLKEVRALPETQGEALRVACGL
FT                   TDGPPADRFLVGLATLTLLAETAKRRPLLICVDDAQWLDEESLGVLAFVGRRVHAEGVG
FT                   LLFAARTGFEVPAGLTPTEVAGLEDRFALELLREIVPGRLDNRVAARIVAATAGNPLAL
FT                   TDLGRELSADQLSGGLALSEPLSVGGRLEAYYLGKVRELPQPTRTWLLLAAAEPGGDLG
FT                   YLMSAARRLGIGTDASGPAESARLVAVHTAVRFRHPLVRSAVYSGATSVERRRAHHALA
FT                   AATERPADIDRRAWHLAAAAIGEDAEVAAEVERVADRAGARGGYAARATFLTRAAELTP
FT                   AGEVRAGRLLAAAEAALRAGAPLQAESLLDAIDGELLGDAGQGRALLVRANTGVALGRA
FT                   DSFAHAPALCVRAALLLLDGAPELAREALLVAIERAITGEHLIRDTTLAEIARAVDTLL
FT                   PRTRPATGVDLALRGFAALITDGYEDALPHLRRASAMVLDPATTEEEVLRGYLPAVTLS
FT                   MILWDEEVHTAVIRRAADAARRTGSLWQLDTALYCGTMSETNLGELAAADDLLAEGHRI
FT                   RSAIGANDDVWAIYRHPELLAWHGEHDGLDAVLRGSMEAGTYLGAGAVESIARIGMVVL
FT                   ALGRGDYAQARAVAHALIEQDVLGVHSRVLPRLVEAAVRCGDRVLATQALGTLASRATA
FT                   SGTPWALGLLARSRALLAAVDDAEPLYREAITLLSGTRARSDLAVAHLLYGEWLRRRKR
FT                   RKDAGEQLGTAVTMFDAMGATVYAARAAQELAATGARPRRGPAGTASALTSQELQIARL
FT                   ARGGATNAEIAAQLYISASTVDYHLRKIFRKLDVTSRRQLQQAVDD"
FT   misc_feature    complement(523113..523286)
FT                   /locus_tag="SCAB_4611"
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR family, score 1.5e-14"
FT                   /inference="protein motif:PFAM:PF00196"
FT   misc_feature    complement(523143..523277)
FT                   /locus_tag="SCAB_4611"
FT                   /note="HMMPfam hit to PF04967, HTH DNA binding domain,
FT                   score 7.9e-05"
FT                   /inference="protein motif:PFAM:PF04967"
FT   misc_feature    complement(523728..523805)
FT                   /locus_tag="SCAB_4611"
FT                   /note="HMMPfam hit to PF07721, no description, score 0.03"
FT                   /inference="protein motif:PFAM:PF07721"
FT   misc_feature    complement(525735..525758)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(526046..526645)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4621"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4621"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67665"
FT                   /db_xref="UniProtKB/TrEMBL:C9YU93"
FT                   /protein_id="CBG67665.1"
FT                   /translation="MGIGYKTSWLAVPGRDDREVADALGLHTRVPMDWATGTETAYRRG
FT                   VFVASPVDGWTLAHGRVHLAAGLRDNGPSLQAWLGSLGSLLGDFQYFRTDRIVESHAWA
FT                   RVEAGRVVRAYSYDGDMPLCIGEPTGIEHRLGVGIRGREEGMDAWDEAAWDDWLADMPS
FT                   ERHVMAIAEEWGVSPLGIPDEPSPCDGVHGLPPGVA"
FT   CDS_pept        complement(526717..528075)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4631"
FT                   /product="putative metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4631"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67666"
FT                   /db_xref="GOA:C9YU94"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniProtKB/TrEMBL:C9YU94"
FT                   /protein_id="CBG67666.1"
FT                   /translation="MVFVLLALVVQLVVAGPGAHRANAAAGAATPGTATPDRARYDVSL
FT                   RADADGSHWKGRQKVSFRNASRHPLREVYLRLWGNGQDGCGKPGAPSPVTVSKVRGGRP
FT                   DRLTVRCTALRIALPRPLAHGERTTVAFDVSVTVPDRTDRFGRDGAHRFLGNALPVLAV
FT                   HDARGWHLDPYVALGESFHALVSDFRVRLDHPSALKVPATGRTRTQPAGHGRTVTLSVA
FT                   HRVRDFAWAAGPFRTATQTTPGGVRVKSYWAADTPAAGVRVNRADAVASIDRFGKEFGR
FT                   YPYGEIDLVMTSRFGGGMEYPGLVLVGTTEEGGAVVHEVAHQWWYGIVGNDEYASPWLD
FT                   ESFAQYANARFYGWETRDCWSEVDWPDDSTALTNSMAYWSRHRGEYHLVYTAGSCALAD
FT                   LERTLGAGTMARMLKRYAADHWYGLSTTAAFKKAAQAATDKDLGPFWRTHRIR"
FT   misc_feature    complement(526897..527988)
FT                   /locus_tag="SCAB_4631"
FT                   /note="HMMPfam hit to PF01433, Peptidase family M1, score
FT                   7.4e-06"
FT                   /inference="protein motif:PFAM:PF01433"
FT   misc_feature    complement(527104..527133)
FT                   /note="PS00142 Neutral zinc metallopeptidases, zinc-binding
FT                   region signature."
FT                   /inference="protein motif:Prosite:PS00142"
FT   misc_feature    complement(528004..528075)
FT                   /locus_tag="SCAB_4631"
FT                   /note="Signal peptide predicted for SCAB4631 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.997) with cleavage site
FT                   probability 0.462 between residues 24 and 25"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(528218..528580)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4641"
FT                   /product="hypothetical protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4641"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67667"
FT                   /db_xref="UniProtKB/TrEMBL:C9YU95"
FT                   /protein_id="CBG67667.1"
FT                   /translation="MDMGNWAVVAQYGHSEMYRTEFVWRGKTSKEQALEALRAAVHTYV
FT                   PSKHLVEKRRQVYRFADQESYLVVIKGKLTEWECTLRIAELVSDSADPAVAERARGDGG
FT                   APRAGDEPRDRNPFAP"
FT   CDS_pept        complement(528634..529239)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4651"
FT                   /product="RarD (conservon) homolog"
FT                   /note="PMID: 12657469"
FT                   /note="partial conservon"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4651"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67668"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YU96"
FT                   /protein_id="CBG67668.1"
FT                   /translation="MPSPTHGAHSATAVEQPPLPVKLVVAGGFGVGKTTTVGSISEIRP
FT                   LTTEAAITEVAAGVDDLTHTPEKTTTTVAMDFGCITLDPTLKLYLFGTPGQDRFGFMWD
FT                   DIVDGAVGALVIVDTRRLDDCYAAVDYFEHKGIPFAVAVNAFDGEVVHDLDEVRWALDI
FT                   AEHVPLTVFDARRTGSVRDALLVVLDVALSRAEAITTA"
FT   misc_feature    complement(528658..529167)
FT                   /locus_tag="SCAB_4651"
FT                   /note="HMMPfam hit to PF03029, Conserved hypothetical ATP
FT                   binding protein, score 2.5e-62"
FT                   /inference="protein motif:PFAM:PF03029"
FT   misc_feature    complement(529138..529161)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(529196..529561)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4661"
FT                   /product="conserved hypothetical protein"
FT                   /note="partial conservon"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4661"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67669"
FT                   /db_xref="InterPro:IPR007995"
FT                   /db_xref="UniProtKB/TrEMBL:C9YU97"
FT                   /protein_id="CBG67669.1"
FT                   /translation="MVRPFLLTAGRVSGAGPAAPLPIETQIVATAAGLSLLGRLAFEHH
FT                   DIVAACRRPQSVAELAARLRLHLNVVRVLAEDLCAAGHLAIYVPHARIGQDISVLRRVI
FT                   NGLRAVPDSRGTLRDSG"
FT   misc_feature    complement(529232..529561)
FT                   /locus_tag="SCAB_4661"
FT                   /note="HMMPfam hit to PF05331, Protein of unknown function
FT                   (DUF742), score 5.7e-20"
FT                   /inference="protein motif:PFAM:PF05331"
FT   misc_feature    complement(529469..529561)
FT                   /locus_tag="SCAB_4661"
FT                   /note="Signal peptide predicted for SCAB4661 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.913) with cleavage site
FT                   probability 0.778 between residues 31 and 32"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(529669..530145)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4671"
FT                   /product="RarB (conservon) homolog"
FT                   /note="PMID: 12657469"
FT                   /note="partial conservon"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4671"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67670"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:C9YU98"
FT                   /protein_id="CBG67670.1"
FT                   /translation="MTTSADDSTPEETKPTDLRTAAADFTWLLDRFATETAGVVDAIAV
FT                   SSDGLLIAVSQLRERADSERLAAIVSGVTSLAAGVSGNYGLGGLNKVIIDLEGGHVLVS
FT                   AIGNGAVLGVVASKEAKLGNIAYEMTLFANRAGAALTPQLVMELKNSVGSPVAG"
FT   misc_feature    complement(529798..530073)
FT                   /locus_tag="SCAB_4671"
FT                   /note="HMMPfam hit to PF03259, Roadblock/LC7 domain, score
FT                   1e-19"
FT                   /inference="protein motif:PFAM:PF03259"
FT   CDS_pept        complement(530142..532715)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4681"
FT                   /product="RarA (conservon) homolog"
FT                   /note="PMID: 12657469"
FT                   /note="partial conservon"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4681"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67671"
FT                   /db_xref="GOA:C9YU99"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C9YU99"
FT                   /protein_id="CBG67671.1"
FT                   /translation="MTAEQHTPKETSVPANTVERPPGHRDRTSPFRRKTGSVLARWPFR
FT                   RKLNVLVVAPVAVVGVLLAVGVGGQMEQARDAGRIAELVRDSEQVTKLINDVQAEHRLA
FT                   LLLSVQYEAARPGAARPPTAAYREAQQATDAQVGAVRAAFGASLPAAEKQALGYITGLD
FT                   VLREKLGRDYVPAANIDPAYAAAVGYLIDGIGLDRFSVNSTSSASSVTSLLDAILRADA
FT                   AHAAFESAVFSAQTRDANALTEYTRAAGAHELFVHQSDRFGRMAAPAQVLRMAGIERGA
FT                   EQNDITSQFAELQIDPSALQSQSPRELRAKISAGERQAETRLAITRTLIDETAAQADAA
FT                   SADALRKAWILLGVALLGFAVWLAFCVLVRRSVVRPLVALTGSARQVVEAADEELARVA
FT                   DDELADTTPFSPRPIPVPVRDEIGELAEAFNRVQDTAAALLERQVLSRRNIAEMFGNVG
FT                   RRVSNLTTRQLLLIDAVEREETDPDLLDRLYRIDHIAVRLQRNADSLMLLAGIRETDVE
FT                   ARPITLADVIRSGLGRIEGYQRVSLRSETDITVGPDITGDLTLLLAELMENAVAFSPSD
FT                   SPVEVVVRPGTDVTRDGGALVEIIDHGLGMSAERLAEENARLVRRERLDLVPTKVLGLF
FT                   VVGSLARHLDLRVTLSRTPGGGVTSTVLIPAALLLAMSPVDAAPPAAGRGRTTREFAPH
FT                   TAAPPSAATATATALERRPVAPSPEGELPRRVPLRARTARAEAPDTASPPTTARPLRRR
FT                   VRGATLTATAAERTVPTVRQPADAEAVRAELDEFEAAVRRAEQDSAVRDSAVRDSAVRD
FT                   SAVRDSAVRGGAAQDSAAHLGGEPPNPARTTATRENPRRPEGDGQ"
FT   misc_feature    complement(530715..531059)
FT                   /locus_tag="SCAB_4681"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 3.1e-11"
FT                   /inference="protein motif:PFAM:PF02518"
FT   misc_feature    complement(531402..531665)
FT                   /locus_tag="SCAB_4681"
FT                   /note="HMMPfam hit to PF00672, HAMP domain, score 7.8e-09"
FT                   /inference="protein motif:PFAM:PF00672"
FT   misc_feature    complement(join(531606..531674,532509..532568))
FT                   /locus_tag="SCAB_4681"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SCAB4681 by TMHMM2.0 at aa 50-69 and 348-370"
FT   CDS_pept        533102..534244
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4711"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4711"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67672"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUA0"
FT                   /protein_id="CBG67672.1"
FT                   /translation="MHSTRKATAAAVALLAVATAATGCESGTAAPAAATASREPGCPAV
FT                   LAKAKRAVKEAEDVNAPWSGPTRGPAAVPSRTIVYVAQTMTNPGVSGVAKGVEEAARII
FT                   GWDVRTIDGRGTPAGIRNAFTEAIALKPSGIVVGGFDPASVSRQVEQADAAGIPLIGWH
FT                   ATAAPGPSKDPKLFTNITTDVADVARISADWIIARSGGRAGVVVFTDASIPFAKRKSEL
FT                   IKKELATCPDVDLLSYEDIPIPQANTGTVERVSALRTRFGDRWTYSAAINDLYFDHAAP
FT                   ALRAAGRKGDGAPFNIGAGDGDPSAFQRINGKQYQSATVPEPLSEQGWQIIDEFNRAFT
FT                   DEPASTYVAPVHITTATNSGGALSWDSEGYRRAYRKIWGR"
FT   misc_feature    533102..533215
FT                   /locus_tag="SCAB_4711"
FT                   /note="Signal peptide predicted for SCAB4711 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.667 between residues 38 and 39"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    533141..533173
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    533843..533872
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   CDS_pept        complement(534342..535490)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4721"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4721"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67673"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUA1"
FT                   /protein_id="CBG67673.1"
FT                   /translation="MSDQPVFVLGEELQALELAGFETEQEFQELLARHPRVLDFGSLAD
FT                   GRPLRLTLVAREMGVATTAECGAAYWLDHLFVDADGVPTLVEVKRATDTRIRREVVGQM
FT                   LDYAANAARYWPAALLRRSFEETCALDGRPPAEAYGELLGERSPDEFWTTVEERLAAGQ
FT                   MRLLFVADRIPLELRAIVEFLNRQMRQTDVYAVELTQYRGAKDLRVLVPRVHGEVATAA
FT                   KSPSGRRTTQRTTRADMDEAIGSRPDPDVRRIATALLDHAAEWGRWEGGTAKYRSMSAY
FT                   YAVSGRQVPVWSLSLQDGPAKDDLSFAFGSISHHLGRERAAAFAASLPPVPELAERLRA
FT                   LPEKEYNAWPSVSLSALASEPGALEGVLSAIRQLMDGQELAV"
FT   CDS_pept        complement(535700..535873)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4731"
FT                   /product="putative membrane protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4731"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67674"
FT                   /db_xref="GOA:C9YUA2"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUA2"
FT                   /protein_id="CBG67674.1"
FT                   /translation="MSGLQWMLVLIVVSFLGLGAMAWKGPEIRQDMLKLMGGMVVAAVL
FT                   GYVVSSVQGIRW"
FT   misc_feature    complement(join(535709..535777,535796..535864))
FT                   /locus_tag="SCAB_4731"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SCAB4731 by TMHMM2.0 at aa 4-26 and 33-55"
FT   misc_feature    complement(535808..535873)
FT                   /locus_tag="SCAB_4731"
FT                   /note="Signal peptide predicted for SCAB4731 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.971) with cleavage site
FT                   probability 0.698 between residues 22 and 23"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        536034..536990
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4741"
FT                   /product="putative AraC-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4741"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67675"
FT                   /db_xref="GOA:C9YUA3"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUA3"
FT                   /protein_id="CBG67675.1"
FT                   /translation="MPDSRLRRVAVLVLEGAKPLDVGIPAQVFTTRASMPYEVRVCGAA
FT                   PGLVTGGDGLAYFVEHGLDALVWADVVFVPGYRFPDREDPPRAVVDALIAAHDRGARLA
FT                   AISTGAFALAATGLLDGRRATTHWHYARALARRHPLVRVDENVLFVDEGSVLTSAGAAS
FT                   GIDLCLHILRGDLGVAASNHAARRLVAAPYRSGGQAQYVPRSVPEPLGERFAATREWAL
FT                   HRLGEPLTLDTLARQAGVSPRTFSRRFVEETGYTPMQWVMRARIDLSRELLERSERGVE
FT                   QIAADVGLGTGANLRLHFQRILGTTPSEYRRTFTRGT"
FT   misc_feature    536145..536561
FT                   /locus_tag="SCAB_4741"
FT                   /note="HMMPfam hit to PF01965, DJ-1/PfpI family, score
FT                   1.7e-17"
FT                   /inference="protein motif:PFAM:PF01965"
FT   misc_feature    536679..536819
FT                   /locus_tag="SCAB_4741"
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix prote, score 4e-07"
FT                   /inference="protein motif:PFAM:PF00165"
FT   misc_feature    536826..536954
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00041"
FT   misc_feature    536835..536969
FT                   /locus_tag="SCAB_4741"
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix prote, score 1e-06"
FT                   /inference="protein motif:PFAM:PF00165"
FT   CDS_pept        537087..538085
FT                   /transl_table=11
FT                   /gene="gap"
FT                   /locus_tag="SCAB_4751"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase"
FT                   /note="cluster 0095 with SCAB10521, SCAB69701, SCAB83281"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4751"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67676"
FT                   /db_xref="GOA:C9YUA4"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUA4"
FT                   /inference="protein motif:GO:0006096"
FT                   /protein_id="CBG67676.1"
FT                   /translation="MTRIAINGFGRIGRNVLRALLERDSALEIVAVNDLTEPATLARLL
FT                   AYDSTAGRLGRPVTVDGNTLVVDGRRITVLAEREPAQLPWAELGVDIVLEATGRFTSAK
FT                   AARAHLDAGARKVLVSAPSDGADVTLAFGVNTDAYDPDLHTVVSNASCTTNALAPLAQV
FT                   LDELAGIEHGFMTTVHAYTQEQNLQDGPHRDARRARAAGVNIVPTTTGAAKAIGLVLPN
FT                   LDGKLSGDSIRVPVPVGSIVELNTTVARDVTREEVLAAYRAAAEGPLAGILEYSDDPLV
FT                   SSDITGNPASSIFDSDLTRVDGRHVKVVAWYDNEWGFSNRVIDTLEFLTTG"
FT   misc_feature    537090..537542
FT                   /gene="gap"
FT                   /locus_tag="SCAB_4751"
FT                   /note="HMMPfam hit to PF00044, Glyceraldehyde 3-phosphate
FT                   dehydrogenase, NA, score 1.2e-87"
FT                   /inference="protein motif:PFAM:PF00044"
FT   misc_feature    537534..537557
FT                   /note="PS00071 Glyceraldehyde 3-phosphate dehydrogenase
FT                   active site."
