(data stored in ACNUC10821 zone)

EMBL: FN557490

ID   FN557490; SV 1; circular; genomic DNA; STD; PRO; 2797636 BP.
XX
AC   FN557490;
XX
PR   Project:PRJEA41123;
XX
DT   18-FEB-2010 (Rel. 103, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   Listeria seeligeri serovar 1/2b str. SLCC3954 complete genome
XX
KW   complete genome.
XX
OS   Listeria seeligeri serovar 1/2b str. SLCC3954
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
XX
RN   [1]
RP   1-2797636
RA   Hain T.;
RT   ;
RL   Submitted (22-OCT-2009) to the INSDC.
RL   Hain T., Justus-Liebig-University, Institute for Medical Microbiology,
RL   Frankfurter Strasse 107, 35392 Giessen, GERMANY.
XX
RN   [2]
RX   DOI; 10.1128/JB.01415-09.
RX   PUBMED; 20061480.
RA   Steinweg C., Kuenne C.T., Billion A., Mraheil M.A., Domann E., Ghai R.,
RA   Barbuddhe S.B., Karst U., Goesmann A., Puhler A., Weisshaar B., Wehland J.,
RA   Lampidis R., Kreft J., Goebel W., Chakraborty T., Hain T.;
RT   "Complete genome sequence of Listeria seeligeri, a nonpathogenic member of
RT   the genus Listeria";
RL   J. Bacteriol. 192(5):1473-1474(2010).
XX
DR   MD5; c22dd3a3e95b74763f8bdfa32ef13829.
DR   BioSample; SAMEA2272547.
DR   EnsemblGenomes-Gn; EBG00001140118.
DR   EnsemblGenomes-Gn; EBG00001140119.
DR   EnsemblGenomes-Gn; EBG00001140120.
DR   EnsemblGenomes-Gn; EBG00001140121.
DR   EnsemblGenomes-Gn; EBG00001140122.
DR   EnsemblGenomes-Gn; EBG00001140123.
DR   EnsemblGenomes-Gn; EBG00001140124.
DR   EnsemblGenomes-Gn; EBG00001140125.
DR   EnsemblGenomes-Gn; EBG00001140126.
DR   EnsemblGenomes-Gn; EBG00001140127.
DR   EnsemblGenomes-Gn; EBG00001140128.
DR   EnsemblGenomes-Gn; EBG00001140129.
DR   EnsemblGenomes-Gn; EBG00001140130.
DR   EnsemblGenomes-Gn; EBG00001140131.
DR   EnsemblGenomes-Gn; EBG00001140132.
DR   EnsemblGenomes-Gn; EBG00001140133.
DR   EnsemblGenomes-Gn; EBG00001140134.
DR   EnsemblGenomes-Gn; EBG00001140135.
DR   EnsemblGenomes-Gn; EBG00001140136.
DR   EnsemblGenomes-Gn; EBG00001140137.
DR   EnsemblGenomes-Gn; EBG00001140138.
DR   EnsemblGenomes-Gn; EBG00001140139.
DR   EnsemblGenomes-Gn; EBG00001140140.
DR   EnsemblGenomes-Gn; EBG00001140141.
DR   EnsemblGenomes-Gn; EBG00001140142.
DR   EnsemblGenomes-Gn; EBG00001140143.
DR   EnsemblGenomes-Gn; EBG00001140144.
DR   EnsemblGenomes-Gn; EBG00001140145.
DR   EnsemblGenomes-Gn; EBG00001140146.
DR   EnsemblGenomes-Gn; EBG00001140147.
DR   EnsemblGenomes-Gn; EBG00001140148.
DR   EnsemblGenomes-Gn; EBG00001140149.
DR   EnsemblGenomes-Gn; EBG00001140150.
DR   EnsemblGenomes-Gn; EBG00001140151.
DR   EnsemblGenomes-Gn; EBG00001140152.
DR   EnsemblGenomes-Gn; EBG00001140153.
DR   EnsemblGenomes-Gn; EBG00001140154.
DR   EnsemblGenomes-Gn; EBG00001140155.
DR   EnsemblGenomes-Gn; EBG00001140156.
DR   EnsemblGenomes-Gn; EBG00001140157.
DR   EnsemblGenomes-Gn; EBG00001140158.
DR   EnsemblGenomes-Gn; EBG00001140159.
DR   EnsemblGenomes-Gn; EBG00001140160.
DR   EnsemblGenomes-Gn; EBG00001140161.
DR   EnsemblGenomes-Gn; EBG00001140162.
DR   EnsemblGenomes-Gn; EBG00001140163.
DR   EnsemblGenomes-Gn; EBG00001140164.
DR   EnsemblGenomes-Gn; EBG00001140165.
DR   EnsemblGenomes-Gn; EBG00001140166.
DR   EnsemblGenomes-Gn; EBG00001140167.
DR   EnsemblGenomes-Gn; EBG00001140168.
DR   EnsemblGenomes-Gn; EBG00001140169.
DR   EnsemblGenomes-Gn; EBG00001140170.
DR   EnsemblGenomes-Gn; EBG00001140171.
DR   EnsemblGenomes-Gn; EBG00001140172.
DR   EnsemblGenomes-Gn; EBG00001140173.
DR   EnsemblGenomes-Gn; EBG00001140174.
DR   EnsemblGenomes-Gn; EBG00001140175.
DR   EnsemblGenomes-Gn; EBG00001140176.
DR   EnsemblGenomes-Gn; EBG00001140177.
DR   EnsemblGenomes-Gn; EBG00001140178.
DR   EnsemblGenomes-Gn; EBG00001140179.
DR   EnsemblGenomes-Gn; EBG00001140180.
DR   EnsemblGenomes-Gn; EBG00001140181.
DR   EnsemblGenomes-Gn; EBG00001140182.
DR   EnsemblGenomes-Gn; EBG00001140183.
DR   EnsemblGenomes-Gn; EBG00001140184.
DR   EnsemblGenomes-Gn; EBG00001140185.
DR   EnsemblGenomes-Gn; EBG00001140186.
DR   EnsemblGenomes-Gn; EBG00001140187.
DR   EnsemblGenomes-Gn; EBG00001140188.
DR   EnsemblGenomes-Gn; EBG00001140189.
DR   EnsemblGenomes-Gn; EBG00001140190.
DR   EnsemblGenomes-Gn; EBG00001140191.
DR   EnsemblGenomes-Gn; EBG00001140192.
DR   EnsemblGenomes-Gn; EBG00001140193.
DR   EnsemblGenomes-Gn; EBG00001140194.
DR   EnsemblGenomes-Gn; EBG00001140195.
DR   EnsemblGenomes-Gn; EBG00001140196.
DR   EnsemblGenomes-Gn; EBG00001140197.
DR   EnsemblGenomes-Gn; EBG00001140198.
DR   EnsemblGenomes-Gn; EBG00001140199.
DR   EnsemblGenomes-Gn; EBG00001140200.
DR   EnsemblGenomes-Gn; EBG00001140201.
DR   EnsemblGenomes-Gn; EBG00001140202.
DR   EnsemblGenomes-Gn; EBG00001140203.
DR   EnsemblGenomes-Gn; EBG00001140204.
DR   EnsemblGenomes-Gn; EBG00001140205.
DR   EnsemblGenomes-Gn; EBG00001140206.
DR   EnsemblGenomes-Gn; EBG00001140207.
DR   EnsemblGenomes-Gn; EBG00001140208.
DR   EnsemblGenomes-Gn; EBG00001140209.
DR   EnsemblGenomes-Gn; EBG00001140210.
DR   EnsemblGenomes-Gn; EBG00001140211.
DR   EnsemblGenomes-Gn; EBG00001140212.
DR   EnsemblGenomes-Gn; EBG00001140213.
DR   EnsemblGenomes-Gn; EBG00001140214.
DR   EnsemblGenomes-Gn; EBG00001140215.
DR   EnsemblGenomes-Gn; EBG00001140216.
DR   EnsemblGenomes-Gn; EBG00001140217.
DR   EnsemblGenomes-Gn; EBG00001140218.
DR   EnsemblGenomes-Gn; EBG00001140219.
DR   EnsemblGenomes-Gn; EBG00001140220.
DR   EnsemblGenomes-Gn; EBG00001140221.
DR   EnsemblGenomes-Gn; EBG00001140222.
DR   EnsemblGenomes-Gn; EBG00001140223.
DR   EnsemblGenomes-Gn; EBG00001140224.
DR   EnsemblGenomes-Gn; EBG00001140225.
DR   EnsemblGenomes-Gn; EBG00001140226.
DR   EnsemblGenomes-Gn; EBG00001140227.
DR   EnsemblGenomes-Gn; EBG00001140228.
DR   EnsemblGenomes-Gn; EBG00001140229.
DR   EnsemblGenomes-Gn; EBG00001140230.
DR   EnsemblGenomes-Gn; EBG00001140231.
DR   EnsemblGenomes-Gn; EBG00001140232.
DR   EnsemblGenomes-Gn; EBG00001140233.
DR   EnsemblGenomes-Gn; EBG00001140234.
DR   EnsemblGenomes-Gn; EBG00001140235.
DR   EnsemblGenomes-Gn; EBG00001140236.
DR   EnsemblGenomes-Gn; EBG00001140237.
DR   EnsemblGenomes-Gn; EBG00001140238.
DR   EnsemblGenomes-Gn; EBG00001140239.
DR   EnsemblGenomes-Gn; EBG00001140240.
DR   EnsemblGenomes-Gn; EBG00001140241.
DR   EnsemblGenomes-Gn; EBG00001140242.
DR   EnsemblGenomes-Gn; EBG00001140243.
DR   EnsemblGenomes-Gn; EBG00001140244.
DR   EnsemblGenomes-Gn; EBG00001140245.
DR   EnsemblGenomes-Gn; EBG00001140246.
DR   EnsemblGenomes-Gn; EBG00001140247.
DR   EnsemblGenomes-Gn; EBG00001140248.
DR   EnsemblGenomes-Gn; EBG00001140249.
DR   EnsemblGenomes-Gn; EBG00001140250.
DR   EnsemblGenomes-Gn; EBG00001140251.
DR   EnsemblGenomes-Gn; EBG00001140252.
DR   EnsemblGenomes-Gn; lse_0027.
DR   EnsemblGenomes-Gn; lse_0028.
DR   EnsemblGenomes-Gn; lse_0187.
DR   EnsemblGenomes-Gn; lse_0188.
DR   EnsemblGenomes-Gn; lse_0256.
DR   EnsemblGenomes-Gn; lse_0257.
DR   EnsemblGenomes-Gn; lse_1169.
DR   EnsemblGenomes-Gn; lse_1170.
DR   EnsemblGenomes-Gn; lse_1766.
DR   EnsemblGenomes-Gn; lse_1767.
DR   EnsemblGenomes-Gn; lse_1924.
DR   EnsemblGenomes-Gn; lse_1925.
DR   EnsemblGenomes-Gn; lse_r001.
DR   EnsemblGenomes-Gn; lse_r002.
DR   EnsemblGenomes-Gn; lse_r003.
DR   EnsemblGenomes-Gn; lse_r004.
DR   EnsemblGenomes-Gn; lse_r005.
DR   EnsemblGenomes-Gn; lse_r006.
DR   EnsemblGenomes-Gn; lse_r007.
DR   EnsemblGenomes-Gn; lse_r008.
DR   EnsemblGenomes-Gn; lse_r009.
DR   EnsemblGenomes-Gn; lse_r010.
DR   EnsemblGenomes-Gn; lse_r011.
DR   EnsemblGenomes-Gn; lse_r012.
DR   EnsemblGenomes-Gn; lse_r013.
DR   EnsemblGenomes-Gn; lse_r014.
DR   EnsemblGenomes-Gn; lse_r015.
DR   EnsemblGenomes-Gn; lse_r016.
DR   EnsemblGenomes-Gn; lse_r017.
DR   EnsemblGenomes-Gn; lse_r018.
DR   EnsemblGenomes-Gn; lse_t001.
DR   EnsemblGenomes-Gn; lse_t002.
DR   EnsemblGenomes-Gn; lse_t003.
DR   EnsemblGenomes-Gn; lse_t004.
DR   EnsemblGenomes-Gn; lse_t005.
DR   EnsemblGenomes-Gn; lse_t006.
DR   EnsemblGenomes-Gn; lse_t007.
DR   EnsemblGenomes-Gn; lse_t008.
DR   EnsemblGenomes-Gn; lse_t009.
DR   EnsemblGenomes-Gn; lse_t010.
DR   EnsemblGenomes-Gn; lse_t011.
DR   EnsemblGenomes-Gn; lse_t012.
DR   EnsemblGenomes-Gn; lse_t013.
DR   EnsemblGenomes-Gn; lse_t014.
DR   EnsemblGenomes-Gn; lse_t015.
DR   EnsemblGenomes-Gn; lse_t016.
DR   EnsemblGenomes-Gn; lse_t017.
DR   EnsemblGenomes-Gn; lse_t018.
DR   EnsemblGenomes-Gn; lse_t019.
DR   EnsemblGenomes-Gn; lse_t020.
DR   EnsemblGenomes-Gn; lse_t021.
DR   EnsemblGenomes-Gn; lse_t022.
DR   EnsemblGenomes-Gn; lse_t023.
DR   EnsemblGenomes-Gn; lse_t024.
DR   EnsemblGenomes-Gn; lse_t025.
DR   EnsemblGenomes-Gn; lse_t026.
DR   EnsemblGenomes-Gn; lse_t027.
DR   EnsemblGenomes-Gn; lse_t028.
DR   EnsemblGenomes-Gn; lse_t029.
DR   EnsemblGenomes-Gn; lse_t030.
DR   EnsemblGenomes-Gn; lse_t031.
DR   EnsemblGenomes-Gn; lse_t032.
DR   EnsemblGenomes-Gn; lse_t033.
DR   EnsemblGenomes-Gn; lse_t034.
DR   EnsemblGenomes-Gn; lse_t035.
DR   EnsemblGenomes-Gn; lse_t036.
DR   EnsemblGenomes-Gn; lse_t037.
DR   EnsemblGenomes-Gn; lse_t038.
DR   EnsemblGenomes-Gn; lse_t039.
DR   EnsemblGenomes-Gn; lse_t040.
DR   EnsemblGenomes-Gn; lse_t041.
DR   EnsemblGenomes-Gn; lse_t042.
DR   EnsemblGenomes-Gn; lse_t043.
DR   EnsemblGenomes-Gn; lse_t044.
DR   EnsemblGenomes-Gn; lse_t045.
DR   EnsemblGenomes-Gn; lse_t046.
DR   EnsemblGenomes-Gn; lse_t047.
DR   EnsemblGenomes-Gn; lse_t048.
DR   EnsemblGenomes-Gn; lse_t049.
DR   EnsemblGenomes-Gn; lse_t050.
DR   EnsemblGenomes-Gn; lse_t051.
DR   EnsemblGenomes-Gn; lse_t052.
DR   EnsemblGenomes-Gn; lse_t053.
DR   EnsemblGenomes-Gn; lse_t054.
DR   EnsemblGenomes-Gn; lse_t055.
DR   EnsemblGenomes-Gn; lse_t056.
DR   EnsemblGenomes-Gn; lse_t057.
DR   EnsemblGenomes-Gn; lse_t058.
DR   EnsemblGenomes-Gn; lse_t059.
DR   EnsemblGenomes-Gn; lse_t060.
DR   EnsemblGenomes-Gn; lse_t061.
DR   EnsemblGenomes-Gn; lse_t062.
DR   EnsemblGenomes-Gn; lse_t063.
DR   EnsemblGenomes-Gn; lse_t064.
DR   EnsemblGenomes-Gn; lse_t065.
DR   EnsemblGenomes-Gn; lse_t066.
DR   EnsemblGenomes-Gn; lse_t067.
DR   EnsemblGenomes-Tr; EBT00001556745.
DR   EnsemblGenomes-Tr; EBT00001556746.
DR   EnsemblGenomes-Tr; EBT00001556747.
DR   EnsemblGenomes-Tr; EBT00001556748.
DR   EnsemblGenomes-Tr; EBT00001556749.
DR   EnsemblGenomes-Tr; EBT00001556750.
DR   EnsemblGenomes-Tr; EBT00001556751.
DR   EnsemblGenomes-Tr; EBT00001556752.
DR   EnsemblGenomes-Tr; EBT00001556753.
DR   EnsemblGenomes-Tr; EBT00001556754.
DR   EnsemblGenomes-Tr; EBT00001556755.
DR   EnsemblGenomes-Tr; EBT00001556756.
DR   EnsemblGenomes-Tr; EBT00001556757.
DR   EnsemblGenomes-Tr; EBT00001556758.
DR   EnsemblGenomes-Tr; EBT00001556759.
DR   EnsemblGenomes-Tr; EBT00001556760.
DR   EnsemblGenomes-Tr; EBT00001556761.
DR   EnsemblGenomes-Tr; EBT00001556762.
DR   EnsemblGenomes-Tr; EBT00001556763.
DR   EnsemblGenomes-Tr; EBT00001556764.
DR   EnsemblGenomes-Tr; EBT00001556765.
DR   EnsemblGenomes-Tr; EBT00001556766.
DR   EnsemblGenomes-Tr; EBT00001556767.
DR   EnsemblGenomes-Tr; EBT00001556768.
DR   EnsemblGenomes-Tr; EBT00001556769.
DR   EnsemblGenomes-Tr; EBT00001556770.
DR   EnsemblGenomes-Tr; EBT00001556771.
DR   EnsemblGenomes-Tr; EBT00001556772.
DR   EnsemblGenomes-Tr; EBT00001556773.
DR   EnsemblGenomes-Tr; EBT00001556774.
DR   EnsemblGenomes-Tr; EBT00001556775.
DR   EnsemblGenomes-Tr; EBT00001556776.
DR   EnsemblGenomes-Tr; EBT00001556777.
DR   EnsemblGenomes-Tr; EBT00001556778.
DR   EnsemblGenomes-Tr; EBT00001556779.
DR   EnsemblGenomes-Tr; EBT00001556780.
DR   EnsemblGenomes-Tr; EBT00001556781.
DR   EnsemblGenomes-Tr; EBT00001556782.
DR   EnsemblGenomes-Tr; EBT00001556783.
DR   EnsemblGenomes-Tr; EBT00001556784.
DR   EnsemblGenomes-Tr; EBT00001556785.
DR   EnsemblGenomes-Tr; EBT00001556786.
DR   EnsemblGenomes-Tr; EBT00001556787.
DR   EnsemblGenomes-Tr; EBT00001556788.
DR   EnsemblGenomes-Tr; EBT00001556789.
DR   EnsemblGenomes-Tr; EBT00001556790.
DR   EnsemblGenomes-Tr; EBT00001556791.
DR   EnsemblGenomes-Tr; EBT00001556792.
DR   EnsemblGenomes-Tr; EBT00001556793.
DR   EnsemblGenomes-Tr; EBT00001556794.
DR   EnsemblGenomes-Tr; EBT00001556795.
DR   EnsemblGenomes-Tr; EBT00001556796.
DR   EnsemblGenomes-Tr; EBT00001556797.
DR   EnsemblGenomes-Tr; EBT00001556798.
DR   EnsemblGenomes-Tr; EBT00001556799.
DR   EnsemblGenomes-Tr; EBT00001556800.
DR   EnsemblGenomes-Tr; EBT00001556801.
DR   EnsemblGenomes-Tr; EBT00001556802.
DR   EnsemblGenomes-Tr; EBT00001556803.
DR   EnsemblGenomes-Tr; EBT00001556804.
DR   EnsemblGenomes-Tr; EBT00001556805.
DR   EnsemblGenomes-Tr; EBT00001556806.
DR   EnsemblGenomes-Tr; EBT00001556807.
DR   EnsemblGenomes-Tr; EBT00001556808.
DR   EnsemblGenomes-Tr; EBT00001556809.
DR   EnsemblGenomes-Tr; EBT00001556810.
DR   EnsemblGenomes-Tr; EBT00001556811.
DR   EnsemblGenomes-Tr; EBT00001556812.
DR   EnsemblGenomes-Tr; EBT00001556813.
DR   EnsemblGenomes-Tr; EBT00001556814.
DR   EnsemblGenomes-Tr; EBT00001556815.
DR   EnsemblGenomes-Tr; EBT00001556816.
DR   EnsemblGenomes-Tr; EBT00001556817.
DR   EnsemblGenomes-Tr; EBT00001556818.
DR   EnsemblGenomes-Tr; EBT00001556819.
DR   EnsemblGenomes-Tr; EBT00001556820.
DR   EnsemblGenomes-Tr; EBT00001556821.
DR   EnsemblGenomes-Tr; EBT00001556822.
DR   EnsemblGenomes-Tr; EBT00001556823.
DR   EnsemblGenomes-Tr; EBT00001556824.
DR   EnsemblGenomes-Tr; EBT00001556825.
DR   EnsemblGenomes-Tr; EBT00001556826.
DR   EnsemblGenomes-Tr; EBT00001556827.
DR   EnsemblGenomes-Tr; EBT00001556828.
DR   EnsemblGenomes-Tr; EBT00001556829.
DR   EnsemblGenomes-Tr; EBT00001556830.
DR   EnsemblGenomes-Tr; EBT00001556831.
DR   EnsemblGenomes-Tr; EBT00001556832.
DR   EnsemblGenomes-Tr; EBT00001556833.
DR   EnsemblGenomes-Tr; EBT00001556834.
DR   EnsemblGenomes-Tr; EBT00001556835.
DR   EnsemblGenomes-Tr; EBT00001556836.
DR   EnsemblGenomes-Tr; EBT00001556837.
DR   EnsemblGenomes-Tr; EBT00001556838.
DR   EnsemblGenomes-Tr; EBT00001556839.
DR   EnsemblGenomes-Tr; EBT00001556840.
DR   EnsemblGenomes-Tr; EBT00001556841.
DR   EnsemblGenomes-Tr; EBT00001556842.
DR   EnsemblGenomes-Tr; EBT00001556843.
DR   EnsemblGenomes-Tr; EBT00001556844.
DR   EnsemblGenomes-Tr; EBT00001556845.
DR   EnsemblGenomes-Tr; EBT00001556846.
DR   EnsemblGenomes-Tr; EBT00001556847.
DR   EnsemblGenomes-Tr; EBT00001556848.
DR   EnsemblGenomes-Tr; EBT00001556849.
DR   EnsemblGenomes-Tr; EBT00001556850.
DR   EnsemblGenomes-Tr; EBT00001556851.
DR   EnsemblGenomes-Tr; EBT00001556852.
DR   EnsemblGenomes-Tr; EBT00001556853.
DR   EnsemblGenomes-Tr; EBT00001556854.
DR   EnsemblGenomes-Tr; EBT00001556855.
DR   EnsemblGenomes-Tr; EBT00001556856.
DR   EnsemblGenomes-Tr; EBT00001556857.
DR   EnsemblGenomes-Tr; EBT00001556858.
DR   EnsemblGenomes-Tr; EBT00001556859.
DR   EnsemblGenomes-Tr; EBT00001556860.
DR   EnsemblGenomes-Tr; EBT00001556861.
DR   EnsemblGenomes-Tr; EBT00001556862.
DR   EnsemblGenomes-Tr; EBT00001556863.
DR   EnsemblGenomes-Tr; EBT00001556864.
DR   EnsemblGenomes-Tr; EBT00001556865.
DR   EnsemblGenomes-Tr; EBT00001556866.
DR   EnsemblGenomes-Tr; EBT00001556867.
DR   EnsemblGenomes-Tr; EBT00001556868.
DR   EnsemblGenomes-Tr; EBT00001556869.
DR   EnsemblGenomes-Tr; EBT00001556870.
DR   EnsemblGenomes-Tr; EBT00001556871.
DR   EnsemblGenomes-Tr; EBT00001556872.
DR   EnsemblGenomes-Tr; EBT00001556873.
DR   EnsemblGenomes-Tr; EBT00001556874.
DR   EnsemblGenomes-Tr; EBT00001556875.
DR   EnsemblGenomes-Tr; EBT00001556876.
DR   EnsemblGenomes-Tr; EBT00001556877.
DR   EnsemblGenomes-Tr; EBT00001556878.
DR   EnsemblGenomes-Tr; EBT00001556879.
DR   EnsemblGenomes-Tr; lse_0027.
DR   EnsemblGenomes-Tr; lse_0028.
DR   EnsemblGenomes-Tr; lse_0187.
DR   EnsemblGenomes-Tr; lse_0188.
DR   EnsemblGenomes-Tr; lse_0256.
DR   EnsemblGenomes-Tr; lse_0257.
DR   EnsemblGenomes-Tr; lse_1169.
DR   EnsemblGenomes-Tr; lse_1170.
DR   EnsemblGenomes-Tr; lse_1766.
DR   EnsemblGenomes-Tr; lse_1767.
DR   EnsemblGenomes-Tr; lse_1924.
DR   EnsemblGenomes-Tr; lse_1925.
DR   EnsemblGenomes-Tr; lse_r001-1.
DR   EnsemblGenomes-Tr; lse_r002-1.
DR   EnsemblGenomes-Tr; lse_r003-1.
DR   EnsemblGenomes-Tr; lse_r004-1.
DR   EnsemblGenomes-Tr; lse_r005-1.
DR   EnsemblGenomes-Tr; lse_r006-1.
DR   EnsemblGenomes-Tr; lse_r007-1.
DR   EnsemblGenomes-Tr; lse_r008-1.
DR   EnsemblGenomes-Tr; lse_r009-1.
DR   EnsemblGenomes-Tr; lse_r010-1.
DR   EnsemblGenomes-Tr; lse_r011-1.
DR   EnsemblGenomes-Tr; lse_r012-1.
DR   EnsemblGenomes-Tr; lse_r013-1.
DR   EnsemblGenomes-Tr; lse_r014-1.
DR   EnsemblGenomes-Tr; lse_r015-1.
DR   EnsemblGenomes-Tr; lse_r016-1.
DR   EnsemblGenomes-Tr; lse_r017-1.
DR   EnsemblGenomes-Tr; lse_r018-1.
DR   EnsemblGenomes-Tr; lse_t001-1.
DR   EnsemblGenomes-Tr; lse_t002-1.
DR   EnsemblGenomes-Tr; lse_t003-1.
DR   EnsemblGenomes-Tr; lse_t004-1.
DR   EnsemblGenomes-Tr; lse_t005-1.
DR   EnsemblGenomes-Tr; lse_t006-1.
DR   EnsemblGenomes-Tr; lse_t007-1.
DR   EnsemblGenomes-Tr; lse_t008-1.
DR   EnsemblGenomes-Tr; lse_t009-1.
DR   EnsemblGenomes-Tr; lse_t010-1.
DR   EnsemblGenomes-Tr; lse_t011-1.
DR   EnsemblGenomes-Tr; lse_t012-1.
DR   EnsemblGenomes-Tr; lse_t013-1.
DR   EnsemblGenomes-Tr; lse_t014-1.
DR   EnsemblGenomes-Tr; lse_t015-1.
DR   EnsemblGenomes-Tr; lse_t016-1.
DR   EnsemblGenomes-Tr; lse_t017-1.
DR   EnsemblGenomes-Tr; lse_t018-1.
DR   EnsemblGenomes-Tr; lse_t019-1.
DR   EnsemblGenomes-Tr; lse_t020-1.
DR   EnsemblGenomes-Tr; lse_t021-1.
DR   EnsemblGenomes-Tr; lse_t022-1.
DR   EnsemblGenomes-Tr; lse_t023-1.
DR   EnsemblGenomes-Tr; lse_t024-1.
DR   EnsemblGenomes-Tr; lse_t025-1.
DR   EnsemblGenomes-Tr; lse_t026-1.
DR   EnsemblGenomes-Tr; lse_t027-1.
DR   EnsemblGenomes-Tr; lse_t028-1.
DR   EnsemblGenomes-Tr; lse_t029-1.
DR   EnsemblGenomes-Tr; lse_t030-1.
DR   EnsemblGenomes-Tr; lse_t031-1.
DR   EnsemblGenomes-Tr; lse_t032-1.
DR   EnsemblGenomes-Tr; lse_t033-1.
DR   EnsemblGenomes-Tr; lse_t034-1.
DR   EnsemblGenomes-Tr; lse_t035-1.
DR   EnsemblGenomes-Tr; lse_t036-1.
DR   EnsemblGenomes-Tr; lse_t037-1.
DR   EnsemblGenomes-Tr; lse_t038-1.
DR   EnsemblGenomes-Tr; lse_t039-1.
DR   EnsemblGenomes-Tr; lse_t040-1.
DR   EnsemblGenomes-Tr; lse_t041-1.
DR   EnsemblGenomes-Tr; lse_t042-1.