FT                   /inference="protein motif:Prosite:PS00071"
FT   misc_feature    537555..538022
FT                   /gene="gap"
FT                   /locus_tag="SCAB_4751"
FT                   /note="HMMPfam hit to PF02800, Glyceraldehyde 3-phosphate
FT                   dehydrogenase, C-, score 2.7e-96"
FT                   /inference="protein motif:PFAM:PF02800"
FT   CDS_pept        complement(538131..538700)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4761"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4761"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67677"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUA5"
FT                   /protein_id="CBG67677.1"
FT                   /translation="MKANRTVWTTAALVTATLAAVAIPTAATAATPRAATAACPTGWGS
FT                   LDKVDWSYTAGEYITNARTGRHDCYDRFVVDVPAASADQIGYTVHYVDRLIQDPTGDPI
FT                   PINGGAILEVIVRAPAYDSGAPTYPGQAGQPLPGLNLTGYRTFRDAKFASSFEGQSQFG
FT                   LGLRARLPFRVQQLDGRLVVDVAHTW"
FT   misc_feature    complement(538614..538682)
FT                   /locus_tag="SCAB_4761"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB4761 by TMHMM2.0 at aa 7-29"
FT   misc_feature    complement(538614..538700)
FT                   /locus_tag="SCAB_4761"
FT                   /note="Signal peptide predicted for SCAB4761 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.714 between residues 29 and 30"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        538968..539984
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4771"
FT                   /product="putative integral membrane protein"
FT                   /note="no significant db matches"
FT                   /note="TTA-Leu codon(s) 13 may indicate regulation by BldA"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4771"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67678"
FT                   /db_xref="GOA:C9YUA6"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUA6"
FT                   /protein_id="CBG67678.1"
FT                   /translation="MSASSAPAALPRLRHRWAAVTGLLVLSPVSAEYLIGYGDSTDRPL
FT                   ELLAGLLILTPLYGTVAVLIREITRRTGRGWPTILLLSTAFGVIQAGLIDQTLFDNQVD
FT                   PGGPDWATQPLVTLVPGLGIDAASLLNYVGGHVIWSFAAPIAVVDACAPRIADRRWLGP
FT                   AGIGSLVLLWAVSAGLIHTDTATDSTAGPAQLTGAAVVAVALIVAAFTVRPPRTRSSTP
FT                   APSWWLVGGVTGVAWCAGQLLPATWTGVTVNVVVMVALGLLLLRWSRRRGWGQRHVLAA
FT                   AGSALVVRASLSFLVEPLGDHVDLATKYAVNAAMLGGVTVLLFLAARRLRRREARTC"
FT   misc_feature    join(539004..539072,539100..539162,539181..539249,
FT                   539343..539411,539448..539507,539535..539603,
FT                   539640..539696,539706..539762,539799..539867,
FT                   539895..539948)
FT                   /locus_tag="SCAB_4771"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SCAB4771 by TMHMM2.0 at aa 13-35, 45-65, 72-94, 126-148,
FT                   161-180, 190-212, 225-243, 247-265, 278-300 and 310-327"
FT   CDS_pept        539978..540946
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4781"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4781"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67679"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUA7"
FT                   /protein_id="CBG67679.1"
FT                   /translation="MLTVRGISYLVGDADAADVRRDMEVIARDLHCTTVMVIGDGERLI
FT                   EAARTALDVGLGVHLRPHLAELPRPKLLERLGAVAEAAEGLRRDHPDRVTLLVGSEFSH
FT                   TVPGIVPGPRSFLRLKLIVRFRRLLRRRIARRLHPLLAAAATTARSRFGGPVTYSAAGW
FT                   EPVDWSLFDQVGVSLYRSRRNRHAYTDRLRGLVRDHGRPVVVTEFGCGAFTGADERGAG
FT                   SFWIVNWFATPPRIRGDHPRDEAAQARYLGELIDLYEAEGVHGCFVFTYAMPDFPRHDD
FT                   PRLDLDRAGFGIVAVTDDGTRCRKEAFHEVARLYGDLAGKG"
FT   CDS_pept        541188..541883
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4791"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4791"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67680"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUA8"
FT                   /protein_id="CBG67680.1"
FT                   /translation="MSPTKRILIIVTSTGEYEKVGYRTGLWLGELTHFYDVAEAAGFAL
FT                   TIASIEGGAVPLDPESLAHNVLGDLGTDKRYADRAFMDGLRDVVPVTEVDVDDYDAIYL
FT                   TGGHGVMFDFHQSRALETLIARFHESGRIVSAVCHGPCGLLDVTLSDGEPLVRGRNVTG
FT                   FSWREEELAQRADAVPYSLEDRLRELGAHYSVAAKPFDTHVVEDDRLITGQNPGSARAV
FT                   AEAVVRRLG"
FT   misc_feature    541359..541880
FT                   /locus_tag="SCAB_4791"
FT                   /note="HMMPfam hit to PF01965, DJ-1/PfpI family, score
FT                   1.6e-22"
FT                   /inference="protein motif:PFAM:PF01965"
FT   CDS_pept        complement(542204..543190)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4801"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4801"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67681"
FT                   /db_xref="GOA:C9YUA9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUA9"
FT                   /protein_id="CBG67681.1"
FT                   /translation="MMAKNRQDAPREIPELPFAAPAGTPAGVEVMSLAELRRRVPAQAL
FT                   AGPQRPDFHHLLTLTEGDLRQVVDFSGHALEPGSWLWVRPGQVHQWGDVTRAEGTLILF
FT                   RQDVLDPATATAARVDDPHAPVVTTPVTADAEAVTMAAEHLSREFRALGRLPLEVHIAA
FT                   LRHLLAVLLLRLAHLTLPVGGRVPDPDETYLRFRDAVEQHFTGTRRVEDYARMLGYSGR
FT                   TLARATLANSGLSAKEFIDRRVVLEAKRLLAHGEETAAQISDHLGFVTASQFSKYFAQR
FT                   TGRSPIEFRREIRGLAASESDGGRQRTRTADGPGAPAVQEPPVPPSR"
FT   misc_feature    complement(542318..542452)
FT                   /locus_tag="SCAB_4801"
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix protei, score 2.4e-07"
FT                   /inference="protein motif:PFAM:PF00165"
FT   CDS_pept        543313..544320
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4811"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4811"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67682"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUB0"
FT                   /protein_id="CBG67682.1"
FT                   /translation="MCRSDLPLSSPARAGRHPATAFDTCPTPAIRGTGKDLYAVSTVPR
FT                   PLAPAATTTPAPLASARATFRAWLEEADRVLIAAGAGLSAAAGYDYGDTERFRELLPAL
FT                   YRLGLRSRYLFGAPLPADMMWGYWAVHIDDIRYGSEPNPLYRSLRERIGDRDHWVMTSN
FT                   VDGLFARNGFEADRVFTPQGDYGSFQCTVPCSRETWSARPFIDAILAAYDRDTGRVTDS
FT                   RALPRCPRCGADMFPNVRVGPEFVDDAHLPAGRRLVRWLDDAPADSALLVVEIGAGFQT
FT                   PGVIRGPMENLVRHTPRARLVRINPDHPDVPSDLGARALSVPFGADLLLDRPRP"
FT   CDS_pept        544336..545214
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4821"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4821"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67683"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUB1"
FT                   /protein_id="CBG67683.1"
FT                   /translation="MSEASGTSVPTLAVTGSTGRLGGRVARRLAVRGVPQTLLVRSPER
FT                   APRLPGAVAVRAEYADQNAVRDALTGTRTVFMVSASESADRLARHRAFVDAVAEAGVRH
FT                   LVYVSFYGAAPDAAFTLARDHFHTEQHIRASGLAYTFLRDNLYAEFVPDLVGEDGVIRG
FT                   PAGNGRAAFVGQDDIADAAAAVLLRPDDHAGTTYDLTGPESLSLDQAAAVLSERFGRTV
FT                   TYQPETMEAAYASRASFDAPPWQLDAWVSTYTAIASGELDGVSDAVPRLTGHPATSLAD
FT                   VIRGEGDRRNA"
FT   misc_feature    544369..545013
FT                   /locus_tag="SCAB_4821"
FT                   /note="HMMPfam hit to PF05368, NmrA-like family, score
FT                   4.4e-10"
FT                   /inference="protein motif:PFAM:PF05368"
FT   CDS_pept        545361..546122
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4831"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4831"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67684"
FT                   /db_xref="GOA:C9YUB2"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUB2"
FT                   /protein_id="CBG67684.1"
FT                   /translation="MSNAKNTVLQATAELFGDKDPSAVDRWVAADYRQHSALAADGPEA
FT                   LRGLVAGLGEDFRYDGARVIADGDLVALHGTYHGFGPDPLVGFDIFRVDADGKLAEHWD
FT                   ALTPLVEDTVSGRSQTDGPAAVTETGSTEANRALVAEFAEKVLVGADYAVLTDYISTET
FT                   YHQHNTEAADGLDGFGAAAAKWAEEGKNLVYKKVHRVIAEGEFVLTQSEGEFGAAVAYY
FT                   DLFRVADGRIVEHWDVIAPVPAELPHGNGLF"
FT   misc_feature    545376..545720
FT                   /locus_tag="SCAB_4831"
FT                   /note="HMMPfam hit to PF07366, SnoaL-like polyketide
FT                   cyclase, score 4.3e-05"
FT                   /inference="protein motif:PFAM:PF07366"
FT   misc_feature    545769..546098
FT                   /locus_tag="SCAB_4831"
FT                   /note="HMMPfam hit to PF07366, SnoaL-like polyketide
FT                   cyclase, score 1.2e-05"
FT                   /inference="protein motif:PFAM:PF07366"
FT   CDS_pept        546233..547234
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4841"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4841"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67685"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUB3"
FT                   /protein_id="CBG67685.1"
FT                   /translation="MIPIRAESDALTGMGTQRSLPLTAYRAAVALDSPFLPTAAPAAAD
FT                   RRDAHLRSALRLLSTDPVVSRLGLRSDSLRNLAERATETESDAAAARDVLRALLTVRDP
FT                   GPLPEEAERELDALLGAESGLRPRFSPRELPTIEDELPDSAFRAAAATTLWRGDLTTLA
FT                   ADAVVNAANSRLLGCFRPRHPCIDNALHNAAGPRLRDDCHTIVTAQGTREPTGTAKITR
FT                   GYHLPARHVLHTVGPLVQGRPHTDDAQALASSYRSCLDLAAQVESVRTVAFCAVSTGVF
FT                   GYPKDEAASVALRTVEDWITARPHRFDRVVLTVFTADDERAYRHALGEYTRS"
FT   misc_feature    546734..547108
FT                   /locus_tag="SCAB_4841"
FT                   /note="HMMPfam hit to PF01661, Appr-1-p processing enzyme
FT                   family, score 3.7e-55"
FT                   /inference="protein motif:PFAM:PF01661"
FT   CDS_pept        547313..548023
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4851"
FT                   /product="ABC-transporter ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4851"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67686"
FT                   /db_xref="GOA:C9YUB4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUB4"
FT                   /protein_id="CBG67686.1"
FT                   /translation="MSRVVTAAMLRVTDVHKSYGRGAGTVHALRGVSFEVPRGELVAVK
FT                   GRSGSGKTTLLNIVGGLDEPDSGHVTVDGLDLREQSEDALLALRRERIGFVFQSFGLLP
FT                   ILTAAENVGVPLRLRRADPHERRERVDLLLSLVGLADHAEQRPGELSGGQRQRVAIARA
FT                   LANSPSILIADEPTGQLDAETGHSVMELLRAVVRSEQITALVATHDATLLDLADRVLEL
FT                   NDGEITEVARSEAR"
FT   misc_feature    547427..547987
FT                   /locus_tag="SCAB_4851"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   6.4e-60"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    547448..547471
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    547760..547804
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(548086..555155)
FT                   /note="transport system"
FT   CDS_pept        complement(548090..549049)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4861"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4861"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67687"
FT                   /db_xref="GOA:C9YUB5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUB5"
FT                   /protein_id="CBG67687.1"
FT                   /translation="MTSSPTFHELADRALARRDAAAYGHDALITCDRVVRIFSADGVEV
FT                   QALQGLDLLVRQGELMALVGASGSGKSTLMNILAGLDRPTAGAARVAGHDLAAMSAKER
FT                   LAYRRGTVGFVRQQTSQNLLSYLTAAQNVALPLQLARTAGGRRARAARAVELLDLLDVA
FT                   GCRDRRPHEMSGGQQQRVALAVALANGPAVLLADEPTGELDSHTGEQVFAAFRTANAEL
FT                   GTTIVIVTHDQSVAGEVSRTVAIRDGRTSTEVLRHSEVDSATGQENMVAREYAMLDRAG
FT                   RLQLPAEYTRALGMRDRVALELEPDHIAVRPDDIRNEA"
FT   misc_feature    complement(548306..548878)
FT                   /locus_tag="SCAB_4861"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.4e-54"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    complement(548489..548533)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(548834..548857)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(549151..551925)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4871"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4871"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67688"
FT                   /db_xref="GOA:C9YUB6"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUB6"
FT                   /protein_id="CBG67688.1"
FT                   /translation="MTAQPVPPRDGGAKATPPRVRAGLWTRLRAFAGTSVALAVLVAVT
FT                   AALAAAYPRAVDRYGDAGLRRAVEQALPDQTTVQLQAPQSWMDTVEELEAALRAGPLDE
FT                   ARAEVLAAAEAPLVPDRAQSSYGVRTTVPLEAPDRWLPQPAGYPAQLVLAAQQDLASHA
FT                   RLREGRLPRTTDTPATSATTRVEAAVTVETARALRIRVGSVIHLPRSGKDPLAVEVTGI
FT                   VAPRVPEGAYWSALPVLRTPVLSRPPQLMPTDVHWLGGLLLAPDAGPALLGTPGRPERY
FT                   WNVAPDTATLHGRDLDRTASAVAALESGPGLQRLRSAVDDGLEAQTNLDAVLADHARLR
FT                   SGIVPLLLLAAVGAGSLAVIVLSMAGGVAADRRRAELALLRARGASLTGLAGRLLAETA
FT                   VVAVPAGALGLTVALLALPGARTGPAITAALAVTLTACAALPLRAVVAHRTVRMHEGRQ
FT                   DAAAARPSRRRTVAELTVLVIASGAVVALRRQGSGSTALVAAAPLLTGVVAALLLARLH
FT                   PLPLRALSGAATRMRGLVIPLSLAQVARAPGFAVLPLLALLSALTTAAFGGSVLAGVTE
FT                   ARDRAALLDVGADGRVESITGALPPTLPDRVERMPGVRDVAEASVSYDAKPEQGSGSLP
FT                   LAAVDPGTYARLARRTGLGPFDAARLTPKDGATAGSTGRPLPALASSGVVDEYGTGPHS
FT                   VLLADGTSVTVRIVLVRDRTPAVSGDEFLIVDRAGLPRGAAPTTTLLLTGDALNGRALR
FT                   AAAKGSAATVRLRTEERDRHVDSPLQSGAERLYGAAVATGAGYAVLALVLTVLRTAPER
FT                   AALLARLRTMGMTRSQGRRLLILTALPQAFLAAAGGVLTGWAAIHLLAPGVDLSALALA
FT                   TPSAAEGAALRTDPLSLAVPALTVLLLAVGVPAGQAWWVGRRGSVRELRLGDT"
FT   misc_feature    complement(join(549196..549264,549364..549432,
FT                   550213..550281,550384..550452,550585..550653,
FT                   550666..550734,550831..550899,551770..551838))
FT                   /locus_tag="SCAB_4871"
FT                   /note="8 probable transmembrane helices predicted for
FT                   SCAB4871 by TMHMM2.0 at aa 30-52, 343-365, 398-420,
FT                   425-447, 492-514, 549-571, 832-854 and 888-910"
FT   misc_feature    complement(550561..551070)
FT                   /locus_tag="SCAB_4871"
FT                   /note="HMMPfam hit to PF02687, Predicted permease, score
FT                   0.0027"
FT                   /inference="protein motif:PFAM:PF02687"
FT   misc_feature    complement(550615..550647)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(551779..551925)
FT                   /locus_tag="SCAB_4871"
FT                   /note="Signal peptide predicted for SCAB4871 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.972) with cleavage site
FT                   probability 0.905 between residues 49 and 50"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(551922..555140)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4881"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4881"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67689"
FT                   /db_xref="GOA:C9YUB7"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUB7"
FT                   /protein_id="CBG67689.1"
FT                   /translation="MLRAWAYRALVGAVLLTVLLTTAVLAALTAYSTAMGDAALRRTLA
FT                   GQRTAAETALMLKADVPADQRKAADDAVRAGARAVFDGLPLSVRTLLRSGPYALPPALR
FT                   PASERGENPDLTFFAALDRTQVRAVAGRLPRETVSGGTVEAALPQSAARRLGVEAGDRL
FT                   TVTDRLDGPAVRVLITGVYRPVDAGAPYWRLDDLGGRGVQASSYTTYGPLLTAAGLPTS
FT                   GRVSTGASGWLVSADYSSLTTERIGALREAARSGSAHLRKNPALSSATAADTALPEVLD
FT                   RIERSLLVTRSSMLIVAGQLGLLAACALVLVAGLLSSERTAETRLLRARGATRARLAGL
FT                   AALEALLISLPAMVVAPLLSGPLTRLLAGQGALGGTGVRVDVPAGGRPEVWAVAAGVAA
FT                   VCALAVAVPAWRASFAGSAGTRAQALAAPLRAGADVGLLAVAGVALWLLGDQDSGAVTA
FT                   DRGGVLGVDPLLVVAPALVLLAGTVLVLRLLPLLARVGERLVTRGHGLTAAMVGWQFSR
FT                   RPMRGAGPVLLLVISVALGVMAIGQNASWHRSQADQADFRVGADLRVLTSGSGGVGRTD
FT                   VYADLPHVDAVAPAFRGTVPLSGSRNATVLAVNTTEAAHVVRARHDLTDGPLFAGLAPR
FT                   GAPAGVEVPEGTTRLTLTATLHSTGRGPGADVTLTVRDRHGTTYEIPSGSLAADGRPHR
FT                   LTPDLNGARGPLTLTGLTLGTPQPTDRADRHRLVLGALTATARDGDDRRLSLPAKWTTA
FT                   VQADLAAAPEDDARPTRPRLTSTAPVTFTYGTGYQPSGNSPPALPLEVRLKVAQPRPPE
FT                   IAAVATDRFLTASGAREGQRLKVPFDGRSVPVRIVRTASALPTTEATARDGGALLVDLR
FT                   AVNQVLQIRHGTSLKPAEWWLSTAEPRATAAAVRALPDVDPEQVMVRDETAAELRGDPF
FT                   GAAPEAALTAAAAVTVLFASLGFAVSAAGAMRSRDAEFAVLGALGTPRRRLARLVAVEH
FT                   CVLVTLALLVGTALGAVLTHALVPLVVLTGRATRPVPPVLVELPLLPLTALLAALAAGP
FT                   ALVTAALALRRAKPVTALRDEVTQ"
FT   misc_feature    complement(551955..552446)
FT                   /locus_tag="SCAB_4881"
FT                   /note="HMMPfam hit to PF02687, Predicted permease, score
FT                   0.00034"
FT                   /inference="protein motif:PFAM:PF02687"
FT   misc_feature    complement(join(551970..552038,552105..552173,
FT                   552267..552335,553503..553571,553668..553736,
FT                   553794..553862,553899..553967,554064..554132,
FT                   554193..554261,555048..555116))
FT                   /locus_tag="SCAB_4881"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SCAB4881 by TMHMM2.0 at aa 9-31, 294-316, 337-359, 392-414,
FT                   427-449, 469-491, 524-546, 936-958, 990-1012 and 1035-1057"
FT   misc_feature    complement(553896..554456)
FT                   /locus_tag="SCAB_4881"
FT                   /note="HMMPfam hit to PF02687, Predicted permease, score
FT                   0.0001"
FT                   /inference="protein motif:PFAM:PF02687"
FT   misc_feature    complement(554220..554252)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(555045..555140)
FT                   /locus_tag="SCAB_4881"
FT                   /note="Signal peptide predicted for SCAB4881 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.530 between residues 32 and 33"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        555399..556055
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4891"
FT                   /product="hypothetical protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4891"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67690"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUB8"
FT                   /protein_id="CBG67690.1"
FT                   /translation="MVGMSVDLVGTMYTPVPLDGLVLAAEETSARLLGLTTAPVIDVIA
FT                   DRRIEQGRVVGEGRRLSRRERSTELIGERAGGSDDERAGGRDIAFLVAGHEDVVRLLVF
FT                   DPGGVPGREGHEAADGQREPVEAVFSPSRTCAGVVTATALALAVADLGGGEFVDAEIRM
FT                   LPSREPHPGRMIERTRLPDRGDGFAARCERFMRQFARLNGWPRTVHLPPGRQAAL"
FT   CDS_pept        556110..556931
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4901"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4901"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67691"
FT                   /db_xref="GOA:C9YUB9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUB9"
FT                   /protein_id="CBG67691.1"
FT                   /translation="MHTARAERWFSMTPRGQTPPADATRPVALVTGVGRTVGIGAGIAR
FT                   RLAEAGWNVAFTYWTPYDARMPWGAEAGAADTLTAALAERGADAAAVEADLADPDAAAR
FT                   VFDEAERRLGGVTALVMCHCESVESGLLDTTVESFDRHFAVNARAGWLLIREYGRRFRG
FT                   AEGTGRVLSLTSDHTVGNLPYGASKGALDRITLAAAHELSHLGITANVINPGPVDTGWM
FT                   SDGIREHVLRRTPLGRLGSPRDTAHLVEFLCSPQGQWVNGQLLMSNGGFAG"
FT   misc_feature    556185..556718
FT                   /locus_tag="SCAB_4901"
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase,
FT                   score 9.3e-08"
FT                   /inference="protein motif:PFAM:PF00106"
FT   misc_feature    556620..556706
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00061"
FT   misc_feature    556698..556727
FT                   /note="PS00142 Neutral zinc metallopeptidases, zinc-binding
FT                   region signature."
FT                   /inference="protein motif:Prosite:PS00142"
FT   CDS_pept        557182..558039
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4911"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4911"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67692"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUC0"
FT                   /protein_id="CBG67692.1"
FT                   /translation="MVIHLPHDEESGGSGHGHGVGSGGHSAGAGRPRHRAGPVTLRLGP
FT                   GGVARFGRGSADTPVELRLGDPAVSRLAGEIRVTEDHWQLSNFSATQSYLVENPEGAGE
FT                   YVRVPPRRVGAPIPFEFARVVLPARESTVSFQVFAPDHVYLDPDRAQHTAGPWGTQTLT
FT                   AYSLDETATYFLVLVALCEPRLRDESAVAVPTTPQVVERLRTRPEHGGLTARAVSSHIA
FT                   YLAEEKLRLDVPAAVEPGQGARRNGKREAIVGLALRFGLVHEEHLALLPPRTAAGLGAR
FT                   TCTA"
FT   CDS_pept        558027..559412
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4921"
FT                   /product="putative serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4921"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67693"
FT                   /db_xref="GOA:C9YUC1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUC1"
FT                   /protein_id="CBG67693.1"
FT                   /translation="MHGVSDPLERLTPGYRVGDWEVGERIASGGWGTVYEGRPTLPRDE
FT                   GPAAPSGEGGQVVALKFLPTAGLAPRQARALVETARRETEVGRRTRHPRLIRMLDSVVL
FT                   SEPGDPVLDGSVVLVMERAEHSLRRLLERDGPGPAESEKVRLLTEICEGLAHLHGTGWV
FT                   HGDLKPDNVLIMADGSARLSDFGLAVELDGTHGYTPPLGTPDYLPPERWRAPLGERGVQ
FT                   VRPSNDIWALGIMIHQMFTGGASPFPGATPMARGAAAQEYAEGRASLRLDNAVPPLWRE
FT                   LAADCLAPTHAERAGHTAESLLARMRTAAVPRSGGRAKPLLGLALAAALCGTAATGWAY
FT                   SSGGDRSGAPHTAEPAGRVAVFNVVGLCRDRAEDRLPACSLGLAVDPALPYTVENVVAH
FT                   RVWHGDVLAVDCHVLRGTPVSDETGSRSTRWLRVRLPDGSPQTTAWLPAVRTKDGPALP
FT                   DCS"
FT   misc_feature    558084..558944
FT                   /locus_tag="SCAB_4921"
FT                   /note="HMMPfam hit to PF00069, Protein kinase domain, score
FT                   4.5e-39"
FT                   /inference="protein motif:PFAM:PF00069"
FT   CDS_pept        complement(559422..560333)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4931"
FT                   /product="putative secretd protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4931"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67694"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUC2"
FT                   /protein_id="CBG67694.1"
FT                   /translation="MATFAGMLVAVLTALAAMASAASAAPPAARSAPAAPAARPDFKLP
FT                   FACQQTWQLQTYRGHAPDDKKLDMYRVGGNTLGSLVAASAAGTVTERFDPGGVEINHGN
FT                   GWFTVYLHMDRVDVTVGQRVDSGTTLGRLGLEGTTSAHLHYEQLYDTNGDNNGENDEIV
FT                   HPVIQGTEYRLSPDDTFPKVTSTNACGGGSEPSKQWVDTFADATGYAAVDCVGDSRPGC
FT                   APQGKLYKGTNYVLCKKKGAKFQVGSAYNHWWLLTDLDEVAPGGKGRAYVSAYYLQRWG
FT                   NDEAKDNDGRVIRDCGADEVPR"
FT   misc_feature    complement(559839..560123)
FT                   /locus_tag="SCAB_4931"
FT                   /note="HMMPfam hit to PF01551, Peptidase family M23, score
FT                   3.2e-13"
FT                   /inference="protein motif:PFAM:PF01551"
FT   misc_feature    complement(560232..560333)
FT                   /locus_tag="SCAB_4931"
FT                   /note="Signal peptide predicted for SCAB4931 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.305 between residues 34 and 35"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    complement(560247..560315)
FT                   /locus_tag="SCAB_4931"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB4931 by TMHMM2.0 at aa 7-29"
FT   CDS_pept        complement(560472..561059)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4941"
FT                   /product="conserved hypothetical protein"
FT                   /note="PMID:2575701"
FT                   /note="PMID:11567009"
FT                   /note="PMID:11451671"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4941"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67695"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUC3"
FT                   /protein_id="CBG67695.1"
FT                   /translation="MCSSPAKTAADHARRRQAVPMTTTPDGRPVPPAYADEPAMLEAWL
FT                   DFHRATLALKCSGLTDEQSRRAAAAPSAMTLLGLVQHMAEVERTWFQRVFAGRPVPPVF
FT                   GQDNADGFALRPERGLDEATALWREQVARGRELIAGVPLDTVGRLSEQEAGHVGEPGVS
FT                   LRWIMVHMIEEYARHNGHADLLRELIDGVTGA"
FT   misc_feature    complement(560478..560951)
FT                   /locus_tag="SCAB_4941"
FT                   /note="HMMPfam hit to PF04978, Protein of unknown function
FT                   (DUF664), score 2.5e-87"
FT                   /inference="protein motif:PFAM:PF04978"
FT   CDS_pept        complement(561366..563285)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4951"
FT                   /product="putative ABC transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4951"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67696"
FT                   /db_xref="GOA:C9YUC4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUC4"
FT                   /protein_id="CBG67696.1"
FT                   /translation="MMGTTEMRGPAPARSAVVLALRHYVREVLRLRRLALPALLLPAMG
FT                   NIGVRYVAPLLIAKLAAQAADDSLTLGAALPYVLGFGVTLVLAEIVWRVGQHCLNRVDA
FT                   LGMEHLYVSGMDELLAKDAAFFHDNFAGSLTKRVLSYGKRFEDFVDTLTYRIVGSFVPL
FT                   LFGAVVLWSYEPMLVVGLVVMIALTAVAATPLIRRRQRLVHDREAAIARVSGHVADSLM
FT                   NMETIRAFAAERREADEHRSRVAESRRLTLRSWDYGNLRVDMVIAPMSVLTNVLGLVVA
FT                   IAFGSSGQGVEEIVVAFTYYSNATQIMFEFNQIYRRLESSMTEAAQFTELLLDPPTVLD
FT                   PPEPEALAPKDTGIRFDAVTFAHAGAKPIFRDLDLDVPAGARVGLVGRSGGGKTTLTRL
FT                   LLRMADIDRGRLAIGGQDISRLRQTDLRSLIAYVPQEPAMFHRSLRDNIAFARPGATDE
FT                   EVRAAAAAAHVTEFADQLPDGFATLVGERGVKLSGGQRQRVALARAILRDAPILLLDEA
FT                   TSALDSESELLVQDALWRLMDGRTALVVAHRLSTVAGMDRLVVLDRGSVVEQGTHEELL
FT                   ASQGAYAKLWQHQSGGFLGESDESADGCPVPEADHDRLPGPADPAADGEHRTWSDARTR
FT                   TGSM"
FT   misc_feature    complement(561594..562148)
FT                   /locus_tag="SCAB_4951"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.5e-59"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    complement(561603..561632)
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   misc_feature    complement(561771..561815)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(562104..562127)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(join(562428..562496,562698..562757,
FT                   562767..562835,563001..563069,563112..563180))
FT                   /locus_tag="SCAB_4951"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SCAB4951 by TMHMM2.0 at aa 36-58, 73-95, 151-173, 177-196
FT                   and 264-286"
FT   CDS_pept        complement(563438..564742)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4961"
FT                   /product="putative secreted protein"
FT                   /note="PMID:14762003"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4961"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67697"
FT                   /db_xref="GOA:C9YUC5"
FT                   /db_xref="InterPro:IPR001139"
FT                   /db_xref="InterPro:IPR001286"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033452"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUC5"
FT                   /protein_id="CBG67697.1"
FT                   /translation="MTERQNEPERGRGGSPSRRTVLAAVGALPILTAVAPPAAGAVRAA
FT                   AATAVIDPSARRQTIRGFGGMTHTAWIGDLTAAQRDTAFGAGEGQLGLSLLRIPVPEDR
FT                   AAWNRDLATAKRAAQLGAAVIASPWNPPARMVETFVRGSQTDARRLRYDMYGAYAQHLN
FT                   DFTTYMRDNGVNLYGISVQNEPDYAHDWTWWTPAEMLRFLRENAGSIGTRVIAPESFQY
FT                   LKNMSDPILNDPVALANVDIVGAHLYGTSFSNFPYPLFKQKGAGKELWMTEVYHPNSSD
FT                   SADLWPQALDVGEHMHRAMVDAEFQAYIWWYIRRGYGPLREDGRISKRGACMAHFARFV
FT                   RPGYVRIDATPRPATDVYVSAYRSTGSTVAVVAVNKSASAVSQQFTLTSGSPSRVSSWL
FT                   TDASRSVAPQAATGVSNGSFTATLPARSVTTFVTG"
FT   misc_feature    complement(564605..564742)
FT                   /locus_tag="SCAB_4961"
FT                   /note="Signal peptide predicted for SCAB4961 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.608 between residues 46 and 47"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    complement(564617..564685)
FT                   /locus_tag="SCAB_4961"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB4961 by TMHMM2.0 at aa 20-42"
FT   CDS_pept        564953..565312
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4971"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4971"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67698"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUC6"
FT                   /protein_id="CBG67698.1"
FT                   /translation="MSKPDKLLIDVAALVESKKSNQMSLTVVTNGAVITGRLAPETVWR
FT                   QRVSDVLRDSDRLGEFSAMFEAPDRSDGAPTHLHFHVARILQGTVGIPETGGMYRVAIE
FT                   DVSAWTVGDFSYSDT"
FT   CDS_pept        complement(565446..566243)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4981"
FT                   /product="hypothetical protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4981"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67699"
FT                   /db_xref="GOA:C9YUC7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUC7"
FT                   /protein_id="CBG67699.1"
FT                   /translation="MDTFWGECLMNAVGKGPSVVKSGVRRLLGRAGFDIVRSTDNRGGV
FT                   DDFLPFEATMRAARASGLSVGDHIDEVMNKTPGATRKTVDELRARGVFEGDPARVLEIG
FT                   PGSGRYLEKTLKECSPERYEIYETAKPWADYLVETFGVVAQPTEGSSLAPTPDGSVDLL
FT                   QAHKVFNTVTFLCASRYFLEMARVTRPGGRIVFDVMTENCLDPATVRAWAAEGGSGHDS
FT                   YPAPMPRQTCVDLFATLDCTLEAGFLAPMGVGSTEVLVFTKKA"
FT   CDS_pept        complement(566492..567529)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_4991"
FT                   /product="putative polyprenyl synthatase"
FT                   /note="PMID: 12761202"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_4991"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67700"
FT                   /db_xref="GOA:C9YUC8"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUC8"
FT                   /protein_id="CBG67700.1"
FT                   /translation="MTALSTALRPPVDVPFVLERCRELVRPALREAVGRTHPWVGEMAA
FT                   YSFGWCEVGGAPTAASGGKGVRQALAVLGAEVVGAPARAGVPAAVAVELVHVFSLLHDD
FT                   IMDGDVERRRRPTVWKAYGTGPAVLAGDALFALAVETLATAEPGASALRTLSAALGELV
FT                   RGQADDLLFAARPWAGPERVRPAEYRAMAERKTGALLGCAAALGALLGGGPPAAVAALD
FT                   RAGRRLGLAFQIVDDVLGIWGDPEITGKPVHGDLRERKKTFPVLAALDAGSPEARRLAE
FT                   LLASDADPREAAVLVEAAGGRAAALDEARRHITAAQDALADLAPRSAAVDELRALSAFL
FT                   LRRDV"
FT   misc_feature    complement(566612..567382)
FT                   /locus_tag="SCAB_4991"
FT                   /note="HMMPfam hit to PF00348, Polyprenyl synthetase, score
FT                   2.7e-50"
FT                   /inference="protein motif:PFAM:PF00348"
FT   misc_feature    complement(566810..566848)
FT                   /note="PS00444 Polyprenyl synthetases signature 2."