DR   EnsemblGenomes-Tr; lse_t043-1.
DR   EnsemblGenomes-Tr; lse_t044-1.
DR   EnsemblGenomes-Tr; lse_t045-1.
DR   EnsemblGenomes-Tr; lse_t046-1.
DR   EnsemblGenomes-Tr; lse_t047-1.
DR   EnsemblGenomes-Tr; lse_t048-1.
DR   EnsemblGenomes-Tr; lse_t049-1.
DR   EnsemblGenomes-Tr; lse_t050-1.
DR   EnsemblGenomes-Tr; lse_t051-1.
DR   EnsemblGenomes-Tr; lse_t052-1.
DR   EnsemblGenomes-Tr; lse_t053-1.
DR   EnsemblGenomes-Tr; lse_t054-1.
DR   EnsemblGenomes-Tr; lse_t055-1.
DR   EnsemblGenomes-Tr; lse_t056-1.
DR   EnsemblGenomes-Tr; lse_t057-1.
DR   EnsemblGenomes-Tr; lse_t058-1.
DR   EnsemblGenomes-Tr; lse_t059-1.
DR   EnsemblGenomes-Tr; lse_t060-1.
DR   EnsemblGenomes-Tr; lse_t061-1.
DR   EnsemblGenomes-Tr; lse_t062-1.
DR   EnsemblGenomes-Tr; lse_t063-1.
DR   EnsemblGenomes-Tr; lse_t064-1.
DR   EnsemblGenomes-Tr; lse_t065-1.
DR   EnsemblGenomes-Tr; lse_t066-1.
DR   EnsemblGenomes-Tr; lse_t067-1.
DR   EuropePMC; PMC2820865; 20061480.
DR   EuropePMC; PMC3497465; 23002226.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00038; PrfA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF00615; LhrA.
DR   RFAM; RF00616; LhrC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01457; rli22.
DR   RFAM; RF01459; rliE.
DR   RFAM; RF01460; rliH.
DR   RFAM; RF01461; rli24.
DR   RFAM; RF01467; rli36.
DR   RFAM; RF01468; rli32.
DR   RFAM; RF01471; rliB.
DR   RFAM; RF01472; rli40.
DR   RFAM; RF01474; rli42.
DR   RFAM; RF01475; rli45.
DR   RFAM; RF01478; rli47.
DR   RFAM; RF01481; rli53.
DR   RFAM; RF01482; AdoCbl_riboswitch.
DR   RFAM; RF01483; rli56.
DR   RFAM; RF01485; rli61.
DR   RFAM; RF01487; rliI.
DR   RFAM; RF01489; sbrA.
DR   RFAM; RF01490; rli51.
DR   RFAM; RF01494; rliD.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; FN557490.
DR   SILVA-SSU; FN557490.
DR   StrainInfo; 14882; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2797636
FT                   /organism="Listeria seeligeri serovar 1/2b str. SLCC3954"
FT                   /strain="SLCC3954"
FT                   /mol_type="genomic DNA"
FT                   /serovar="1/2b"
FT                   /db_xref="taxon:683837"
FT   gene            319..1674
FT                   /gene="dnaA"
FT                   /locus_tag="lse_0001"
FT   CDS_pept        319..1674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="lse_0001"
FT                   /product="chromosomal replication initiator protein"
FT                   /function="ATPase involved in DNA replication initiation"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0001"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26152"
FT                   /protein_id="CBH26152.1"
FT                   /translation="MQSIEDIWQETLQIVKKNMSKPSYDTWMKSTTAHSLEGNTFIISA
FT                   PNNFVRDWLEKSYTQFIANILQEITGRLFDVRFIDGEQEENFEYTVIKPSPALDEDGIE
FT                   IGKHMLNPRYVFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAV
FT                   GHYVQQHKDNAKVMYLSSEKFTNEFISSIRDNKTEEFRTKYRNVDVLLIDDIQFLAGKE
FT                   GTQEEFFHTFNTLYDEQKQIIISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRI
FT                   AILRKKAKADGLDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLVNKDITAGLAAEA
FT                   LKDIIPSSKSQVITISGIQETVGEYFHVRLEDFKAKKRTKSIAFPRQIAMYLSRELTDA
FT                   SLPKIGDEFGGRDHTTVIHAHEKISQLLKTDQVLKNDLAEIEKNLRKAQNMF"
FT   gene            1869..3014
FT                   /gene="dnaN"
FT                   /locus_tag="lse_0002"
FT   CDS_pept        1869..3014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="lse_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /function="DNA polymerase sliding clamp subunit (PCNA
FT                   homolog)"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0002"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26153"
FT                   /protein_id="CBH26153.1"
FT                   /translation="MKFVIERDRLVQAVNEVTRAISARTTIPILTGIKIVVNDEGVTLT
FT                   GSDSDISIEAFIPLIENDEVIVEVESFGGIVLQSKYFGDIVRRLPEENVEIEVTTNYQT
FT                   NISSGQASFTLNGLDPMEYPKLPEVTDGKNIKIPINVLKNIIRQTVFAVSAIEVRPVLT
FT                   GVNWIIKENKLSAVATDSHRLALREIPLETDIDEEYNIVIPGKSLAELNKILDDASESI
FT                   EMTLANNQILFKLKDLLFYSRLLEGSYPDTSRLIPTDTKSELVINSRAFLQAIDRASLL
FT                   ARENRNNVIKLITLDNGQVEVSSNSPEVGNVSENVFSQSFTGEEVKISFNGKYMMDALR
FT                   AFEGDDIQISFSGTMRPFVLRPKDATNPNEILQLITPVRTY"
FT   gene            3121..4464
FT                   /locus_tag="lse_0003"
FT   CDS_pept        3121..4464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0003"
FT                   /product="MATE efflux family protein"
FT                   /function="Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0003"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26154"
FT                   /protein_id="CBH26154.1"
FT                   /translation="MMKDMTTGNPTKLIFLFAMPMLIGNLFQQFYTMIDAVIVGKFVSV
FT                   DALAAVGATNSVNFFMVSLIIGLMSGISVVVAQYFGFKDYNRLKDVIATATYAVVFSAI
FT                   ILTVAGVLLAKPLLILLRTPANILDDSSIFLTTLFIGILPMSLYNGMAAILRALGNSIT
FT                   PLLFLILSSLLNIALDFLFVVHMNMGVRGAAIATVLSQSVAAVLVIFYAYRHVPFMRIE
FT                   RAKFKLSPPLLKEMIRIGLPSGLQGSFISIGNMALQSLINGFGSSVVAAYTAASRIDSL
FT                   TYQPGIAFGAASSTFAGQNIGAGKMERVREGFWSGIKVVTVISIGITILVQLFARQFLL
FT                   LFVDGSETEVIDIGVSYLLIVSLFYVVVGVLFVVRETLRGTGDAMVPLAMGIFELVSRL
FT                   VIGFVLSIYIGYIGLWWATPVAWITATMLGVWRYKSGAWKKKAVIRRK"
FT   gene            4630..4866
FT                   /locus_tag="lse_0004"
FT   CDS_pept        4630..4866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0004"
FT                   /product="S4-domain binding protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0004"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26155"
FT                   /protein_id="CBH26155.1"
FT                   /translation="MGVKFLAETVKINSEFVTLGQLLQMIDVVSTGGMAKAYLSENTIY
FT                   VNGEQDNRRGKKLRNGDVVLVPGIGKVKIEQGK"
FT   gene            4870..5982
FT                   /gene="recF"
FT                   /locus_tag="lse_0005"
FT   CDS_pept        4870..5982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="lse_0005"
FT                   /product="DNA replication and repair protein"
FT                   /function="Recombinational DNA repair ATPase (RecF
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0005"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26156"
FT                   /protein_id="CBH26156.1"
FT                   /translation="MHLESIVLRNFRNYENLELEFSPSVNVFLGENAQGKTNLLEAVLM
FT                   LALAKSHRTTNDKDFIMWEKEEAKMEGRIEKRGQTVPLELTITQKGKRAKVNHLEQKKL
FT                   SQYVGNLNVVIFAPEDLSLVKGAPGIRRRFLNMEIGQMQPIYLHNLSEYQRILQQRNHY
FT                   LKMLQMKRKVDPLLLDILTEQFADVAINLTKRRADFIQKLEAYAAPIHSQISRGLETLK
FT                   IEYKASVTLAGDDPEVWKADLLQKMESIKQREIDRGVTLIGPHRDDSLFYINGQNVQDF
FT                   GSQGQQRTTALSVKLAEIDLIHEETGEYPVLLLDDVLSELDDYRQSHLLGAIEGKVQTF
FT                   VTTTSTSGIDHNTLKQATTFYVEKGTVKKS"
FT   gene            6029..7969
FT                   /gene="gyrB"
FT                   /locus_tag="lse_0006"
FT   CDS_pept        6029..7969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="lse_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /function="Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0006"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26157"
FT                   /protein_id="CBH26157.1"
FT                   /translation="MSEENITNVQENASDYNEDQIQVLEGLEAVRKRPGMYIGSTSQRG
FT                   LHHLVWEIVDNAIDEALAGFCTEIEITIEADNSITVRDNGRGIPTGINEKIGRPTVEVI
FT                   FTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTYLEVYVHREGKKYYQRFERGDVVMD
FT                   MEEQGETDYRGTIVHFTPDPQIFSETTEFDFDTLRTRTRELAFLNRGLTISIEDKREEH
FT                   KVRKDFHYEGGIRSYVEHLNKAKDVIHEPPIYLEGERDDIMVEISMQYNTGFSSNIISF
FT                   ANNIHTYEGGTHESGFKTALTRVINDYARRNKVFKDSDDNLSGEDVREGLTAIISIKHP
FT                   DPQFEGQTKTKLGNSEARSITDKLFSEALNKFMMENPDVAKKIVEKGVVASRARLAAKR
FT                   AREVARKSSGLEISSLPGKLADCSSRNPEISELYIVEGDSAGGSAKQGRDRLFQAILPI
FT                   RGKILNVEKARLDRILANEEIRTIFTAMGTGFGGDFDVSKSRYHKLIIMTDADVDGAHI
FT                   RTLLLTLFYRYMRPLLDAGYIYIAQPPLYQIKHGKQIEYVYSDGQLEDYLASLDKDTKY
FT                   GIQRYKGLGEMNPEQLWDTTMNPEHRTLLQVNIKDAIDADETFEMLMGDRVEPRRKFIE
FT                   ENAQYVKNLDV"
FT   gene            8065..10590
FT                   /gene="gyrA"
FT                   /locus_tag="lse_0007"
FT   CDS_pept        8065..10590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="lse_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /function="Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0007"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26158"
FT                   /protein_id="CBH26158.1"
FT                   /translation="MAETPNQRITEINLNKEMRTSFLDYAMSVIVARALPDVRDGLKPV
FT                   HRRILYAMNDLGMTSDKAYKKSARIVGEVIGKYHPHGDTAVYFTMVRMAQDFSYRNMLV
FT                   DGHGNFGSVDGDMAAAMRYTEARMSKISMELLRDINKDTIDYADNYDGSEREPVILPAR
FT                   FPNLLVNGSSGIAVGMATNIPTHHLGEVIDGVLALSNDPDISIRELMEYIPGPDFPTAG
FT                   MIMGRSGIRRAYESGRGSITVRGRVDIEEKKNGKETIVITEIPYQVNKARLVERIAELA
FT                   REKKIDGITSLNDESDRSGMRIVIEVRRDISASVIVNNLFKMTALQTTFGINMLALVDN
FT                   HPKVLNLKEILYYYLEHQKVVIRRRTEFELRKAEARAHILEGLRIALDNIDAIIKLIRG
FT                   SKTSDVAKEGLMTQFNLSDKQAQAILDMRLQRLTGLEREKIEEEYQNLVALINDLKAIL
FT                   ADDERILEIIREELEEIKVKYADKRRTEILAGDLVSLEDEDLIPEEEVAITLTKRGYIK
FT                   RLPLSTYRSQRRGGRGIQGMSTHEDDFVEHLVATSTHDTLLFFTNTGKVYRSKGYEVPE
FT                   YGRTAKGIPIINLLGIESQEQVNAVINLSEFTDDNYLFFTTKHGVVKRTTLSQFAKIRQ
FT                   SGLRAVELRENDELISVQMTDGNKNMIIATKHGQSIYFPEANIRVMGRTAAGVRGIRLR
FT                   EGDEVIGMEVLEDDEKVLVVTEKGYGKQTPASQYPLRNRGGMGVKTVTITEKNGNLVAM
FT                   KTVTGEEDLMLMTVSGVLIRFEIDTVSQTGRSAMGVKLIRLDEDEKVATVAKVPKEEDI
FT                   ELEEEIDETLITQVPDESFEDAPGSDIEE"
FT   gene            10715..12229
FT                   /gene="cls"
FT                   /locus_tag="lse_0008"
FT   CDS_pept        10715..12229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cls"
FT                   /locus_tag="lse_0008"
FT                   /product="cardiolipin synthetase"
FT                   /function="Phosphatidylserine/phosphatidylglycerophosphate/
FT                   cardiolipin synthases and related enzymes"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0008"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26159"
FT                   /protein_id="CBH26159.1"
FT                   /translation="MRKLIQFLVIVVVLTLVEYLLITQAATLFLISSLIIQLCGVVIAI
FT                   RLLLFDQRNTSSKVAWIAVIFVVPVLGTISYLVFGRNPATRRFTTAQVIEKEKLIEAIH
FT                   AIPNNTHEKLPRLSKRIAHLTSIEPIKGNKIEVLTNGEETFPVLLDGLRKAENHIHIQY
FT                   YIFKTDEISTEIRDILVERAKAGVEVRFMFDGLGSSKLKKDFLKPLTDAGVEIHAFDPI
FT                   TSPWIVRTANLRNHRKIVVIDGQIGFTGGLNIGEEYRSNTPDFRVWRDTHLKITGQAVI
FT                   ELQESFLNDWIYMENRKGAADKFINEAGLKQYFSPVDMGDEWAQVIYGGPYDKEKWVRD
FT                   SMLDLIDSAKESVWIVSPYFVPDEEALAVIRRVAMSGIDVRVIIPGKGDRGISFHGSNA
FT                   YVKTMLEAGAKMYAYQDDSFVHAKAMLVDGTHAAVGTANFDVRSFRLNHELMVFLYDES
FT                   EALRHLKRDFKKDFEDSRLFTMKDMEEKTRTTRIKEVLSSLLSPIL"
FT   gene            12246..12764
FT                   /gene="speG"
FT                   /locus_tag="lse_0009"
FT   CDS_pept        12246..12764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speG"
FT                   /locus_tag="lse_0009"
FT                   /product="spermidine N1-acetyltransferase"
FT                   /function="Acetyltransferases, including N-acetylases of
FT                   ribosomal proteins"
FT                   /EC_number="2.3.1.57"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0009"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26160"
FT                   /protein_id="CBH26160.1"
FT                   /translation="MSGDLKLRPLEREDLKFVHRLNNDAKIMSYWFEEPYEAFVELQEL
FT                   YDKHIHDQSERRFILELDGQMVGLVELMEIDYIHRRTEFQIIIDPKFQGHGYAVSATKL
FT                   AMKYAFHVLNMHKLYLVVDKVNEKAIHVYEKVGFIREGELIDEFFVDGTYHDAIRMCLF
FT                   QHQYKEMDM"
FT   gene            12908..13876
FT                   /locus_tag="lse_0010"
FT   CDS_pept        12908..13876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0010"
FT                   /function="Mevalonate kinase"
FT                   /EC_number="2.7.1.36"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0010"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26161"
FT                   /protein_id="CBH26161.1"
FT                   /translation="MATGIGTAKMILCGEHAVVYGEPAISVPFTQAVVTTNVETSTKTE
FT                   FSSAFFSGNLEDMPDFLAGIKSLVVDILKEIGKGECVSIHVTSGVPIGRGLGSSAAVAT
FT                   SIARGLYKYFDKELDKKKLLAIVNAAEKIAHGNASGVDAITVVSEKPVWYERDRKLEIM
FT                   HFPKKVTFVVADTGVPSETRAAVADVQQLYQKNEAEIGKIIHALGDISREIKTNLEGNA
FT                   DTVKIGTAMNKAQSYLEILTVSDKSLEKLIEVARSNGADGAKLTGGGRGGCIIAVAKNQ
FT                   ETAEKITKALHKAGAAQEWIFTIGEGSYESDSHRTHECGAN"
FT   gene            13833..14804
FT                   /gene="mvaD"
FT                   /locus_tag="lse_0011"
FT   CDS_pept        13833..14804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvaD"
FT                   /locus_tag="lse_0011"
FT                   /product="mevalonate diphosphate decarboxylase"
FT                   /function="Mevalonate pyrophosphate decarboxylase"
FT                   /EC_number="4.1.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0011"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26162"
FT                   /protein_id="CBH26162.1"
FT                   /translation="MRATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTV
FT                   EWDEKLKQDRFMLNGEQKTDAKVTRFIDKMREEFGITAKALIISENHVPTAAGLASSAS
FT                   AFAALALAGSSAAGRNDTQQYISKLARFGSGSASRSIYGDFVIWEKGELADGSDSFAIP
FT                   FTKKLSDKMSMVIAVVSDKEKKVSSRDGMRLTVETSPFFKEWVAAAETDLEEMKQAILA
FT                   EDFIKVGEITERNGMKMHATTLGAEPPFTYFQPLSLEIMDEVRALREEGIPAYFTMDAG
FT                   PNVKVICERKNEKIVAEKLSELAKNVLICHAGKEASVVSDEK"
FT   gene            14782..15864
FT                   /locus_tag="lse_0012"
FT   CDS_pept        14782..15864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0012"
FT                   /product="phosphomevalonate kinase"
FT                   /function="Mevalonate kinase"
FT                   /EC_number="2.7.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0012"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26163"
FT                   /protein_id="CBH26163.1"
FT                   /translation="MLYQMKNKLQVKIPGKLYVAGEYAVVESGHTAILTAVNRYITLTL
FT                   EDSERNELWIPHYENPVSWPVGGELKPDGEHWTFTAEAINIATTFLKSEGIELTPVKMM
FT                   IETELIDKSGAKYGLGSSAAATVAVINALMTKFYPEISMLKKFKLAALSHLVVQGNGSC
FT                   GDIASCMYGGWIAYTTFDQEWVKHRLAYKSLEWFMKEPWPLLEIETLEEPTSVFSVGWT
FT                   GTPVSTGKLVSQIHAFKQEDSENYQQFLTRNNQIMKQIIQAFHTKDEELLYSSIKENRR
FT                   ILQDLGTKAGVNIETSLLKKLADLAEQNDGAGKSSGSGGGDCGIAFSKTPEIAEKLVNE
FT                   WEKLGIKHLPFNTGKVQITE"
FT   gene            16210..17316
FT                   /gene="qoxA"
FT                   /locus_tag="lse_0013"
FT   CDS_pept        16210..17316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qoxA"
FT                   /locus_tag="lse_0013"
FT                   /product="quinol oxidase, subunit II"
FT                   /function="Heme/copper-type cytochrome/quinol oxidases,
FT                   subunit 2"
FT                   /EC_number="1.9.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0013"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26164"
FT                   /protein_id="CBH26164.1"
FT                   /translation="MSKLLKSLLLMALLGVTGLISGCGDLTVLNPKGPVAKGQSDLIIY
FT                   SIIFMLVIVLTIFVLFTIMLVKYRERKDISNYEPDMHGSKKLEIFWTLIPVAIVIALAI
FT                   PTVKTIYAGEEAPKVTSHKDPIIIYATSADWKWIFSYPDESIETVNYVNIPTDRPVLFK
FT                   LTSADTMTSFWVPQLGGQKYAMSGMTMSLYLQADEVGTYKGRNANFNGEGFADQRFDVV
FT                   AQSESDFKKWAKETKASSPVITQDIYDRLLIPGSSKKKTYSGTHLAFVDVAADPEYVFY
FT                   AYKRFGYEMTNPHNPNTKSTISDKPLLPVRPVTVTNPQFERHDMEPQIIKNGEGYHEDK
FT                   HREDEMKKMEEDIQTNEFNKKESDDAGN"
FT   gene            17335..19314
FT                   /gene="qoxB"
FT                   /locus_tag="lse_0014"
FT   CDS_pept        17335..19314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qoxB"
FT                   /locus_tag="lse_0014"
FT                   /product="quinol oxidase, subunit I"
FT                   /function="Heme/copper-type cytochrome/quinol oxidases,
FT                   subunit 1"
FT                   /EC_number="1.9.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0014"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26165"
FT                   /protein_id="CBH26165.1"
FT                   /translation="MKWNEFIVTGDPMILGAQISIVLASVGIVVLLTYTKKWKWLMKEW
FT                   ISSVDHKKIGIMYLLAAVLMFFRGGVDALMMRTQLALPDMKFLDAQHYNEVFSTHGTIM
FT                   ILFMAMPFIIGLMNIAVPLQIGARDVAFPFLNNLSFWTFFMGAMLFNLSFVIGGSPDAG
FT                   WTNYAPLATDFSAGYGINFYLLGVQIAGIGTLMTGINFFVTILRMRTKGMTLMKMPMFT
FT                   WSSLITSLIIIFAFPVLTVALALMSFDRLFGTAFFTLTNGGLPMMWANLFWVWGHPEVY
FT                   IVILPAFGIFSEIISTFSRKKLFGYPAMVAAMAVISLLSFLVWVHHFFTMGSGALVNSF
FT                   FSITTMMIAIPTGIKIFNWLFTMYKGRITFTTPMLWSLAFIPNFVVGGVTGVMLAMAAA
FT                   DYQYHNTYFLVSHFHYVLIAGTVFSCFAGLTYWYPKMVGYRLNEKIGKWFFWIFVVGFN
FT                   VCFFPQYFLGLDGMPRRIYTYVQGDGWTTLNFISTVGGFLMGIAFLVLCYNIYYSYKNS
FT                   KREVTGDPWDARTLEWATSSAVPPKYNFAVLPEWNDLDDFWNRKQKGEPYVNDKNYKPI
FT                   HMPSNTMVGFVMSVFFFIAGFGLVFYWYWLGIIGLIGILGCMVYRSFQNNDGYHVEVDE
FT                   IKATEEHNARELATGVKEGNPWNL"
FT   gene            19302..19913
FT                   /gene="qoxC"
FT                   /locus_tag="lse_0015"
FT   CDS_pept        19302..19913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qoxC"
FT                   /locus_tag="lse_0015"
FT                   /product="quinol oxidase AA3, subunit III"
FT                   /function="Heme/copper-type cytochrome/quinol oxidase,
FT                   subunit 3"
FT                   /EC_number="1.9.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0015"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26166"
FT                   /protein_id="CBH26166.1"
FT                   /translation="MESVETNKNLPIEYRSEQGRLNILGFWIFLGAEIALFATLFATYF
FT                   VMRKAGSNAGHPPAEMFELWLVLIMTFLLLTSSFTCGLAIGEMRKGNVKMLTIYSIITL
FT                   ILGAGFVGFELYEFAHYVTEGVTMQIGSYWSAFFVLLGTHGLHVTVGIFWISFILIQIK
FT                   MHGLTPKTASKVFISSLYWHFLDVVWIFIFTGVYLLGMVN"
FT   gene            19915..20247
FT                   /gene="qoxD"
FT                   /locus_tag="lse_0016"
FT   CDS_pept        19915..20247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qoxD"
FT                   /locus_tag="lse_0016"
FT                   /product="quinol oxidase AA3, subunit IV"
FT                   /function="Heme/copper-type cytochrome/quinol oxidase,
FT                   subunit 4"
FT                   /EC_number="1.9.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0016"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26167"
FT                   /protein_id="CBH26167.1"
FT                   /translation="MAQNNKSNAAHAESGIPWKHIVGFALSIILTLLAVWVALYSTLTT
FT                   NVKVVIIFIFAFIQAALQLLMFMHMTEGRDGKIQIGNILFAAFIAIVVVIGSYWVMEIG
FT                   HMNHLM"
FT   gene            20412..21845
FT                   /locus_tag="lse_0017"
FT   CDS_pept        20412..21845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0017"
FT                   /product="glycosyl hydrolase, family 1"
FT                   /function="Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0017"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26168"
FT                   /protein_id="CBH26168.1"
FT                   /translation="MTESKFPKDFLWGGAVAANQCEGAYLEDGKGLSLVDILPTVEDGR
FT                   WEALFNPAKALATDYGFYPSHESIDFYHRYKEDIKLMADMGFKCFRMSISWPRIFPNGD
FT                   ESKPNEKGLAFYDAVFDECHKYGIEPVVTINHFDTPLEVFKKYGGWKNRKCIDFYLNFC
FT                   EAIFTRYKDKVKYWMTFNEINMILHLPYIGGGLDVTKEENPEEVKYQAAHHQLVASALA
FT                   TKLGHEINPENQIGCMLAAGNTYPMTCNPEDVWKSIGADREGYFFIDVQSRGYYPSYTK
FT                   RFFKENNINIKMEDGDVEALRDNTVDYIAFSYYSSRLTSADPEKNKETEGNVFATLKNP
FT                   YLKASEWGWQIDPLGLRITMNTIYDRYQKPLFIVENGLGAVDTVEEDGSINDDYRIDYM
FT                   REHVREMGEAIEDGVELLGYTPWGCIDLVSAGSGEMKKRYGFIYVDRDNKGNGTLNRSK
FT                   KKSFDWYKKVIETNGKDID"
FT   gene            complement(21895..22284)
FT                   /locus_tag="lse_0018"
FT   CDS_pept        complement(21895..22284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0018"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26169"
FT                   /protein_id="CBH26169.1"
FT                   /translation="MKKSTILISLTIFIIMLICIGGYFIMQNHEKQEAKQQFLSEESPR
FT                   IEKYLKYNYKNIENVTFTNADITGMGTPYIEGYVNGDKDLYITASIYGKHFEKNVGMPI
FT                   EMYDWAKFPTDKSVSEIEKEENANK"
FT   gene            22326..22958
FT                   /locus_tag="lse_0019"
FT   CDS_pept        22326..22958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0019"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26170"
FT                   /protein_id="CBH26170.1"
FT                   /translation="MVMKVKDNTNFYLADAVYANKYLKTGSVLPLENNEEWVTINSVNK
FT                   DNGLQAIAVVPLKDYKDYNNGKLKTYNHIVFVSRGSEELDDWNENLGLVAKMRQVENYM
FT                   QDYEEWEKMQSQRLRSQLDEETWEGGKYSELTSWDVDDVLTEVSRKYKDGVYRFHNTDK
FT                   FEEFYDENRKTIQKLNGFKEEVISAALAFNDKDKELGNWIKENSKGW"
FT   gene            22962..23390
FT                   /locus_tag="lse_0020"
FT   CDS_pept        22962..23390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0020"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26171"
FT                   /protein_id="CBH26171.1"
FT                   /translation="MYGSSPTTQKIENYDYYVKAEQQRLQAKLDNKNDELSKQERADII
FT                   QAQRALEKQIQKQHLQVDVPKKVTKIIDEGKQELANFEQTWVDLLAEYADIVTQMECSF
FT                   ESKTGQALKDWMVNYRSNQIVQNENLIYDCQDSIKLDN"
FT   gene            complement(23476..24300)
FT                   /locus_tag="lse_0021"
FT   CDS_pept        complement(23476..24300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0021"
FT                   /product="putative secreted SH3 domain protein"
FT                   /function="SH3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0021"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26172"
FT                   /protein_id="CBH26172.1"
FT                   /translation="MGAIFSKWGKLLLVLGLVFSVFSVSTTGHAATKETVINKQMITTA
FT                   SLNVRASSTTSSKVIGWFKNKTKFKAIAKTSNNWYRLSYKGKKGYVSGKYVKTVSATKP
FT                   TPAPSTPKIVQMNVPLIVQRPQLPTGCEITNIAMMLRYAGKNVDKVKLAKEMKRHKSNP
FT                   NYGFVGNPFSRSGWTIYPPALMSQVKKHAGSAKNMTGTSLSGIKTQLNKKRPVVAWVSN
FT                   FHGFSVHAITITGYDKNNFYYNDSWSGQKNARISQSYFNTCWNKQAKRAISY"
FT   gene            24660..26564
FT                   /locus_tag="lse_0022"
FT   CDS_pept        24660..26564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0022"
FT                   /product="PTS system, beta-glucoside-specific IIABC
FT                   component"
FT                   /function="Phosphotransferase system IIC components,
FT                   glucose/maltose/N-acetylglucosamine-specific"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0022"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26173"
FT                   /protein_id="CBH26173.1"
FT                   /translation="MKYEQLAKDILKNVGGKENINSVFHCITRLRFKLKDENIANTKEI
FT                   EKLDGVISVIKSGGQYQVVIGNHVPDVFKAVLEVGGISAEGADDTSAPSGGNIFNRFID
FT                   MISGVFTPVLGVLAATGMIKGFTAMFAAFGWITVESGTYQLLYAIGDCLFYFFPIFLGY
FT                   TAMKKFGGNIFIGMAIGASLVYPTLAGITAGDPIYTLFAGTIFESPIHVTFLGIPVILM
FT                   SYASSVIPIILAAYFGSKVEKGFKKIVPDVIKTFVVPFCTLLVVVPLTFIVIGPIATWA