FT                   /inference="protein motif:Prosite:PS00444"
FT   CDS_pept        complement(567526..568590)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5001"
FT                   /product="conserved hypothetical protein"
FT                   /note="PMID:16208464"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5001"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67701"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUC9"
FT                   /protein_id="CBG67701.1"
FT                   /translation="MYGKAFAPEYQGALTTLSVNSSLTEVLAAGTRQLRAAERAGQHGE
FT                   AARSGLAVAEAHRRLGQIGDADQAWKASYRAARAAGDQGAMAWALWSGGTLARQRGSFA
FT                   LARRLLGLAADLGARGGDVVVRGYSLAGLAETGRIQGDYEAVAQLHEQLLAEARRRGEA
FT                   RHTVWALEGIAQIHRQQGAYDSAYTLFEEAAGIAVGADDRRGHAWALRGLADIVSARDG
FT                   DVERALALLSEAEATCREMRLSSALAYNHKMRGNVHYRAGRYAEARDTYELALGEFREM
FT                   SEPRGQALARLGLAKSLARLGRDHDETAAELAALEQELERIGLRHARQMVARAHEELGI
FT                   RPQPRGGVRVEAAR"
FT   misc_feature    complement(567748..567849)
FT                   /locus_tag="SCAB_5001"
FT                   /note="HMMPfam hit to PF07719, Tetratricopeptide repeat,
FT                   score 0.0011"
FT                   /inference="protein motif:PFAM:PF07719"
FT   CDS_pept        complement(568841..569710)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5021"
FT                   /product="putative integral membrane protein"
FT                   /note="no significant db matches"
FT                   /note="TTA-Leu codon(s) 21 may indicate regulation by BldA"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5021"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67702"
FT                   /db_xref="GOA:C9YUD0"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUD0"
FT                   /protein_id="CBG67702.1"
FT                   /translation="MMSLGPSVGCWVLTLSLLLRLRGARGRARTRLLLVAGSAAAGGVY
FT                   RAALAALSGQPAQAPDAAGPAGLTVIVGVTVTVGLGTAGLVAAADAGSGWRAWLRRVLD
FT                   GTVMAGAAFMAGWVFLGRAGEGWRPGAGMLGVLWAAEVVFLGFLLALRRLVRDDQRATV
FT                   WAAIAGVSLMVVGDSLPLSPTDAGDREMLSSPWADLCVTAGLLIVAVGPWVPGGASVLG
FT                   AGRPALRSGMEGAAAFIPLTVCTVTALGYVLAPSAADPVPLLVGGLALLGLWARQIYLP
FT                   SDVRTQDD"
FT   misc_feature    complement(join(568871..568930,568940..569008,
FT                   569042..569110,569168..569224,569258..569326,
FT                   569354..569407,569444..569512,569555..569614,
FT                   569648..569701))
FT                   /locus_tag="SCAB_5021"
FT                   /note="9 probable transmembrane helices predicted for
FT                   SCAB5021 by TMHMM2.0 at aa 4-21, 33-52, 67-89, 102-119,
FT                   129-151, 163-181, 201-223, 235-257 and 261-280"
FT   misc_feature    complement(569534..569710)
FT                   /locus_tag="SCAB_5021"
FT                   /note="Signal peptide predicted for SCAB5021 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.930) with cleavage site
FT                   probability 0.686 between residues 59 and 60"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(570021..570902)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5031"
FT                   /product="putative methyltransferase"
FT                   /note="PMID:15686551"
FT                   /note="PMID:12940979"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5031"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67703"
FT                   /db_xref="GOA:C9YUD1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUD1"
FT                   /protein_id="CBG67703.1"
FT                   /translation="MTTDTTATATATARIPSPATPYQGDIARYWNNEARPVNLRLGDVD
FT                   GLYHHHYGIGAVDRAALGDPAHSEYEKKLIAELHRLESAQAEFLLDHLGAVGPDDTLVD
FT                   AGCGRGGSMIMANRRFGCAVEGVTLSATQADFGNRRARELRVEDRVRSRVCNMLDTPFD
FT                   KGSVTASWNNESTMYVDLHDLFAEHARFLKVGGRYVTVTGCWNPRYGQPSKWVSEINAH
FT                   FECNIHSRREYLRAMADNRLVPQAIVDLTPETLPYWELRATSSLVTGIEKAFIESYRDG
FT                   SFQYVLIAADRV"
FT   misc_feature    complement(570027..570758)
FT                   /locus_tag="SCAB_5031"
FT                   /note="HMMPfam hit to PF02353,
FT                   Cyclopropane-fatty-acyl-phospholipid, score 8.4e-05"
FT                   /inference="protein motif:PFAM:PF02353"
FT   misc_feature    complement(570303..570596)
FT                   /locus_tag="SCAB_5031"
FT                   /note="HMMPfam hit to PF08241, Methyltransferase domain,
FT                   score 1.9e-09"
FT                   /inference="protein motif:PFAM:PF08241"
FT   CDS_pept        complement(570917..572239)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5041"
FT                   /product="conserved hypothetical protein"
FT                   /note="cluster 0734 with SCAB82161"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5041"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67704"
FT                   /db_xref="GOA:C9YUD2"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR034686"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUD2"
FT                   /protein_id="CBG67704.1"
FT                   /translation="MPTPASSAAVPDAAAPAAAPDHRPVAPTASGFLAALHPPVALLVP
FT                   PPTVPTPTPSPPVEPSAAVPGPPDTTAADDALRRILRAPTGPGTASLVVADRFAPPLPS
FT                   PVSRAPVEPAAGRAVPGLYHHPVPEPDPVRVEEVSRRIKRWAEEEVQLYPEEWEGQFDG
FT                   FSVGRYMVACHPDAPTTDHLMLATRLMVAENAVDDCYCEDHGGSPVGLGGRLLLAHTAL
FT                   DHFHTTAEYAPAWQESLASDAPRRAYRSAMDHFVGAATPSQADRYRHDMARLHLGYLAE
FT                   AAWAQTGHVPEVWEYLAMRQFNNFRPCPTITDTVGGYELPADLHARPDMQRVIALAGNA
FT                   TTIVNDLYSYTKELDSPGHHLNLPVVIAERERLPVRDAYLKAVEVHNELQHAFEAASAE
FT                   LAEACPLPAVLRFLKGVAAWVDGNHDWHRTNTYRYTLPDFW"
FT   misc_feature    complement(571058..571873)
FT                   /locus_tag="SCAB_5041"
FT                   /note="HMMPfam hit to PF03936, Terpene synthase family,
FT                   metal bindin, score 3.3e-13"
FT                   /inference="protein motif:PFAM:PF03936"
FT   misc_feature    complement(572051..572239)
FT                   /locus_tag="SCAB_5041"
FT                   /note="Signal peptide predicted for SCAB5041 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.818 between residues 63 and 64"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(572371..573744)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5051"
FT                   /product="putative cyclic-nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5051"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67705"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUD3"
FT                   /protein_id="CBG67705.1"
FT                   /translation="MPQQSLSTAAARTLATTTKSAPQMQEITSRWLLRMLPWVEAEGGV
FT                   YRVNRRLRHTLGNGRVGFVQEGATVRVLPQGLGELAFLRGFEDRDVLGALADRCAQRDF
FT                   TAGEVLVERGSCADRIHLIAHGRVSQTSEGKYGGETAVAVLADGEHFGAHALADPDARH
FT                   DCTVTAETAGTLLTLSRADFTAVQATAPRLRAHLDTFGSRRRRPQNKHGESEIAVSAGH
FT                   TGEPELPGTFVDYELNPREYELSVAQTVLRIHSRVGDLYNGPMDQSEEQLRLTVEALRE
FT                   RQEHELINNREFGLLHNADFKQRIQPRLGPPTPDDMDELLCRRRGTRMFLAHPRTIAAV
FT                   GRGFSACGLHPDQVDIEGQSVPAWRGVPILPCDKIPISAEQTSSIIALRTGEKSQGVIG
FT                   LRRTGLQDEYEPGLSVRFMGINEQAVVSYLVSTYFSAAVLLPDAVGVLENVRIAPGPR"
FT   misc_feature    complement(573169..573444)
FT                   /locus_tag="SCAB_5051"
FT                   /note="HMMPfam hit to PF00027, Cyclic nucleotide-binding
FT                   domain, score 2.4e-16"
FT                   /inference="protein motif:PFAM:PF00027"
FT   CDS_pept        574124..574693
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5061"
FT                   /product="hypothetical protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5061"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67706"
FT                   /db_xref="InterPro:IPR029082"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUD4"
FT                   /protein_id="CBG67706.1"
FT                   /translation="MIDREAAVRLVEEQLTRDYRTWLATDPDAMRMAVVRVREHELVWI
FT                   VSWQSEEFVRTRRPERMLVGNGPYLVDRVDGSLHQVGVVSAKSGAWEADYRARIRGLPV
FT                   RTAVDDLHDGIRAVAVARGRVHAVLTLRRRLPGLTPAEAVRYVGALLDGDLPGRLLAAA
FT                   TAALVTPVDPVSAVQTIRPGGGGRAG"
FT   CDS_pept        complement(574711..576483)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5071"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5071"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67707"
FT                   /db_xref="GOA:C9YUD5"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="InterPro:IPR022029"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUD5"
FT                   /protein_id="CBG67707.1"
FT                   /translation="MRLRIASLPSPVLTGGALTVGLGGLYLAGLLVTSGDIEAGTTVRG
FT                   VDIGGLSRTEAIRKLDAHLAAAGPSELAVRVGDRSGTVDTRQAGLGFDSERTVDRATRT
FT                   ASDPLSVIGGFFHSGGDIEPVVRLDEDKAHAALGNLAKALDQKVRDGAVTFADGRVAQV
FT                   AAHSGYALDVDAAADTLRTSFLHGARGRAVVLPARETRPGVTADEVRRAVRDFAQPAMS
FT                   APVTLTAAGTRFTVDQAVLGEHLRMVPDGSGRLVPKLDVKGLRSAPAVAGPLAAVTTTA
FT                   QNARLELDGDKVAVAEDARPGVQISDSALSEAVLPLLTRTGSARTADVAVRRIQPEVTR
FT                   ENAARLGLTQKMSSFTVNFEPAPYRTKNIGRAAQLINGSVVMPDETWSFNRTVGRRTEA
FT                   NGFVEGIMILDDQFTKAAGGGVSAVATTVYNAMFFAGVKPVEHGAHSFYIERYPEGREA
FT                   TVAWGSLDLRFTNDSGKALYIQAEATDTSVTISFIGTRHYDEIRSVKGPRTHVQPPAKK
FT                   VRTDDKCVPQTPLEGFDVTVERVFYDAGKEVRREPFRTHYTPRDEITCETPEPSDTPSP
FT                   GPTTGQTAPPATHG"
FT   misc_feature    complement(574996..575409)
FT                   /locus_tag="SCAB_5071"
FT                   /note="HMMPfam hit to PF04294, VanW like protein, score
FT                   1.3e-46"
FT                   /inference="protein motif:PFAM:PF04294"
FT   misc_feature    complement(575941..576027)
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   misc_feature    complement(576367..576483)
FT                   /locus_tag="SCAB_5071"
FT                   /note="Signal peptide predicted for SCAB5071 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.978) with cleavage site
FT                   probability 0.779 between residues 39 and 40"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    complement(576382..576450)
FT                   /locus_tag="SCAB_5071"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB5071 by TMHMM2.0 at aa 12-34"
FT   CDS_pept        576810..577439
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5081"
FT                   /product="hypothetical protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5081"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67708"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUD6"
FT                   /protein_id="CBG67708.1"
FT                   /translation="MNSDADADADADANANANANGNTYFGSGSGSGSASGLDDPSHDLG
FT                   TWSIERLRSFTERVQDGQLEAVRVVAQQHAYSAVGSPEACREWARLSLRANQRMSGDRS
FT                   WDRARKAHQNFMLRMWVIERLGPDPGDRLWDPEALAADTVSALDLTPVAARALAEHWPD
FT                   LAIERIGELRRHKNLTAHAGELVGRLRPGPVRDLLLTWSETRPHLP"
FT   misc_feature    576945..576974
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   CDS_pept        577571..578251
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5091"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5091"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67709"
FT                   /db_xref="GOA:C9YUD7"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUD7"
FT                   /protein_id="CBG67709.1"
FT                   /translation="MTDDIAAGSPVPHLVSSAGGYAGDPAVRAEWDSRYADRTQLWSGQ
FT                   PNGALVAETAGLTPGRVLDVGCGEGADAVWLARGGWDVTALEVSGVALERAAGHARDAG
FT                   LAIRWVHAELAGAALPPGSFDLVSAQYPALLRTPDSAAERALLAAVAPGGVLLLVHHAG
FT                   METRQAHENDFDPADYVWPSMVAELLDDDWEIEVDEQRPRVAPDGGAGAHHTDDLVLRA
FT                   RRLR"
FT   misc_feature    577757..578038
FT                   /locus_tag="SCAB_5091"
FT                   /note="HMMPfam hit to PF08242, Methyltransferase domain,
FT                   score 1.6e-11"
FT                   /inference="protein motif:PFAM:PF08242"
FT   misc_feature    577757..578044
FT                   /locus_tag="SCAB_5091"
FT                   /note="HMMPfam hit to PF08241, Methyltransferase domain,
FT                   score 9.6e-11"
FT                   /inference="protein motif:PFAM:PF08241"
FT   CDS_pept        578534..580036
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5111"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5111"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67710"
FT                   /db_xref="InterPro:IPR018535"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUD8"
FT                   /protein_id="CBG67710.1"
FT                   /translation="MRHTTRKRSRTTHRVVAAAAGLALGAGGLIAVNVYASAHEGDNAY
FT                   ATKRSPQAQGQAGQAGAAGAVTIGCPDVGAKLTSVPDRARGEVDRELALLDQQVAEAYQ
FT                   RLRDSGGAVQADAGFVTNAIMGPLKDKRAATIDRIAIAISRSAPRPQGLESLAACTLRD
FT                   SGGQPAGSQGQSGGQGQSGGNAGGQNGTGAPGGNGPASADFVDITKVQPNVKTPRRSRG
FT                   ASSGIFTTRCGVNANKLYNSDNIIVAPGVGNGAHHTHDYVGNQDNDAFTTNEEFAAAST
FT                   SCRNQGDKSTYYWPVLRLQDGTREFDAKRLGGGAEGNTGRILTASKVTLNFVGSPRGKV
FT                   VAMPKFLRIITGDAKAFTNGTANANAAWSCTGFENRQLTDKYPVCPRGSSLVRTSKFQS
FT                   CWDGRSIDSANHRAHVAFADPRTGACPNGFKAIPQLVQRLVYDVKAPSLGDNGKSSPFY
FT                   AVDGFPEQMHKPITDHGDFINVFDERLMNRMVQCINTGRACR"
FT   misc_feature    578534..578641
FT                   /locus_tag="SCAB_5111"
FT                   /note="Signal peptide predicted for SCAB5111 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.673 between residues 36 and 37"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    578570..578638
FT                   /locus_tag="SCAB_5111"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB5111 by TMHMM2.0 at aa 13-35"
FT   CDS_pept        580171..580806
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5121"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67711"
FT                   /db_xref="InterPro:IPR008319"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUD9"
FT                   /protein_id="CBG67711.1"
FT                   /translation="MTTKYDVKRALKAYYAPKNTDWELVDVSELRYLAVDGHGDPNTAT
FT                   AYRHAVEALYAVAYTVKFTSRRELGEDFVVGPLEGLWWADDMGDFLARRKDNWRWRMLI
FT                   NVPGWITDLMIEEARAAALAKKDRPALGDVRPETLREGTSAQVLHIGSYDDETPVLTRL
FT                   HRDYLPAHGLREAGLHHEIYLSDPRRTDPARLRTVLRQPVERRRPVEG"
FT   CDS_pept        complement(580828..581523)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5131"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5131"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67712"
FT                   /db_xref="GOA:C9YUE0"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUE0"
FT                   /protein_id="CBG67712.1"
FT                   /translation="MTLISPDSDSDRGPDDAPAPVPARPRGTRLLGVLAALTLTAGVVC
FT                   QFLQRTDPTPPLMYFTVDSAVLAATVRTWRPARGPGGGVWPERIRDAATVGVVLSALVY
FT                   CTVIAPSSPSGTWFGAHDDVWARAATVLLHAVAPVWVVAEFLTRPYTPAPTLREAALLT
FT                   CWPALYLVVVGGLAGAGAATMPYDFLRPSQLGRPAVAVAVVVLYALALGLASALLMART
FT                   HVQGRRTRR"
FT   misc_feature    complement(join(580867..580935,580978..581046,
FT                   581083..581151,581194..581247,581380..581448))
FT                   /locus_tag="SCAB_5131"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SCAB5131 by TMHMM2.0 at aa 26-48, 93-110, 125-147, 160-182
FT                   and 197-219"
FT   CDS_pept        complement(581520..582467)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5141"
FT                   /product="hypothetical protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5141"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67713"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUE1"
FT                   /protein_id="CBG67713.1"
FT                   /translation="MTSVLKAAPAWEAVRVATAGGPLGETLVGVVDGRGDAGGPTFLVA
FT                   QGFLAFVEPFEMQRFRLIASILRARLVVVETPGAGFAASRLLPAERRALLRGDFTVPAR
FT                   RMLRAATEVLGADGRGAGAGETDVSGVLGYSLGASFAAAMAAVSGTTRTGPPLRTVVLV
FT                   EPVAVRRWSAVGLLAAVHHENRLIRPYLDQTATVPGAVRPLEDRTDAEPVTRRRGDLLL
FT                   LANALRAARLGGDLMTAGRRDPGPERSRLLVVRGERSTLSPREAVASLMASAERHGYAA
FT                   HLLSVPGPHAFWHSLPAVAAATTRLGRILGTTTP"
FT   CDS_pept        complement(582464..583381)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5151"
FT                   /product="hypothetical protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5151"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67714"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUE2"
FT                   /protein_id="CBG67714.1"
FT                   /translation="MMKYLLIDDQGKRSRVFAEQVSLPGRLEFEIMDDPELLRDLDVED
FT                   LAEFDGAIVDFHLNTPSGPGYRPLTIVDPARFDGPVEVRTGMGAMLYLRQHVPDMSLYG
FT                   MTELTHGHAQLFLAAAAVWLAADPLNVNEPPEILRRVLLAPDGEQAHLQASHRQMSDST
FT                   GPFRRLMDSCLKRKHLTETYDWLRCYRMCNGPRAHRQVAGSVKRLLGLRIPVDAERTFF
FT                   PMMTQWQTDLEAFVRAWGEDTTHWPDVTTGVSAKTWAERNPVLDYVKSGAYETFFNSPD
FT                   VRAALTFHRVNEAQEKLRAREEQP"
FT   CDS_pept        complement(583378..584778)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5161"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5161"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67715"
FT                   /db_xref="GOA:C9YUE3"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUE3"
FT                   /protein_id="CBG67715.1"
FT                   /translation="MSLSRQDRLSLVDFLPAQDRPTGPWAQILWDLRAPAPMSVWSTRV
FT                   TAARIHRYDRVRPFVTRGFLLVVLAVLFAYADDARPLAWALLSVGVLQTTLEIYLDGQA
FT                   HGGARSRFTVVRMLLSWQDDWQWERTLLNATGLLGGLAVPANVLAVLFLTGPGDPGWVK