FT                   GQLLGAGTIWVYNLSPVIAGLILGGFWQVFVIFGLHWGLIPVAINNLTTLGADPILAMT
FT                   FGASFAQIGAVLAVFFKTRNTKIKSLSIPAFISGIFGVTEPAIYGVTLPLKKPFIMSCI
FT                   AGGIGGGIIGFAGAQSYIMGGLGIFGIPNFIKPGTGIDGAFWWIMIAMAISFILGFILT
FT                   YVVGFKDPAEAVVEKSNTVEGETLIERETIPAPVVGEIVTLADVKDEAFSSGALGKGVA
FT                   IIPSVGRVVAPAAGTVTTIFPTGHAVGITTNDGAEVLIHIGMDTVQLEGKFFTAHVKQG
FT                   DTIVKGQLLVEFDIEGIKSAGYDVTTPVVITNSGSYLDVMITDSKEAKLEDRLITLVI"
FT   gene            26645..27520
FT                   /locus_tag="lse_0023"
FT   CDS_pept        26645..27520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0023"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized proteins, homologs of microcin
FT                   C7 resistance protein MccF"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0023"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26174"
FT                   /protein_id="CBH26174.1"
FT                   /translation="MLIAGDSVGIICCSDGKKHSDKEKIEKLEQILNDKFDLRAVFAET
FT                   IFRTNDSPYSGTPKARAIELMKLYNNPKIKAIFDISGGDAANQILPYLDFDSIRKARVP
FT                   FVGYSDLTVILNAIYAKTKQIGYNYLLLNLVGEESELQQVQFKKVFFENRLLINGRTLT
FT                   DFDWHQADVIGGNIRCFLKLAGTEFMPDFSGKIILLESFGGKEAKIASYLTQLEQLGAF
FT                   SKCSGIIVGQHSEAEKSGEYKEIGRLYQELGLKYKLPIFRTAEIGHGSAAKPCPIGAEI
FT                   NVSRETLTNF"
FT   gene            complement(27671..28291)
FT                   /locus_tag="lse_0024"
FT   CDS_pept        complement(27671..28291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0024"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0024"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26175"
FT                   /protein_id="CBH26175.1"
FT                   /translation="MTKTKAGIFVALAVITLLFFLVPKGVKYIKNQDPELLNAAESVKL
FT                   QSGEYTVGEEIKVGIYDMQVTKGSLSYFDTKLSKGDKLVGMELLDDNKIYFEGSGEIEL
FT                   TPAEFTPIKSSDDIYRVEHSGSYEVGKQIPAGEYNLTYTADKKSSEKPFIQISPSYADD
FT                   ARVDIQFENKDTYDIDLKSGEILTVKKTKSEELDDMEILLEKK"
FT   gene            complement(28284..28913)
FT                   /locus_tag="lse_0025"
FT   CDS_pept        complement(28284..28913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0025"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /function="ABC-type spermidine/putrescine transport
FT                   systems, ATPase components"
FT                   /EC_number="3.6.3.25"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0025"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26176"
FT                   /protein_id="CBH26176.1"
FT                   /translation="MIKIVNLHKQIKHTEVLTNINYSFEPGKIYGIFGKNGSGKTMLLR
FT                   SLAGLIIPTSGEIFIDNKQLHQDISFPPSMGIIIENMELLPQFDARTNLKILAEIKNIA
FT                   NEEDIDNAIDRVGLTPHIDKKVKKYSLGMKQRLNIAQAIFEKPAVILLDEPTNAIDDQG
FT                   IELINQLLLEEKQRGATIIIASHHKEDIAPLCDVTIRMDQGKIVHD"
FT   gene            complement(28929..29651)
FT                   /locus_tag="lse_0026"
FT   CDS_pept        complement(28929..29651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0026"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0026"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26177"
FT                   /protein_id="CBH26177.1"
FT                   /translation="MKNRKLIILVIICLFLQAILFISFDFRFTTLPILDGFPVGLATPV
FT                   VTRLLVYWYLPIIAFSFYISGNIKDLLSNYGFLQISRNYKKEYWLIKQFLKLFVKIILF
FT                   ICLQIALISIITPFHISWTSQFFYLILGYFLMLFTIFSLQYLLELFIDAQKALLLINSY
FT                   LIISVLAADLIYQNTAATWPYYLLIPNYGMGFRTGLCEFPNTSTSLILQPAGLIILLVV
FT                   LLCVFTIAIKKFKTTDIL"
FT   gene            complement(29641..29922)
FT                   /pseudo
FT                   /locus_tag="lse_0027"
FT   CDS_pept        complement(29641..29922)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0027"
FT                   /db_xref="PSEUDO:CBH26178.1"
FT   gene            complement(29915..30271)
FT                   /pseudo
FT                   /locus_tag="lse_0028"
FT   CDS_pept        complement(29915..30271)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0028"
FT                   /db_xref="PSEUDO:CBH26179.1"
FT   gene            complement(30258..31022)
FT                   /locus_tag="lse_0029"
FT   CDS_pept        complement(30258..31022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0029"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0029"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26180"
FT                   /protein_id="CBH26180.1"
FT                   /translation="MKSQLTYLLNNKTTRGMFILILLIPCVEIIQLYIMMKPDGIDIHP
FT                   AFAFFLAGSSQGHITQILLLWFLPILGLLLGTDSSIQEYQTGVRNIVINKIGKKAYILQ
FT                   KLGTSFILCFITMFAALLLNFILVSIIFRGGTYQMGLDGAGSLNSLFDISMQNPYLADI
FT                   GFGLVACLMAGMAGLIGSSASLFFLNKKFAYPAAFFVWFLMILPNNSIMFIFQPFTEYG
FT                   LETILPIFLVFSLIVLLIVGILYLYEVRYVKE"
FT   gene            31414..31752
FT                   /locus_tag="lse_0030"
FT   CDS_pept        31414..31752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0030"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26181"
FT                   /protein_id="CBH26181.1"
FT                   /translation="MKVEGLLGFLGAALGIGFSLMVLVIPDISQALEEESFFFYMLTIG
FT                   SLVLSGVGLAGSFIVSHKPRLGGAMMVAAAIGCTMSISIMFLLPIVLLAVGGLIALINY
FT                   EEAASVEE"
FT   gene            31991..32650
FT                   /locus_tag="lse_0031"
FT   CDS_pept        31991..32650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0031"
FT                   /product="DedA family protein"
FT                   /function="Uncharacterized membrane-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0031"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26182"
FT                   /protein_id="CBH26182.1"
FT                   /translation="MDFITYIIDFILHIDQHLVEIINNFGIWTYIILFLIVFIETGLVV
FT                   FPFLPGDSLLFAAGALSVLDGSILHIVPLIITLWLAAVIGDSVNYQIGKKIGTSIPEDS
FT                   WFGKLINKEKMEKAEAFFNKHGGKTIFIARFMPFIRTFAPFVAGASRMNYRYFLNYNIL
FT                   GATVWVLLCTLAGYFFGNFPIVKDNFSLVVIGIIVVSVIPMVVSFIKSKMDKKNAD"
FT   gene            32729..33958
FT                   /gene="arcA"
FT                   /locus_tag="lse_0032"
FT   CDS_pept        32729..33958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /locus_tag="lse_0032"
FT                   /function="Arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0032"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26183"
FT                   /protein_id="CBH26183.1"
FT                   /translation="MEVENILNITSEIGKLRTVLVKRPGSELENITPEYLHSLLFDDIP
FT                   YLKMMQKEHDYFVKTMQDAQIEVLYLENLAAEALRESGDKEIFLTKMIQESSQLDASAL
FT                   YVRDYLMSFDEKDMIKKLMSGVKKSEIPARKKKHLNEMMENQYPFFLDPLPNLYFTRDP
FT                   AAVIGNGVTINKMFQPARRRESMFMELILQHHPRFSKQEIPIWTDREAQFPMEGGDELI
FT                   LNKETILIGVSERTDARAVEQLAENLFSRETQIKRVLAVEIPETRSFMHLDTVFTMVNY
FT                   DQFTIHPAIQNQQGELNVYILEQGDNGLEITSRKDFQRVMAEVLEVPEVDFIPCGGEDV
FT                   IVSAREQWNDGANTLAIAPGEVITYDRNQVSNELLRSAGIKVHEVISSELSRGRGGPRC
FT                   MSMPLVRENL"
FT   gene            34240..34533
FT                   /gene="rpsF"
FT                   /locus_tag="lse_0033"
FT   CDS_pept        34240..34533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="lse_0033"
FT                   /product="30S ribosomal protein S6"
FT                   /function="Ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0033"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26184"
FT                   /protein_id="CBH26184.1"
FT                   /translation="MARKYEIMYIIRPNIEEDEKKAVVERFDGILTENGAEIIESKEWG
FT                   KRRLAYEINDYRDGFYHIVKLNADKADSINEFDRLAKISDDIVRHMVIKEEA"
FT   gene            34590..35132
FT                   /gene="ssb"
FT                   /locus_tag="lse_0034"
FT   CDS_pept        34590..35132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="lse_0034"
FT                   /product="Single-strand binding protein"
FT                   /function="Single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0034"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26185"
FT                   /protein_id="CBH26185.1"
FT                   /translation="MMNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRTFTNQQGERE
FT                   ADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTRNYEGNDGKRVYVTEIVAESVQFLE
FT                   PRNSNSGGGNNYQGGNTTNNSNYNNGGNNFGQAPTNNGGFAQDQQQSQNQNHQSTNNDP
FT                   FASDGKPIDISDDDLPF"
FT   gene            35175..35414
FT                   /gene="rpsR"
FT                   /locus_tag="lse_0035"
FT   CDS_pept        35175..35414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="lse_0035"
FT                   /product="30S ribosomal protein S18"
FT                   /function="Ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0035"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26186"
FT                   /protein_id="CBH26186.1"
FT                   /translation="MAGGRRGGRRRKKVCYFTSNGITHIDYKDVELLKKFVSERGKILP
FT                   RRVTGTSAKYQRKLTVAIKRSRQMALLPFVAEEK"
FT   gene            35568..36179
FT                   /locus_tag="lse_0036"
FT   CDS_pept        35568..36179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0036"
FT                   /product="lipoprotein, putative"
FT                   /function="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0036"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26187"
FT                   /protein_id="CBH26187.1"
FT                   /translation="MYKKLATVGMTVLLVGALSACSFGDDNNSSSNNSSEETSKSSSSE
FT                   NSSSSESLQKKSFDMSYEDAVNAFKEKHSDAEISSVELEKSLGKYVYTVDGIADDNEYE
FT                   MKFNADTKEQLSDETDRLDSEDAGGVEKANEKLDLDGIKTPQEAMDKAVSEQAGDVTSW
FT                   TIERELDTTYYEVTVKQDNNKYEIKLNAKTLEVLQTEQDD"
FT   gene            36434..37048
FT                   /gene="agrB"
FT                   /locus_tag="lse_0037"
FT   CDS_pept        36434..37048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agrB"
FT                   /locus_tag="lse_0037"
FT                   /product="accessory gene regulator B"
FT                   /function="Membrane protein putatively involved in
FT                   post-translational modification of the autoinducing
FT                   quorum-sensing peptide"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0037"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26188"
FT                   /protein_id="CBH26188.1"
FT                   /translation="MSNFTAKIPLSERMADILISKDRWKDDEEGYLKVKYGLEIILINV
FT                   MKFAIVYGIALVTGVLLQTMTVHLSYLWLRRYSFGLHATKTLNCTLISLTMFVLTPWIF
FT                   QNVLSNNWIVLGTFAFILLNMFLFAPADTENLPLIGEGHRKKLKRKAMIGTLILTGITL
FT                   LIPFAEMKTLIMIGSLFQVVSINPLTYKLLRRRYRNYEKYE"
FT   gene            37032..37193
FT                   /gene="agrD"
FT                   /locus_tag="lse_0038"
FT   CDS_pept        37032..37193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agrD"
FT                   /locus_tag="lse_0038"
FT                   /product="accessory gene regulator protein D"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0038"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26189"
FT                   /protein_id="CBH26189.1"
FT                   /translation="MKNMNNKVGKFLSKKLEEQSMKVADSSMSKACFMFVYEPKSPFVK
FT                   MQEKKENK"
FT   gene            37285..38580
FT                   /gene="agrC"
FT                   /locus_tag="lse_0039"
FT   CDS_pept        37285..38580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agrC"
FT                   /locus_tag="lse_0039"
FT                   /product="accessory gene regulator protein C"
FT                   /function="Predicted signal transduction protein with a C-
FT                   terminal ATPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0039"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26190"
FT                   /protein_id="CBH26190.1"
FT                   /translation="MFSILMAFIQLTGIFIAIQILTNKVFSVKEGVVTVAIAMLAFPLF
FT                   TLVQYWSMIFVLVIFVSALYWKNKSIVASASITLAVIILLTISDSIVGFVLVPVLNFKY
FT                   EDIFNELLPTIIYCVGMLANLLVFSYVLRKLIGKINIIRFVKNRKYAYIILSIVTLTVL
FT                   AFYLNIYAGSLAGYDSTILKTNTLIFTGYTILLIVIVTVVLRTATNELKVQNQKEQLEQ
FT                   LQDYVTTLESLHREMRVFRHDYVNILSTLVGYIDNNDMPGLKFYFENNIVPINKTIESN
FT                   NYKISLLQNIHVIELKGLLAVKLIRAQELKIDAILEVVEPIDKIAMDSIDLCKAVGILL
FT                   DNAVEAALTCENPVIRIAFVKKGDSILIVFANSLPMNMPPVYKIFEEGFSTKGEGRGLG
FT                   LASLREIMQKYSHVALDTKVTNREVIQELEIM"
FT   gene            38599..39327
FT                   /gene="agrA"
FT                   /locus_tag="lse_0040"
FT   CDS_pept        38599..39327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agrA"
FT                   /locus_tag="lse_0040"
FT                   /product="accessory gene regulator protein A"
FT                   /function="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0040"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26191"
FT                   /protein_id="CBH26191.1"
FT                   /translation="MLPVFICEDNRMQRERLTKYIEDYIMVEHFDMKLELSTGDPFELV
FT                   SRMPRHQGMGLYFLDIDLGQPDMNGFELAQEIRKFDPRGFIIFITTHAELSYMTFTYKV
FT                   EALDYIIKDDIDTLHDRVLACMKQAEERVSNDQDMQKYFTFKVSDKKIIHELLDDILFF
FT                   ETAPTIHKVILHGKNRQVEFYGKLKSIEKMLDESFYRCHRSYIVNKKNIHELDATKGVV
FT                   KMSNGENCYASSKLIKSLSL"
FT   gene            39494..41467
FT                   /locus_tag="lse_0041"
FT   CDS_pept        39494..41467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0041"
FT                   /product="DHH subfamily 1 protein"
FT                   /function="Predicted signaling protein consisting of a
FT                   modified GGDEF domain and a DHH domain"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0041"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26192"
FT                   /protein_id="CBH26192.1"
FT                   /translation="MSGYFQKRMLKYPLYGLIAATVILSVITFFFSWWLSVLVVVGGII
FT                   LTVAMFYFEYRLNEDVQKYVSNLTYRIKRSEEEALVEMPMGILLYDEHYKIEWVNPFMS
FT                   KYFDKAELIGESLEEVGPEFLDVITGNDDDGIMSIAWREHRFDTIVKRKERILYLYDRT
FT                   EYYELNKKFQANKSVFGVIFLDNYDEWAQGMDDRRRSALNNLVTSMLTNWAREHRIYLK
FT                   RISTDRFMAFLTEEMLKRLEEEKFQILDRIRERTSKQNIPLTLSIGIGYKEEDLIALAD
FT                   LAQSSLDLALGRGGDQVVIKQPEGKVRFYGGKTNPMEKRTRVRARVISQALQELITQSD
FT                   QVFVMGHRYPDMDVIGSSLGVMRIAEMNDRNAYVVVEPGKMSPDVKRLMNEIEEYPNVI
FT                   KNIVTPQVALENITEKSLLVVVDTHKPSMVINKELLDTATNVVVVDHHRRSEEFVGSPV
FT                   LVYIEPYASSTAELITELFEYQPDLEQVGKIEATALLSGIVVDTKNFTLRTGSRTFDAA
FT                   SYLRSLGADTILVQQFLKEDITTFTQRSRLVESLEIYHDGMAIATGHEDEEFGTVIAAQ
FT                   AADTMLSMEGVQASFVITLRPDKLIGISARSLGQINVQVIMEKLGGGGHLSNAATQLKD
FT                   VTIAEAEKQLISAIDAYWKGET"
FT   gene            41470..41916
FT                   /gene="rplI"
FT                   /locus_tag="lse_0042"
FT   CDS_pept        41470..41916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="lse_0042"
FT                   /product="50S ribosomal protein L9"
FT                   /function="Ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0042"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26193"
FT                   /protein_id="CBH26193.1"
FT                   /translation="MKVIFLKDVKGKGKKGETKNVADGYANNFLIKNGYAVEASNAALS
FT                   TLSAQKKKEDKLAAEELAEAKALKEKMEKLTVELKAKSGEGGRLFGSITSKQIAQALEK
FT                   THGIKIDKRKMDLPEAIRALGHTKVPVKLHHEVTATLDVHVGEE"
FT   gene            41941..43293
FT                   /gene="dnaC"
FT                   /locus_tag="lse_0043"
FT   CDS_pept        41941..43293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaC"
FT                   /locus_tag="lse_0043"
FT                   /function="Replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0043"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26194"
FT                   /protein_id="CBH26194.1"
FT                   /translation="MDNNFQDRTPPQNIEAEQAVLGAIFLEPNALITASEILMPDDFYR
FT                   TGHQLIFETMLDLNDHGKAVDVLTVYEALAAKGNLEDVGGLPYLTELSGAVPTAANLEY
FT                   YAHIIEDKALLRRLIRTATQIATDGYSREDELDMLMDEAEKSILEVSQRKNVGAFKNIK
FT                   DVLVKTYDDIEILHNRKGDITGIPTGFNELDKMTAGFQRNDLIIVAARPSVGKTAFALN
FT                   IAQNVATKTDENVAIFSLEMGAEQLVMRMLCAEGNINAQNLRTGALTSDDWQKLTIAMG
FT                   TLSNSGIYIDDTPGVRVNEIRSKCRRLKQETGLGMIVIDYLQLIAGSGRGGENRQQEVS
FT                   EISRSLKALARELEVPVIALSQLSRSVEQRQDKRPMMSDIRESGSIEQDADIVAFLYRE
FT                   DYYDREGENDGTIEIIIAKQRNGPVGDVKLAFVKEYNKFVNLEVRYDDAMA"
FT   gene            43554..44846
FT                   /gene="purA"
FT                   /locus_tag="lse_0044"
FT   CDS_pept        43554..44846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="lse_0044"
FT                   /product="adenylosuccinate synthetase"
FT                   /function="Adenylosuccinate synthase"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0044"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26195"
FT                   /protein_id="CBH26195.1"
FT                   /translation="MSSVVVVGTQWGDEGKGKITDFLSENAEAIARYQGGNNAGHTIKF
FT                   DGETYKLHLIPSGIFYKEKISVIGNGMVVDPKALVEELKYLHDKGVDTSNLRISNRAHI
FT                   ILPYHIRIDEADEERKGANKIGTTKKGIGPAYMDKAARVGIRIIDLLDKETFKEKLAHN
FT                   LGEKNRLLERFYELEGFKLEDILEEYYEYGQQFKGYVCDTSVVLNDALDDGKRVLFEGA
FT                   QGVMLDIDQGTYPFVTSSNPIAGGVTIGSGVGPSKINHVVGVAKAYTTRVGDGPFPTEL
FT                   FDAIGDNIREVGREYGTTTGRPRRVGWFDSVVVRHARRVSGLTDLSLTLLDVLTGIETL
FT                   KICVAYKLDGKTITEFPASLKDLARCEPVYEELPGWTEDITGVSSLDDLPANCRHYMER
FT                   IAQLTGVQVSMFSVGPDRAQTHVIKSVWRLA"
FT   gene            45177..45470
FT                   /locus_tag="lse_0045"
FT   CDS_pept        45177..45470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0045"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0045"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26196"
FT                   /protein_id="CBH26196.1"
FT                   /translation="MSGQIRMSPSELRDRAKTYGQSGRDIEDILSRLSQLQDQLRSEWE
FT                   GQAFARFDDQFEQLKPKVTEFANLMDQINDQLEKTANAVEEHDQQLSQNFGF"
FT   gene            45617..48874
FT                   /locus_tag="lse_0046"
FT   CDS_pept        45617..48874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0046"
FT                   /product="putative membrane protein"
FT                   /function="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0046"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26197"
FT                   /protein_id="CBH26197.1"
FT                   /translation="MKKVKWSILLFLVLAVFLSAGITYLALNQGANKDTAEEEGTEKAH
FT                   KMTIALVNEDQGATFQGEEVEFGNQFVKSIEKDDQHEWYVVSRGVAESGLKRDVYNMMI
FT                   VIPSDFSEKALSMTSDAPEKVTISYKVNDVGNSDLKAEAEKTAAAVLEDFNTRIIDVYF
FT                   ASILTTLQEAQDNVGTLVEEEKEYDETYNKDVNNPLSSYTEQFKTVQDYTGTSKESFQG
FT                   FQDIMKDFEESLNVAKKENATHMTNMDDFTKMQELNVPFEETFTENLQKFDGSLSADDI
FT                   RAQTAALEQANAQMTTEFQIMEDNNTLLSQTQGLQNYIADTNARINSLDDEIMTTLSDD
FT                   FRTAVYDDLLRILQENEYSDQLNEIDLKDLTGEDINDGFNKRIVKEIKALPTYNTEQLA
FT                   GIGPDTEMYKNIVTLSRKYYGEHRSAFGDDFSFDMKEKTLETETVTNEALARLQSGVSI
FT                   ESEEFMLPASEYKSEIFLTIDSNFTLNDVHCFVNDEERTDLVQSDEYSEGGLKLTLKDL
FT                   KDGAKIKITGTAKLKEEVEISLMGAVSWNATLQQYEAPVEDSGELPIIPTDDTEEETNP
FT                   DDTDEPDDVPVPDEDFDGVRKQIEPIKVIEPTYLEETDSSIKAIVDTVKDYYKLQVLFD
FT                   LYYGIDANNSEQMPDFSSGGTLENSAKTSSYYYIFNKEDIIGSFVNLTTDRFVADYTKK
FT                   IEAFEQRIADYKSVMAEADARSEDVTTRLAETTQEAINLNTNLALTLEDLEAWRDASND
FT                   LVEENDVVVEKSGEEGTMALELSSEFAGLLAESESLAGTSEGNLESAEVVYKTFDAIDD
FT                   EAKDIQKSGETLVAEASTLSEDLAEKLEDDETFEKNFAKVMDNSRVGDRQNENLYSFLS
FT                   SPVDKMNAGTIVAGDKSMPYFMILICTILAIFTSYVISHQEKKRQQLNEFEKEMSLALK
FT                   NIPITFLMICVSVIEGLVIGAVSGYMFGVGEIGMFLWIGICVLIMMTLVTVFSYLLRQL
FT                   NMIGMSIILLILSLYLFLTDAVGLNIDSESIFATFRTFSPLQYMEQLLNGILSKQQDYI
FT                   VIVYSLIGAVVVFTALNLFVWHRSKDEENEEEHSDEI"
FT   gene            48864..49373
FT                   /locus_tag="lse_0047"
FT   CDS_pept        48864..49373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0047"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0047"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26198"
FT                   /protein_id="CBH26198.1"
FT                   /translation="MKFKISVFLVLICFAFAPSVLAAESDSYLENSGKMEIQTDRLQKT
FT                   DEEKAKELEDTEETELDKNGIPLFTDEMDEKIEKQKEAEKAEYERIKDSLFEEEPVAGE
FT                   TVKATKQKLFTDDYETAAAEETTITTTNTEDETKKTKQKTVGGAIAGTLVALAGGIYVA
FT                   ARNVFE"
FT   gene            49391..49642
FT                   /locus_tag="lse_0048"
FT   CDS_pept        49391..49642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0048"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0048"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26199"
FT                   /protein_id="CBH26199.1"
FT                   /translation="MAKDTHMNVTVDFTNWGAGKYDLRIPVHQPIKALIVNLAETLKIE
FT                   HQDMSKCTIKTTNKAILLSDDDKLTNFQIADGDILEIL"
FT   gene            49664..50887
FT                   /locus_tag="lse_0049"
FT   CDS_pept        49664..50887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0049"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0049"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26200"
FT                   /protein_id="CBH26200.1"
FT                   /translation="MNKTTEMDGTTYDFTYDDLVWSVTFPKSKTHAKEIAQLELLEKPA
FT                   NHFVPAKITSDSDSYTISYDIDKHTYGFEQVRKMEREDKLRALRNIADLSDMLNTRYTF
FT                   FLHPDNLIFDINLVPSIVHRGIKNILPPYELSEATFFKQYQCFVIAMFSKKYSFDNLYN
FT                   GSLASARGTQFEKSILDAKTIQDIADILEEAYVKENTAVHKNISRVPKKKYRTFRGLAV
FT                   GFIIVAVLLAVPVSYFAFVKVPLQNDLLTANENFLKTDYDKVITGLEDIDPEKMPQSVQ
FT                   YELAYSYVDGEKMSDKKKENIMRTISLKSDPQNLLYWIYNGRGEFDKSLDIAKLLDDPS
FT                   LAMYSLTKQIEQVQNDTTLSGDEKVEKLKTLEESLKEYDDKLNEQAAETEDEAATQTED
FT                   ESTNTEAK"
FT   gene            50901..55403
FT                   /locus_tag="lse_0050"
FT   CDS_pept        50901..55403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0050"
FT                   /product="FtsK/SpoIIIE family protein"
FT                   /function="DNA segregation ATPase FtsK/SpoIIIE and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0050"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26201"
FT                   /protein_id="CBH26201.1"
FT                   /translation="MNREALLIVSNGQQCHKHHLSPERVVTIGNTTQHEITYPEIAESI
FT                   EVKYGEDSWNAGATALKVNEAVNIEKLAFYLCQDLRTQVYDVVTNLSVAFGAGTENEVT
FT                   IDETKSDFLLLRDVKSDLFELQVLNGEIYHNFSLVTGICKLEPGDQLYTDGVTITIGKE
FT                   DISVLAAKERVTSKLAPLFAADNSFGEDYPDYHRSPRIIYRAPEEKISMAKPSSKPSKP
FT                   TDGLLKIILPPLVMVAITVVISIFQPRGLYIIMTIAMTAMTITMAIVNYIKSRKKYKED
FT                   SKQRLESYDLYLKRKTKELHETSEKQRHALTYHYPDVTELEKMALRVDSRIYEKTMFHH
FT                   DFLTFRVGCGDESSSFSVEFQQEEFTQEKDELIEEAVKIKGQYLSINQVPVATDLMHGP
FT                   VGYIGPRRLVLEQLQMLVMQTTLFHSYYDLQFITIFPEEEKADWDWMRWLPHANMRDVN
FT                   VRGFVYHERSRDQVLNSLYQILKERKQALTEQSSKQEQLYFSPHYVVLITDEKLVLDHT
FT                   VMEFFNEDPSELGVSLVFVQDVMESLPEHVKTVVDIRDAKSGNIILEQGDLVNRAFVPD
FT                   HLPADFDKEVISRALAPLNHLQNLKNSIPEAVTFLEMYGVERVEELNIAGRWAKNETYK
FT                   SLAVPLGLRGKDDIVQLNLHEKAHGPHGLVAGTTGSGKSEIIQSYIISLGVNFHPYEVA
FT                   FLLIDYKGGGMANLFKNMPHLLGTITNLDGAQSMRALASIKAELQKRQRLFGEHDVNHI
FT                   NQYQKLFKQGKATEPMPHLFLISDEFAELKSEQPEFMKELVSTARIGRSLGIHLILATQ
FT                   KPSGVVDDQIWSNSKFKLALKVQNASDSNEILKTPDAAEITLPGRSYLQVGNNEIYELF
FT                   QSAWSGADYVPDKESTDNIDTTIYAINDLGQYDILTEDLSGLDKKDDLTKLPSELDAVI
FT                   DHIHAYTEAAGIEALPRPWLPPLPEQIFAEDLHPVNFEEAWKEPKKPLQATIGLLDQPE
FT                   LQEQVPLTLDLTKDGHVAVFSSPGYGKSTFLQTVTMDLARKHNPNHLQIYLLDFGTNGI
FT                   LPLAKLPHTVDFLDIDNEEKLRKFTKRMNELISDRKKLLSKNAVANLSQFEELTKEVLP
FT                   EILILIDNYDSIRETDFSFGFEATLTQIAREGNSVGIHLVISATRQNSMRQNLLANLKL
FT                   QLALYMIEGNEVKSIVGQTKLTITENAGRGLVKLEDPTLFQASFPTRSNGTMEHLEHLE
FT                   KEMLQMSEYGTYEITSKIPMLPDKISLEEFSNKKSVQNTLESHLFVIGLDDEEAESFAV
FT                   NKVNQLPLLVTGENNFDISNVIKQFIELESKDLLAKEIIVIDNMKYDFSKYQNDMYIYG
FT                   NNKTFMETIIQNSMAEYEERRQALTRLREKNRTRVEIEEHLANMPEILIFITNLSSLTD
FT                   SVEVKDLDVLEKMLVDSALYKIFFIIGADLGSLSGYDSISKTVKAMKNVLLFTDVKQQS
FT                   VINVVSKPGAIKPLKPFEAYYIDNKIYSKVKVSYVNEEE"
FT   gene            55406..56509
FT                   /locus_tag="lse_0051"
FT   CDS_pept        55406..56509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0051"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26202"
FT                   /protein_id="CBH26202.1"
FT                   /translation="MVFSLKARMEEQAGHLDKTFSFSISLPCGHSTNWLQKDGEVFEIG
FT                   RATSKIFGTYKKKVLEDKGIKVNLAVEMNATIFWGEASKKDLVSIIKVLADDSFENEKF
FT                   NQVKKRAINDLKHNYRNEEYKALFKSYELIFYSQQFNFQEFILSHRNLKIESLEFIQKN
FT                   IVTKENVYMFIDGEFEKEAIERILPRAIKNQSMIVFPTISKSFNFDYRVSLRGNLNDEH
FT                   LVVKFNSHISDSISREKEFLILTFWGQQYFGRNYSVYNHFSNKAICGIRKKGLPMDIEH
FT                   LMISENVFDEIKKIIISSFEKLANTNDGEFAILKGKLRMDSLDWNKLQQELEKINLQDV
FT                   LAYLDKEKRTIQYGQITFSGELNYYGR"
FT   gene            56499..56780
FT                   /locus_tag="lse_0052"
FT   CDS_pept        56499..56780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0052"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26203"
FT                   /protein_id="CBH26203.1"
FT                   /translation="MADKIIVHPAELQEEVDLFLATTGDVGDVSNEKLKSLKEKMILDT
FT                   IDTLQEVVDNFIKCIEAYVELSKKDAKEIEKLKEAWIEGDKELSKNFK"
FT   gene            56797..58065
FT                   /locus_tag="lse_0053"
FT   CDS_pept        56797..58065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0053"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26204"
FT                   /protein_id="CBH26204.1"
FT                   /translation="MPRLVIEEMKEIKDNISTYNDDLSDAVYEHYKNIVVLSETINIKG
FT                   AAADTMKKYMATVQSNIAEKIINVSAELLTAVGTVKEDFESFEGDKKGIVGDSTIKDIK
FT                   KQTEDYKKTFEDATDGDKKLLEEAAEFIATTKLNTETVIDTFGSSATKLQQYKDELDEH
FT                   DAASLNQLTDVKERVDSLAKQIEEVCNNYRDAKGIIPSKVDSLTKEPWYSNEMKGAFNN
FT                   MAEEDPFYYGAGDASLYEGQWVTGTNDAYAQAYARGVGATGSFKMDNDSIETSGEFSAA
FT                   SGNASAQYKALNVGVNATVLGGEGHFNLDDKGLDAGAEAHLASVDGSLTLGNADYNGFL
FT                   NGNASLGNADANIAFNQNEIGAGAHASWARAEAEAGGTIGGVEISGGLSVGAQVGGGFS
FT                   ISTTGIEIDGALIFGIELSIKFP"
FT   gene            58105..58521
FT                   /locus_tag="lse_0054"
FT   CDS_pept        58105..58521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0054"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26205"
FT                   /protein_id="CBH26205.1"
FT                   /translation="MEKENLINKKSKQQKQLSLKEAELVQLDDKISQLKKIKTKLVDLK
FT                   EEVKDIKKNVKSMVDDEHDYWKGDLKDNWEDKVKNDLIDDGVKAYIDKIDNNLDEVNIK
FT                   IMEFENKKYSTEGVIGSLKSGINWLGTQIENLFN"
FT   gene            58534..58971
FT                   /locus_tag="lse_0055"
FT   CDS_pept        58534..58971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0055"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26206"
FT                   /protein_id="CBH26206.1"
FT                   /translation="MMVKLVVQKKYQQKMTEDAKKELASVQTYFDTNPMELKKDTINCL
FT                   ILEGRTIEIREKMHVVLVLVNQCEFPVTAMKFQLKITCEKEANLQFAEATIYLDHNYLG
FT                   KLNKGEGIIFHIEIPINGKPRQAIYKNSDLKGELKQVQVGS"
FT   gene            59001..59456
FT                   /locus_tag="lse_0056"
FT   CDS_pept        59001..59456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0056"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0056"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26207"
FT                   /protein_id="CBH26207.1"
FT                   /translation="MSGNVKNRLGKHITGRLLWEASPFMALLVVGISVFIMLFCFSEQL
FT                   IEFSAEYPTISDIMLYIPMLLCLLFSWIINVKWLWKDRNEMKLLVKTPYDNKLVNLYTI
FT                   ASIFYVCVLFVPFALILRGSLRRIILDRIKPNTLSAFINEKYLKGWE"
FT   gene            59458..59904
FT                   /locus_tag="lse_0057"
FT   CDS_pept        59458..59904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0057"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26208"
FT                   /protein_id="CBH26208.1"
FT                   /translation="MTFLQEKYWLVLLLNLFVNAAIFYTGVLGVGTIYLFIMVLTVVFQ
FT                   VKATLKINNPKLAVHKSQNKLMYFVLSALVIIVVGTTVFVYPYINQWFSGLTGYAHFLY
FT                   TYRFFLIPVGTIIFILSVVVTILKINAVNKLYFKKVGNQEIESF"
FT   gene            59891..60301
FT                   /locus_tag="lse_0058"
FT   CDS_pept        59891..60301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0058"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0058"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26209"
FT                   /protein_id="CBH26209.1"
FT                   /translation="MNHFKTEKILTITGAILFMLMGLGILLIGSFTPVQFNINGDYYTA
FT                   TYWEVASISMGGFWLWTVFFGVPLMIGIMGLICWIFMKKQPKKGWGIVLIIMGVISFFS
FT                   LVGVLYLVAGIMFLNNKYWRESNQWNKNGMEK"
FT   gene            60312..60878
FT                   /locus_tag="lse_0059"
FT   CDS_pept        60312..60878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0059"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26210"
FT                   /protein_id="CBH26210.1"
FT                   /translation="MKKIIVMILLISVGLFACGNNTKTNDYNDVNKEAVEKEKTFFLQI
FT                   PEFYQDDADFVKSSETAYADLKAKGEIERVFGKSNLEVEAVLLNGHFFRKDQVIGVGLF
FT                   VANNSGKDIDSFTMDMELQIDGYPEAMILSKDVEFEHNMLGTMKPNSIVPLKVLLPCQN
FT                   FNPSKDEFPSNEMDMTVKNIKVNYH"
FT   gene            61064..63568
FT                   /locus_tag="lse_0060"
FT   CDS_pept        61064..63568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0060"
FT                   /product="FtsK/SpoIIIE family protein"
FT                   /function="DNA segregation ATPase FtsK/SpoIIIE and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0060"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26211"
FT                   /protein_id="CBH26211.1"
FT                   /translation="MQLNLHEKAHGPHGLVAGTTGSGKSEIIQSYIISLGVNFHPYEVA
FT                   FLLIDYKGGGMANLFKNMPHLLGTITNLDGAQSMRALASIKAELQKRQRLFGEHDVNHI
FT                   NQYQKLFKQGKATEPMPHLFLISDEFAELKSEQPEFMKELVSTARIGRSLGIHLILATQ
FT                   KPSGVVDDQIWSNSKFKLALKVQNASDSNEILKTPDAAEITLPGRSYLQVGNNEIYELF
FT                   QSAWSGADYVPDKESTDNIDTTIYAINDLGQYDILTEDLSGLDKKDDLTKLPSELDAVI
FT                   DHIHAYTEAAGIEALPRPWLPPLPEQIFAEDLHPVNFEEAWKEPKKPLQATIGLLDQPE
FT                   LQAQVPLTLDLTKDGHVAVFSSPGFGKSTFLQSLVMDLARQHNPEQLHVYLLDFGTNGL
FT                   LPLIDLPHVADTIMVDEVEKARKFAKIIIREIKARKKMLSEYRVANIEQYSKASQKNVA
FT                   NILVCLDNYDALREAGFGDEFDKTMIQMAREGAALGIYLVTSASKQSSIRMQVLSSIKT
FT                   QVALYLIDKSEVTSIVGRTDLILEELYGRGMVKVGSQAIFQASLPTRGDDIVDQIKNMT
FT                   KELALMKSKWNGELPESIPIMPEILHIEDFVNRKTTKESIENQILPLGLEYENIESIGL
FT                   DFKMKQNLLIVSDSNIKINLVQKSIVKSTKAVSSSYQLLILDKVSQPLKEIAGLADGYV
FT                   SEIEEHEKFDSMMEEEFKTRKDLVNRKMLKEIEGWIILITDLAEFIQHSSITIERMKEF
FT                   IENGPSLNIFFIVSGMQTSIEYGLNPIEKYVKTAIRTGLVAMKNADQGIFKGNYISNEQ
FT                   PLEKFETYFYIDSTRQKIRLPN"
FT   gene            63589..64014
FT                   /locus_tag="lse_0061"
FT   CDS_pept        63589..64014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0061"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26212"
FT                   /protein_id="CBH26212.1"
FT                   /translation="MSTLSDLTRDYNNVLNDITSLKSELNIISDKADRLRIAAAEMQYC
FT                   LEEITDIDASLVKIKIDGSIWEGKTKKDNESILEDTLKSGMKDYHSKVSDIYESYTNEI
FT                   SKLYQQHDDLSSSLRVKKAMKSHLKSEIKKEKESNDE"
FT   gene            64007..64306
FT                   /locus_tag="lse_0062"
FT   CDS_pept        64007..64306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0062"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26213"
FT                   /protein_id="CBH26213.1"
FT                   /translation="MSEIRVNKEILNQVVSKGQGILSNGSPTLSYDLKKTNIKPFSNGT
FT                   STTDNYTALAAEIFRLVRYSEQSLNIALSLVDKTAEAMEELDKVIGDGIASKGL"
FT   gene            64332..65714
FT                   /locus_tag="lse_0063"
FT   CDS_pept        64332..65714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0063"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26214"
FT                   /protein_id="CBH26214.1"
FT                   /translation="MGKKVYFDEVQNFSNVFNQVGNEEIMRLHSLLENINEIGTLESFQ
FT                   GKSAQTAKAYLNEVHGTVMILLVQAISRVRELVTDDIGRFQQDVDSATTTIIDEEYLKE
FT                   VKKKVEKNYTKFTEIHDSIDKTVSGVNDLVPNAVPSKIAIKDSKDDFVKNINLLDTHLE
FT                   NYDKRKRSGTNEVKKILKQVEAILLSEASYHDNGKGIISYNIGGIYEKDGVDKELINGN
FT                   VLDVLGTGSDLFAMSITSKDMAILAMNNGLTVQKKMIGGKNQYTIYGNKEQLKNLDVKM
FT                   NAAAASKSKVKIYDSSKMRGYSKYGNTIMEAYPVLRGMTGSSSEMLKGFAASIKDPFTG
FT                   GYSNLSGVGKLAKGLGVFGVAVSVMSNANEALGDGFQGYTDVRKITVDSTIDVGISGGL
FT                   VSGLGIAGAHFGPVGAIVGSVIGFAFDLGLSLRGDKDKLKTTVNEKMLQLENWYWVGGK
FT                   VS"
FT   gene            65738..66460
FT                   /locus_tag="lse_0064"
FT   CDS_pept        65738..66460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0064"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0064"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26215"
FT                   /protein_id="CBH26215.1"
FT                   /translation="MKIKLEQVYTLEFTMGLRYSPLQIRHSMPLIFLIFLFITWFQTGI
FT                   MESLPGDFATTKLNIGLIVISLLIYIALYPKKILIAFQNLQYLFAICFYQLTIFMAIKS
FT                   FYFLLFDTIKYEIKLNVDTIIIAYVTLIVIWILVFILSSFWFRKRLVRGDFKKNSELQK
FT                   KRSNLGLMLNKNVYILIIGFFIVTLLSRIIGGVMEEVVICLWFFVAFGLSFIGVILFPE
FT                   HLFTAYCKFKFKEFHIEE"
FT   gene            66472..66924
FT                   /locus_tag="lse_0065"
FT   CDS_pept        66472..66924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0065"
FT                   /product="hypothetical protein"
FT                   /function="ATP-dependent Lon protease bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0065"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26216"
FT                   /protein_id="CBH26216.1"
FT                   /translation="MKVEQAGFQFDHCLTYKRTDKIENWFLPFEDLEKIALMNDIYQTG
FT                   PIFFSMKEVDGERNYREFKYYLPINEKVEIETEQDLFGYESVKVDHALKVRDLDNANLQ
FT                   DIQESIVNYAEEQNFEIEHEIYCIFLDVYNDVIFDFYAPLRNEVNK"
FT   gene            66921..67370
FT                   /locus_tag="lse_0066"
FT   CDS_pept        66921..67370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0066"
FT                   /product="hypothetical protein"
FT                   /function="Dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0066"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26217"
FT                   /protein_id="CBH26217.1"
FT                   /translation="MIVENRELTLNNVIGKNYIVEPKDLFVFLETFRDDLKKVGLTIIG
FT                   RVVVAIESPLNAESYSIEILAEIDKSTIDKVEGAKFQSYYSVKNLIHTRAVGDLEKNLP
FT                   AVFGEITEYVEVNRRNICTPVFNVLKSVENSPYIEVYVGLDPYDE"
FT   gene            67424..68065
FT                   /gene="lytN"
FT                   /locus_tag="lse_0067"
FT   CDS_pept        67424..68065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lytN"
FT                   /locus_tag="lse_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0067"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26218"
FT                   /protein_id="CBH26218.1"
FT                   /translation="MKFLGEDDYFIKKDKDINIIEVREKTNGIVNQDIAFTLVEDGLKY
FT                   DILRKSRGSEAKIITLSNKATALFYLGTKVKVSRLSIRYPKPKISYISSKDNAREVLSD
FT                   FLEDGLYEIEKRKKDAICLFEENNIYVVGYCDLVTTALTSMSVGGVKGAVIGVAASVFA
FT                   DMLMDPTVEYIKKHKVEEKRADWEDDGIHKGWKKIQDLKLKYTIENYKAS"
FT   gene            68110..68445
FT                   /locus_tag="lse_0068"
FT   CDS_pept        68110..68445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0068"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26219"
FT                   /protein_id="CBH26219.1"
FT                   /translation="MYIKLKSKEGKVIETKVGSCWTCVFLSFLGPLLRGDVKFFILYAL
FT                   LDGIGLFIALYFNENIGVPLMVFVTLLFEANYNTWFIRGKLNNGWEAETEKDREILIEK
FT                   GVIKVEV"
FT   gene            68478..68918
FT                   /locus_tag="lse_0069"
FT   CDS_pept        68478..68918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0069"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26220"
FT                   /protein_id="CBH26220.1"
FT                   /translation="MNSNEVPEIVIEQNRTKTILSLVYVFPILLMGVLGTIQLKNSMLM
FT                   GVAGIIILVLLTPTYFRVLKQSFSDKPLLKVNQEGIAGWGKFFEWREIEKVALRRDWGA
FT                   VFLTVYVRNNGRMRKYNINAKNLNGSATELIKQIGVLKSKYK"
FT   gene            69010..69873
FT                   /locus_tag="lse_0070"
FT   CDS_pept        69010..69873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0070"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26221"
FT                   /protein_id="CBH26221.1"
FT                   /translation="MSYEYVDEEQKIILTEQNGNKIEYIHDDAFRNTEIIYEDGKIVRS
FT                   FNDQGDIDAEKKSSHKHDATKTVTKSQTTKTADNGTVTKQTITNDDTEEEEEVELSYYD
FT                   TIEDAVKGSNFAMDEEDEEEGASYFNKKVIKEKVLFLESETDALLFFIGNLLEGKDDDD
FT                   ALVVYKFKVKQEGNKEKYSTPTDATQIAARSEKWDYEHEGSKQEIQTSLNLNNAYQSFN
FT                   LYPETTQLQWGMSYDKNAPNLTVNGEHPTKVIPIELDGDECYFWYYEDLKYDSSKKAKI
FT                   SFKKTK"
FT   gene            70238..71254
FT                   /locus_tag="lse_0071"
FT   CDS_pept        70238..71254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0071"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26222"
FT                   /protein_id="CBH26222.1"
FT                   /translation="MRKLFFVLGCLFLLLVIWSQKDNGKDSYFELKEINDDFSQDEVYK
FT                   VDKKEAENTAKLIGNLYKTNDGNLDNMVDYANELIQDRAKLEQEKANLKYLIENQAFSD
FT                   KEQQRTQLTTFYYLLIQLQESKSNVSPVTDGENFQVNQIEVVENERFCTVLNISYQCMS
FT                   KTEFEKYYTKYVNPNNGTKKAEQKRYLDNTFTIKNFDEDIRASIQAEEYKEYQEHKKEN
FT                   RVSPYDKAVMGLTKKPVTPAYLEEKVKKDAKENTAEKFDMTSTIITNTTELFDTKSMTI
FT                   TPTQETQEILNRWEERAKVSKNVTFPKGENYIQLYESYMNQVENWTDADERYVFEGG"
FT   gene            71367..71765
FT                   /locus_tag="lse_0072"
FT   CDS_pept        71367..71765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0072"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26223"
FT                   /protein_id="CBH26223.1"
FT                   /translation="MKINVKRNTGAMGAASKVSLKLDKQKVKSLKHKEEVELEIQGDSG
FT                   EVSANQWFFGSKAVKVSAGEAVEIKTNPKSILSFVGVFFLLILSFFLNNLVVSVIALVG
FT                   VFGAILYFIQNYYVIKPISSSGKNSSTY"
FT   gene            72033..72815
FT                   /locus_tag="lse_0073"
FT   CDS_pept        72033..72815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0073"
FT                   /product="secreted protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0073"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26224"
FT                   /protein_id="CBH26224.1"
FT                   /translation="MKMTRTKRLWLILLILVMWALGLYFNSIDAEKKSSHKHDATKTVT
FT                   KSQTTKTVDNGTVTKQTITNDDTEEEEEVQRSYYDTIEDAVKSSNFPKEDEESSYTNKK
FT                   VIKEKVLFLENETDALLFFIGNLLERKDYRDALVVYKFKVKKEGNQTKYSTPTNATQIA
FT                   AKSEKKSFEYGGSKYEIQTSLNLNNAYQSFNLYPETTQLQWGLSYNKNAPNLTINGEHP
FT                   TKVIPIELDGDDCYFWYYEDLKYDSSKKVKISFKKTEA"
FT   gene            72831..73310
FT                   /locus_tag="lse_0074"
FT   CDS_pept        72831..73310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0074"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0074"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26225"
FT                   /protein_id="CBH26225.1"
FT                   /translation="MEINAEQVYTLNFTMRLRLDPLQNKKLLKLSVLVILFFNWAQRDF
FT                   LGELPGYFGSTKLNLILIAIAMLFYLILSPKKLTVRFQAAQYLLSICCLQWVIFTVAKF
FT                   FYVLFFYTLQQETYIYCLCCFFNTMAYIFCVFLSLFWEEINKRGFSGKLRDAKET"
FT   gene            73620..73967
FT                   /locus_tag="lse_0075"
FT   CDS_pept        73620..73967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0075"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26226"
FT                   /protein_id="CBH26226.1"
FT                   /translation="MQKITIDNNIQQTGPIFFLIKKPFKKKKYYEFKYYVPINQKEELA
FT                   SDLFGYESIKVERALKTRDTEDVDLQYMQKRMKKYTKEMRWKINQNEVFGFIINNSDEV
FT                   GFDFYVPLVKR"
FT   gene            74052..74840
FT                   /locus_tag="lse_0076"
FT   CDS_pept        74052..74840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0076"
FT                   /product="PEP phosphonomutase, putative"
FT                   /function="PEP phosphonomutase and related enzymes"
FT                   /EC_number="2.7.8.23"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0076"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26227"
FT                   /protein_id="CBH26227.1"
FT                   /translation="MELIMMEENYEKLKMMHQGNEALVLYNCWDVASARAIQAGGTKVM
FT                   ATSSYAIAGALGVEDGEYLTFDEMFEVISRIAKNVAVPLTVDIEGGYAGNSEELGQNIE
FT                   QLINIGVSGVNVEDQLIGATSPALCNTEEHCDKIKTIKQTATKLNTDIFVNARTDIFFQ
FT                   GQEETEALVNEAIERTKAYAKAGADSIFIPGLLSPRLIRGFVQKSPLPVNVMLMDGMIS
FT                   VKELQEIGVKRISYGPNSYFQANLAIQQAAENIFGGVEVV"
FT   gene            74837..75889
FT                   /gene="ada"
FT                   /locus_tag="lse_0077"
FT   CDS_pept        74837..75889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ada"
FT                   /locus_tag="lse_0077"
FT                   /product="Ada regulatory protein"
FT                   /function="Methylated DNA-protein cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0077"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26228"
FT                   /protein_id="CBH26228.1"
FT                   /translation="MITNARDIDKYYDMLVEKNSNYEGVFFVGVKTTGILCRPTCPAKK
FT                   PLKANCEFFSTAKEALLASYRPCKRCEPLSNPTKMSPAVKLLVDAIEKNPEKKWTDKDF
FT                   DGLSISANTARRQFQKQFGMTFIEYARSRRLGLAFKHIRNGDSIINAQIDSGYESGNGF
FT                   RDAFSKTMGDVPHKTNGITILYSAWLETKLGSMLAISDDDHLLLLEFVDRKGLEMEIKK
FT                   LRTRLKAAISPEKTDVIRQVEAELELYFDGELVNFKTPIRYIGSEFQQGVWDELRRIPM
FT                   GETISYKVLAEKLGKPTASRAVARANGANQLSLIVPCHRVINSNGELGGYGGGLARKEW
FT                   LIKHEKMVPK"
FT   gene            complement(75912..76553)
FT                   /locus_tag="lse_0078"
FT   CDS_pept        complement(75912..76553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0078"
FT                   /product="pentapeptide repeats domain protein"
FT                   /function="Uncharacterized low-complexity proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0078"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26229"
FT                   /protein_id="CBH26229.1"
FT                   /translation="MMKKITAPRIPDEDLQIYPDDTYVIEDIGEISEQIFKKTTLTGEI
FT                   FEHFNLETVVFDGCVFDSVSLVSVNLTDVIFRNCDLSNLDLMGAVIHRVRFENCKLIGV
FT                   NFSDATLRNCVFDDCYADYVAFRYANLKWVSFDSGAYTNSDFSGAQLVDTYLERLDLNK
FT                   AQFLNCALSGIDISSCIFESITAMPQDLKGVSIDYSHAPALMPLFGIRVK"
FT   gene            76680..77621
FT                   /locus_tag="lse_0079"
FT   CDS_pept        76680..77621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0079"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   family protein"
FT                   /function="Lactate dehydrogenase and related
FT                   dehydrogenases"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0079"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26230"
FT                   /protein_id="CBH26230.1"
FT                   /translation="MTASVLVTGKLLPETMKALEKWQVETIIGEELTEENLIKKAAKVD
FT                   AIICPLSTQITAKVLESAENLKIVANIGAGFDNIDVKKAKELGIAVTNTPDVSTEATAE
FT                   LTLGLILAVARRITEGDRLCRETPKEFKGWAPTFFLGTELTGKTLGIIGLGRIGQAVAK
FT                   RAVAFGMKIIYSGHNQKDWDAEFVSQEELLKRSDVVTIHAAYNPDLKHLINEETLRMMK
FT                   PSAFLINAARGPVVEEAALVKALKNEEIAGAALDVFEFEPKIGEELRGLDNVVLTPHIG
FT                   NATIETRSEMGRMAISNVEAVLAGKAPIHSVY"
FT   gene            77705..77777
FT                   /locus_tag="lse_t001"
FT   tRNA            77705..77777
FT                   /locus_tag="lse_t001"
FT                   /product="tRNA-Lys"
FT                   /anticodon="(pos:77738..77740,aa:Lys)"
FT   gene            77962..78246
FT                   /locus_tag="lse_0080"
FT   CDS_pept        77962..78246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0080"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26231"
FT                   /protein_id="CBH26231.1"
FT                   /translation="MSEIKVLESDLKKYATKLGEKATAVEYLPMKDGNMAYSRANSINH
FT                   FRTAMFDLVEAVDAFQGVVETDAVRLKELGLSFTNKDRELERTMGLEVK"
FT   gene            78247..78615
FT                   /locus_tag="lse_0081"
FT   CDS_pept        78247..78615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0081"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0081"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26232"
FT                   /protein_id="CBH26232.1"
FT                   /translation="MDANSCELEQQLHTLKKQQRATEDTLLLLKREQNEQEWLEEDFAR
FT                   HCQLEMETMASLRELWQGDEARNFAYYLEDIHEEEKKNWRQNILSKREKQQEKINSCQK
FT                   NLYQIEREQQSIQKELTR"
FT   gene            78612..79886
FT                   /locus_tag="lse_0082"
FT   CDS_pept        78612..79886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0082"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0082"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26233"
FT                   /protein_id="CBH26233.1"
FT                   /translation="MSRIDIGEVQTFLTQLRTSNENGEKAIQSIQKVVMQYAEDDSLKG
FT                   KAIDASKRYYQATYISLCDAMKEAMSESEDRLSQYIQDFHAQVDSSANAKIDAAGLYEL
FT                   ELKIDKIERNKEDLAQRMNSGTEGQMQNYRSKLSAAYKKENILEKYLSFEQSHGSFFEN
FT                   LTVLVQSIQQTVRELQNNIQFNSQTGTYDMSKLNLSSISRMQQALNKAKDNKATINFDD
FT                   YQKTYQGHTWILMKDGKVDAEATNAYNEAILNGTLPKETNAATQEAELLKGILASLKNK
FT                   KDPITGADISSVHVLSILSGLAFSYRAGRYRGKKLRIPNPDKRKRKKTSGGKLDFNNNK
FT                   FSGINEMTKDDILNDLPVGWKYTENNGFIHVRDSNGNVRMKFDPPDNVTNFDHIHLFDN
FT                   NGNPIDINGNVVNRKSSDAHIPYKK"
FT   gene            79899..80297
FT                   /locus_tag="lse_0083"
FT   CDS_pept        79899..80297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0083"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26234"
FT                   /protein_id="CBH26234.1"
FT                   /translation="MGKIKIIQKVIEDTDYWDARVFDCKTLYFGDEVHVIFEGEGTQIY
FT                   TIKFINCYKVTYKNSFAPDTRMKVRNMSKGQLGYFMQDISMEKYEDDEEFIECSLNLSI
FT                   MTMNVVCKDILVEKLDKKNSSFFWEDEQ"
FT   gene            complement(80549..80674)
FT                   /locus_tag="lse_0084"
FT   CDS_pept        complement(80549..80674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0084"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26235"
FT                   /protein_id="CBH26235.1"
FT                   /translation="MEHALNLHNKALSFFELIEDENMYNDLKSDWVKCKEQFDIK"
FT   gene            80957..81400
FT                   /locus_tag="lse_0085"
FT   CDS_pept        80957..81400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0085"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0085"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26236"
FT                   /protein_id="CBH26236.1"
FT                   /translation="MSRIDIGEVHAFLYQLKSVNETGKKEIQAIKTVVTDYVDEASLKG
FT                   KAIDASKRYYQATYFPLCDALIEAMNESEERLSQYIRDFQEEVDSSLDTKIDADGLYEL
FT                   GKMIDRIEGKKEALAQQMNSGSEGTMQNYRSELATGLQKRGYA"