FT                   PAALAVALAYANSGIFHVLTDGTYYSANQSLPRFLVTLRAYGWLLVTGVLVAFVALSVH
FT                   LGKWSPEMVPLAWAACVLPYFVGLKARDCDRSLRAGGEEVALAMNEARDRLAQDFHDMH
FT                   TGARSLFRALADDEAVSAQVRIDAADFAPMITLVKEMADERAWDAGDKEIALDAVLAQL
FT                   ARDHSLRLTTRLRLGELRPANRELVRQLITTVVSNAAQAMARRAIHDRPVSVSGEVSEG
FT                   MIHLRISDPLPLIPDGAWCVDGSTLAFMRDRLRRLGGDMTQSEVAGGKEIRGVWSVRPP
FT                   RLKRESTR"
FT   misc_feature    complement(join(584041..584094,584122..584190,
FT                   584209..584277,584320..584388,584479..584538,
FT                   584551..584604))
FT                   /locus_tag="SCAB_5161"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SCAB5161 by TMHMM2.0 at aa 59-76, 81-100, 131-153, 168-190,
FT                   197-219 and 229-246"
FT   CDS_pept        585066..585362
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5171"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5171"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67716"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUE4"
FT                   /protein_id="CBG67716.1"
FT                   /translation="MGRFTAVPTPRSATEESMALTRRPRRPRRNWPVCATTGKRRLGER
FT                   KDARLLLAAARRSRSHAELQGVRPEWTVVRAYRCPHCSGGWHLTSVARWAGAA"
FT   CDS_pept        585359..586540
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5181"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5181"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67717"
FT                   /db_xref="GOA:C9YUE5"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUE5"
FT                   /protein_id="CBG67717.1"
FT                   /translation="MTRHSPVPRTAPLLSALAVCALAVGTLTACGSVPGPAPLTVAVTG
FT                   SMAEPAPWAPVVEDIAVRHALDAVDPGDGKVSVVVSTNPRVTEVDLTPLRDAREVEQDR
FT                   AAAGEKARAGAAGLRRAMTEGRPAADGLDLLGTYRRALRATPDGGTVVLVSSGVQTADP
FT                   LDLRTLGWTFDPATVVRDLKNRSLVPDATGRHVEFVGLGIVLGTQPELPLPAARRITAL
FT                   WRAVCAASGAASCTVRDDDVPRLPSASQRPVPVVPVGATPTSCKGTYVVPASVTFTADD
FT                   ARLAPGADRYLRPVADSLERCGTDVVVTITGHTARVGAGASGFALSGRRARAVSERLVR
FT                   LGVSPALIGSVEGVGSTRPRVDNMPGGVFAERLARQNRRVEITVTPKEGPGRS"
FT   misc_feature    585359..585502
FT                   /locus_tag="SCAB_5181"
FT                   /note="Signal peptide predicted for SCAB5181 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.766 between residues 48 and 49"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    585395..585463
FT                   /locus_tag="SCAB_5181"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB5181 by TMHMM2.0 at aa 13-35"
FT   misc_feature    585416..585448
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    586031..586063
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    586184..586492
FT                   /locus_tag="SCAB_5181"
FT                   /note="HMMPfam hit to PF00691, OmpA family, score 1.3e-06"
FT                   /inference="protein motif:PFAM:PF00691"
FT   CDS_pept        586537..587883
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5191"
FT                   /product="putative membrane protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5191"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67718"
FT                   /db_xref="GOA:C9YUE6"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUE6"
FT                   /protein_id="CBG67718.1"
FT                   /translation="MTSISPGGTASPPHVTHTAAGHGGRPRIPLGETLTSVLGMGPMPF
FT                   TKIVRCHALVGEARRIGRDRPADAWTHSEDSLRGAAERRADAWVRTEAGRTVEPAVATI
FT                   KGLHAEARFLGHQLASLHERRYVGPHGESYTTAEAHGRHADWAARVEDEERAGSRAHRR
FT                   IPPRAKKLLLGLLALDVIVLTFLMAKFLNVDLRRALLSADSVLRAVTALLFGILGTVGV
FT                   ALTMKLFGRRHRAYRAAHGGWDLAGGGSSRGGVKTLVSELLLCGLLALALGAAMAWRLV
FT                   LDGPSDQRLLTGVMAALFALVIGAVAYLSYQSEFADGSTTTEAIDVLAPQLHGTHRTEE
FT                   ALRAKREILLRQAARLTARLARDCARLRAEAERRVVESTEDRAVRYARSVHQHCGYGSA
FT                   LPGPRLSLGDLDLALAQARSWTDTEAVPAVAVGGEGQGEQGDEGLAVVA"
FT   misc_feature    join(587047..587115,587158..587226,587308..587376,
FT                   587404..587472)
FT                   /locus_tag="SCAB_5191"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SCAB5191 by TMHMM2.0 at aa 135-157, 172-194, 222-244 and
FT                   254-276"
FT   CDS_pept        587880..588146
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5201"
FT                   /product="hypothetical protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5201"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67719"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUE7"
FT                   /protein_id="CBG67719.1"
FT                   /translation="MSLWGRARSTARRAWAVGEIIAAVTGAGQAPPPPGMPAYLQQQYA
FT                   EHSGTRTERLGRDTGRLTATDRRPTTGLTLDRDSARRLRGGKK"
FT   CDS_pept        complement(588200..588925)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5211"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5211"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67720"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUE8"
FT                   /protein_id="CBG67720.1"
FT                   /translation="MTRSDAIVVPELYVGYPGVAFGGYVAGTLAQRLDARTVRVDFRGP
FT                   APVDVPLPVAGTADGGVRLGEAERPLAAARPAELSLDVPTAPSRAAATAASERFRSDPP
FT                   PGAVDCFGCGLRAPGRGLRVHCAPVPGSGLVAAAWVPPPVFAGPDGRLPERLVWGVLDC
FT                   PGHWAGRFLGTQQPGAVTASLTGSILRPVTTGEPHVVHAWLLSESGRKHTMGVALTTAE
FT                   GELCALSEALWIDPRPAPA"
FT   misc_feature    complement(588206..594661)
FT                   /note="putative transport system"
FT   misc_feature    complement(588839..588907)
FT                   /locus_tag="SCAB_5211"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB5211 by TMHMM2.0 at aa 7-29"
FT   CDS_pept        complement(589041..589631)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5221"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5221"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67721"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUE9"
FT                   /protein_id="CBG67721.1"
FT                   /translation="MIKGYDMRRIGAAAAVLVLAGTTLGTAAGTAGAETEAAAGRTVAA
FT                   ACPTGWGSGAKGGAAVGADHLRNIRTGRHACYDRMVFEVPGGGRISYHVQYVKRLLTDG
FT                   GGQYIPVKGGAILDIRIGAWSYDLEAGAPTYPGKVGKRLPGVDVTGYNTFRDTRFGGTF
FT                   EGQTQVGLGVRARLPFRVLRLSDRVVVDVAHRW"
FT   misc_feature    complement(589533..589631)
FT                   /locus_tag="SCAB_5221"
FT                   /note="Signal peptide predicted for SCAB5221 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.929 between residues 33 and 34"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(589747..591288)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5231"
FT                   /product="putative nucleotide-binding ABC transporter
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5231"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67722"
FT                   /db_xref="GOA:C9YUF0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUF0"
FT                   /protein_id="CBG67722.1"
FT                   /translation="MSHTRGRYTKADDPTGDDSPAVRVSDLTVTAPDGRHLLSEASLTA
FT                   RPGRLLALTGPSGAGKTTLLRALTGLLPPGTTRTAGHVDVLGHDVFALTDRELRTLRGT
FT                   RLAYVGQDPGSGLNPRMRVRTLVRELAADRDPKAVAALLAEVRLPDDGRLAGRRPGALS
FT                   GGQQRRVALARALARRPDLLLLDEPTAGLHPELRDEIAELLRHLAREHHLAVILSCHDH
FT                   AVVERVADDIVELGARPRPPSPAPVLTPRTAPAPPLPGTPPALDVRNLHVSFRGTPALT
FT                   GVDLTVAPGAAVGIVGVSGAGKTTLVRTVVGLQRSTSGTIRLSGTALSTGLRGRTRAQR
FT                   RGLQLVTQNPLGALNPSRRVGDAVGRPLRLHRRCPSAETAQRVAHLLEQVGLPPAFADR
FT                   YPHELSGGQRQRVAVARALAAEPDVLICDEVTSALDAETGHALMDLLTDLRERNGTTLV
FT                   LISHDLSLIADRTSTVTVLEAGRAVESGPTAEVFAAPRHAATRALLGAAVSATAP"
FT   misc_feature    complement(589849..590421)
FT                   /locus_tag="SCAB_5231"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.6e-53"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    complement(590035..590079)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(590377..590400)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(590581..591147)
FT                   /locus_tag="SCAB_5231"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   2e-55"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    complement(590761..590805)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(591103..591126)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(591285..592091)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5241"
FT                   /product="putative transport system integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5241"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67723"
FT                   /db_xref="GOA:C9YUF1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUF1"
FT                   /protein_id="CBG67723.1"
FT                   /translation="MKIAAALRATPALLLIGLALAGPWIAPHAVDTPVTAPYATPDSAA
FT                   LLGGDQLGRDVLARLLAGGRDLVLSSLLVALLVTGTAALLGAIGAVRPLVGRLVERTAD
FT                   VLMLLPAVLGILLVTLSWPDGGRLAVIAAAVVLGVPYAVRLTASAARPIAEAGYVEAAA
FT                   AGGERLWYLVVREILPNLRATLLALFGLRFVAAVYLVATAGFLQVGPQPPAADWALMVR
FT                   ENSSGLLLNPWAVVAPSIAIGLLALSVNLAAATLAPQTGRKAVTVL"
FT   misc_feature    complement(591294..591902)
FT                   /locus_tag="SCAB_5241"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 6.1e-19"
FT                   /inference="protein motif:PFAM:PF00528"
FT   misc_feature    complement(join(591336..591404,591462..591530,
FT                   591657..591710,591723..591782,591819..591887,
FT                   592011..592079))
FT                   /locus_tag="SCAB_5241"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SCAB5241 by TMHMM2.0 at aa 5-27, 69-91, 104-123, 128-145,
FT                   188-210 and 230-252"
FT   misc_feature    complement(591984..592091)
FT                   /locus_tag="SCAB_5241"
FT                   /note="Signal peptide predicted for SCAB5241 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.342 between residues 36 and 37"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(592088..593008)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5251"
FT                   /product="putative metal transport integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5251"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67724"
FT                   /db_xref="GOA:C9YUF2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUF2"
FT                   /protein_id="CBG67724.1"
FT                   /translation="MGAVLLKRALLLALLLALVFGTVELLPGDAATATAERGESAADVA
FT                   ARRAQLGLDRPVLERFGDWMTGLPTGDLGTSARGEKVTDLLSSAFPNTLLLGGIALLLT
FT                   ALVSLTAGCWAALRPGGRVDRAVSATATAVLALPEFVVAVALVLVFSLWTGWLPAVTLT
FT                   GADGTPADWTMLVLPALALTVPQAGWNIRIVRAALADEARAPHVETAVLDGLPPHRVLT
FT                   HHVLPGALPAIAAGLATSTGMLLGGAVVVETIFNHPGIGSVLASAVSDRDSPVIAGVTA
FT                   LSGAVLTAVLLLADLVRDLATGVRR"
FT   misc_feature    complement(592091..592741)
FT                   /locus_tag="SCAB_5251"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 1.7e-39"
FT                   /inference="protein motif:PFAM:PF00528"
FT   misc_feature    complement(join(592118..592186,592244..592312,
FT                   592427..592495,592538..592606,592664..592732,
FT                   592925..592984))
FT                   /locus_tag="SCAB_5251"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SCAB5251 by TMHMM2.0 at aa 9-28, 93-115, 135-157, 172-194,
FT                   233-255 and 275-297"
FT   misc_feature    complement(592670..592702)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(592919..593008)
FT                   /locus_tag="SCAB_5251"
FT                   /note="Signal peptide predicted for SCAB5251 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.481 between residues 30 and 31"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(593092..594645)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5261"
FT                   /product="putative secreted solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5261"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67725"
FT                   /db_xref="GOA:C9YUF3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUF3"
FT                   /protein_id="CBG67725.1"
FT                   /translation="MDLTRRQLLWAGGAIGAGVMLTACGGGDEKPTASATGDSAKPRKG
FT                   GTLRVGALGRAGAITRDPHGSQANESDYLIISLLYDTLTVPGAKPNTEPRLAASWKPSK
FT                   DLKTWRFTLAKGATFHDGTPVTAEDVVFSLKRLRATPSGASRLPGIQAKNITADGTDTV
FT                   VIVSDYANAELPLLVRLTTFVVPKGTTDKDIAKAPGTGPFKLDWFRGGNARLVRNDDWY
FT                   GGEVHLDAIEVKIFESPQAMASALLAGQIDLASNVGAVAARTAESRKDIQAVRRPNDMA
FT                   MPLVMRTADGPFADPRVREALRLAVDREAMVKQVLSGYGTVANDILGTGDPAYAKDLPQ
FT                   RTRDLTKAKALLKEAKFDTSKTYELYTTEDIAGLAESATLFATQAREAGVKIKVVKQES
FT                   ATFWDKTWLKGDLYTTYWGTNDSVVFFASKTMVSDSGTNEAGWKDEDFDTAYEEAIGTA
FT                   APAERTALLKELQKIGYDASGYLLWGMADGIDLAGAEVRGLPTLPGYGRVQLEGAWLAS
FT                   "
FT   misc_feature    complement(593329..594375)
FT                   /locus_tag="SCAB_5261"
FT                   /note="HMMPfam hit to PF00496, Bacterial extracellular
FT                   solute-binding prot, score 3.4e-78"
FT                   /inference="protein motif:PFAM:PF00496"
FT   misc_feature    complement(594382..594645)
FT                   /note="PS00430 TonB-dependent receptor proteins signature
FT                   1."
FT                   /inference="protein motif:Prosite:PS00430"
FT   misc_feature    complement(594541..594645)
FT                   /locus_tag="SCAB_5261"
FT                   /note="Signal peptide predicted for SCAB5261 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.989) with cleavage site
FT                   probability 0.721 between residues 35 and 36"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    complement(594574..594606)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        594935..595924
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5271"
FT                   /product="putative oxygenase (putative secreted protein)"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5271"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67726"
FT                   /db_xref="GOA:C9YUF4"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR014503"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUF4"
FT                   /protein_id="CBG67726.1"
FT                   /translation="MPTGSTPVRLLDGDSVAELTAAAHTLLAAHDGDPTHPGLLARVPA
FT                   VAASLSEPIRHACRPVDTADGLFVLRGLRVDDDAVGPTPDHWSTAGHAGAVHDVVLLLL
FT                   STVMGTPIAWEGQQDGRFVHNIVPSPGHEEEQTGASSSVLLSPHTEDAFHPGRAHLLIL
FT                   GCVRNPDSVATTAAGIRNVELSDADVELLSRPVLPILPDDAYEEARAYQGTPPPVPTLW
FT                   QSHEGLTLRFDPAYTPLEQAPEDHRAAYARLEDELARVSVAVSLEPGEVLVVDNDLVVH
FT                   GRVPFKARYDGSDRWLKRSSVRAKGRRTRPPAEESEHGYGQAAVEAHA"
FT   CDS_pept        595921..596943
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5281"
FT                   /product="putative ornithine cyclodeaminase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5281"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67727"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUF5"
FT                   /protein_id="CBG67727.1"
FT                   /translation="MTGTDSTGGTAMTPDDTTLRILGTSDVAGIDISLADVVSVVEQAY
FT                   RTLADGQSDNPQKLTVKPQDGHSVAYAMLGRDGVRGVVAVKTSYKYGLHEDRDKQHYYT
FT                   TLTLYDDESGLPVAMLDCGRVGALRTPAVSALLARELAAPGARSALVVGTGTQGRLALP
FT                   FLLTTLPGLERLMLFGTHPDGIRAVREQLRTHFPDRELEVVTDLRAAAGDADIVLATAG
FT                   PNTPASVDAEWLKPAALSVLIGYGIAPSTLHRADRVIATSTAQMRVTGVDMADADGRLP
FT                   EVDAEFPEVLAGRAEGRTDAGQRIFAYNSGLVVTDIALGHRFAQLALAQGLGTAVPLWK
FT                   "
FT   misc_feature    595969..596913
FT                   /locus_tag="SCAB_5281"
FT                   /note="HMMPfam hit to PF02423, Ornithine
FT                   cyclodeaminase/mu-crystalli, score 3.6e-13"
FT                   /inference="protein motif:PFAM:PF02423"
FT   CDS_pept        596940..598286
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5291"
FT                   /product="putative lysine/ornithine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5291"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67728"
FT                   /db_xref="GOA:C9YUF6"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUF6"
FT                   /protein_id="CBG67728.1"
FT                   /translation="MTAALPSHTTPEVRALLGDALLHELSHGLRGPYHVLLPERFDANA
FT                   AAFRRVFAEAGVDGRVYYAKKANKAAVYAERAAVAGLGVDVASQGELREALAAGVRGED
FT                   LVVTGPAKVDDLLRVAVLQGALIAVDALDELDRLLSLAEQLGRTARVLLRRLPPGQPHS
FT                   RFGLDDGELDAALRRCVTGPVEMEGFSFHLSGYDTRQRADLAAESIGLCTRARALGLRA
FT                   DRISIGGGFAVDYVGAEEWRRFEESRRPEHFHAEKSFGGFYPYHSPVAGADALRTILAT
FT                   TPAGAGEGTTLAGLLRAAGVTLLVEPGRALLDQAGFTVFRVQGVKERDGYALLTVDGSS
FT                   LSLSEQWFDSEFLPDPVLVPAGSGPRADAGPYPACVGAATCLESDMLTWRKVPFPLRPA
FT                   AGDLLVYLNTAGYQMDSNESPFHDLPLPPKAVVEPSASPFRWRLDRHPH"
FT   misc_feature    596997..597026
FT                   /note="PS00142 Neutral zinc metallopeptidases, zinc-binding
FT                   region signature."
FT                   /inference="protein motif:Prosite:PS00142"
FT   misc_feature    597063..597881
FT                   /locus_tag="SCAB_5291"
FT                   /note="HMMPfam hit to PF02784, Pyridoxal-dependent
FT                   decarboxylase, py, score 2.5e-10"
FT                   /inference="protein motif:PFAM:PF02784"
FT   misc_feature    597468..597536
FT                   /note="PS00527 Ribosomal protein S14 signature."
FT                   /inference="protein motif:Prosite:PS00527"
FT   misc_feature    597888..598235
FT                   /locus_tag="SCAB_5291"
FT                   /note="HMMPfam hit to PF00278, Pyridoxal-dependent
FT                   decarboxylase, C-, score 4.9e-07"
FT                   /inference="protein motif:PFAM:PF00278"
FT   CDS_pept        598317..599375
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5301"
FT                   /product="putative cystathionine beta-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5301"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67729"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUF7"
FT                   /protein_id="CBG67729.1"
FT                   /translation="MDDPLYRPPVVRQVSELIGATPLFELARTESDTRLLLKLEQFNPT
FT                   GTAKIRMARQMVVDAEERGLLRPGGRIVESTSGNTGLGLAVVAAERGYTFTAVVDHHAA
FT                   VDKLRAMKALGAELVYVAEEGDGDLATAAREEFAEKLAAESDNAYFTEQHNNMANGVGY
FT                   HPVARELHAALDGRIDILIGAVGTGGGLFGTGGPLRETVPGLRIVGVEPKGSIAFGPPA
FT                   HDYHQSGTGTPEGATIGAMVDYSLLDEGVKVGDVEAFATARAVARRTGLLLGGSAGGVV
FT                   HEALTRLSTLPPGTTMVALINDGGEKYMDTVFDDDWMAARALLSPQVEREIDELLTKLR
FT                   HAPSPEPSQETV"
FT   misc_feature    598356..599228
FT                   /locus_tag="SCAB_5301"
FT                   /note="HMMPfam hit to PF00291, Pyridoxal-phosphate
FT                   dependent enzyme, score 5.1e-58"
FT                   /inference="protein motif:PFAM:PF00291"
FT   CDS_pept        599375..600784
FT                   /transl_table=11
FT                   /gene="norM"
FT                   /locus_tag="SCAB_5311"
FT                   /product="multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5311"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67730"
FT                   /db_xref="GOA:C9YUF8"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUF8"
FT                   /inference="protein motif:GO:0042493"
FT                   /protein_id="CBG67730.1"
FT                   /translation="MPPALTRLLTDSRALATLAVPLALTQLAQVALTTTDTIMMGLLGT
FT                   EALAAGGLALVIFNQLRTMGVGLVTAVGNQVAAADARTESQGADADAGAAETALEEVRD
FT                   LVRASLLLSTLAGLAGALLMVGIGHLVVHLGQDPDVVDAAKPVLYALAPGLLPCLWFQA
FT                   IRQFTVGMRRPQALLRITIASIAVNVGLNWVFIHGTWGLPKLGLPGIGLATTSVYALSF
FT                   LALYLSARRDPRLAPVLSLSIWKTRPATLRRLTALGAPIAATYGSEAGFFSVVALLVGS
FT                   FGTAALAAHTAVNQLVYIVFQIAVGLSHAASLGVSRELALGNTAAAQRLKSTALACAAA
FT                   VMAVVAVLYAAVPGLVLAPFFEGESRTATDLATSLLLIAAVMQFFDCAQNIGVGLLRGL
FT                   DDTKGGFRITLVGYWLVGLPAALLLGFATGWDTVGIWLGLLTGLATTALLLLRRFNKGV
FT                   RLRNAATAMAA"
FT   misc_feature    599375..599464
FT                   /gene="norM"
FT                   /locus_tag="SCAB_5311"
FT                   /note="Signal peptide predicted for SCAB5311 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.732) with cleavage site
FT                   probability 0.314 between residues 30 and 31"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    join(599483..599551,599702..599770,599813..599866,
FT                   599900..599959,599987..600055,600134..600202,
FT                   600245..600313,600374..600442,600485..600553,
FT                   600590..600658,600668..600727)
FT                   /gene="norM"
FT                   /locus_tag="SCAB_5311"
FT                   /note="11 probable transmembrane helices predicted for
FT                   SCAB5311 by TMHMM2.0 at aa 37-59, 110-132, 147-164,
FT                   176-195, 205-227, 254-276, 291-313, 334-356, 371-393,
FT                   406-428 and 432-451"
FT   misc_feature    600152..600643
FT                   /gene="norM"
FT                   /locus_tag="SCAB_5311"
FT                   /note="HMMPfam hit to PF01554, MatE, score 2.1e-19"
FT                   /inference="protein motif:PFAM:PF01554"
FT   CDS_pept        complement(600787..601818)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5321"
FT                   /product="putative LacI-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5321"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67731"
FT                   /db_xref="GOA:C9YUF9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUF9"
FT                   /protein_id="CBG67731.1"
FT                   /translation="MAANRRPTLADVAREVGVSAKTVSRVLNEDGPASAQTREQVMAAV
FT                   AKLGFQPNLMARNIRVGGPDTTVGLVIPDLGNPFFGAVASSIEDTVRDRGLTLLMGSSA
FT                   DDPDRERALTDKFLARRISILMVVPSVGADHSHLKSHRAAGLPVVFLDRPGAALATDHV
FT                   VSSNRTGAHDGVAHLIAHGHRRIGFIGDLPAKLYTRRERLTGYRSALQEAGLPADRALI
FT                   TNAHDQRGASAATSQLLGLADPPTALFAGNNIVALGIVTELARTGRKDVAVVAFDDVAL
FT                   ADALEPALTVVAQNPEELGRTAATVALARLDGDRTRARTITVPTRLIIRGSGERPAPAP
FT                   RGV"
FT   misc_feature    complement(600826..601626)
FT                   /locus_tag="SCAB_5321"
FT                   /note="HMMPfam hit to PF00532, Periplasmic binding proteins
FT                   and sugar b, score 1.4e-11"
FT                   /inference="protein motif:PFAM:PF00532"
FT   misc_feature    complement(601723..601800)
FT                   /locus_tag="SCAB_5321"
FT                   /note="HMMPfam hit to PF00356, Bacterial regulatory
FT                   proteins, lacI fami, score 1.1e-08"
FT                   /inference="protein motif:PFAM:PF00356"
FT   misc_feature    complement(601738..601794)
FT                   /note="PS00356 Bacterial regulatory proteins, lacI family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00356"
FT   misc_feature    complement(601885..604937)
FT                   /note="putative transport system"
FT   CDS_pept        complement(601900..602736)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5331"
FT                   /product="putative ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5331"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67732"
FT                   /db_xref="GOA:C9YUG0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUG0"
FT                   /protein_id="CBG67732.1"
FT                   /translation="MTATSTVTPVLQARGLVKRYGHVTAIDGADFDLLPGEVLAVIGDN
FT                   GAGKTSLIKALTGAVTPDEGEIRLNGEPITFAGPQSARAHGIETVYQDLAVAASMDIAS
FT                   NMFLGRELRRPGVLGSVFRMLDKKRMRDEAAEHMADLKIGLRSLTQSVETLSGGQRQAV
FT                   AVARSVAWARSVVVMDEPTAALGVKESGQVLDLIRRVRDKGLPVVLISHNMPHVFEIAD
FT                   RIHVHRLGRRAAVIKPSDYSMAEVVAIMTGALTVDEAGDTVVADSAAAKAAGVQAD"
FT   misc_feature    complement(602047..602631)
FT                   /locus_tag="SCAB_5331"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   2e-41"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    complement(602230..602274)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(602587..602610)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(602733..603746)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5341"
FT                   /product="putative sugar transport integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5341"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67733"
FT                   /db_xref="GOA:C9YUG1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUG1"
FT                   /protein_id="CBG67733.1"
FT                   /translation="MTATTTPPGTSSPYAELKAPNPARRLLTAPTTGPLVALILACAFF
FT                   SLSSDQFLTGGNFSLIVQQVMVVGTLAIGQTLIILTAGIDLSCGAVMAFGSIMIAKMAA
FT                   EGSLPPLAAIALGLVVCGGFGLLNGLLVQKIPLPPFIVTLGMLNVAFALTHIYSEEQTV
FT                   TNLPGPLTALGQTFPLGKTDITYGSLVTIALFLLLAYTLSNTGWGRHVYALGNSPEAAR
FT                   LNGIRTGRLTIGVYTVAGILYGIAALLLISRTGVGDPQAGQTDNLDSITAVVLGGTSLF
FT                   GGRGSVLGTFIGVLIVGVFRNGLQLMGVASIYQTLITGVLVILAVTVDQISRKKAR"
FT   misc_feature    complement(join(602763..602831,602850..602909,
FT                   602994..603062,603123..603191,603273..603332,
FT                   603351..603419,603447..603515,603534..603593,
FT                   603603..603671))
FT                   /locus_tag="SCAB_5341"
FT                   /note="9 probable transmembrane helices predicted for
FT                   SCAB5341 by TMHMM2.0 at aa 26-48, 52-71, 78-100, 110-132,
FT                   139-158, 186-208, 229-251, 280-299 and 306-328"
FT   misc_feature    complement(602769..603578)
FT                   /locus_tag="SCAB_5341"
FT                   /note="HMMPfam hit to PF02653, Branched-chain amino acid
FT                   transport syst, score 2.2e-61"
FT                   /inference="protein motif:PFAM:PF02653"
FT   misc_feature    complement(603621..603653)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(603900..604928)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5351"
FT                   /product="putative substrate-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5351"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67734"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUG2"
FT                   /protein_id="CBG67734.1"
FT                   /translation="MSRTARLSSSLVRTAAVAGVAALTLTACGSGSGSTSTGSGSGSGS
FT                   GEVKVGLITKTDTNPFFVKMKEGAEKAADAEGVKLMTAAGKFDGDNAGQVTAIENMVAA
FT                   GVKGILITPSDSKAIVPAIEKAKAKGVLVIALDTPTEPESAVDALFATDNLKAGELIGE
FT                   YAKAAMKGKKAKIAALDLAPGVSVGVQRHNGFLKGFGATDKDVACAQDTGGDQAKGQTA
FT                   MENCLQKEPDINVVYTINEPAALGAYTALKAKGREKDVLIVSVDGGCTGTQAVKDGKIA
FT                   ATSQQYPLKMAAEGVKAVVTYAKDGKKASGYTDTGVTLITDKPQDGVTSKDTVYGLENC
FT                   WG"
FT   misc_feature    complement(603936..604790)
FT                   /locus_tag="SCAB_5351"
FT                   /note="HMMPfam hit to PF00532, Periplasmic binding proteins
FT                   and sugar b, score 2.6e-13"
FT                   /inference="protein motif:PFAM:PF00532"
FT   misc_feature    complement(604809..604928)
FT                   /locus_tag="SCAB_5351"
FT                   /note="Signal peptide predicted for SCAB5351 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.333 between residues 40 and 41"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    complement(604845..604877)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        605179..606141
FT                   /transl_table=11
FT                   /gene="scrK"
FT                   /locus_tag="SCAB_5361"
FT                   /product="fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5361"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67735"
FT                   /db_xref="GOA:C9YUG3"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUG3"
FT                   /inference="protein motif:GO:0000272"
FT                   /protein_id="CBG67735.1"
FT                   /translation="MSPRQITVLGECVADAFAEPSSASNELALRVLPGGGPANTAVALA
FT                   RLGTPARFLARLSGDVFGRLFRAHLEASGVDLSSAVRAAEPSTLAVAELDSTGQASFSF
FT                   HAQNTADWQWTAAELARVDLSGTACLHTGSLALVREPGAAAVEEFLAAAAPTATISIDP
FT                   NVRPLLVRPEVYRARLAHWCALTDVLRLSEDDLELLLPGTPPEQACDIWHAAGARLVVI
FT                   TRGADGVLASLDGERVRVSAVRTAVADTVGAGDSFTAGLLHHLGARGLLGGRLTGLRLD
FT                   DVAEACRFAVRVAALTCSVVGPNPPWENQLTQLTTADLV"
FT   misc_feature    605185..606108
FT                   /gene="scrK"
FT                   /locus_tag="SCAB_5361"
FT                   /note="HMMPfam hit to PF00294, pfkB family carbohydrate
FT                   kinase, score 9.3e-39"
FT                   /inference="protein motif:PFAM:PF00294"
FT   misc_feature    605923..605964
FT                   /note="PS00584 pfkB family of carbohydrate kinases
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00584"
FT   CDS_pept        606345..606638
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5371"
FT                   /product="putative secondary metabolism monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5371"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67736"
FT                   /db_xref="GOA:C9YUG4"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUG4"
FT                   /protein_id="CBG67736.1"
FT                   /translation="MNKTLLAEFTAREGAQDEVARLIVEYAEKVREEDGNITFDVYTKA
FT                   SRPRAFWIFEVYRDEDAFQAHIAAPYGGPFNAALAPLIEEDASVLTFLDPVA"
FT   misc_feature    606375..606563
FT                   /locus_tag="SCAB_5371"
FT                   /note="HMMPfam hit to PF03992, Antibiotic biosynthesis
FT                   monooxygenase, score 7.2e-14"
FT                   /inference="protein motif:PFAM:PF03992"
FT   CDS_pept        complement(606669..607178)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5381"
FT                   /product="hypothetical protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5381"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67737"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUG5"
FT                   /protein_id="CBG67737.1"
FT                   /translation="MPCCTPDVLRTFIDRHVDTADPGDERLRAFVRTHVVGEPHVGDAE
FT                   ALAELRPGDGSGDGSGDGFALYVRARAFYGAVIAPTHDGAAVLGLSIDDPEGSPRTRDT
FT                   ARRLLDRLRREFSAPAWIAGVELPPPRTRAEWEEEPVELRVGRVPPGPGHPAGPRGRGG
FT                   SGRDGE"
FT   CDS_pept        complement(607224..608609)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5391"
FT                   /product="putative regulator (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5391"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67738"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUG6"
FT                   /protein_id="CBG67738.1"
FT                   /translation="MFGIIRPCRHRLGDGMRTEWMAHLCGLCLALRGEYGQFARVATNY
FT                   DGLIVSVLTEAQSERSGDRRRGAGPCPLRGMRSADVAQGEGARLAATVSLVLAAAKIRD
FT                   HVADGDGLLGRRPVTLAARRIAHGWDRAGAAGGERLGFDTAVLLAAVDRQPGIERTTRP
FT                   GGSLLTVTEPTETATAAAFAHTAVLAGRPGNAEPLAEAGRLFGRLAHLLDAVEDLDADR
FT                   ASGAWNPIAVTGADHAEVRRLCDDAVRGIRLALSDAEFVDGRLVRALLGGELERAVDRA
FT                   FDPRHRHHQHRARGRSVRMLPWLGLRTATEPAERTGTDAACGVGALTDATPEGARMMSG
FT                   RPREGECRRCGRWDRLCGSCGLCSRCCTCDDEGPDDGDFSFGNDNRDGGPGRDGSGGDG
FT                   WSGGSGGGNSGGYQGGSGGGGHGSGGHGSGGSGGSGGGSGDGCGGGGGGCCNPCKCCCD
FT                   CCD"
FT   CDS_pept        608875..609624
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5411"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5411"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67739"
FT                   /db_xref="GOA:C9YUG7"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUG7"
FT                   /protein_id="CBG67739.1"
FT                   /translation="MDPADFYTGIVAELYAPLKAFSQDPEPYADFVRRAGVPALELGCG
FT                   DGDPLLELCRRGLEVDGVDSSADMLERLRLRAEEQDVRTTVFHQRMEALSLPRRYRAVF
FT                   LAGPTFTLLPDDTVALAALKGIRAHLTDDGSVLVPLFVPEPTPADQIGRVRTATAADGA
FT                   ELRVSVVAEERNESARTRTTVLRYERHQRSDSTVVDRPWVLHWYTRDGFEKLATAAGLT
FT                   VASVTDPQGGPAPADGTDLHVLLRAAP"
FT   misc_feature    608992..609282
FT                   /locus_tag="SCAB_5411"
FT                   /note="HMMPfam hit to PF08242, Methyltransferase domain,
FT                   score 5.6e-08"
FT                   /inference="protein motif:PFAM:PF08242"
FT   misc_feature    608992..609288
FT                   /locus_tag="SCAB_5411"
FT                   /note="HMMPfam hit to PF08241, Methyltransferase domain,
FT                   score 2.6e-06"
FT                   /inference="protein motif:PFAM:PF08241"
FT   CDS_pept        complement(609649..610689)
FT                   /transl_table=11
FT                   /gene="litR"
FT                   /locus_tag="SCAB_5421"
FT                   /product="putative DNA-binding regulator"
FT                   /note="PMID:15716454"
FT                   /note="carotenoid pigment gene cluster"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5421"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67740"
FT                   /db_xref="GOA:C9YUG8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUG8"
FT                   /protein_id="CBG67740.1"
FT                   /translation="MEPLPHGVTTGFLARQLGVSPTTLRSWDRRYGLGPAVRAEGRQRR
FT                   WSPEDVAMLQEMCRLTATGIPPAEAARAAMRRPRGRAAEPPAAELPAVATATARRASGG
FT                   SAAEPEEPARPGAFGAASHAATALPLGDVRQECRGLARAAVRLDAAAVQEQLLTVVRTY
FT                   GLVVAWEEVIAPTLRAVGRKWESSGDRYVEVEHLLSWHISTTLRHLYAATPQPQGDTPP
FT                   VLLACLPDEHHTLPLEALSAALAESRVPALMLGGAVPADALDGAVRRTGPAAVALWAQS
FT                   RRTAGLPLAQHTAATRWGVRGARRQTPVLLCGPGWGRRTPEELLRPAGLRDAVTTLVAL
FT                   STSARP"
FT   misc_feature    complement(610552..610665)
FT                   /gene="litR"
FT                   /locus_tag="SCAB_5421"
FT                   /note="HMMPfam hit to PF00376, MerR family regulatory
FT                   protein, score 8.1e-10"
FT                   /inference="protein motif:PFAM:PF00376"
FT   CDS_pept        complement(610908..611858)
FT                   /transl_table=11
FT                   /gene="crtV"
FT                   /locus_tag="SCAB_5431"
FT                   /product="putative iron-sulfur protein"
FT                   /note="PMID:10767533"
FT                   /note="PMID:11200234"
FT                   /note="PMID:15716454"
FT                   /note="carotenoid pigment gene cluster"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5431"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67741"
FT                   /db_xref="GOA:C9YUG9"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUG9"
FT                   /protein_id="CBG67741.1"
FT                   /translation="MAWERQRPTWREARPAVIARALKRAQARPSGNWYVVGATRDLRAD
FT                   RPLARTVAGREVVVWRDADGRLVAGPGVCPHLGAPLKDSPVRCGTLVCHWHGLALPGSP
FT                   FAGWEPLPAHDDGVLVWVRLDDVGGEAPLDAPVVPVRPAPAASLSAVYVGIGTCEPEDV
FT                   VANRLDPWHGAWFHPYSFVDLTVADAPTGAGDEDAFVVDVSFKLAGRLVVPVRAVFTAP
FT                   EPRTVVMHITDGEGQGSVVESHATPLAPDDRGRPRTAVVEAVVAASDRPGFAVARRAAP
FT                   LLRPLMRAAAGRLWRDDLAYAERRWHLRSTGRFPG"
FT   misc_feature    complement(611490..611765)
FT                   /gene="crtV"
FT                   /locus_tag="SCAB_5431"
FT                   /note="HMMPfam hit to PF00355, Rieske [2Fe-2S] domain,
FT                   score 3.6e-09"
FT                   /inference="protein motif:PFAM:PF00355"
FT   CDS_pept        complement(611915..612829)
FT                   /transl_table=11
FT                   /gene="crtB-1"
FT                   /locus_tag="SCAB_5441"
FT                   /product="putative phytoene synthase"
FT                   /note="PMID:8917308"
FT                   /note="PMID:15716454"
FT                   /note="carotenoid pigment gene cluster"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5441"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67742"
FT                   /db_xref="GOA:C9YUH0"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUH0"
FT                   /protein_id="CBG67742.1"
FT                   /translation="MERRPAVHALYGFARWADDIVDSLDTDLPPHRRAADLGLLHERLE
FT                   QGLRDGDSPEPVVLALADTARRYAIDHRHFRDFMASMRSDLEVTDYPTYDALRAYTHGS
FT                   AAVIGLQMLPILGTVVPREEAAPHAAALGLAFQLTNFLRDVGEDLDRGRVYLPADLLAA
FT                   HGVDRELLSWSRRTGRRDPRITRALRAFDDLTRGVYREAAPGLPMLDPVSRPCIRTAFV
FT                   LYGGILDAVADDGYAVLHRRAVVPRRRRAAVAADGLVRLTAARLRGRAQARRTPPATAV
FT                   VPTAAPPRTGVGAAPDPVHEEVA"
FT   misc_feature    complement(612041..612877)
FT                   /gene="crtB-1"
FT                   /locus_tag="SCAB_5441"
FT                   /note="HMMPfam hit to PF00494, Squalene/phytoene synthase,
FT                   score 4.2e-86"
FT                   /inference="protein motif:PFAM:PF00494"
FT   misc_feature    complement(612359..612436)
FT                   /note="PS01045 Squalene and phytoene synthases signature
FT                   2."