FT   gene            81529..81966
FT                   /locus_tag="lse_0086"
FT   CDS_pept        81529..81966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0086"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0086"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26237"
FT                   /protein_id="CBH26237.1"
FT                   /translation="MTRHPIARTNAATQEAELLKGILASLKNKKDPITGADISSVHVLS
FT                   ILSGLAFSYRAGRYRGKKLRIPNPDKRKRKKKKETSGTDFEDIIKKGEKMPDHEVVEKG
FT                   SLPKAGKPNSSADILNADGTHEFPHRHKWDWTNPEKPKRLK"
FT   gene            81980..82366
FT                   /locus_tag="lse_0087"
FT   CDS_pept        81980..82366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0087"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26238"
FT                   /protein_id="CBH26238.1"
FT                   /translation="MEWGKIETQADIDKLMQLINNFHDSCISGLTYSSGTYVDEEYSMI
FT                   MNTEPVVNLLIQRQSEFMTNIELCLSGVSKFHINNDLGLTLDILGAHFIKQEEDFYWYS
FT                   SEDIEDDTVTRFVCKEIKWRSISS"
FT   gene            82886..83143
FT                   /locus_tag="lse_0088"
FT   CDS_pept        82886..83143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0088"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26239"
FT                   /protein_id="CBH26239.1"
FT                   /translation="MLRENVLIGMLITFIVMCVSASQETNTQAVSIPHPMTIDQIFPDS
FT                   GLEKAVKQSLGKKSVKNIVSQKELGKVQEFYDNNYNVSLI"
FT   gene            83186..83614
FT                   /locus_tag="lse_0089"
FT   CDS_pept        83186..83614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0089"
FT                   /product="LRR protein"
FT                   /function="Leucine-rich repeat (LRR) protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0089"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26240"
FT                   /protein_id="CBH26240.1"
FT                   /translation="MSQLEILILDQNKLKNIDALTNLTHLAYLYLNKNELRDISILEKL
FT                   GNLEDVGLADQKCSNNPIEYQQKLVVPNTIKGIDKMPITPNFISDNWRCLKNHVIWDLP
FT                   IYVKEVSYKFGETIKNGEAAVRYMHTTVVSQNKLNRVK"
FT   gene            83836..85191
FT                   /locus_tag="lse_0090"
FT   CDS_pept        83836..85191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0090"
FT                   /product="internalin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0090"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26241"
FT                   /protein_id="CBH26241.1"
FT                   /translation="MRENKWLKNLLVTVIIIVGSLYISLSTGIKVQAEGITSPTPINQL
FT                   FPDPALAELMKDALGKMSVTEEVTQRELDTVKRVNGTQLGIKTIEGIQFLNELIALILT
FT                   RNEIMDIKPLANLKKLEKLSLAVNRVIDVRSLAELKNLKTLYLFGQVYRNTPLEFQEHI
FT                   TIPNTVRKLSGRLIKPYFISGNGVYMKPNLVWDLSGYLNEVSYSFNYLVKIGEAEANFS
FT                   GKVIQPLGDYDVIEYNKAHRAIGRIKPGSKHDIWSHPYKTQGSKIVGNICNFIGEDLRI
FT                   IREVKTTSDTFYQFSVAGDKIGWVEASALTVLYRGPKGELSENKEAENVCGKTRISNLV
FT                   NTRRIQFEQILKNGFPDGKKLNQHAFNSLFKSGRKSITFKEILGALINTPNPAKEGSVE
FT                   YINTITGTSVFVNPDKNEVVGIWPACFKKKYGGKSTIRVKAKLHETITSENS"
FT   gene            85814..86779
FT                   /gene="manL"
FT                   /locus_tag="lse_0091"
FT   CDS_pept        85814..86779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manL"
FT                   /locus_tag="lse_0091"
FT                   /product="PTS system, mannose-specific, IIAB component"
FT                   /function="Phosphotransferase system,
FT                   mannose/fructose-specific component IIA"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0091"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26242"
FT                   /protein_id="CBH26242.1"
FT                   /translation="MVGIILATHGEFAEGILQSGTMIFGEQENVKAITLMPSEGPEDIK
FT                   AKMEAAIASFDSQDEVLFLVDLWGGTPFNQANGLYELHKDKWAIVAGLNLPMLIEAFSS
FT                   RFTMESAHEIAANILAPAKEGVRVKPEELQPQEAVAAHPEAEITTVGDGKIEFVLARVD
FT                   SRLLHGQVATAWTKATHPTRIIVVSDAVAKDELRKKLIEQAAPPGVKANVIPVSKMIEI
FT                   AKDPRFGNTKALLLFENPQDVLRAIDGGVEITQVNVGSMAHSVGKVVVSKVLSMGQDDV
FT                   KAFEELKAKGVKFDVRKVPNDSSANMEEILKKAKHELKTQ"
FT   gene            86803..87609
FT                   /locus_tag="lse_0092"
FT   CDS_pept        86803..87609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0092"
FT                   /product="PTS system, mannose/fructose/sorbose family, IIC
FT                   component"
FT                   /function="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIC"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0092"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26243"
FT                   /protein_id="CBH26243.1"
FT                   /translation="MSVISIILVVLIAFLAGIEGILDEFQFHQPLIACTLIGLVTGNLT
FT                   ACIILGGTLQMIALGWANIGAAVAPDAALASVASAIILVLGGQGVAGIPSAIAIAIPLA
FT                   VAGLFLTMIVRTLAVPIVHLMDRAAEKGNIRSVEWLHISAICMQGIRIAIPAAALLFIP
FT                   ADSVQNFLEAMPAWLTDGMAIGGGMVVAVGYALVINMMATKEVWPFFVIGFVVAAISQL
FT                   TLIAIGALGVALALIYLNLSKMGGGNSNGGGGGNSRDPLGDILNDY"
FT   gene            87631..88542
FT                   /locus_tag="lse_0093"
FT   CDS_pept        87631..88542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0093"
FT                   /product="PTS system, mannose/fructose/sorbose family, IID
FT                   component"
FT                   /function="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IID"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0093"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26244"
FT                   /protein_id="CBH26244.1"
FT                   /translation="MAEKIELTKRDRLRVAWRSTFIQGSWNYERMQNGGWAFSMIPAIK
FT                   KLYKSKEDRSAALKRHLEFFNTHPYIASPILGVTLALEEERANGAEVDDVAIQGVKVGM
FT                   MGPLAGVGDPVFWFTIRPMLGALGASLALSGNILGPILFFVAWNVIRWGFMWYTQEFGY
FT                   KAGSKITDDLSGGLLQDITKGASILGMFVLAALVQRWVNIQFAPIISKVKLDEGAYIDW
FT                   SHLPQGAQGIKTALEQQQAGLALSEIKVTTLQNNLDNLIPGLAAVALTFLCMWLLKKKI
FT                   SPIIIILGLFVVGIVGHLIGLL"
FT   gene            88669..89061
FT                   /locus_tag="lse_0094"
FT   CDS_pept        88669..89061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0094"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0094"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26245"
FT                   /protein_id="CBH26245.1"
FT                   /translation="MVQSINTKVDLTIDATAYTGLTDYGKIMIGDKGFEFFNSRDVRKF
FT                   VQIPWEEVDQVIVSVMLKGKWIPRYAIKTKRNGTYTFASKKPKDVLRAIRVYVDPANMV
FT                   SSLSFFDVMKRSFKSIFSKKKNKQAK"
FT   gene            89183..89533
FT                   /locus_tag="lse_0095"
FT   CDS_pept        89183..89533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0095"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0095"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26246"
FT                   /protein_id="CBH26246.1"
FT                   /translation="MKQPKIYSMSFASVYPLYIKKAEKKERTKAEVDEIIFWLTGYDED
FT                   SLQQVIDQKVDFETFFAEAPEMNPNVTLITGMICGYRVEDIEEKLMQQIRYLDKLIDEL
FT                   AKGKKMEKILRK"
FT   gene            complement(89596..89904)
FT                   /locus_tag="lse_0096"
FT   CDS_pept        complement(89596..89904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0096"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /function="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0096"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26247"
FT                   /protein_id="CBH26247.1"
FT                   /translation="MKTKNELSKPELLLIFQALSDPIRLDIFLCLLKNKEKRFSGTTYN
FT                   VSKSTLSHHIKLLKEAKLINLRKEGTTHIYSVNEEIVDQIGSFFANNCRSSIPTDTL"
FT   gene            90017..90307
FT                   /locus_tag="lse_0097"
FT   CDS_pept        90017..90307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0097"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0097"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26248"
FT                   /protein_id="CBH26248.1"
FT                   /translation="MLHIEAQITIKKEQTETFLQAANEVIAATRAEVGNHGYELVQSTE
FT                   NETVYYILEKWEDMDAITKHNESDHFKNFQKLAANFVAKPLEVTVLTTITR"
FT   gene            90320..90952
FT                   /locus_tag="lse_0098"
FT   CDS_pept        90320..90952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0098"
FT                   /product="nitroreductase family protein"
FT                   /function="Nitroreductase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0098"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26249"
FT                   /protein_id="CBH26249.1"
FT                   /translation="MTYLNNDFEDLMKNRRSIREYDETVKISQEEMQAILTDAVTAPSS
FT                   VNMQPWRFVVVESDAGKEKLKPLIRFNTLQNDTSAAMILIFGDLQNFENGEKIYGGAVE
FT                   RGLMPADIKEQQMAKLSQYFKTIPRSELERVVLIDGGIVAMQLMLVARAYGYDTNPIGG
FT                   FERTEVAKAFGMDPERYEPVMIVSIGKAKTDGYDSYRLPIGDVTTFA"
FT   gene            complement(91055..91843)
FT                   /locus_tag="lse_0099"
FT   CDS_pept        complement(91055..91843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0099"
FT                   /product="transcriptional regulator"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0099"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26250"
FT                   /protein_id="CBH26250.1"
FT                   /translation="MKLEEVVNTYYDKLNYNDLHIWQYIRDNKEKCSSMSINELALECN
FT                   VSRTTILRFAKKISFDGYSELKVHIKLDLEKGTKMENNSVELIAEGYVRTIEEISKKDF
FT                   GPICHLIYQAKRVFIFGSGDYQMAVARQLKRLFLHSGDCFYDFDAITLNKEFFNIVEAD
FT                   DLVILISLDGESKNIVSIAKNLKLMNVSVISISKLKNSTLATLSKENIYIKNTSIHFDN
FT                   KSTQSFESTASLYLVAELLFVKYSLFKNKLAFIESDQSII"
FT   gene            92082..93677
FT                   /gene="malP"
FT                   /locus_tag="lse_0100"
FT   CDS_pept        92082..93677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malP"
FT                   /locus_tag="lse_0100"
FT                   /product="PTS maltose-specific enzyme IICB component"
FT                   /function="Phosphotransferase system IIC components
FT                   glucose/maltose/N-acetylglucosamine-specific"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0100"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26251"
FT                   /protein_id="CBH26251.1"
FT                   /translation="MMKKVQRFGGAMLTPVLLFSFAGVVVGFAILFMNEDIMGDLASPD
FT                   SLWYQIWNVIAEGAWTVFRQMPLLFVIGLPIGLAKKESGRACLEALVTYITFNYFLSAI
FT                   LMTWGSFFGVDMAQEAGGTSGLAMIASIKTIDTGMFGALIISGIVVYLHNRYFDTELPE
FT                   VLGVFRGTSFVVILGFIVMLPIAFLFAFIWPHFQSFMLGLQGFFISSGNIGVWIYSFLQ
FT                   EILIPTGLHHFIYAPFAYDNAVVPGGMAAYWATHLGDFQTTAHSLKEMYPAGGFALSGM
FT                   SKVFGSIGIVFAFYKTARPEKRKAVLGLMIPVAATAVFAGITEPLEFTFLFVAPVLFIV
FT                   HAVLAATVSTVAYAFGVVGDFGGGLINWFAVNWLPLWKYHWPTYVTQIIIGLAFAFLWY
FT                   IIFVFIIKKMDLKTPGREPEDSEVKFYTKADYKEKKEDGVKGKKKENQNQKKAVLFLEA
FT                   LGGSENITDVTNCATRLRLTLKDPELMGPDAQFLQAGAHGVVRNGQAIQIIVGLSVPSV
FT                   RSEFENLLNEKDEE"
FT   gene            93674..95002
FT                   /gene="malH"
FT                   /locus_tag="lse_0101"
FT   CDS_pept        93674..95002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malH"
FT                   /locus_tag="lse_0101"
FT                   /product="maltose-6'-phosphate glucosidase"
FT                   /function="Alpha-galactosidases/6-phospho-beta-glucosidases
FT                   family 4 of glycosyl hydrolases"
FT                   /EC_number="3.2.1.122"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0101"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26252"
FT                   /protein_id="CBH26252.1"
FT                   /translation="MMKKSSILIAGGGSTYTAGIVVMLLEAKETFPVRQIKFYDNDKER
FT                   QKKVAEACEIIIRERAPEVAFSYTTDPEEAFTDVDFVMAQLRVGKYALREQDEKIPFKH
FT                   GVVGQETCGPGGIAYGLRSIGPIIELIDYMERYSPDAWLLNYSNPAAIVAEGTRRLRPD
FT                   SKVINICDMPICLEDIMARAIGLKNRKEMEVRYFGLNHFGWWTSIQDHAGNDLMPKIKA
FT                   HVAKQGYTENTPAGQHKEESWLEAMRAGKELLEIEPAFLSNTYLKYYLMADETVEHANK
FT                   SYTRANEIIDGREKEVFSECERVVQQNSAKDTTFHSNEHASFIVDLARALTFNTKERML
FT                   LITENNGSIENFASDAMVEVPCIVGKNGFEPLTMGKIPTFQKGMMEQQVASEKLAVEGW
FT                   MEGSYQKVWQSITLNKTVPSAKVAKEILDDLIEVNKPYWPELK"
FT   gene            95066..95575
FT                   /locus_tag="lse_0102"
FT   CDS_pept        95066..95575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0102"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0102"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26253"
FT                   /protein_id="CBH26253.1"
FT                   /translation="MRSVFLTLFDSIRRALISARILLFTEIIFFVAPILFFVYLVLISW
FT                   QTHLDMLEPIKQSPVYALYFIMFLSFFFCGFVTRFIRKESRINKENSLLKFELLLLTGS
FT                   QLLVLNLFCAALLVWYIQREYGQSIFKIKLKNQSINFKNWAFIIACYIFLVAILVFILR
FT                   LVLKTQ"
FT   gene            95591..96082
FT                   /locus_tag="lse_0103"
FT   CDS_pept        95591..96082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0103"
FT                   /product="PTS system, glucose-specific IIA component,
FT                   putative"
FT                   /function="Phosphotransferase system IIA components"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0103"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26254"
FT                   /protein_id="CBH26254.1"
FT                   /translation="MFQKFKKKKKNVLSLLAPINGTCISLSEVPDEVFSSKMMGDGVAI
FT                   KPTSNKLFAPTDGKVTFIAETKHAIGFVTTDGQELLIHVGLDTVSLNGEGFSLSVEVNQ
FT                   EVRAGEQLLSFNQTFIEDNQLNLITPIILLENKNLNLEQLTIGTDVIAGETIIINCTQN
FT                   "
FT   gene            96098..97279
FT                   /gene="lacY"
FT                   /locus_tag="lse_0104"
FT   CDS_pept        96098..97279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacY"
FT                   /locus_tag="lse_0104"
FT                   /product="proton/sugar symporter LacY"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0104"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26255"
FT                   /protein_id="CBH26255.1"
FT                   /translation="MEDTKKRRSFTLLYLCMYMAFSFSMTQFTPFLSKIGYDEMERGIL
FT                   LSSYAITTILLQIAIGFFADKFQTIKKFMFLFIVLFLAATCVFYLTDTPLIGIHLTLIA
FT                   LSGGLINTCTGLTDTWVLKSSYSVQMNFPYIKAFGSIGWAIGSVLLSFLLSRNGYISLS
FT                   IGIFILSLLTLFFIIRLSDIEKGPLMNQKKLQVADFKELVLDKNYDLLILILFLLYSVI
FT                   VANNITVIDKMLTLGASDIQIGYKWSVQSLFEIPAYFFGQKIMKRFSNYTLLRITAITL
FT                   TAQFILFTLADNVWAIILISCLQFLTTPILMIASKQLILQNFTARMQSTAQLFALSIFT
FT                   GVSSLVIPVIAGTLTKYTSVDITLLLLSILPVIAFLLLRVYEKHQRAVKLQTC"
FT   gene            97400..97783
FT                   /locus_tag="lse_0105"
FT   CDS_pept        97400..97783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0105"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0105"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26256"
FT                   /protein_id="CBH26256.1"
FT                   /translation="MTIKITRNARAIGGILPTKIKIENEGNVELKDGESYFFMPKNEKT
FT                   KIKVDQWFSGSQEVELDNNNEALIKVNATAVVLQYSIFPFLFVGLLMTSGVSTGIALVL
FT                   FIVSFFYSRKNWFKIVKVEKQKR"
FT   gene            98049..100334
FT                   /gene="chiB"
FT                   /locus_tag="lse_0106"
FT   CDS_pept        98049..100334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chiB"
FT                   /locus_tag="lse_0106"
FT                   /product="chitinase B"
FT                   /function="Chitinase"
FT                   /EC_number="3.2.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0106"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26257"
FT                   /protein_id="CBH26257.1"
FT                   /translation="MNKKTKKLFSIASVVLLVLSLVVVSIGVAQPKRVKAAENTPQYRN
FT                   VMYYGDWSIWGGEGNFYPKDIPAEQLTHLNFAFLDFNSNGDLVFTDKDAAVGAPVGQEG
FT                   VQWGGANAGILNAIQDLRAQNPNLKIGVSVGGWSKSGDFSTVAADPTKRANFVKNVMKF
FT                   VKYTNMDFVDLDWEYPASVRAADLVDNKNDEGTPNAKPADKQNFITLLQDLRTALDKQG
FT                   VDINKKYELSVALPAAKSTLENGIDVANLFKVVDFANVMTYDLNGAWTPNSAHHTALYG
FT                   NPKDPNYDSGFSVDQTIKYLKDKGAVSNKIVVGAAFYTRGWNKVAAGDDAALPGLFQTA
FT                   EKNNKDADGSLTYGANNENPIKTGDGGRAGGVYAYRSIDALKAKTPTLKEYWDDTAKAP
FT                   YLYSKETGEFYTYDNTRSIGYKAQYVKDNNLGGMISWMQSQDKATTSTKRDELTKAIKT
FT                   GLFGTSAIPQNTIKYADLNVVATVKPYSENGVGYEITITNNEKADETNEVLKSTELAFE
FT                   TVKLPKFYIPVKAGETLTAGDYKAGTVTTSGGNTVVDLASVYDAQQIPQGASYTFRLKS
FT                   SAATVDVNNISKIDLTQRMVKSSVEFSKQTIYGGGSVVPDPTDTEAPTVPKTVISSNVT
FT                   DKSATLTWTASTDNKAVAGYKIYRNGTEVGSVSGTTFTDSGLTAKTAYTYTVKAYDAAG
FT                   NFSAASTALTVTTLDAATPPATPAWDTAKTYNKGDRVSYKGKTYEAQWWTQGNEPGAEQ
FT                   WGPWLLIS"
FT   gene            100469..101368
FT                   /locus_tag="lse_0107"
FT   CDS_pept        100469..101368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0107"
FT                   /product="ROK family protein"
FT                   /function="Transcriptional regulator/sugar kinase"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0107"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26258"
FT                   /protein_id="CBH26258.1"
FT                   /translation="MYFVYDIGGTFIKFALMENNGNIKMKDKFPTTAKSAEELVAQMVE
FT                   KFLPYKQAVKGIAVSCPGVVDSEKGVIYQGGSLLFMHEKNLAEMLARECHVPVVLQNDA
FT                   KSAALAELWLGVAKDVHSAAILTLGSGVGGGIIMDGKLQSGYHLMAGEVSYMESDFDTE
FT                   KLRGEFFGRTGSAVELIKRIATKKNLTDKKDGEQVFALIAHGDEEANAIFNDYIYGLAV
FT                   QILNIQYLIDPEIIAIGGGISAQPIVVERLNEAVAQIKAANPFHAAKPNIVTCRFQNDA
FT                   NLYGALYNFFIQFADEVI"
FT   gene            101904..105308
FT                   /locus_tag="lse_0108"
FT   CDS_pept        101904..105308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0108"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0108"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26259"
FT                   /protein_id="CBH26259.1"
FT                   /translation="MKKSTLVITLMLLVSTIMPTTSFSNTEIAENPVKESTTIDATETL
FT                   QEENLAIDKSSSDDKQETTAPEVADINNTTAIKQTEKSNEEKSSPDSLDAKNSTTNSVS
FT                   ALQAASSDAGMTYRTGETLSSTQYLEDIHATVISGQTATADFSKVNTAVAGTYPVKIQY
FT                   KDSSNNVVQTLDREIKMVVPIKMNGYDSRGGGAWTLNYFWGRYYVYADTYHQKIKVLDA
FT                   ITELVSPSAPDAMIHTHFQNAAYYKLKLYQSNVKNVVLEGQNTVRASLPLLEDWSYNIG
FT                   DYYEIHCQESGKLADYAIATMENKPANADQQHMIGTSSEISGGGYLKFQMSEDGFIYVD
FT                   TIKPTLNVAHTNVSLDYNASVTEEEFLELAGVTYSDNMDTVNQSGDSVTVTTDFDQDTL
FT                   TNSVGNKTVNIKVTDDEGNFVEKSVTVTVSATDITADDGMTYRTGETLSSNQYLEDIHA
FT                   TEINGLTATADLSDVNVSRVGSYTVPIQYKDSEGAVAYELESQLSIVEPIYINGLAAAD
FT                   ADDSIRYYIYADAYHQEIKLKLGGAAYSPFNANMYSSQYVKFSLKDRDGAVKNSVTLNA
FT                   QQKANDPTLYSSVNNWEYELGDYYQIDHSEGDYRLVNEPDATIANKPFNPSESNMSSPS
FT                   FELNNSSNDAALTLEMIDSGFKYVDTKPPTATADNTLKLEYKQPMSEEAYYDAIHLTLA
FT                   DNMFDSFTMSADDFFTVESNYSSSITDNRSGTYPITIHVEDESGNRMRNGSTNTEITRT
FT                   NTITMQTTLPTADAVKPNKGYTLGTDISTINPDELVENLDSSVSFVNDVEVIGWDSAHT
FT                   PSSNTIGTKSANVLIEDDRGVQASIPVDIGINYDDSLYFAASGVNRGGVVLTLTDNNNL
FT                   PNLALTAGDNDGTTAFDSSDSNAEYLSTTFYHRSSTTGPITDDTQYGTVAVNKGDKLAD
FT                   YVTKYDTENIASELRYGDIIAVDYDYQDHVTRYDDSVAHDDATSGETIYYEVTKDGFEP
FT                   VTEPFGTVQFDQNDGPNEIAFETTRVGEGLKTIHRDEANYSFSVLDTRYQKGWKVYVGI
FT                   SEPLTSSTGDTLDGAIIWKSSNGTETTLTPGNAIEIGGLASTTDESKQKTTFSFGAEEG
FT                   PLLKYNTSAVSAGNYATTFDWSIVDAP"
FT   gene            105460..105765
FT                   /locus_tag="lse_0109"
FT   CDS_pept        105460..105765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0109"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26260"
FT                   /protein_id="CBH26260.1"
FT                   /translation="MCFLVMSPQVIFADTTHSDQGAVSEAGVTFKGYEKGSDTPTNKPK
FT                   DPPIPGGSDITVDSGDNEGNKGSLPRTGDTYSQLALGAGIGLVGLSIYRFKKAKKS"
FT   gene            105831..106553
FT                   /locus_tag="lse_0110"
FT   CDS_pept        105831..106553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0110"
FT                   /product="secreted protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0110"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26261"
FT                   /protein_id="CBH26261.1"
FT                   /translation="MKNKKVLALLTTFAVTALPVVTLLGTDVSAATTFNSNGLGATSDG
FT                   TIIFEPNTTPVNPVNPDDDDPYTPDDNPVNPDDTNPLKIAYVSTLDFGTQAISSENKVY
FT                   TANKVTLTNQLDNTTTKEINPAVTISDGRGTGAGWKLQVKQNSAFTNASSDTLEGAQLT
FT                   LEKSGIYTNQSNTSVPPTGAASVDVNTSNANVLTAAANTGQGVWQEEMVAKLAVAGNTA
FT                   KEGTYSTTLTWTLTDTPS"
FT   gene            106653..107711
FT                   /locus_tag="lse_0111"
FT   CDS_pept        106653..107711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0111"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0111"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26262"
FT                   /protein_id="CBH26262.1"
FT                   /translation="MRFKAKSCIIFGVLLMGLNWFPPIAQADSTINFGVQAEIPENQID
FT                   KKQTYFDLQMSAGKKETIYVDVSNPTNSKVTVEVEVNSATTNDNGIIDYSEGNKKPDKT
FT                   LKYDMKDIVKYDKEFQLAPKETKKVPIEIIMPETTYDGIILGGINFKQKETEVSATETE
FT                   EKDKSMVENRYSYIIGLKLTETTNEVTPDMKLKSIKPGQYNYANYVKVNLQNPTSTMIS
FT                   NLKIDGKVYKDGSKEVLHETKKEKLSMAPNSNFNYMIDWGNQAFKSGDYRLKMTATDGE
FT                   HTWKWDEQFTIDKKDAQKYNNRAVNLEKDYTWLYIVLGVIGLLLLLLLVFLLGRRSSKK
FT                   KEQGIKEKETKE"
FT   gene            complement(107761..109542)
FT                   /locus_tag="lse_0112"
FT   CDS_pept        complement(107761..109542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0112"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /function="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0112"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26263"
FT                   /protein_id="CBH26263.1"
FT                   /translation="MARNKFDVDEELETAFSSAHLKRILVYVKPYQKSIYLTLVVILLA
FT                   NIATMVGPYLTKIVIDDTIPNKDLTQLFWIAIIFIASVVITGLCMRYRIKSITLIGQDI
FT                   LKDMRTAIFGHLQKLPFSYFDSRPHGKILIRVVNYINMLSDLLSNGLINLISDILSVLV
FT                   TLGFMLMIDPTLTLYSLALIPVLFILVMVIKTAQRKAYQVLSNKQSNMNAYIHESIAGI
FT                   KVTQSFSREEENFEIFTEVSNEYRTSWMKAVKIQFLLWPGVQNIAVMTTCLIYFVGIKG
FT                   YGVDVSTGTLIAFIGYVGNFWNPVINIGNFYNSLITATTYLERIFETMDVEPDIKDLPN
FT                   AKKMPQIVGNVDFKNVYFRYEEGHDILKGINFHVDAGESIALVGPTGAGKTTIINLLSR
FT                   FYDINSGEILVDGENIQDVTLRSLREQMGVMLQDTFIFSGTIIENIRYGKLDATEAEII
FT                   AAAKVVRAHDFISGLKDGYYTEVKERGSTLSAGQRQLISFARALLADPKILILDEATSS
FT                   IDTQTEILLQEGLEKLLEGRTSFIIAHRLSTIKNSSRIFYIDNGKIQESGSHEELMAQH
FT                   GYYYNLYQSQFDMLQAL"
FT   gene            complement(109535..111277)
FT                   /locus_tag="lse_0113"
FT   CDS_pept        complement(109535..111277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0113"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /function="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0113"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26264"
FT                   /protein_id="CBH26264.1"
FT                   /translation="MKSMKWIWQYVRKYRLLMFGVFILIFIASGISIIYPLLGGKVIDD
FT                   VVYKNQPKLLIPLLLIMIISTIIRTICRYAYQIMCERIGQNSLFQIREDLYKKLQSLDF
FT                   DFFNNTRVGDIMARMTGDTDAIRHFVSWVSYNILENIFLFTFAIVIMTTIDWKLTLALV
FT                   IVTPLIAFLTMKMSSKAQPVFYEIRESFSRLNSMVEENISGNRVVKAFAREDFEMKKFH
FT                   EHNEDFKQRNLDSAAVSRTYLPVLDSLAGILVVITLVFGGYLVIKGQMTLGDLVAFNGF
FT                   LWMLNGPMRMSGWLINDVQRFVASSFKIQDMMATTAKIPIHAEKPAPSLQGYVEFKNVS
FT                   FHFEDDPNTDVLKNISLKAAPGQTIAILGETGAGKSTLVNLICRFYDPTSGEILLDGVD