FT                   /inference="protein motif:Prosite:PS01045"
FT   CDS_pept        complement(612952..614496)
FT                   /transl_table=11
FT                   /gene="crtI"
FT                   /locus_tag="SCAB_5451"
FT                   /product="putative phytoene dehydrogenase (phytoene
FT                   desaturase) (putative secreted protein)"
FT                   /note="PMID:8917308"
FT                   /note="PMID:15716454"
FT                   /note="carotenoid pigment gene cluster"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5451"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67743"
FT                   /db_xref="GOA:C9YUH1"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR008150"
FT                   /db_xref="InterPro:IPR014105"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUH1"
FT                   /protein_id="CBG67743.1"
FT                   /translation="MSRTVPGRTDHIVVVGAGLSGLAAALHLLGAGRRVTLVERDPLPG
FT                   GRAGRLVRGGYRIDTGPTVLTMPDLADEAFAAVGENLRDRVELIPLHPAYRALFADGSG
FT                   IDVHTDADAMEAEVERFAGAEEAAGYRRLRGWLEKLYRAQLRRFIDTNFDSPLQLLTPD
FT                   LARLAALGGFGRLDAGIGRHLRDERLRRVFSFQALYAGVPPARALAAYAVIAYMDTVAG
FT                   VYFPRGGMHALPQAMADAAADAGADLRFGQEVVRLERSGDRVTAVVTADERIPCDAVVL
FT                   TADLPAVYRLLGRTPRRPLRIRHAPSAVVLHAGTDRTWPELAHHTLSFGAAWRRTFDEL
FT                   TRTGSLMSDPSLLITRPTATDPTLAPPGHHLHYILAPCPNTDIGPDAAAWGDLAPRYRD
FT                   SVLRELERRGFDGIADAVEEQALVTPADWHAQGHAAGTPFSAAHTFAQTGPFRPRNLVR
FT                   GTTNAVLAGCGTTPGVGVPTVLLSGKLAAARITGGHAAPVPGRVRTAPTAPEGPTS"
FT   misc_feature    complement(613024..614442)
FT                   /gene="crtI"
FT                   /locus_tag="SCAB_5451"
FT                   /note="HMMPfam hit to PF01593, Flavin containing amine
FT                   oxidoreductase, score 3.1e-56"
FT                   /inference="protein motif:PFAM:PF01593"
FT   misc_feature    complement(613030..614466)
FT                   /gene="crtI"
FT                   /locus_tag="SCAB_5451"
FT                   /note="HMMPfam hit to PF01266, FAD dependent
FT                   oxidoreductase, score 6e-10"
FT                   /inference="protein motif:PFAM:PF01266"
FT   misc_feature    complement(613051..613113)
FT                   /note="PS00982 Bacterial-type phytoene dehydrogenase
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00982"
FT   misc_feature    complement(614404..614463)
FT                   /gene="crtI"
FT                   /locus_tag="SCAB_5451"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB5451 by TMHMM2.0 at aa 12-31"
FT   CDS_pept        complement(614493..615851)
FT                   /transl_table=11
FT                   /gene="crtE"
FT                   /locus_tag="SCAB_5461"
FT                   /product="putative geranylgeranyl pyrophosphate synthase"
FT                   /note="PMID:8917308"
FT                   /note="PMID:15716454"
FT                   /note="carotenoid pigment gene cluster"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5461"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67744"
FT                   /db_xref="GOA:C9YUH2"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUH2"
FT                   /protein_id="CBG67744.1"
FT                   /translation="MSATEGTVMGPSDAKDHPVAASPPATRAAPRREHAGDDPCSGVHR
FT                   PSPGPRREDHPHPPPGAGGPHTVDDDVPAAVRRVLENLLAERTERAAALDPVFAADLAD
FT                   RVARFALDGGKLMRPRFVWWALRACGGGAAETEAALRVGAALELIQTCALVHDDVMDAS
FT                   RLRRGRLALHADIAAQYAGGTAPADGARFGEAAAILAGDLALAWADDIVAATLTTPDTD
FT                   RAVRELWSVMRTEMVAGQYLDIQGQATSSRSLARAIRAACLKSALYSVERPLALGAALA
FT                   GADAARTRALCSAGRCVGIAFQLRDDLGDVFGGPRHSGKPTGGDIRAGKPTYLVAVAQA
FT                   RAEAAGDRRALTVLRESLGDAELPENRLAEVVDVLVRTGARDLVEAKIDRLVAQGLRHL
FT                   DSAPLETEGRRRLRELLHTTAGGPPPTPPFGARGPLDGLPVPLLPGAVEEVAR"
FT   misc_feature    complement(614703..615548)
FT                   /gene="crtE"
FT                   /locus_tag="SCAB_5461"
FT                   /note="HMMPfam hit to PF00348, Polyprenyl synthetase, score
FT                   6.7e-28"
FT                   /inference="protein motif:PFAM:PF00348"
FT   misc_feature    complement(614922..614960)
FT                   /note="PS00444 Polyprenyl synthetases signature 2."
FT                   /inference="protein motif:Prosite:PS00444"
FT   misc_feature    complement(615348..615392)
FT                   /note="PS00723 Polyprenyl synthetases signature 1."
FT                   /inference="protein motif:Prosite:PS00723"
FT   CDS_pept        616152..616775
FT                   /transl_table=11
FT                   /gene="litS"
FT                   /locus_tag="SCAB_5471"
FT                   /product="putative sigma factor"
FT                   /note="PMID:15716454"
FT                   /note="cluster 0758 with SCAB85121"
FT                   /note="carotenoid pigment gene cluster"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5471"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67745"
FT                   /db_xref="GOA:C9YUH3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUH3"
FT                   /protein_id="CBG67745.1"
FT                   /translation="MSAQQAEKTQDGVALWAPAEDSLEQEELAAGFVAGDEGCLTAAYH
FT                   RWGGLVYTLARRSLGDAREAEDVRQSVFLAAWRGRAGYAPERGALGAWLVGITRRKIAD
FT                   ALTARTRQADLVAAAGTRMAEAPVNRDTLPEAVLDRVLIGREFARIPAPQRRVLTLAFY
FT                   DDLTQAQIAEVTGWPLGTVKSHARRGLQRLSRSLSEEGVDDHHG"
FT   misc_feature    616278..616487
FT                   /gene="litS"
FT                   /locus_tag="SCAB_5471"
FT                   /note="HMMPfam hit to PF04542, Sigma-70 region, score
FT                   3.2e-17"
FT                   /inference="protein motif:PFAM:PF04542"
FT   misc_feature    616569..616730
FT                   /gene="litS"
FT                   /locus_tag="SCAB_5471"
FT                   /note="HMMPfam hit to PF08281, Sigma-70, region, score
FT                   3.4e-14"
FT                   /inference="protein motif:PFAM:PF08281"
FT   misc_feature    616587..616736
FT                   /gene="litS"
FT                   /locus_tag="SCAB_5471"
FT                   /note="HMMPfam hit to PF04545, Sigma-70, region, score
FT                   4.3e-13"
FT                   /inference="protein motif:PFAM:PF04545"
FT   CDS_pept        617042..618277
FT                   /transl_table=11
FT                   /gene="crtY"
FT                   /locus_tag="SCAB_5491"
FT                   /product="putative lycopene cyclase"
FT                   /note="PMID:8917308"
FT                   /note="PMID:15716454"
FT                   /note="carotenoid pigment gene cluster"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5491"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67746"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUH4"
FT                   /protein_id="CBG67746.1"
FT                   /translation="MLEADVAIVGAGAAGLSLAHRLSRPAPGGPRLSVLLLDAPPGPSR
FT                   PPVRTWCFWEAGPGPYDAALSAAWRRLRVRTPEGRLLDTDIAPLTYKMIRSDDFEALVT
FT                   GELARSDEVRRVEAAVETVDGVARGAEILARTGGGAPVAVRARWVFDSRPLGSLPAART
FT                   TLLQHFHGWYVRAERPVFDRGTVEFMDFRVPQPPGGLAFGYVLPTDSRRALVEYTEFSR
FT                   AVLSPGAYDTALRRYTEEVLRLGDFAVVSTETGVIPMTDARFPRRSGPSVFRIGAAGGA
FT                   TRPSTGYTFSAIQRQTRAVAAALRAGRHPLPPPAHSARSRAMDAVLLRALDSGRVDGAA
FT                   FFARLFARVPAERLLRFLDGETRLHEDLALGIRTPVLPMLRSAAELSWLPRRAAPPVGP
FT                   ADTFPGRGPGRP"
FT   misc_feature    617054..618193
FT                   /gene="crtY"
FT                   /locus_tag="SCAB_5491"
FT                   /note="HMMPfam hit to PF05834, Lycopene cyclase protein,
FT                   score 1.2e-137"
FT                   /inference="protein motif:PFAM:PF05834"
FT   misc_feature    617189..617236
FT                   /note="PS00024 Hemopexin domain signature."
FT                   /inference="protein motif:Prosite:PS00024"
FT   CDS_pept        618392..619120
FT                   /transl_table=11
FT                   /gene="crtT"
FT                   /locus_tag="SCAB_5501"
FT                   /product="putative methyltransferase"
FT                   /note="PMID:8917308"
FT                   /note="PMID:15716454"
FT                   /note="carotenoid pigment gene cluster"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5501"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67747"
FT                   /db_xref="GOA:C9YUH5"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUH5"
FT                   /protein_id="CBG67747.1"
FT                   /translation="MTLLRDEDLAAAFDHASRSYDTLVAANPGYHAHLRRSARRLGLPR
FT                   PGAGLRVLDLGCGTGASTAALSAVLPGAEITAVDASAGMLERAARKPWREGVRFVHAPA
FT                   ERLVDAGVEGPFDAVFAAYLFRNVADPDAVLSTVREVLAPRGRLAVHEYTLSGRAVHRA
FT                   VWTGVCRGMVLPVAALLGDGHLYRHLWRSVVDFDTADAFAARVGAQGFDTVRVLPLPGW
FT                   QTGITHTIVARRPAGAGDGR"
FT   misc_feature    618392..619087
FT                   /gene="crtT"
FT                   /locus_tag="SCAB_5501"
FT                   /note="HMMPfam hit to PF01209, ubiE/COQ5 methyltransferase
FT                   family, score 6.6e-09"
FT                   /inference="protein motif:PFAM:PF01209"
FT   misc_feature    618548..618835
FT                   /gene="crtT"
FT                   /locus_tag="SCAB_5501"
FT                   /note="HMMPfam hit to PF08242, Methyltransferase domain,
FT                   score 1.7e-20"
FT                   /inference="protein motif:PFAM:PF08242"
FT   misc_feature    618548..618841
FT                   /gene="crtT"
FT                   /locus_tag="SCAB_5501"
FT                   /note="HMMPfam hit to PF08241, Methyltransferase domain,
FT                   score 2.8e-23"
FT                   /inference="protein motif:PFAM:PF08241"
FT   CDS_pept        619117..620739
FT                   /transl_table=11
FT                   /gene="crtU"
FT                   /locus_tag="SCAB_5511"
FT                   /product="putative dehydrogenase"
FT                   /note="PMID:8917308"
FT                   /note="PMID:15716454"
FT                   /note="carotenoid pigment gene cluster"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5511"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67748"
FT                   /db_xref="GOA:C9YUH6"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUH6"
FT                   /protein_id="CBG67748.1"
FT                   /translation="MRAAGRTGPTRHGRDRRARRLDAAPGAPRFTGDRSPAVAVVGGGI
FT                   AGLAAATALAERGTRVTLYEREATLGGRLAGWPTVLSDGTTVTMSRGFHAFFRQYYNLR
FT                   GLLRRTDPGLDRLRGLPDYPLRHADGLHDSFRHVPRTPPWSALGFVALSPSFGLRDLLR
FT                   MDPVAALPLLDVRVPGIHDRLDDVSARDFLDAIRFPEAAQHLAFEVFSRSFFADPRELS
FT                   AAEMVLMFHIYFLGSAEGLLFDVPDEPFPAALWDPLAGYLRGHGADLRTGTPVETVEPT
FT                   ADGGFVVTAGGEERGHDAVVLALDTGGLRSLAGRSPRLADAAWRERVAGLRSAPPFLVS
FT                   RLWLDRPVAGDRPGFLGTGGYGTLDNVSVLDRWEGESARWAARTGGSVVELHAYALSDQ
FT                   VSRDVEQKRLLEQLHRVYPETREATVLDERHEWRADCPLFPVGGYHDRPNVRTGDPGLV
FT                   VAGDLVRTGLPVALMERAATSGFLAANALLERWGVRGQTLWTVPDGGRGPLLRRLARLD
FT                   RGTPQAPGPGRLEGQVGVPPRHG"
FT   misc_feature    619117..619281
FT                   /gene="crtU"
FT                   /locus_tag="SCAB_5511"
FT                   /note="Signal peptide predicted for SCAB5511 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.617) with cleavage site
FT                   probability 0.600 between residues 55 and 56"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    619225..620586
FT                   /gene="crtU"
FT                   /locus_tag="SCAB_5511"
FT                   /note="HMMPfam hit to PF01266, FAD dependent
FT                   oxidoreductase, score 1.9e-06"
FT                   /inference="protein motif:PFAM:PF01266"
FT   misc_feature    619249..620580
FT                   /gene="crtU"
FT                   /locus_tag="SCAB_5511"
FT                   /note="HMMPfam hit to PF01593, Flavin containing amine
FT                   oxidoreductase, score 7.1e-35"
FT                   /inference="protein motif:PFAM:PF01593"
FT   CDS_pept        620839..621333
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5521"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5521"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67749"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUH7"
FT                   /protein_id="CBG67749.1"
FT                   /translation="MTRPHDKADGPDGAHRRPEGLSDATVEALGSLSKALETTERARGH
FT                   LFSFHQLTGTADLELDRATSLLREAGHHEWARRIETEVLGRNVIPGHWTFQIVEAYDRT
FT                   YYQAFKDLEREAVDRLAAGRDHLYEAEMKESRRTHDHPDHTYTPDSPDARRPTAPFDRR
FT                   G"
FT   CDS_pept        621598..622284
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5531"
FT                   /product="putative secreted protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5531"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67750"
FT                   /db_xref="InterPro:IPR025326"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUH8"
FT                   /protein_id="CBG67750.1"
FT                   /translation="MTYAVRSRRATAALAVLSLGILALTACKGDAEQDASAPGTTASPS
FT                   PTKGGKGGGKDTDKPSTAGQGDGDGGGEDSSGGAEGTPAASEPGTDDGQDGGVGMCETT
FT                   DLNYKVTVASKLVNHALLAATNKSGDPCLLPANDLVITIPGLDGAAEHMGPEGKDWIMK
FT                   PGETAYAGILFSRADTAGGKSAATVEVALTASESPATVTIVDGPVTVNDGQVTSFYGTA
FT                   EDALTY"
FT   misc_feature    621598..621696
FT                   /locus_tag="SCAB_5531"
FT                   /note="Signal peptide predicted for SCAB5531 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.485 between residues 33 and 34"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    621646..621678
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    622126..622149
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        622374..623090
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5541"
FT                   /product="putative GntR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5541"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67751"
FT                   /db_xref="GOA:C9YUH9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUH9"
FT                   /protein_id="CBG67751.1"
FT                   /translation="MMTAPLYVRIRREIEARIRAGELPPGARLPTEKDLTAQYGVSRAT
FT                   AQRVLNDLADAGLAIRRRRHGTFVAEVTRQINLLNFVTPATAARGTPGRHDVVSARVVR
FT                   AADAVLRLPGAAADTAVVELVRRKLDVREEPQSVERHVVLFAAAPDLLSEDLETLVTLP
FT                   YLRREGVPVDSVRLCLDPVVLDEHDATLLRSEIGTPALMRRRELRTADGGTVEVVTTVV
FT                   RPGTAEFFLELPVPPE"
FT   misc_feature    622389..622580
FT                   /locus_tag="SCAB_5541"
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family, score 3.5e-22"
FT                   /inference="protein motif:PFAM:PF00392"
FT   misc_feature    622458..622532
FT                   /note="PS00043 Bacterial regulatory proteins, gntR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00043"
FT   misc_feature    622635..623057
FT                   /locus_tag="SCAB_5541"
FT                   /note="HMMPfam hit to PF07702, UTRA domain, score 6.1e-06"
FT                   /inference="protein motif:PFAM:PF07702"
FT   CDS_pept        623144..624310
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5551"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5551"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67752"
FT                   /db_xref="GOA:C9YUI0"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUI0"
FT                   /protein_id="CBG67752.1"
FT                   /translation="MKVIVIGAGVLGASAARHLAVAGADVLLLDRLGAGTGTSATTFAW
FT                   TNSSRKPHPAYHRLNLAGMEEHARLAAELPGAPSYFPSGALQWADAANERRLSDHVTRL
FT                   RSLGYPAHWVTADEAGRIAGGLRVPATITSLAHFPSEGYVLPDRFVEGLVADAERHGAA
FT                   YAAGEVEAVDDGPDGVAVTLTGGRVHRGDRVVLAAGRWTRELAARAGIDVPMVTDTGRG
FT                   AQTVGLLGYVRQPRLDLRCVIHSPGLNLRPAGGGHTVLQALDLNAAVDPRDPPSADGDL
FT                   ASTLVRRFRSVLPDPAGTPRIELRVGLRSLPADGHTVAGYADARARVYCLVSHSGVTLA
FT                   PVLGRLAAAEITTDREQELLAAFRPTRFTGAARPDTAVDQRAVGLGDQ"
FT   misc_feature    623144..623212
FT                   /locus_tag="SCAB_5551"
FT                   /note="Signal peptide predicted for SCAB5551 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.822) with cleavage site
FT                   probability 0.461 between residues 23 and 24"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    623147..624193
FT                   /locus_tag="SCAB_5551"
FT                   /note="HMMPfam hit to PF01266, FAD dependent
FT                   oxidoreductase, score 1.9e-45"
FT                   /inference="protein motif:PFAM:PF01266"
FT   CDS_pept        624458..625405
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5561"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5561"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67753"
FT                   /db_xref="GOA:C9YUI1"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUI1"
FT                   /protein_id="CBG67753.1"
FT                   /translation="MSPHDRTPNTPDTTDLPDMPEPRVREFPAHSIGGGLALLLGLVGL
FT                   AAGVGLVVLGAVSTSSGVKAALIVGGILVGLAAFLAMCGLNMVAPGEARVVQLFGRYRG
FT                   TIRTDGLRWVNPFTSRVKISTRVRNHETAVLKVNDAYGNPIELAAVVVWKVEDTAQASF
FT                   EVDDFLEFVSTQTEAAVRHIAIEYPYDAHDEEGLSLRGNAEEITEKLAVELHARVEAAG
FT                   VHIIESRFTHLAYAPEIASAMLQRQQAGAVVAARRQIVDGAVGMVEAALARIAEQGIVE
FT                   LDSERKAAMVSNLMVVLCGDRAAQPVLNTGSLYQ"
FT   misc_feature    join(624551..624619,624656..624724)
FT                   /locus_tag="SCAB_5561"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SCAB5561 by TMHMM2.0 at aa 32-54 and 67-89"
FT   misc_feature    624707..625264
FT                   /locus_tag="SCAB_5561"
FT                   /note="HMMPfam hit to PF01145, SPFH domain / Band, score
FT                   3e-06"
FT                   /inference="protein motif:PFAM:PF01145"
FT   CDS_pept        625402..625695
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5571"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5571"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67754"
FT                   /db_xref="GOA:C9YUI2"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUI2"
FT                   /protein_id="CBG67754.1"
FT                   /translation="MTPPPPDGGPGADPAPKRSATQRKQVLLRLDPLVHDALARWAGDE
FT                   LRSTNAQIEFLLRRALSDAGRLPGAAGPLPRRGRPPKPSDTGGERERPGDDA"
FT   CDS_pept        complement(625738..626166)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5581"
FT                   /product="conserved hypothetical protein"
FT                   /note="PMID:11731481"
FT                   /note="TTA-Leu codon(s) 63 may indicate regulation by BldA"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5581"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67755"
FT                   /db_xref="InterPro:IPR011944"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUI3"
FT                   /protein_id="CBG67755.1"
FT                   /translation="MILMNTETANAVNAANAADIKAIEEVVATVERTQRARDAEGFLAL
FT                   FHPDALWTTAHGKVLIGLPAIAEFTRAVLPGAVWDGEVTYEVAHTQFLRPDVAAVKVRQ
FT                   VHHPAEGDTEGAPLYVMTRQADGTWLLHACQNTSVRRD"
FT   CDS_pept        626411..627070
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5591"
FT                   /product="putative two-component system response regulator"
FT                   /note="PMID:16723573"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5591"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67756"
FT                   /db_xref="GOA:C9YUI4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C9YUI4"
FT                   /protein_id="CBG67756.1"
FT                   /translation="MVVDDEALVRSGFGLILGASDDIEVVATASGSGAVETVRRERPDV
FT                   VLLDIRMPDVDGLTVLRELRTMPDAPVVAMLTTFDADEYILTALHSGAAGFLLKDTEPD
FT                   QLAHLVRTLAAGGVVLSPKASRTLLHSHSGSASAVDEDATRVRLLTSRERDVLVLVAEG
FT                   LSNADIGARIHLGAGTVKDHVSAILTKLRVTSRVQAALLAQRAGLLDEGRRPEAGR"
FT   misc_feature    626411..626743
FT                   /locus_tag="SCAB_5591"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 2.4e-31"
FT                   /inference="protein motif:PFAM:PF00072"
FT   misc_feature    626825..626983
FT                   /locus_tag="SCAB_5591"
FT                   /note="HMMPfam hit to PF08281, Sigma-70, region, score
FT                   0.0038"
FT                   /inference="protein motif:PFAM:PF08281"
FT   misc_feature    626843..626989
FT                   /locus_tag="SCAB_5591"
FT                   /note="HMMPfam hit to PF04545, Sigma-70, region, score
FT                   0.0038"
FT                   /inference="protein motif:PFAM:PF04545"
FT   misc_feature    626846..627019
FT                   /locus_tag="SCAB_5591"
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR fami, score 4e-17"
FT                   /inference="protein motif:PFAM:PF00196"
FT   misc_feature    626897..626980
FT                   /note="PS00622 Bacterial regulatory proteins, luxR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00622"
FT   CDS_pept        627067..628185
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5601"
FT                   /product="putative two-component system sensor kinase"
FT                   /note="PMID:16723573"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5601"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67757"
FT                   /db_xref="GOA:C9YVK9"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C9YVK9"
FT                   /protein_id="CBG67757.1"
FT                   /translation="MSRARALWERVPAPAVDVALAVVAAVDVWLNLWDKSRTGIALAAL
FT                   GCAALVLRRRFPLAVLLLTLPIALTQEVALAPLLALYSVAERSRDRRLLAGCVALVAAT
FT                   SSTPWPPAGLAEVGRTMTLIILVYNLALAVVPALVGQLVQAHRDLARRLAEVEEAREQE
FT                   RALHAQAALAHERTRLAREMHDVVSHQVSLIAVQAGALQVSTGDTDTREAARTIRSLSV
FT                   TTLDELRTMVTLLRASGGHATELTPQPTLADLHALVGSSGIEARLTGELPPGVGTPAQR
FT                   ALYRTVQEALTNVRKHAPGATAVVELWHDGDHVGVTVTNSPPTRPSLVLPGSRLGLVGL
FT                   RERADILRGTLESGPAREGGYRLRLRVPLGTD"
FT   misc_feature    join(627238..627306,627427..627495)
FT                   /locus_tag="SCAB_5601"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SCAB5601 by TMHMM2.0 at aa 58-80 and 121-143"
FT   misc_feature    627589..627786
FT                   /locus_tag="SCAB_5601"
FT                   /note="HMMPfam hit to PF07730, Histidine kinase, score
FT                   5.1e-18"
FT                   /inference="protein motif:PFAM:PF07730"
FT   misc_feature    627730..627768
FT                   /note="PS00068 Malate dehydrogenase active site signature."
FT                   /inference="protein motif:Prosite:PS00068"
FT   misc_feature    627898..628176
FT                   /locus_tag="SCAB_5601"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 9.8e-09"
FT                   /inference="protein motif:PFAM:PF02518"
FT   misc_feature    complement(628058..628071)
FT                   /note="gagccgggagccgg"
FT   CDS_pept        628287..628472
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5611"
FT                   /product="hypothetical protein"
FT                   /note="no significant db matches"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5611"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67758"
FT                   /db_xref="UniProtKB/TrEMBL:C9YVL0"
FT                   /protein_id="CBG67758.1"
FT                   /translation="MSNDIRIDRAPSAGGGIQITVSLSPAVLAKLQQDGSWTESIKEGQ
FT                   VTGDGPAITQIEFKVA"
FT   CDS_pept        complement(628488..628967)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5621"
FT                   /product="putative ATPase"
FT                   /note="PMID:15112998"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5621"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67759"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C9YVL1"
FT                   /protein_id="CBG67759.1"
FT                   /translation="MGSYADGDGSTEPDGPLLRAGFALDGDDACIADARHHAVVFLDRA
FT                   RSDRHLPVSARARDITQLVVSELVTNARKYAPGPVLMELRITADSVEIVVWDSDPTVPS
FT                   ARAADPDRVGQHGLEIVKAVTEDLFVEQASVGKRITARVALSDPPGAGSAARGPA"
FT   misc_feature    complement(628530..628796)
FT                   /locus_tag="SCAB_5621"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 3.3e-06"
FT                   /inference="protein motif:PFAM:PF02518"
FT   CDS_pept        629141..629509
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5631"
FT                   /product="putative anti-sigma-factor antagonist"
FT                   /note="PMID:15793135"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5631"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67760"
FT                   /db_xref="GOA:C9YVL2"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C9YVL2"
FT                   /protein_id="CBG67760.1"
FT                   /translation="MTAIENADRPGRLSFAHHVVDDIRVVTMRGEIDHDVKDLFEEALL
FT                   TGGVAAPPPRIVVDLGGVTFMDSSGINVLVAAHRRVSGERGWLRIAAAQESVLRVLQLV
FT                   GVDTFIPCHPTVEQALSG"
FT   misc_feature    629180..629497
FT                   /locus_tag="SCAB_5631"
FT                   /note="HMMPfam hit to PF01740, STAS domain, score 4e-18"
FT                   /inference="protein motif:PFAM:PF01740"
FT   CDS_pept        complement(629566..630426)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5641"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5641"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67761"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:C9YVL3"
FT                   /protein_id="CBG67761.1"
FT                   /translation="MMTTVRAQLGQALFRRVAGPDGPATRARIHDTPGPRWFGPDRPIR
FT                   TVHGDASMFIGGLSALLLQSLHPLAMAAVAGHSGYRGDPWGRLQRTSTFLAVTTYGTAA
FT                   DARQAVDQVRGIHERIRGTTAEGVPYHAADPHLLGWVHAAETDSFLRAHERFGARPLDA
FT                   DAYDAYVADTARVAAALGVSDPPRDRRELAERLAAYRHELRATSEALAAARFLLFRPPL
FT                   PLAVRPFYGGLAANAVALLPPWAGRMLRLPRVPVVENLAVRPTGQVLTRTIRWAMTPPG
FT                   RSRPT"
FT   CDS_pept        complement(630537..631685)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5651"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5651"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67762"
FT                   /db_xref="GOA:C9YVL4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9YVL4"
FT                   /protein_id="CBG67762.1"
FT                   /translation="MRIVVTGGFGFLGREVARALLGTRTFRGAPIDSLVLVDRTVPTGQ
FT                   PPVTAPSPSAPPVSDPLVSDALVSDPYVSDPYVSDPLVEIVHGDLSGHLDAVFARPVDA
FT                   VFHLAAAVSAECEADFDLGMDANVDTTRALLDAARAQSAAGGPTPCLLFSSSVAVYGPD
FT                   PALPLPPVVSEATLPTPRSSYGVQKLVCEQLIADYTRRGFVDGRVARLMTVVVRPGRPN
FT                   AAASGFLSGIIREPLAGRAAVCPVRPDLTVALASPGRTVEALLRIARAERGAGRGRLAG
FT                   ALPVNLPALTVSVAEMLATLRKEAGDAVADLVTIRPDPAVEAIVGSWPSAFDPTRAAAL
FT                   GLAPDPDFASVLRAYVADHPDAVLPAPARAKGQPDPGPPAGR"
FT   misc_feature    complement(630831..631676)
FT                   /locus_tag="SCAB_5651"
FT                   /note="HMMPfam hit to PF01073, 3-beta hydroxysteroid
FT                   dehydrogenase/iso, score 7.1e-05"
FT                   /inference="protein motif:PFAM:PF01073"
FT   misc_feature    complement(630843..631679)
FT                   /locus_tag="SCAB_5651"
FT                   /note="HMMPfam hit to PF01370, NAD dependent
FT                   epimerase/dehydratase fam, score 3.3e-08"
FT                   /inference="protein motif:PFAM:PF01370"
FT   misc_feature    complement(630921..631673)
FT                   /locus_tag="SCAB_5651"
FT                   /note="HMMPfam hit to PF07993, Male sterility protein,
FT                   score 2.6e-05"
FT                   /inference="protein motif:PFAM:PF07993"
FT   CDS_pept        631892..632839
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5661"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5661"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67763"
FT                   /db_xref="GOA:C9YVL5"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:C9YVL5"
FT                   /protein_id="CBG67763.1"
FT                   /translation="MTPLPSGPPDNGPAVTRAEFDALFDRLRSWGRWTPADRGAANRIT
FT                   PDHVRRASALVRSGTVVPMALPWNTVPGPDNGKPALHHMTELGDVEPPEPTCHKDFIAA
FT                   DYHGKGVSHLDALSHIAYRGLLYEGRDARGSVDARGARFGAVDALGPLVTRGVLLDMPA
FT                   VLSRDWLEPGTAVHADDVLSAERALGVTVGEGDAVLLRSGRFRRRRELGPWNPDEAGAG
FT                   LHVDAMPLLAERGVALLGGDGDSDVRPSPVEGVSSPVHALAIAAMGVPLLDNLDLEALS
FT                   AACAGAGRYAFLMVVAPLNVPGGTGSPVNPVAVL"
FT   CDS_pept        complement(632897..634006)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5671"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5671"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67764"
FT                   /db_xref="UniProtKB/TrEMBL:C9YVL6"
FT                   /protein_id="CBG67764.1"
FT                   /translation="MTRRLLVAALAAALTLLAPMTSAAADTQSWHHVPVPAQVRPQAGL
FT                   NEAVAFGPDRAWAVGTDAVGREAPGFPLVLRWDGTAWQRRALPGIGWQGELLSVAGTSP
FT                   AEVWAVGRDAAGATRLLRSDGSAWSESRPPRGVVLTKVVAGGGETWLIGSRDGAQALLR
FT                   RDGGAWQDVPVPPGAVYGLHILAADDVWAAGATGAGAAVSHWDGQAWRQTIVDGFPRSA
FT                   VGSVLAVSPTEVWAGGTAGFVGGPVGRPIPPLLVRFDGRTWNHVTVPTDFGSVTALTPA
FT                   SSGALRWVAVARSQKWGPPGSQPPFVPGPDFLARDGQSFTEYDEPAVAGEGDSSRLQPA
FT                   PVPGTGTVWSVGRADGPEGTFAPRILRFG"
FT   misc_feature    complement(633932..634006)
FT                   /locus_tag="SCAB_5671"
FT                   /note="Signal peptide predicted for SCAB5671 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.860 between residues 25 and 26"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS_pept        complement(634003..635061)
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5681"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5681"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67765"
FT                   /db_xref="UniProtKB/TrEMBL:C9YVL7"
FT                   /protein_id="CBG67765.1"
FT                   /translation="MNGLRAVVVCLLAVCAAVVSPAAAVTPRSWTALAVPAAAPPVTVT
FT                   DLAARGPGQAWATGHETAADGLRPVLYRWDGTAWNRDTTFPGAGEPGGLTKVRFVGREV
FT                   WILRTRAGEGEILRRTAAGWSVLPVPRTLWTYQDFTAVPGAAWVVGEDDTGLKILRYDG
FT                   SGWTAQTAPDGVRYLMGITARTATDAWAWADTDTGTAVLRWDGTAWRDADVPLPPDSNV
FT                   HTVLLEPSGRVTIGGSQYTDGVARTYLMTGDRHVWRTTRPPLGDTATEAMVRGPDGALW
FT                   LPVRSDRAFQSKYARVDGARTTFSYGPERRNAIDVKPRALARAGSSLLSFGTAEIYGSK
FT                   PNLMSERLGGRP"
FT   misc_feature    complement(634348..634377)
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00178"
FT   misc_feature    complement(634945..635061)
FT                   /locus_tag="SCAB_5681"
FT                   /note="Signal peptide predicted for SCAB5681 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.326 between residues 39 and 40"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    complement(634984..635043)
FT                   /locus_tag="SCAB_5681"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SCAB5681 by TMHMM2.0 at aa 7-26"
FT   CDS_pept        635306..637381
FT                   /transl_table=11
FT                   /locus_tag="SCAB_5691"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SCAB_5691"
FT                   /db_xref="EnsemblGenomes-Tr:CBG67766"
FT                   /db_xref="GOA:C9YVL8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C9YVL8"
FT                   /protein_id="CBG67766.1"
FT                   /translation="M