FT                   AKKWHVRELRNHIATVMQDIFLFSDTIEGNIAFGAPDATMEDVRRMAQIADADHFIETM
FT                   PESYDTIVGERGVGLSGGQKQRISLARALLKNPSILILDDTTSAVDMETEVKIQGELKQ
FT                   ITENTTTFIIAHRISSVKEADEILILNHGEIIERGTHASLLAKKGYYFDIYNKQLGTEA
FT                   SANG"
FT   gene            111422..112255
FT                   /locus_tag="lse_0114"
FT   CDS_pept        111422..112255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0114"
FT                   /product="transcriptional regulator, AraC family"
FT                   /function="AraC-type DNA-binding domain-containing
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0114"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26265"
FT                   /protein_id="CBH26265.1"
FT                   /translation="MLKINTTTFNPQILYIASYYTNEARVGDNHHHDFLEISIICEGTS
FT                   IYDIEGERVKLSAGDVLVFNPGVNHYDITEPGMENVQLHIGFRNFALEGYTRNTFPFKK
FT                   AFLRKNETESAILDIAKQIIEEKDAEKPGYDLILKAFVMQLIIHILREATPEQLENNGV
FT                   KLSTDEQQKQLLVNEIIHYMEKHHTEDVSLSSLSQTMYISPAYISKVFKEETGVSPINY
FT                   LIKIRLTRAEELLKNKDITVKQAANMVGYNDAYYFSKLFKKYYGFPPSENWRKSS"
FT   gene            112291..113409
FT                   /locus_tag="lse_0115"
FT   CDS_pept        112291..113409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0115"
FT                   /product="lipase"
FT                   /function="Esterase/lipase"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0115"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26266"
FT                   /protein_id="CBH26266.1"
FT                   /translation="MHYEEALKFLKTNTTTQQDEGTEVIFKMAADTTPGNLDPFLLKDR
FT                   EKELEGTNAAIEGMPQEFTMPDFSKLEIATGAALQMRASMGSPNNDLSQGVTTGNYAVQ
FT                   GEYGDIPVRVYHHKSQNELAPALIFYHGGGFVGGTPDVVENFCKGITEKLPAVVINVDY
FT                   HLAPEFPAPAAPKDCFSVLNWVVENSAKLRVDANKIGVSGDSAGGTLAAAVSYMDREAK
FT                   TNYVGFQALLYPSLTLIDEDNDKYQWDITKFGAQEATLPLVAPGIIGMNSSGLLLRTAY
FT                   VRDENPASPIYSPLSAPDKSIYPPTLLVSAEFDALRPFAAVFAKQLIASGVKTKAIVYQ
FT                   GMCHAFIDKYGIFPQAEDAADEVVQMMKEIFE"
FT   gene            113515..114213
FT                   /locus_tag="lse_0116"
FT   CDS_pept        113515..114213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0116"
FT                   /product="EAL domain protein"
FT                   /function="FOG: EAL domain"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0116"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26267"
FT                   /protein_id="CBH26267.1"
FT                   /translation="MKFQLFIQPKLDVLQRNIVEYEILLRDDSVVPRFPLSELEAVLAD
FT                   EELYYVFSEWFSEAFLKVLHKYPNDRFAVNIAPQQLFYAETIHWLDRVRSESHRITVEI
FT                   TEDIFDVPANKQHLNANDKDAFILNKIKVIHALGYHIAMDDVSCGLNSLERVMSYLPYI
FT                   IEIKFSLIHFQNVDMEDLLYFIKAWANFSQKNNLDFVVEGIETKETMTLLESHGVSIFQ
FT                   GYLVNKPFPA"
FT   gene            complement(114183..114878)
FT                   /locus_tag="lse_0117"
FT   CDS_pept        complement(114183..114878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0117"
FT                   /product="conserved hypothetical protein"
FT                   /function="cAMP-binding proteins - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0117"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26268"
FT                   /protein_id="CBH26268.1"
FT                   /translation="MVYMNDMLDLLSTKYSNKISFSKGDVIHSYRIDSTKNIQIGFIVS
FT                   GATSVEGHTLDGRWLINGLVAESMLFGVEVLLETNTVPKLAEYRVRALTDGTALLINRE
FT                   FFLNYMYANPQFFHQILDNVLTKYFFTAKNYKNINQTPFYKATSVLVEIVELLNLHEQS
FT                   GEITLPSYITQSLLADYCRSGRARITEALETMRENGLLLSKKPIIISSYQELLSQSENF
FT                   QAGNGLLTK"
FT   gene            115109..115609
FT                   /locus_tag="lse_0118"
FT   CDS_pept        115109..115609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0118"
FT                   /product="RNA polymerase sigma subunit, putative"
FT                   /function="DNA-directed RNA polymerase specialized sigma
FT                   subunit sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0118"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26269"
FT                   /protein_id="CBH26269.1"
FT                   /translation="MLLSNEQIIQITKQMYVYLLRQGVRAEVAKDLAQDAIIKAWCYEK
FT                   EIPPEKQKAFIFKIVTNEFYQYYRKHQREVITDNFSHFTHADELAEDLLIQHEENAKIT
FT                   ITLKQLNKNYQKLLIMKYDIGMSYQEIADYLDTTPTNVKTYLSRARSAFKKIWGDFNEQ
FT                   RTK"
FT   gene            115590..116657
FT                   /locus_tag="lse_0119"
FT   CDS_pept        115590..116657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0119"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26270"
FT                   /protein_id="CBH26270.1"
FT                   /translation="MNREQNEELDDLFDIDRMEEEVKKVKRRSILKLILIILAIVLLIV
FT                   AIILAYLFYTDKKARNLAEEQVEFLTTANEFYKYPNTIVQTSTEVEDNARKINVSEIGF
FT                   KLLKDRFIPFTTTTTDIGSDGNGAAYPTIEINHMNKEKDGDTYRVGINNLTSGNRLAEF
FT                   YHPNKNYKTLKQDLDNLNEMPKNTYLEMAISFDKAYSSEEVKEMLPSNIQPTFFWLDGY
FT                   DLSKDIDYTTPTFNNELYGYNNPTTDLEKKFWTNKIKNEQDYIKQMKASNFYFYSNGSL
FT                   SENEVMDGQGKSVYETLKNKSDKGENLVIGISVVATKEDLEKIVDAKYIRASSVGVISN
FT                   EVDAENYYEQTEKIN"
FT   gene            complement(116691..117143)
FT                   /locus_tag="lse_0120"
FT   CDS_pept        complement(116691..117143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0120"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26271"
FT                   /protein_id="CBH26271.1"
FT                   /translation="MYEKLVAKYQDEVTIREEKMPHKLPGLYLNGIILINKNQSTIEKG
FT                   CVLAEELMHYKYTVGNITKQETIMDKKQELFARRKGYEEMVPLEDIITCFYLGLKEYFE
FT                   VADFLEVTEEFLRRTVTHYAEKYGSMYDCGDYLINFGSSIDVYKKF"
FT   gene            complement(117149..117484)
FT                   /locus_tag="lse_0121"
FT   CDS_pept        complement(117149..117484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0121"
FT                   /product="Lambda repressor-like, DNA-binding domain
FT                   protein"
FT                   /function="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0121"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26272"
FT                   /protein_id="CBH26272.1"
FT                   /translation="MELNKFVGNKIKQYREERGLNQEALAERLHTTRQTISRYENGDRK
FT                   ANQDILFELAKIFNKRLDDFFPERNLPPADERGMTIAAHIDDDVTDEELRDILAYIEMK
FT                   KKLHRGM"
FT   gene            117699..118130
FT                   /gene="lmaD"
FT                   /locus_tag="lse_0122"
FT   CDS_pept        117699..118130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lmaD"
FT                   /locus_tag="lse_0122"
FT                   /product="antigen D"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0122"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26273"
FT                   /protein_id="CBH26273.1"
FT                   /translation="MDRKLLKEKQIQLIFQLEQEENRFVRKRLIEELEYFEALGDKEKG
FT                   LLTVEQKLLILSPNEYLTYKKTFSDVQISKLIGVSRSSLAEWKRRKGLSKKQCPRIQEE
FT                   MIRILAYHLNKTAEEISRLPEETIECQYEAFVINEAHNY"
FT   gene            118220..118642
FT                   /locus_tag="lse_0123"
FT   CDS_pept        118220..118642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0123"
FT                   /product="holin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0123"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26274"
FT                   /protein_id="CBH26274.1"
FT                   /translation="MDALVEFGFSIISTFFGYLLAEVDLLVKVLLCFILADYISGLLAS
FT                   FYLGKPNTQLSFKEITPKIAILIIVAIAHQIDLILGMHNTMRDAVIFFYLTNELIDILE
FT                   NFVQMGMKVPDILKNFIALFDSKSGKEDEKSDEKKD"
FT   gene            complement(118750..121089)
FT                   /locus_tag="lse_0124"
FT   CDS_pept        complement(118750..121089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0124"
FT                   /product="5'-nucleotidase, putative"
FT                   /function="5'-nucleotidase/2',3'-cyclic phosphodiesterase
FT                   and related esterases"
FT                   /EC_number="3.1.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0124"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26275"
FT                   /protein_id="CBH26275.1"
FT                   /translation="MNKFFKKTTHVLLVAGLTIGLTVPFTGTTAQAAADTVPIQILGIN
FT                   DFHGALETASKDASGSPIGGADYLATNLDNATNSFLQANPDATADNAIRVQAGDMVGAS
FT                   PAVSGLLQDEPTMKVLQKMNFEVGTLGNHEFDEGLPEYKRILDGVSTNKFGPIVEAYPR
FT                   VKSDMKIVAANVVNKGTNTVAEGFSPYYVKEIDGVKVGFIGIVTTEIPNLVLANHIKDY
FT                   DFLDEAETIVKYSAELRNQGVNAIVVLSHVPALSNGNPNTGTKQDVAGEAANMMTKANE
FT                   LDPNNSVDLVLAGHNHQYTNGLVGKTRIVQSYNNGKAFSDVTGELDKTTGDFVSPPDAK
FT                   ITYNTRSVTPNADITAVTEDAKSRIEGVINETIGLANKEVISRETNPENKAIDDKESEL
FT                   GNMITDAQRYMANKAGADVDFAMTNNGGIRADLTTRLANGQNEITWGAAQAVQPFGNIL
FT                   QVVEMSGADITEALSQQYLSNQTYFLQISGLKYTFTDTDDLDHAYKIASVTTEDGTPLK
FT                   ADQKYKVVINDFLFGGGDGFSAFKKANLVTAIDPDTETFINYIKDQKAAGKVITAQKEG
FT                   RKVYKSQAEIDKETETAAIQAIKDATKINKLAEKDKTLTGTTLPSATVGVQKADSNAKL
FT                   ARAAGPSATADANGKFSVDISSLDLKKGDQITTTVTDTNGYSATFQTTVQAAATTPPDN
FT                   GNGNNGGTDNGNNGGSDNGNTNNGSGTTDGGTITTEKPATSKPNGTANGSKVITALPTT
FT                   GDTAGLATVFGLVLTTTALYVLRKKN"
FT   gene            121280..122026
FT                   /locus_tag="lse_0125"
FT   CDS_pept        121280..122026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0125"
FT                   /product="EAL domain protein"
FT                   /function="FOG: EAL domain"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0125"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26276"
FT                   /protein_id="CBH26276.1"
FT                   /translation="MDISSTEIWDAIRRKNYILYYQPKIDARTNEIIGFEALVRLQTTT
FT                   AILGPGEFFEDVVLLNATREMQDFVAEKAIDQINQLGGRFSISINVPADYLISSNYMLY
FT                   FYDYIKQHLKYPEHLEIEIIERTEITELEIANRNLRKLKDFGVKISMDDFGKGYSSMTY
FT                   LRSLPIDIIKTDMSFIALLKTDRRQRIIIQAIIDLCHDLGGKIVTEGVEDKEQVEMLRE
FT                   MRVDYFQGFYYSRPLPMEELKKQFSI"
FT   gene            complement(122100..123608)
FT                   /locus_tag="lse_0126"
FT   CDS_pept        complement(122100..123608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0126"
FT                   /product="inosine-5'-monophosphate dehydrogenase, putative"
FT                   /function="IMP dehydrogenase/GMP reductase"
FT                   /EC_number="1.1.1.205"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0126"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26277"
FT                   /protein_id="CBH26277.1"
FT                   /translation="MAFYFEEPSRTFSEFLLVPGYSSAECVPTNVSLKTPIVKFKKGEE
FT                   SAITMNIPLVSAIMQAVSDDNMGIALATEGGVSFIFGSQSIESEAAMVSRVKNHKAGFV
FT                   ISDSNISPDKTLQDILDLKEKTGHSTVAVTEDGTANGKLLGIVTSRDYRVTRMSPDEKV
FT                   ADFMTPFDKLVTANKATTLKEANNIIWDNKLNALPLVDDNEHLVHMVFRKDYDSNKENK
FT                   LELLDSSKRYVVGAGINTRDYEERVPALVEAGADILCIDSSEGYSEWQKRTLDYVRGKY
FT                   GDSVKVGAGNVVDRDGFRYLADAGADFVKVGVGGGSICITREQKGIGRGQATALIDVAK
FT                   ARDEYFEETGVYIPICSDGGIVYDYHMTLALAMGADFIMLGRYFSRFDESPTNKVNLNG
FT                   TYMKEYWGEGANRARNWQRYDLGGDKKLSFEEGVDSYVPYAGSLKDNVAISLSKVRSTM
FT                   CNCGALNIPELQQKAKITLVSSTSIVEGGAHDVVVKDASNNLIK"
FT   gene            123786..124019
FT                   /locus_tag="lse_0127"
FT   CDS_pept        123786..124019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0127"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0127"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26278"
FT                   /protein_id="CBH26278.1"
FT                   /translation="MSEEKLLERGYRKYRGAEIDVYFNTNVCAHAGNCVRGNNELFDLD
FT                   RKPWIMPDNVEKEEVKRVIHTCPSGALQYIEK"
FT   gene            124030..124308
FT                   /locus_tag="lse_0128"
FT   CDS_pept        124030..124308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0128"
FT                   /product="acetyltransferase, GNAT family"
FT                   /function="Predicted acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0128"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26279"
FT                   /protein_id="CBH26279.1"
FT                   /translation="MEYRNGENRIYAINDQGVEVGEVTFVPTGEDMFIIDHTGVDDAAR
FT                   GQGIAQELVKHAVEKAKAEGKKIIPLCPFAKAEFAKKPEYQVVQADK"
FT   gene            124640..126214
FT                   /locus_tag="lse_0129"
FT   CDS_pept        124640..126214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0129"
FT                   /product="oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /function="ABC-type dipeptide transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0129"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26280"
FT                   /protein_id="CBH26280.1"
FT                   /translation="MKKFLLVAVISVFALVLTACGGSGASSDKANGSGKAKDGGSIIIG
FT                   VAGDPEVINPNYAGDRVTLTIQQAVYAPLFWESDGKPALAKSLDISDDNLTYTVKLKDG
FT                   LTWHDGKPLTADDVVFTVDSILDTKQNSPNRGNFVFDDKPVKVEAVDDTTVKFTLPTVA
FT                   PAFENTIKTFFPIPKHVFDGVANIEKSDKNKNPIGSGPYKFVEYKAGEYVSLERFNDYF
FT                   DGKPKLDKVTFRITKDQNAANLALQNGEINLKSIQPSDRNKVEKASAVNIITYPENRLS
FT                   YAVFNENQPALKSKELRQALSYALNREDIIEAAYGSDEYAKPASSFLTENTKYFTDKVE
FT                   TYDQDIAKAKALVKESGFDTNQKLTVYYLNNSKSQESIALYLQQQYKEIGVSLDLKPTD
FT                   PNALSNITLDRKNADYSIALNGYIMGNDPDAYKSLFLSDAPYNYANYHNKDLDALWAKG
FT                   AVTADDKERQAVYEDIQNTLADDAVIYPISYDNAVLALDSRYGGQKAATPQPVTMFRDL
FT                   SKLYLTE"
FT   gene            126317..127267
FT                   /locus_tag="lse_0130"
FT   CDS_pept        126317..127267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0130"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /function="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0130"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26281"
FT                   /protein_id="CBH26281.1"
FT                   /translation="MLKTITKRVLQIIPMLFIISIISFALIKLAPGDPVNSFVTPDMNP
FT                   DDVERIRQSLGLDQPIYIQYFIWLGNLLQGNLGYSIINSQPVLQQILERIPATLGLVGT
FT                   SLILTLILSIPLGLVAANYENTWVDKVLNGISYIGISIPIFWFGMILIDVFSIRLGWLP
FT                   SLGMRTIGVDSFWDMAEHAILPVITLTFQGCAAYYRYVRSNTINQLKEEYVLFGYAKGL
FT                   SKVQVMGNHVLKNSLLPVITLLGMSLPQVITGAFITESIFSWPGMGSLGINAIFQLDYP
FT                   VIMAITLFSALLLIIGNLLADLAYMIIDPRIREMG"
FT   gene            127278..128171
FT                   /locus_tag="lse_0131"
FT   CDS_pept        127278..128171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0131"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /function="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0131"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26282"
FT                   /protein_id="CBH26282.1"
FT                   /translation="MRLDFSKKTMQEFERDAEVVHATRERTFWRYMLSDRRAIFATGVL
FT                   IFITIACIFAFLSPYDPNALSIQDKLMPPNTSHWFGTDDHGRDYLTRVLYGGRVSLLVG
FT                   VFAMMIAIVVGTLAGTVSGYFGGFIDNMVMRFLDIFMSIPSFFLLMILNAYLKPGISNI
FT                   IIIIGLLSWMEVARIVRAETLTLKEREFILYSKSAGGGFFHIMFKHIIPNAMPSIVVAA
FT                   SLNVATAILTESALSFLGLGVQQPNASWGSMLNNAQGYVGEATYLALFPGLLILMTILS
FT                   FNVLGDVLRKGLSRRY"
FT   gene            complement(128190..129848)
FT                   /locus_tag="lse_0132"
FT   CDS_pept        complement(128190..129848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0132"
FT                   /product="bacterial extracellular solute-binding protein,
FT                   family 5"
FT                   /function="ABC-type oligopeptide transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0132"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26283"
FT                   /protein_id="CBH26283.1"
FT                   /translation="MHYFKKSLPFIAILTLLLLTACGNDSNKSAEKTSPDKIKFLETSE
FT                   LLTLNTTAEEDFASFTAQNQVFEGLYTLDQKDNFVPGVADGMPKISADQTKYTIKLKKD
FT                   AKWSDGSQVTANDFVYAWRRAVDPKTAPGYSALFKDSIKNATEINEGKLPVTELGAVAT
FT                   DDTTLEITLKKPVPYFISLLSFETFFPQKESYVKEQGDKYGTDSDHTLYNGPFVMKDWG
FT                   GNITNKWTYAKNDNYWDKDNVKVKEIDVQVAKDINAGVNLYNTNEADRAPLSGDFAKQY
FT                   KDKKDFLTEKDALISYLRMNQKRDGKATPLANNALRHALNLSVDKKQLTDRILGDGSFP
FT                   ANGLLPKDFVQNPTTGADFRTDSGDHLVYNKEEALKYWKQAQKELGTNNVTIELLGDDQ
FT                   ETTKTIFAYLKAQFEDNLPGVTIKVKNMPSKSATQLTADGDYDLSLAAWMPDFKDPWTY
FT                   SSLFLSDYYNNHMSYNSPEYDKLVKSTDTTLATKPEERWNAFVASEKVLLDDDAAILPL
FT                   YQHQTAVLQRTDITGVQKHAFGSPYSYKFIQVKNQ"
FT   gene            130068..131018
FT                   /locus_tag="lse_0133"
FT   CDS_pept        130068..131018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0133"
FT                   /product="zinc ABC transporter, zinc-binding protein"
FT                   /function="ABC-type metal ion transport system, periplasmic
FT                   component/surface adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0133"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26284"
FT                   /protein_id="CBH26284.1"
FT                   /translation="MKKWSVLVVTVVAFVLILAGCGASDGEASGDKDKLKVVTTFYPMY
FT                   DFTKNVAGDKASVEMLIDAGTEPHDYEPSAKDIAKIEAADVFVYNSADMETWVPSMLKS
FT                   LDSKKLTVVDASKDITLAEGIEEGEEHDHEHEEEAEHHHEHDPHVWLSPVLAQKEVTNI
FT                   QQGLEKADKSNASTYKAGAEKYIEKLKALDSDYKKAFAGAKQRDFVTQHAAFQYLALEY
FT                   DLHQVAIAGLSPDQEPSPARLAELQKYIQDNHIKTIYFEEVASPKVAETLANETGANLE
FT                   VLSPIEGITAEEQEKGMDYISYMQQNLKALQKTIK"
FT   gene            131031..131735
FT                   /locus_tag="lse_0134"
FT   CDS_pept        131031..131735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0134"
FT                   /product="zinc ABC transporter, ATP-binding protein"
FT                   /function="ABC-type sugar transport systems, ATPase
FT                   components"
FT                   /EC_number="3.6.3.25"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0134"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26285"
FT                   /protein_id="CBH26285.1"
FT                   /translation="MSYINVNKVRFKYETEPVLENISFEVNAGEFIILTGENGAAKSTL
FT                   LRIILGILQPDKGSVSFAKKNIAGKKLLTGYVPQQIASFNAGFPSTVLELVRSGRFPNG
FT                   KWFKRLTERDHEHVEKALKSVEMWDFRYKRIGELSGGQKQRICLARMFAMDPDLLILDE
FT                   PQTAMDKNSKMRFYELLHHEAKVHNKAILMVTHDSEELEGYADKHIRLVRREDVSWKCF
FT                   SMDLCKEPSKRP"
FT   gene            131684..132490
FT                   /locus_tag="lse_0135"
FT   CDS_pept        131684..132490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0135"
FT                   /product="zinc ABC transporter, permease protein"
FT                   /function="ABC-type Mn2+/Zn2+ transport systems, permease
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0135"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26286"
FT                   /protein_id="CBH26286.1"
FT                   /translation="MEMFFYGFMQRAFQASMIIAVIAPLLGVFLIIRRQSLMADTLSHV
FT                   SLAGVAFGLVLNVNPSVTTLIVVVIAAMGIEYLRGVYVTYSELSIAILMAGGLAVALVL
FT                   MSLDQGGITTSVQQYLFGSIVTISKAQVQMLVILGVSIVILFLAFKRFMFVLTFSEDVA
FT                   LAEGVPVRLISLLFSVVTGVAIAFIMPIAGALLVSALIILPAAIGMRISKGFLMCVVSA
FT                   ILIGLLGMFSGLISSYQLGTPPGATITLMFILIFIVVTIVLKLVRR"
FT   gene            132642..134981
FT                   /locus_tag="lse_0136"
FT   CDS_pept        132642..134981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0136"
FT                   /product="conserved hypothetical protein"
FT                   /function="Rad3-related DNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0136"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26287"
FT                   /protein_id="CBH26287.1"
FT                   /translation="MKAVQISVRRLVEFVLRGGSIDSRMTSSDRALEGTKIHQLLQKSA
FT                   GEEYQAEVSLKLDRTVDGVVFLLDGRADGIINEQTIDEIKTTETVMEEITEDFRPLHWA
FT                   QLICYGFMLAEKSDLPEVTLQLTYYQVADEEIKQFRRIMSREEMGVFVDDLLSKYAVWA
FT                   KMSAAWEMKRNKTIQELSFPYNSYRRGQRELSIAVYRTAVSGENLFCEAPTGIGKTMST
FT                   LFPAVKAMGEGKTDKIFYFTAKTITRQVAEDALDEMRRKGLAARSVTITAKDKICFLDE
FT                   RKCEPDHCQFARGYYDRLNEALFDLLGQEEAITRTVVEQYARKYTLCPFELSLDVALFC
FT                   DAIVCDYNYLFDPVVYLKRFFSEGPGKYTFLVDEVHNLVDRARSMFSATLRKSLVMQVK
FT                   RQLDKKLHKRLWNAVNAMNKEMISLNKELIESGETIHVSKADLAEWNESVLKFTFVAKE
FT                   WLPQNTQSETQSDVLELYFESLRYVKIAELYDERYTTQITRTHSDLEIKQLCLDPAFLL
FT                   SEKLKLGASSVLFSATLRPIDYYTNVLGGEEDTSRMVFSSPFEQQNMHLLVADNISTKY
FT                   QMRDQSLASVVEALAALIAGKKGNYLFFFPSFQYLQNVYDLFREKYPEIVVRKQEGAMD
FT                   EEQREAFLEAFKAGNSETLVGFCVLGGVFSEGIDLRGERLIGAAIVGVGLAQLNPESDL
FT                   IKDYYNETIGQGFDYAYQLPGMNKVLQAVGRVIRGESDRGVVLLIDERFSASRYRTLFP
FT                   AHWNHAKIVKNTKEITEQVTEFWRNN"
FT   gene            135028..135840
FT                   /locus_tag="lse_0137"
FT   CDS_pept        135028..135840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0137"
FT                   /product="Cof-like hydrolase"
FT                   /function="Predicted hydrolases of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0137"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26288"
FT                   /protein_id="CBH26288.1"
FT                   /translation="MYKIIAIDIDGTLLNDAHKITPAVRDAIKAAKEKGAKVVLCTGRP
FT                   LAGIKQSLLELDLLDAGDYAITFNGAVVLETASEKTLADITLNKTELEEIYTFCHAEDV
FT                   NVTYFDGKKMYVPSRKITEITCQDSLLLQTPLYHLPVEEAPDSIHVSKVMLLDSPEKIT
FT                   NVIKKLPTTLKEKFYIVRSVPYNLEFLQKGVNKGSALESLANKLGIDQSEVISIGDQEN
FT                   DISMIEYAGMGVAMGNATEHIKEIANYTTTTNNEDGVANAIQFLVLDR"
FT   gene            136080..137156
FT                   /locus_tag="lse_0138"
FT   CDS_pept        136080..137156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0138"
FT                   /product="hypothetical protein"
FT                   /function="L-alanine-DL-glutamate epimerase and related
FT                   enzymes of enolase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0138"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26289"
FT                   /protein_id="CBH26289.1"
FT                   /translation="MKITKIKTHIVPIQLSSTFKTALREVSHVNVVRVYIHFDNGIVGI
FT                   GEAAPTHVITGDTEASITSAINDIFGPFLIGRELDEELTILDEMKSLLVHNSSPKAAID
FT                   IALHDALAKASSKPLYEFLGGGSPRLETDYTISIGTPEKMVRDAETKVAEGFKSLKVKL
FT                   GLDPVEIEVAKIRRMNEALGGKIPFRIDANQGWTPDVAIQILNEWSDIPIDFIEQPVKS
FT                   WDFAGMAKVTANTNIPIMADESLFGIHDAKRLLDEKCCNLLNIKLMKSAGIKEARAIHD
FT                   LASEYKVDCMIGTMIEGYASLSAAAHFAASAKQVKFYDLDVPFMWNLQGKNLADIGLEI
FT                   GRGEVLLTEEDGIGISAY"
FT   gene            137173..138051
FT                   /locus_tag="lse_0139"
FT   CDS_pept        137173..138051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0139"
FT                   /product="NLP/P60 family protein"
FT                   /function="Cell wall-associated hydrolases
FT                   (invasion-associated proteins)"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0139"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26290"
FT                   /protein_id="CBH26290.1"
FT                   /translation="MNKLVGRSNAFLWRKNEMNPVLANIIKARQTSDLIQVTKEDAMKL
FT                   YDDSLVDSDLLYNDLVIVDKIEGDWAKVIVPSQHSFLDKRGYPGWMLLEDLADTDKTTE
FT                   HDEKLAVVVPKTQITYENGATREVSFGTLFSKIAEEENSYKVETPHGQATISRAHVALQ
FT                   NEPRANIGVDVVQMALQFLDLPYVWAGISSAGFDCSGFAFTLYRTCGKYIGRDATEQSF
FT                   AGEKIAYADAEPGDLLFFAYEEGKGEVHHVGVYIGNDEMVHSQTPGSKVILTKITGSKY
FT                   EPELCVTSRHR"
FT   gene            138070..138849
FT                   /locus_tag="lse_0140"
FT   CDS_pept        138070..138849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0140"
FT                   /product="beta-lactamase family protein"
FT                   /function="Beta-lactamase class A"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0140"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26291"
FT                   /protein_id="CBH26291.1"
FT                   /translation="MNSYMKINDTYDMIHSKALYITDGKQVLFAENEDQLYTAASVIKL
FT                   PIYLYFFEKISKGELDLRTEVHISADKVVAGAGIIQILPEKRTWRLEELLHLMIAVSDN
FT                   TATNQLIDLATFSNLQAWIRAKGWEQSVQIERKMMDFKSDKQNEITAKLAVTVFQEIIE
FT                   LSKQYPNLTETIRRPFLNQQHRSNLTGTLEEAGIAGLSMLNKTGELKDIQHDVAIFEYE
FT                   GETRFVAALTNNTGLEANATAWMQNVGRQLFDEINRK"
FT   gene            138862..140511
FT                   /gene="oppA"
FT                   /locus_tag="lse_0141"
FT   CDS_pept        138862..140511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA"
FT                   /locus_tag="lse_0141"
FT                   /product="oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /function="ABC-type oligopeptide transport system
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0141"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26292"
FT                   /protein_id="CBH26292.1"
FT                   /translation="MKKRLALVCIMILSISTFLMACGGSDDEATKSQGKKTLKIMENAE
FT                   VSSMDSTLSQDVPSFTEQGQVFEGLYTLNDKDQAVPAVAKDMPSLSEDQKTYTIKLRTD
FT                   AKWSNGTKVTANDFIFAWKKLANPDTAAQYSFLLDGTVENGTDVITGKKSVDELGVKAL
FT                   DDYTIEIKLEQPVPYFTSLLAFNSFYPQNEEYVKKQGEKYGQSSENMIYNGPFTMKGWT
FT                   NTEKAWTLEKNPKYWDKKNVKSDKIEVSVVKAPNTAVNLYDTGKLDVATLSGDYASQKS
FT                   NDKDYHSELDAYVTHLKLNQAIDGKKTPLANENLRKALSLAVNKESLTKKILADGSKAI
FT                   YGYVPEKFVTNPETGEDFRKESGDYMKQDEAEAKNYFEKAKQELGGGEITVELLNSDLE
FT                   SSKKVGEYLQSQLETALPGLKINLKTVPKKNLLQLTREQNYEIVLSNWGPDFQDPLTFL
FT                   GNYTTGNTYNASGYSSTDYDNMIKATSTTLATEPEQRWETFIDAEKLLIETDAAMIPLY
FT                   QTAVCNLKKDTVKGIVHHNFGTSFSYKGAYVE"
FT   gene            140526..141344
FT                   /locus_tag="lse_0142"
FT   CDS_pept        140526..141344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0142"
FT                   /product="putative peptide transport protein"
FT                   /function="D-aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0142"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26293"
FT                   /protein_id="CBH26293.1"
FT                   /translation="MKLWISVDMEGINGLPDDTFVDSSMRNYTRGQKIMTSETNWVVEE
FT                   ALKAGYDDILVNDSHSKMNNILIEELNSEARLITGDVKPFSMVQGLDSSADAAVFVGYH
FT                   SRAGQPGVMSHSMTSGVRNFYINDVAIGEFGLNAYVAGAFGVPVILVAGDDCIAREAKE
FT                   LIPGIETAIVKEAVSRSSAIAFSLAKSEEIIREKVALALQNKQASVLTPPEKPVLKIEF
FT                   CNYGQAEWAALVPRTKIIDETTVMFEARDILEAYQAMVAMTELAMKCAFS"
FT   gene            141628..143385
FT                   /locus_tag="lse_0143"
FT   CDS_pept        141628..143385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0143"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0143"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26294"
FT                   /protein_id="CBH26294.1"
FT                   /translation="MMKVRFKSSKFKKIGFIFLSAILLVNVILQTNFVKAATNYGSELL
FT                   KTVQLQDADGNPKTDFGYYESIQIHYTWELPNSADAKAGDTMEFTLPEQLKIVTDLDFV
FT                   LKDDEGNIVGNVVATKATGKVVVTFTDYVEKKSNIKGELNFWSNWDKTIINGSEHVTVE
FT                   FPVDGDYVTIPVDVGPKNQINPNETLYKYGWADEKNPAIINWVVRVNYAKLSIDNAVYE
FT                   DFIGPNQTLNFSSVRAYHGVFDADDNFTKGTQVPASAITQTSDGFKIAFGNLTDSVKIS
FT                   YYTIATDGGASSNYANKGILSGDNYVPKTIEVLTPTSGGGGSGEGTTGSVELTKTDNTA
FT                   QKNPLENAEFKLINSAGTTVQEGIKTGTDGKLAISDLKFDTYKLIETKAPVGYELDASP
FT                   VEFTIDETHQALFVSKENAPITGSVSLEKLDSETKVKLAGAEFELQDSDGATLQTGLTT
FT                   NEEGTLTISDLALGDYQLVETKAPAGYELDASPVQFSITEETAKLGLLVTKENTKIPET
FT                   PITPKNPEEPVKPEIPSKPKTPIKPDQIVSEDSTSKTLPKTGDSPLVSGLGLLLVAISA
FT                   SGLILFRKK"
FT   gene            complement(143432..144268)
FT                   /locus_tag="lse_0144"
FT   CDS_pept        complement(143432..144268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0144"
FT                   /product="STAS domain protein"
FT                   /function="Anti-anti-sigma regulatory factor (antagonist of
FT                   anti-sigma factor)"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0144"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26295"
FT                   /protein_id="CBH26295.1"
FT                   /translation="MNESNGSMQLYLKEHTEEIINNWLSKIYEKENAYTSFVYSPRYKD
FT                   ELRADSEQTADLIISYFAGKQAFFAKLDKWLDNMYARRMENEVPLPEVITTLDKLRREF
FT                   LSAVSDFCIENDEVSKRDFSSSMSMVNHGFDRINEAFSAMYYHDIVQHLELQHRLIEEI
FT                   STPVILITDQLAILPLMGRIDRERAEKLSEITANKCVKLGVEQLCIDLSGISYFDDALG
FT                   EMLNNLVTVLKLLGVEAFVSGIQPKMAQQINRVELDLSIPAYHSLKAVLQEKTRTK"
FT   gene            144487..145479
FT                   /gene="holB"
FT                   /locus_tag="lse_0145"
FT   CDS_pept        144487..145479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="lse_0145"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /function="ATPase involved in DNA replication"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0145"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26296"
FT                   /protein_id="CBH26296.1"
FT                   /translation="MGLQDELTVMQPVVMKIFSKSVRENRLSHGYLLEGASGTGKKRTA
FT                   LWLAKSLFCLEATETELACGKCANCTRIASHNHPDVHLLEPDGASIKIDQVRALKQELS
FT                   KRGMESDRKVVIIYDAEKMTVQSANSLLKFIEEPEGGLLLLFLTTNPAQILPTIQSRLQ
FT                   PVTFKSLTFDSLVDSLTRIGISEQKARIYASITGSTEQAKNFEEDEWFGEARSAVVKLY
FT                   EGLHHQGTSPLIIIQESWMPLFKEKDKMALGLELLLLLYRDRLHLTLDESYEPICTAQK
FT                   EMLAQDALRKSLSETTGEIEKILAAKSKLASNMNMQLLMEQLVLEIQGR"
FT   gene            145485..146318
FT                   /locus_tag="lse_0146"
FT   CDS_pept        145485..146318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0146"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized homolog of PSP1"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0146"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26297"
FT                   /protein_id="CBH26297.1"
FT                   /translation="MLKIVGVRFKDVGKIYYFSPGELEITENQGVIVENAQGIEFGKTV
FT                   IEPRYVDEEDVVLPLKKVLRVATEADYKCVAENGDSCQKAFLLCDEKIRERELEMSLVD
FT                   VDYTFDRNKIIFYFTAEGRVDFRELVKDLASVFRTRIELRQIGVRDEAKLLGGIGPCGR
FT                   MLCCSTFLGDFEPVSIKMAKDQNLSLNPTKISGLCGRLMCCLKYENDEYEQAKREMPDV
FT                   GVKVKTPEGAEARVSGINLLSRILQVSLPEEETVIEYELDELRPFNDFLKQPAKS"
FT   gene            146329..146718
FT                   /locus_tag="lse_0147"
FT   CDS_pept        146329..146718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0147"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0147"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26298"
FT                   /protein_id="CBH26298.1"
FT                   /translation="MDKKAIFDSVSNMEEQIGELYQQLGDLKTNLGEMLEENNRLNLEN
FT                   EHLRRRLSLTDEASSEQEAEEEAVHGVMAPNRKEAMQQMIELGEGYDNLVQLYREGFHV
FT                   CNVHFGSPRGNDEDCLFCLSLLNKK"
FT   gene            146755..147528
FT                   /locus_tag="lse_0148"
FT   CDS_pept        146755..147528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0148"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0148"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26299"
FT                   /protein_id="CBH26299.1"
FT                   /translation="MLEKVDYLEKLKLIGDERLDYLLAENLRIIQSPSVFSFSIDAVLL
FT                   AKFSYLPIRKGKIIDLCSGNGIIPLLLSTRTEAQIVGVEIQPRLADMAKRSVVYNELES
FT                   QIEMIEHDLKKITDIIPKERADIVTCNPPYFAGPATSLKNENEHYRIARHEVMCTLEDT
FT                   IRVASNLLKQGGKANFVHRPERLLDILDLMRKYRLEPKRIQMVHPRLDREANTVLVEGI
FT                   KDGKPGVKYIPPVIVYDETGEYTPVIKEILYGESE"
FT   gene            147512..147781
FT                   /locus_tag="lse_0149"
FT   CDS_pept        147512..147781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0149"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted endonuclease containing a URI domain"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0149"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26300"
FT                   /protein_id="CBH26300.1"
FT                   /translation="MAKASEHFFYVLKCSDNSYYGGYTTDVARREAEHNAGIRCKYTKT
FT                   RRPVKVIHFEKFATRSEATKAESAFKKLSRKNKDAYLEREEENE"
FT   gene            147778..148659
FT                   /locus_tag="lse_0150"
FT   CDS_pept        147778..148659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0150"
FT                   /product="tetrapyrrole methylase family protein"
FT                   /function="Predicted methyltransferases"
FT                   /EC_number="2.1.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0150"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26301"
FT                   /protein_id="CBH26301.1"
FT                   /translation="MIKSQKSFSGVQTGALYLVPTPIGNLEDMTFRAINMLKEADIIAA
FT                   EDTRNTVKLLNHFEITTRMTSYHQFTKENKEENIIERMLSGEVVALVSDAGMPSISDPG
FT                   YELVQSALKADIPVIPLPGANAALTALIASGLAPQPFYFYGFLPRQNKERTQAIEKLAA
FT                   REETWILYESPHRLKETLKAISKITGNDRKIVLCRELTKRFEEFLRGTVEEALNWATDE
FT                   EVRGEFCIIIEGNDNPPLAEETLWWQELDIKTHVSTVMEQENVSSKDAIKTVMKARNLP
FT                   KREVYAAYHEIK"
FT   gene            complement(148704..148988)
FT                   /gene="abrB"
FT                   /locus_tag="lse_0151"
FT   CDS_pept        complement(148704..148988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abrB"
FT                   /locus_tag="lse_0151"
FT                   /product="transition state transcriptional regulatory
FT                   protein AbrB"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0151"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26302"
FT                   /protein_id="CBH26302.1"
FT                   /translation="MKSTGMVRKMDELGRVVIPIEIRRTMNLKEKDPLEIFIDDEAIIL
FT                   KKYSAGLVCDVTGEFSVDNKKFVDGKLTLSKEGAAELMEEIKRRFGDSL"
FT   gene            149105..149962
FT                   /locus_tag="lse_0152"
FT   CDS_pept        149105..149962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0152"
FT                   /product="glucose uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0152"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26303"
FT                   /protein_id="CBH26303.1"
FT                   /translation="MNIVIALIPAVMWGIMPLVVSKIGGKPRQQIIGTTLGALLFAIGV
FT                   FLFTNPEYTTTILIASFVSGAFWSLGQMNQFRAFTQVGVSKTMPLSTGMQLVGTSLFGV
FT                   FAFHEWGTTSKLVIGFSALALIIFGIFLTSYQQHKDENSGQNMKKGLITLVISSVGYVG
FT                   YVVITQWFNISGWDAILPQAVGMVVAGLLFSIKSSEKRFTKQTWLNMIPGIMWATGNLA
FT                   LLFSNKLVGIATGFSLSQMGVVISTIGGILFLGEKKTKKELVLVIFGVILVIIGGTMIG
FT                   IAKS"
FT   gene            150118..150978
FT                   /locus_tag="lse_0153"
FT   CDS_pept        150118..150978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0153"
FT                   /product="glucose uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0153"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26304"
FT                   /protein_id="CBH26304.1"
FT                   /translation="MNIMIALIPALLWGTVPLLITKFGGSTRQQTMGMTLGALIFAVIV
FT                   FFFTDPVYTLQTVSISFLTGCLWSVGQMFQLRAFKIIGVSKAMPISTGMQLVGTTLCGV
FT                   ILFHEWDTTLRIILGFIALTLIVGGIFLTSYAEKEEDGSNALKQGLITLLISSAGYVGL
FT                   VVLIQGFKIDGINAILPQAIGMVLSALIMTSSGGTEKRINKRTLLLAIPGIIWATGNVA
FT                   MVYANQLVGVATGFSLSQLGVVISTIGGIVLLKEKKTRKEMIYVIVGVVLVVLGGILIG
FT                   VSKGA"
FT   gene            151047..153044
FT                   /gene="metS"
FT                   /locus_tag="lse_0154"
FT   CDS_pept        151047..153044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="lse_0154"
FT                   /function="Methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0154"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26305"
FT                   /protein_id="CBH26305.1"
FT                   /translation="MLPEEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGY
FT                   DVFYLTGTDEHGQKIQAKAKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRH
FT                   KLTVEKIFEQLLEQGDIYLGEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGN
FT                   EVELVKEESYFFRMSKYADRLVEYYNSHPEFILPESRKNEMINNFIKPGLEDLAVSRTT
FT                   FDWGIKVPSNPKHVVYVWIDALSNYITALGYNTDNDTKFQKYWPADVQIVGKEIVRFHT
FT                   IYWPIMLMALDLPLPKMIFGHGWILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLR
FT                   EVPFGSDGLFTPEDFIDRMNYDLANDLGNLLNRTVAMINKYFDGEIPAYQGAVTPFDET
FT                   LVDFKNNVVADYEKSMDHMQFSVALNQLWSLVSRTNKYIDETAPWALAKDEEKRTELAS
FT                   VMTHLAENLRIIAVLLQPFLTRTPGEIFLQLGLQEENLKKWDSIYGYGEIPAGTNVVKK
FT                   GTPIFPRLDAKEEVTFIQDEMKGSAPAPAEAEAEVTPLETPQIGIEDFDKVDLRVAEVK
FT                   QVEKVKKADKLLCFQLDLGEGRLRQVLSGIAEFYQPEDLIGKKVIVVSNLKPVKLRGLM
FT                   SEGMILSGEKDGKLSVIEASSALPNGAKVK"
FT   gene            153195..154409
FT                   /locus_tag="lse_0155"
FT   CDS_pept        153195..154409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0155"
FT                   /product="xylose repressor protein"
FT                   /function="Transcriptional regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0155"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26306"
FT                   /protein_id="CBH26306.1"
FT                   /translation="MDILRKGNKDLIKDINRYTVLNLIREKGEITRTEIAKKCDFGMST
FT                   LTYILDDLQQEGIILEGAETSSTGGRRAKLVRFNKDYGFVVSVKVEEEQLLFALTDLNA
FT                   KIIQNSSVPFLAEKKPEDAIQLIAENVKKMCGNRNMDHLLGVGIAISGLVNRKKGIVIR
FT                   STMLGWENVALESMLNAHFPNIPVYVDKNINCYTLAELWLGEGKHSNNFATVSVGAGLG
FT                   LSVVINRQIYYGSQGGAGEFGHTTIQPGGYKCHCGQKGCLEMYASEFYFRNRGEELKAA
FT                   YPASDLNDFHFDNVAKSARSGDAMATELMGKMGEYLGYGIRNIINTFNPEKVIIVGEGL
FT                   HHRDLFLTKIDEIASQNFFSGAGFETEITTTSLEDPAWLQGAALLVIHQLFQVPIYEEE
FT                   QTLLR"
FT   gene            154446..155324
FT                   /locus_tag="lse_0156"
FT   CDS_pept        154446..155324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0156"
FT                   /product="sugar ABC transporters, permease protein"
FT                   /function="ABC-type sugar transport systems, permease
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0156"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26307"
FT                   /protein_id="CBH26307.1"
FT                   /translation="MVGMTRKKTLFWLCIFLLPNLLGFLIFIAIPILGSLGISFTDWDL
FT                   VSTIHFTGFDNYKRLFNDPEFWKSFRNTITFIIGYLPTVMVLGLACALMLNQKIKLRPF
FT                   FRAVYFLPVITSWVAVSLVWKWLFNPTYGLINYFLSLIGIAGPDWLTDPHTAMIAVIIT
FT                   SAWKDIGFVMVLFLGGLQNISPSYYEAANMDGASKLRQLFSITIPLLTPTTFFVTIISL
FT                   INSFQVFDQVMIMTEGGPSGATMTLVQNIYNHAFRYFEMGYASAMSWILFIVIFIITII
FT                   QNKLQKRWSNY"
FT   gene            155324..156172
FT                   /locus_tag="lse_0157"
FT   CDS_pept        155324..156172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0157"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /function="ABC-type sugar transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0157"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26308"
FT                   /protein_id="CBH26308.1"
FT                   /translation="MKTEKSGSPKWQLFKNILTYVIICLGGIIMIMPFIWMISTAFKTG
FT                   AANMTLPPQFIPEDPTTANFTQVFEMFPMFRFLINSVVVAVVTTLGQMLFCSMAAYAFA
FT                   RIPFWGRDKLFLLYLATMMVPAQVTMIPQFILMKQFGWLDSYAGLIVPALFSVFGTFLL
FT                   RQAFMGIPKELEEAAFMDGANHFTIFRKVILPLAKPTFATLGILTFMQSWNSYLWPLIV
FT                   TSSQEMATLPLGLSLLQGRYGTNYGLMMAGVLISVIPILAVYLFAQKYFIQGMAMSGMK
FT                   E"
FT   gene            156200..157459
FT                   /locus_tag="lse_0158"
FT   CDS_pept        156200..157459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0158"
FT                   /product="sugar ABC transporter, sugar-binding protein"
FT                   /function="ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0158"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26309"
FT                   /protein_id="CBH26309.1"
FT                   /translation="MKKGLLLLMVVVLSVFGLSACGGGSSSDGDKTEITYYQFSAPADG
FT                   KALDEMVKEFEKQNPDIKVKVQTIAYNDYFTKLQTQIAGGDAPDAFELNYETFVQYAEK
FT                   GVLADLTSYIEKDKDFDPSTLNKQAYDAFKYEDKQYGMVESFSNVVTIYNKDLFDKAGV
FT                   DYPTADWTWKDEQAAAEKLTDAKNKVWGTSQPVTMNEFYKVAAQNGGSIFNEDMTAATI
FT                   NSPENVEALTHLTSEVTDSKVAPSPSDLSGQLPEDLFMNGQIAMLHTGIWLFDMFQDAP
FT                   FEWDVQVEAGNTQKATHFFANGIGVSKDSDKKEAAFKFASFMSANEEAAKIRIDNNWEL
FT                   PATENKEILQPYLDATPPENREAVFESLQYMVLPPVVKDWNKISDYTNSEFEKVLNGAS
FT                   TPEKALKNSEANINETMGFK"
FT   gene            157553..160855
FT                   /locus_tag="lse_0159"
FT   CDS_pept        157553..160855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0159"
FT                   /product="glycosyl hydrolase, family 31"
FT                   /function="Alpha-glucosidases, family 31 of glycosyl
FT                   hydrolases"
FT                   /EC_number="3.2.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0159"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26310"
FT                   /protein_id="CBH26310.1"
FT                   /translation="MSKFTKLMQGYLHLIEGKNEKIKPILTETTPELTKDSVLEAATWL
FT                   WLSSKINHYNKEEVEPVITFLVENWNRPEQSVWGSPEKDIYLATISSVYSALLDVKNTF
FT                   PKPELQQTITTIRDYCFNNLLKGDSILTGFNTRKVSTDQLLSVLPFGLFSPEDLVMVAA
FT                   VGKMEQQLVQDDGVLPYAGAPTVSSFATAMMALYFLEKSDQDKALHYLNMAINLEDNDE
FT                   LGKVFIEINQVFRSMENEVTAHILHNPFGNENRYEKQLTERTPHHPETEMHFSAACEII
FT                   SDVEAIQVELVLKEKDWTILCEKKDKNGVQIWEALVPPLEEVGEYTYYFQATLKNQAIL
FT                   TSEEYLVEPIWKHWSEEAAICETEQGLMVLFKENPASVIPVEFVINEEELVVRMKPTFT
FT                   DKDVKTKPSGRMKKADLEITISNNPVRIEVRYKNNLILESHKIYPALQWYTDKTGTINK
FT                   VKLHLDAPKEEEYYGFGERYNALGQRGNVLDCFVYNQYRDQGTRTYIPMPFYHTNRDYS
FT                   VFVDTARYTSFDLGNQLADKHTITVEINGCDTDICLLMGDIQSAVASYVKKTGKPAMVP
FT                   VWALGPWMSSNNWDRESIVRTEVETTQELQIPSTVVVLEQWSDEATYYMFNDAEYAEKA
FT                   PSESYKYDEISFPSWGRWPNPKGMVDYVHENNMKLILWQIPIQKYLNRQQHPLKDREEA
FT                   YMIEKGYVVKNSDGTPYRIPENWFTESLIMDFSNEEGKKWWFDKRQYLIDIGVDGFKTD
FT                   GGEFVFGEGLQFADGRRGDEMRNLYPNDYIEAYYDFAQQNNGMTFSRAGYTGAQRFPAH
FT                   WAGDERSTFDAFRRSLIAGLSAGFSGIPFWSFDFAGFNGDIPTAELFIRSAQMATFCPI
FT                   MQYHAESKGEFNQDRTPWNIASRTGDETVIPIYRHFANVRMNILPYIYNESRKCVETGL
FT                   PMMRALLLDYKEDPRVSDMYDQYLFGEAMLIAPVIEDGVRSREVYLPEGTWYDFWTGIK
FT                   VNGPTLRKCKAEKEEIPVFIRGGKAILCNVDSSLQLGSWVGNSVEEYSTPLLKIYLDED
FT                   FTEEIIDHLSEKWLVEVTEHAEEIVVSVQTNTPNYEVEVIGATKKVQIKKGR"
FT   gene            160858..163149
FT                   /locus_tag="lse_0160"
FT   CDS_pept        160858..163149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0160"
FT                   /product="alpha-glucosidase"
FT                   /function="Alpha-glucosidases, family 31 of glycosyl
FT                   hydrolases"
FT                   /EC_number="3.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0160"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26311"
FT                   /protein_id="CBH26311.1"
FT                   /translation="MDASTSFAILPSNVKEKTAFPHEINCVKTASWANNCLTGTLDTGY
FT                   FSCYFVNEKIARVIVNPFSEVDLTASIAAIHDTAKQAAEFDETGDYYQLQFADKQIIIY
FT                   KETFQIIMKQAGKVIFQTEGLAVNRNKEHQISIQSRPETAIFGLGEKTGGLNKAGSIIS
FT                   MWNTDVYSPHNKDTVEIYQSIPFMIADTEETTYGLFYDNSYRTEFDFQSYEDKYTILAE
FT                   GGQANFYVIFGEDVKEVVASYTELTGKTPLPPKWSLGYHQSRYSYTSEEEVERIANTFK
FT                   EKEIPLDCVFMDIHYMDDFRVFTFNPDTFPNGPELIARLREQNIDVVPIVDPGIKKDVN
FT                   YPVYQEGIKHNYFCRKLEGEIYYGEVWPGISAFPDFLSTTVQNWWGNLHKFYTDLGIRG
FT                   IWNDMNEPSVFNESKTMDLDVVHDLDGKNVTHKEAHNLYGLYMSKATFEGLKRLVPNER
FT                   PFSLTRAGYAGVQRYSAVWTGDNRSHWEHLEMSLPMIMNLGLSGVAFTGADVGGFSSDC
FT                   TKEMLIRWTQAGAFLPYFRNHCVQDSIYQEPWAFGLDAEKIVKKYIELRYAFLPYIYTE
FT                   FQKTAETGLPIVRPLYTEFKDERDLIQVNDEFMLGENILVAPIVREGQVKRLVRLPKGT
FT                   WFNYWTKEQLEGGDYIVADAPIDTMPIYIKAGTILPIGSSVQNTKETQSIALEIYLANG
FT                   TALGYVYNDDGKSYEYQNGEFAKTGLTATLQNGEVQVKATHSGKVNLQLEITTIQVFGE
FT                   KTNKITRAGI"
FT   gene            163153..164814
FT                   /gene="malL"
FT                   /locus_tag="lse_0161"
FT   CDS_pept        163153..164814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malL"
FT                   /locus_tag="lse_0161"
FT                   /product="oligo-1,6-glucosidase"
FT                   /function="Glycosidases"
FT                   /EC_number="3.2.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0161"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26312"
FT                   /protein_id="CBH26312.1"
FT                   /translation="MKEKDWWKKSVVYQIYPKSFNDSNGDGVGDIQGIIEKLDYLKKLG
FT                   VDVIWLSPVYDSPQDDNGYDIRDYQKIYEEYGDMATFDNLLQGLHDRDMKLVMDLVVNH
FT                   TSDEHKWFEESRKSKDNPYRDYYFWREENEINNWGSIFSGPAWELDEKTGEYYLHLFSK
FT                   KQPDLNWENPKLRQDVYNMMKFWLDKGIDGFRMDVINFISKNTDFPDGPVAEGQIYGDA
FT                   GNDFCNGPRIHEFLREMNQEVTSNYDVMTVGEMPGASTTDAQIYTNPANKEVDMIFTFE
FT                   HMNLDSDGDNKWDLKPIYLPELKENMSEWQVALQENGWNSLYWNNHDQPRIVSRFGNDN
FT                   RFRVRSAKMLGTCLHMMKGTPYIYQGEEIGMTNVHFESLDEYRDIETLNMYKERKEQGH
FT                   SHESIMESIYTKGRDNARTPYQWDNSPNAGFTTGTPWIKVNPRYTEINNEEALKNPDSI
FT                   FYYYQNLIKLRKSTEIITTGNYRLLLPNDEAVFAYERYTNDEKLVVLCNFTEDEQIITD
FT                   KNILNDIKEGTVLVNNVPNIIEGTLRPYEAIVYQVK"
FT   gene            164911..165684
FT                   /locus_tag="lse_0162"
FT   CDS_pept        164911..165684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0162"
FT                   /product="deoxyribonuclease, TatD family"
FT                   /function="Mg-dependent DNase"
FT                   /EC_number="3.1.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0162"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26313"
FT                   /protein_id="CBH26313.1"
FT                   /translation="MLFDTHVHLNDEAFDDDIEEVIKRAQENDVTRMAVVGFNKESIDR
FT                   ALKLAEKYDFISLIVGWHPTDAFSFTDEDLEWLRDLALTHPKVVALGEMGLDYHWDTSP
FT                   KETQFEVFRKQIRLAKEVNLPIVIHNREATEDIIRILQEEHAEEVGGIMHCFGESVEVM
FT                   EACLAMNFYISFGGTVTFKNAKLPKIAAQAIPIDRLLIETDAPYLAPTPNRGKRNEPGY
FT                   VKLVAEKIAELKEMKYSEIATHSRDNAKRLFKIKD"
FT   gene            165976..167211
FT                   /locus_tag="lse_0163"
FT   CDS_pept        165976..167211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0163"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0163"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26314"
FT                   /protein_id="CBH26314.1"
FT                   /translation="MTMENSSNVAQSSKWKLPIMIAGFVIVVALVFYFVFEGTKNDITI
FT                   VNAGEKIESRTHAKTVSAALDEAGIKVSEHDEIAPGKNAEIKDGMEIKYLPAREVTIND
FT                   NGTKKNVWSTKENVSDLLKDENITTTPHDVLNVALDDKLKDGLEVNINRAIELSLQNGA
FT                   KKDTVWTTKTSVGDLLTEKNIKLDKEDRVSPAKDSNLKEKMTVQVTYVDSKADKKKEQI
FT                   KFNTVYKEDDSLNQGVEKVVQEGKTGEKIVEYKVTFENGKEKKRDVVKENVTSEKSDKV
FT                   VVRGTKEKAVVSQIANAKPAKKATSSNTSSSTSSSAPSGGKTFTMESTAYSGGGTTATG
FT                   INLSANPGMKVVAVDPSVIPLGSHVWVEGYGEAIAGDTGGAIKGNIVDVYFPNESSCYS
FT                   WGRRTVTVKVLN"
FT   gene            167315..167890
FT                   /locus_tag="lse_0164"
FT   CDS_pept        167315..167890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0164"
FT                   /product="primase-related protein"
FT                   /function="Small primase-like proteins (Toprim domain)"
FT                   /EC_number="3.1.26.8"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0164"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26315"
FT                   /protein_id="CBH26315.1"
FT                   /translation="MSEKPIIHEFIVVEGRDDTTAINRSVIADTIETNGSALSQETIER
FT                   IRHAQELRGVIIFTDPDFPGEKIRKQIDSAVPGCKHAFINRQDALPKAGRGLGVEHASS
FT                   KNIQEALQHFHTSNERTEKELISKDILIHLGLLGGTGSKERREKLGNTLKIGYTNGKQL
FT                   QTRLESFAISEAELVAACQKISQEEENE"
FT   gene            167883..168770
FT                   /gene="ksgA"
FT                   /locus_tag="lse_0165"
FT   CDS_pept        167883..168770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="lse_0165"
FT                   /product="dimethyladenosine transferase"
FT                   /function="Dimethyladenosine transferase (rRNA
FT                   methylation)"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0165"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26316"
FT                   /protein_id="CBH26316.1"
FT                   /translation="MSKDIATPGKTTEILKKYGFLFKKSLGQNFLIDSNILTRITDTAE
FT                   ITKETNVIEIGPGIGALTEQLAKTANEVVAFEIDQRLLPILDDTLSAYNNVKVVHGDVL
FT                   KADVEEVIASQFTKPELPLKIVANLPYYVTTPIILKLLHDNIPADSMTFMLQKEVADRI
FT                   SAVPSTKSYGSLTIAIQFYMEAELAFIVPKTVFMPQPNVDSAVIHLKRRKEPLAQVNDE
FT                   SFFFEVTRASFAQRRKTLWNNLASKFPELKARKDELVEGLNGIGIDLIRRGETLDIPEF
FT                   AKLSNFLADFLAKK"
FT   gene            168889..169146
FT                   /locus_tag="lse_0166"
FT   CDS_pept        168889..169146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0166"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0166"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26317"
FT                   /protein_id="CBH26317.1"
FT                   /translation="MPKTIASIKTNLDSRLGKALTLKANGGRKKTIERCGILAETYPSV
FT                   FIVELDQDENNFERVSYSYTDILTDAVELVFTDDNKELAL"
FT   gene            169282..170160
FT                   /gene="ispE"
FT                   /locus_tag="lse_0167"
FT   CDS_pept        169282..170160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="lse_0167"
FT                   /product="4-cytidine 5-diphospho-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /function="4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   2-phosphate synthase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0167"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26318"
FT                   /protein_id="CBH26318.1"
FT                   /translation="MKISITAPAKINLSLDALYKRDDGYHEVEMVMTTIDLADRLYIER
FT                   LDEDVIVLDVKAHFIPEDRRNLIYQAAALLKKRFDVKAGVRITIDKHIPVSAGLAGGSS
FT                   DAAAALKGLNIIWELGLSINELAEISSEIGSDIAFCVYGGTAIATGRGEKITSLPNMPG
FT                   CWIVLAKPSISVSTPTIYKELQVDNVEHPDTKKMIESIEQGDLDGIFAATGNVLESVTL
FT                   EKNPQVKRIKDRMIAFGAEAALMSGSGPTVFALIKQYSRAKRVYNGLRGFCEEVYMVRP
FT                   WSESENDTIKG"
FT   gene            170175..170912
FT                   /locus_tag="lse_0168"
FT   CDS_pept        170175..170912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0168"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0168"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26319"
FT                   /protein_id="CBH26319.1"
FT                   /translation="MKIIFNADDFGISPGAVYGILDAYKRGVVKSTTLLANSPAFDLAV
FT                   DVAKENPGLDIGAHLTLTFGSPLLQGLETLTDDDGRFRKNYTALESGLADVDMEEVERE
FT                   LTAQIEKILAAGLKVSHFDTHHSIEPLIYPVQHKLAKKYGVSLRRHEDVSDHGAIKTPD
FT                   LFATEFYADGVSIETIKKIVQKHVGTNDVVEVMTHPAFIDDILLNISSYVKPRTKELTI
FT                   LTSRELQAYLGQQEVEIISFRDL"
FT   gene            171078..171896
FT                   /gene="purR"
FT                   /locus_tag="lse_0169"
FT   CDS_pept        171078..171896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="lse_0169"
FT                   /product="Pur operon transcriptional repressor"
FT                   /function="Adenine/guanine phosphoribosyltransferases and
FT                   related PRPP-binding proteins"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0169"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26320"
FT                   /protein_id="CBH26320.1"
FT                   /translation="MKIRRSERLIDMTQFLLSHPRKLVPLTMFAERYGSAKSSISEDLV
FT                   IIKKTFEDRGIGTLETVPGAAGGVQYISIAGNDDVLDFVHTLCNRIAEPNRLLPGGYLY
FT                   LSDLLGEPVTLKAIGKILATKFNDKKIDAIMTVATKGIPIAQAVAEHLSVPFVIVRRDS
FT                   KVTEGSTVSINYVSGSSKRIEKMELSKRSLAEGSNVVIVDDFMKAGGTINGMKNLLEEF
FT                   NAHLVGIGVLVESEYAEERLVDDYVSLVKIKNVNMKEKQIEVVDGNYFNN"
FT   gene            172065..172742
FT                   /locus_tag="lse_0170"
FT   CDS_pept        172065..172742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0170"
FT                   /product="putative HlyD family secretion protein"
FT                   /function="Membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0170"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26321"
FT                   /protein_id="CBH26321.1"
FT                   /translation="MKKWVKWLIVIVIIAVIAVGAVMLLGKNSGSVTQEKLVTAKVKQG
FT                   DMKINATGTGAISPENTQVPDYDELQLVAQMDELDIPNIKKDQEVKVTVTALPDKTYTG
FT                   KVKEIAEQGQVQNGVSSFSVIISLDKTDDLKAGMTADASILVNEKKDALYVPIEAVQKD
FT                   SDDNYYVLIPEEKENGKTKKVKKTVETGLHNEDNIEITKGVKKGEKVILPTQETETVPG
FT                   APS"
FT   gene            172791..173483
FT                   /locus_tag="lse_0171"
FT   CDS_pept        172791..173483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0171"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /function="ABC-type sugar transport systems, ATPase
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0171"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26322"
FT                   /protein_id="CBH26322.1"
FT                   /translation="MPKPLIDMKNLTKTYTLGGETFKALDDVTFTVDQGEFLSIVGPSG
FT                   SGKSTLMNMIGCLDVPDKGSYHLDDVDVFQLSDNKLSEIRNKKIGFIFQQFNLLPKLSS
FT                   FENVELPLIYAGLSVSAREKAALECLEKVGLLEKRKNLPTQLSGGQQQRVAIARALAGN
FT                   PQILLADEPTGALDSKTGKEVMGILQELNRAGNTIVMITHDPTIASYGTRSIRIQDGKL
FT                   FHEGGTKA"
FT   gene            173480..174688
FT                   /locus_tag="lse_0172"
FT   CDS_pept        173480..174688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0172"
FT                   /product="ABC transporter, permease protein"
FT                   /function="ABC-type antimicrobial peptide transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0172"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26323"
FT                   /protein_id="CBH26323.1"
FT                   /translation="MNVLQSMKMAWKQLKASKLRSFLTMLGIIIGVASVILLVSLGNGV
FT                   TEEVDEQMGDLGSNLITVVNSSVNPNDKYTYDEVMKYQNIDGVKSVSPELSGQVNATFD
FT                   YKNSSNKVIGTNDQYKAARSLEMSEGRFLLPIDTEYGQKVAVIGSTVASDLFGFGNPIG
FT                   ETIRLNGMPYKVVGVLKEKGASMMGSSDDQIFIPISSAQRLLKDTNVRTIYVETKSAED
FT                   VDFVVNTLESRLAIKFGDEKEQEKNASSAQMGPSYQVINQQEILNAFNTISSTLTTALG
FT                   AIAAISLVVGGIGIMNIMLVSVSERTREIGIRKALGAKKRAILLQFLIESIVISVCGGI
FT                   IGIIIGVSGALIFGSVAGISSGITAGTIIFSFVFSLCIGVIFGIAPANKASKLRPIDAL
FT                   RSE"
FT   gene            175381..175689
FT                   /gene="spoVG-1"
FT                   /locus_tag="lse_0173"
FT   CDS_pept        175381..175689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVG-1"
FT                   /locus_tag="lse_0173"
FT                   /product="stage V sporulation protein G"
FT                   /function="Uncharacterized protein, involved in the
FT                   regulation of septum location"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0173"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26324"
FT                   /protein_id="CBH26324.1"
FT                   /translation="MEITDVRLRRVETDGRMKAISSITIDSEFVIHDIRVIDGNEGLFV
FT                   AMPSKRTPDGEFRDIAHPINSNTRAKIQEAVLAAYEVAEEPTASEEKSADESVAEEN"
FT   gene            175817..176125
FT                   /gene="spoVG-2"
FT                   /locus_tag="lse_0174"
FT   CDS_pept        175817..176125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVG-2"
FT                   /locus_tag="lse_0174"
FT                   /product="stage V sporulation protein G"
FT                   /function="Uncharacterized protein, involved in the
FT                   regulation of septum location"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0174"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26325"
FT                   /protein_id="CBH26325.1"
FT                   /translation="MQVTDVRLRRVETDGRMRAIASITLDEEFVVHDIRVIDGNNGLFV
FT                   AMPSKRGVDGEFRDIAHPINSDTRAKIQEVVLAEYVRVGEEEASAVTEEESESVSAE"
FT   gene            176264..176389
FT                   /locus_tag="lse_0175"
FT   CDS_pept        176264..176389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0175"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26326"
FT                   /protein_id="CBH26326.1"
FT                   /translation="MMLQNQAQSRNYYRSTTVISTFNDQMDNHGVSFGIFKQIKY"
FT   gene            176509..177882
FT                   /locus_tag="lse_0176"
FT   CDS_pept        176509..177882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0176"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /function="N-acetylglucosamine-1-phosphate
FT                   uridyltransferase (contains nucleotidyltransferase and
FT                   I-patch acetyltransferase domains)"
FT                   /EC_number="2.7.7.23"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0176"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26327"
FT                   /protein_id="CBH26327.1"
FT                   /translation="MSKRYAVVLAAGQGTRMKSKLYKVLHPVCGKPMVEHVVDQISTLD
FT                   VDKVVTIVGHGAEKVQEHLAGKSEFVKQEEQLGTAHAVLQAKAALAERDGVTLVVCGDT
FT                   PLIEASTMEALLKYHHEKRAKATILTTVIEDPTGYGRIIRDDLGIVEKIVEHKDATEKE
FT                   QRISEINTGTYCFDNKALFEALEKVSNDNVQGEYYLPDVIKILKDSDEVVAAYRMESFE
FT                   ESLGVNDRIALAEASKLMQCRINENHMRNGVTLVNPESTYIDINVKIGQDTVVEPGVML
FT                   RGDTVIGDDCVVTSGSEIVNSIIGERVHIRSSSIFESKVGDDVQIGPYAHLRPESDIHN
FT                   HVKIGNYVETKKAVVGEGTKLPHFIYMGDAEIGKNVNVGCGSIAVNYDGKNKAKTIIGD
FT                   DVFVGCNSNLVAPVKVGNRAFIAAGSTITKDVPDDALGIARAKQDNKIGYAKRLNHGK"
FT   gene            177932..178888
FT                   /gene="prs"
FT                   /locus_tag="lse_0177"
FT   CDS_pept        177932..178888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="lse_0177"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /function="Phosphoribosylpyrophosphate synthetase"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0177"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26328"
FT                   /protein_id="CBH26328.1"
FT                   /translation="MSNEYFDPKLKIFSLNSNRELAEEIAKEVGIELGKSSVTHFSDGE
FT                   IQINIEESIRGCHVYVIQSTSNPVNQNLMELLIMIDALKRASAATINIVMPYYGYARQD
FT                   RKARSREPITAKLVANLIETAGATRMITLDMHAPQIQGFFDIPIDHLNAVRLLSDYFGE
FT                   RHLGDDLVVVSPDHGGVTRARKMADRLKAPIAIIDKRRPRPNVAEVMNIVGNVEGKVCI
FT                   IIDDIIDTAGTITLAAKALREAGATKVYACCSHPVLSGPAMKRIEESPIEKLVVTNSIA
FT                   LPEDKWIDKMEQLSVAPLLGEAIVRVHENASVSSLFE"
FT   gene            179094..181802
FT                   /gene="vclC"
FT                   /locus_tag="lse_0178"
FT   CDS_pept        179094..181802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vclC"
FT                   /locus_tag="lse_0178"
FT                   /product="cell wall surface anchor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0178"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26329"
FT                   /protein_id="CBH26329.1"
FT                   /translation="MKRKNSFFTLLIVACVVFSSLWFPTEIPVKAVGGGKRDDLVKSVS
FT                   FYKSNGNNVSLKEDYNEDLDYFIDVSFAGNSFQVGDYFDVTLSKDALLYTDETYDLTID
FT                   VDPTSTVKQEVVGEVSVNQNGGVPTLHFTFTENSDDYFVKDFTGNFKIQLMPLQGGKNL
FT                   ISLNYNGATQNFKNINSSTVELNVNVMGEWPPLGTSNISRVSGDLYRAQQVYEKPKSKV
FT                   NYETEILVSYPLFEKKIPLGNVQNVRVEIWDESRGIYRPAITGVEYGTITYDVGTPYIG
FT                   GPSYKMNCTIPFIGISSKTRVTFDINTNIDGKSGSTDPYLIGLSSVTAATKSVQFYPID
FT                   NAESNLKVNQYGKVTTSFEDENGAAITFDDYSEAAFAGELNEDGEYEIDGKFLYNSTQS
FT                   VDKHAFDEMLEDEKYKLVDVSSENQLTETEDNLNIQIKLGYENDVLYKIKKLQKPVIQA
FT                   LPEIEYSKTVVKTKEEFLGDVEATTDIPSVIDCDLKDVEWGVPGDYPVVITAVNEDNQE
FT                   ADPVTVMVHILKNPAPVISVDPEITYKKTVTKTDDELLTDVNARTNDGSVITSDIADKV
FT                   KWGVPGDYEVTLNAMNEDGVAAESKTFTVHILKSPAPIIAVDPEITYLKSTTKTEPELL
FT                   ADVHAQTNDGSPIVSDMLTEVKWGVPGEYPVTLNSMNEDGVAAESKTFIVKILKDPAPI
FT                   ITVDPEITYDSKTKKEVAELLTEVHAQTNDGSAITSDAETQVNWGMPGEYPVTLNAMNE
FT                   DGVAAEPKTFIVKILKNPAPVITVDPEITYDSKTKKEVAELLAEVHAQTNDGSAITSDA
FT                   ETQVVWGAPGDYLVTLNAVNEHEIAAEPVSFTVHIVEAKEKPVPKDKPKNKLTVKEKKL
FT                   PQTGDRNSEGVLGFSALCLGLWLFFRNGRLK"
FT   gene            182088..182789
FT                   /gene="vclD"
FT                   /locus_tag="lse_0179"
FT   CDS_pept        182088..182789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vclD"
FT                   /locus_tag="lse_0179"
FT                   /product="sugar isomerase, putative"
FT                   /function="Ribulose-5-phosphate 4-epimerase and related
FT                   epimerases and aldolases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0179"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26330"
FT                   /protein_id="CBH26330.1"
FT                   /translation="MILGVEKIKILKRAVFQASMVLVHQGLINSNWGNVSAIDRELEII
FT                   VIKPNGVAINQMSVDDMVMTDLDGKVLGGKWGPSSDILTHVVLYQNFKKVQSIAHSHSK
FT                   YAVAFSQSGRDIPVYGTTHADMFYGPVPCTRQLTKLETERAYEVESGKVIVETFKERKL
FT                   NENALQGVLVAGHGPYTWGANVEEAVENSTILEEVSGMALHTEILLRGKARQEIPKCLQ
FT                   NKRYFRKNRSN"
FT   gene            complement(182929..183642)
FT                   /gene="prfA1"
FT                   /locus_tag="lse_0180"
FT   CDS_pept        complement(182929..183642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA1"
FT                   /locus_tag="lse_0180"
FT                   /product="listeriolysin positive regulatory protein"
FT                   /function="cAMP-binding proteins - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0180"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26331"
FT                   /protein_id="CBH26331.1"
FT                   /translation="MSTKAEDFKEYLESNGIQPKYFQKKEFIFSQWEPNEYCIFLHEGV
FT                   AKLTSISESGDILNLQYYKGAFIIMTGFIDTEKSLGYYNLEVVSEQAAAYIIKISDLKE
FT                   LVSKDLKQLFYIIDTLQKQVSYSLAKFNDFSSNGKVGSICGQFLILAYVYGEETPNGIK
FT                   ITLEKLTMQELGCSSGIAHSSAVSRIISKLKQENVIEYKDSYFYIKNIAYLKKIAPKID
FT                   EWFYLACHNSWDKFN"
FT   gene            184227..185498
FT                   /gene="vclE"
FT                   /locus_tag="lse_0181"
FT   CDS_pept        184227..185498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vclE"
FT                   /locus_tag="lse_0181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0181"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26332"
FT                   /protein_id="CBH26332.1"
FT                   /translation="MRGDSINFCEFFKELNSQNAELNNAGARTMLVIDEGATDAQLAEV
FT                   EKMLDISLPDDLKEILKLSKKIYWYWTLFGKTIIPSDFEQIKGTFSINLEEIEFFTAPL
FT                   VKIKVRRLLKIAKSIDGEDIIYDLKEGSIYCFNYYHNQLFQMASSLEAYLEITIQNKGL
FT                   AMWNYGLIGNKELKESAFQFIREFLKPLVLDPDAVEIVNYACIHGAEEIISKGLPNEED
FT                   VGRVFTEIMHRLEADLNHFKGYNDLIIELCPAYAKKWIISLWVSKKYEKIADFIYLRAY
FT                   FTGKALPAKEALKLISETIPDRASGKDVYRLLSTIGDSAIIDWMQDKVNYPLGDWVNLF
FT                   LGSQPTKEQVFSWLEGDIICQETVCLALKNLSKESELLKTYTKEEKMKLFILLLGVNHN
FT                   CLFKKDKEEIIRAIRLIIKKFFIE"
FT   gene            complement(185578..186540)
FT                   /gene="plcA"
FT                   /locus_tag="lse_0182"
FT   CDS_pept        complement(185578..186540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plcA"
FT                   /locus_tag="lse_0182"
FT                   /product="phosphatidylinositol-specific phospholipase C"
FT                   /EC_number="4.6.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0182"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26333"
FT                   /protein_id="CBH26333.1"
FT                   /translation="MYIHRSRKVLLVLLCLAVYSIIFPMHGKAISSKTWNTFTKKNINT
FT                   QRWMTSLPDSVSLSALSIPGTHDTMSYNGYITWQFTRPLAQTQTMTLNEQLNAGIRFFD
FT                   IRAKEDLNIYHGPIYLNASLEEVLHTFISFLKENPKEVVIMRLKDENKSENSFDYRIQP
FT                   LIHKLKSFFYTESAKNTSSKTPTLRKLRGKILLLSDNNTKKSLVINSSRYGMQYDSSEQ
FT                   VIQDDYNGPDVNTKYQEIVQTAYQACRQSSSENKLFLNYVSATSLTFTPSQYADKLNSK
FT                   VENFVDNLTANKLNGVGMLIMDFPEKQTIHSIIKNNKFN"
FT   gene            186779..188371
FT                   /gene="hly1"
FT                   /locus_tag="lse_0183"
FT   CDS_pept        186779..188371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hly1"
FT                   /locus_tag="lse_0183"
FT                   /product="listeriolysin O"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0183"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26334"
FT                   /protein_id="CBH26334.1"
FT                   /translation="MKIFGLVIMSLLFVSLPITQQPEARDVPAYDRSEVTISPAETPES
FT                   PPATPKTPVEKKHAEEINKYIWGLNYDKNSILVYQGEAVTNVPPKKGYKDGSEYIVVEK
FT                   KKKGINQNNADISVINAISSLTYPGALVKANRELVENQPNVLPVKRDSLTLSVDLPGMT
FT                   KKDNKIFVKNPTKSNVNNAVNTLVERWNDKYSKAYPNINAKIDYSDEMAYSESQLIAKF
FT                   GTAFKAVNNSLNVNFEAISDGKVQEEVISFKQIYYNINVNEPTSPSKFFGGSVTKEQLD
FT                   ALGVNAENPPAYISSVAYGRQVYVKLSSSSHSNKVKTAFEAAMSGKSVKGDVELTNIIK
FT                   NSSFKAVIYGGSAKEEVEIIDGNLGELRDILKKGSTYDRENPGVPISYTTNFLKDNDLA
FT                   VVKNNSEYIETTSKSYTDGKINIDHSGGYVAQFNISWDEVSYDENGNEIKVHKKWGENY
FT                   KSKLAHFTSSIYLPGNARNINIYARECTGLFWEWWRTVIDDRNLPLVKNRNVSIWGTTL
FT                   YPRHSNNVDNPIQ"
FT   gene            188753..189424
FT                   /gene="vclK"
FT                   /locus_tag="lse_0184"
FT   CDS_pept        188753..189424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vclK"
FT                   /locus_tag="lse_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0184"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26335"
FT                   /protein_id="CBH26335.1"
FT                   /translation="MIIVKKKRNFMLGFLFLVIIITVICPVKTKAMDTHKWMAHLADDV
FT                   RFEKLAIPGVQNNSNACKNEKITKQLNTGVRFFDLSLHCAEIEQTEESMAEIDRFIQKN
FT                   QSEFVLVVTNNNPVVKRSNSTYRIDSRCGKIKIKNFRGKILMVDSKEMKELKIHPYEKA
FT                   KNNGWRYMLVANSIIPKLNQSIITRMNNKGVFMINNPCWKEVRKVVNLNRDYKKPKRVI
FT                   Y"
FT   gene            189447..190979
FT                   /gene="mpl"
FT                   /locus_tag="lse_0185"
FT   CDS_pept        189447..190979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpl"
FT                   /locus_tag="lse_0185"
FT                   /product="zinc metallopeptidase"
FT                   /function="Zinc metalloprotease (elastase)"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0185"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26336"
FT                   /protein_id="CBH26336.1"
FT                   /translation="MYKRLIFVVFAAGLLLNFNTIVKADSVGEEDLHDDVHLKKDAVVL
FT                   KALPNKYKVRDFCKKFKVIKTEKDSLEITHYTLELQNQGYSTDNEEIKVHVSSDNKIIY
FT                   INGDLQQGEIEISNEIKITEKTAIEKAFEAIGRSQDNVISYSGNVIKQKEILINSRTNR
FT                   LVYQVEIIFSEPEVANWIIQIDAETGAVLKKQNILSNACVEKMPRNFKVINKDKNRSIN
FT                   RPLHVEKKDNLFYLIDTTHQGTIKTFNLDHQLDPSFGKLVCSTTNTFAALEYSSAVDAH
FT                   YYAGEVYDYYKNIHQLESLDGRGGDINSFVNYGVDCNNAYWDGEVIIFGDGDKKNYKPF
FT                   SGAKDIVAHELTHAVIQYSAKLDYQGQSGALNESFADIFGYFIAPNNWLIGEDVCVRGV
FT                   KDEMVRSIKEPDKYNQAAHMDEYASLSITEDDDWGGIHYNSGIPNKAAYNTIVKIGSEK
FT                   AERVYFRALYYYLTSQSQFIDAKNALQQSAKDLYGEEVAEKIAEAWLGVGIS"
FT   gene            191278..193365
FT                   /gene="actA"
FT                   /locus_tag="lse_0186"
FT   CDS_pept        191278..193365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="actA"
FT                   /locus_tag="lse_0186"
FT                   /product="actin-assembly inducing protein"
FT                   /function="Type V secretory pathway adhesin AidA"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0186"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26337"
FT                   /protein_id="CBH26337.1"
FT                   /translation="MGLKKIPSVILTIVVITSCLSFTTNDLYAQTTDEEDAKSSLNTNE
FT                   WSEEETKPAAELSNEQGKVEKHAVYETTEQVRERELKELKELAKESSEKKGKRDKIKSF
FT                   FAKKFPSEKSDSKTSTQENSVKNPQQSDSATNEIKEPTPKVDKKAAEKAAKVDKKAVEK
FT                   AAKVDKKAAGKAKKTAKKAKKKAAELDKQLLGKIAQRRGALAESSDEAGRGYLSTSEEE
FT                   REKIAKSKNGPMTKEIKSEKKKKKKKNSSARSTDVEFLPVIQESQLESSDLENEVIEKK
FT                   TKQPFFSKAFEKIKGAGSWALDKLNENPGVKKAIVDQSAGFIDQLLTKKSSDESGAVQK
FT                   EQVKEPAVVQKAPLKPARQAFSSNNPTSKESNSESSVNAKSFVEYITPIPQMSLGELRN
FT                   EMSTKVDRVLYAIDSDMPPPPPSSDEEEVAKIKRQSSVDSDSSVSSDSSYYFRPSKLPR
FT                   LQGFASPAHKQNFKSIHKPCIRGNIPVPVPSHANTMKLKPMNNARNFNQLNILNHAPAV
FT                   SANQGSSKGTLQKKTIATQVRVPLPNSKMSSQKQINKLANTTQNNSAAQVNKTTSQVSG
FT                   TTDVDKSLKVKRNQSAPAVLAPPVVLKEDLSKEEAEKKSNLDKQQQEEKKVEVIDPVKY
FT                   SDLNDDSLDEKSEKVLVKSAEDEKAQETSGSNTILIISILAGSVIALLIFIKILNVRKL
FT                   N"
FT   gene            193392..193547
FT                   /pseudo
FT                   /locus_tag="lse_0187"
FT   CDS_pept        193392..193547
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0187"
FT                   /db_xref="PSEUDO:CBH26338.1"
FT   gene            193578..193778
FT                   /pseudo
FT                   /locus_tag="lse_0188"
FT   CDS_pept        193578..193778
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0188"
FT                   /db_xref="PSEUDO:CBH26339.1"
FT   gene            193946..194833
FT                   /gene="plcB"
FT                   /locus_tag="lse_0189"
FT   CDS_pept        193946..194833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plcB"
FT                   /locus_tag="lse_0189"
FT                   /product="phosphatidylcholine-specific phospholipase C"
FT                   /EC_number="3.1.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0189"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26340"
FT                   /protein_id="CBH26340.1"
FT                   /translation="MKIKGILMGLCLSASIVALSGADEASACGDESVKDQIAPHDIQNK
FT                   LPSKLGWSAEHPSKNEINTHLWLFNQAEKILAKDVTGAQLDLVRELKNYNKEIAQGIFD
FT                   ADHKNPYYDKNTFLSHFYNPKTHKTYIAGFPNAKDTGTKYFNISIEEYQDGNFEKAFYN
FT                   LGLAIHYYTDISQPMHANNFTALSHPVGYHCAYENYVDTFKQIFQASAESEAKWFCTDD
FT                   VSEWFHENAKRAQADYPKIVNTIIKKSYIQGLSDSQKDRTWKKAVRAATGKRLRDSQET
FT                   LAGLLEFWYTKTNE"
FT   gene            194973..196382
FT                   /gene="vclY"
FT                   /locus_tag="lse_0190"
FT   CDS_pept        194973..196382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vclY"
FT                   /locus_tag="lse_0190"
FT                   /product="cell wall surface anchor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0190"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26341"
FT                   /protein_id="CBH26341.1"
FT                   /translation="MKYIGNFMVIAIVVFLSLNMKVLEAKAEEPVFKVDASSYTETIPR
FT                   GNGSLDIDINKKEIIRTEYSLTSFESTLDKVDLQVTLDKNLFHFAEEPTIEVETLAYPQ
FT                   TTKIEYTTDGINYQQTKPALKDLVGFRVSCNGVDPDLAGKTLMVKWGIMPNEDFSDTQL
FT                   NKDITPYDASYSQSTFKLPDGPVYLVRGEDSETIFDHPALHMNFFKEASPVKVKYENTN
FT                   GTEIAENDLISGRVGDNYQTSKKNIPDWDFIRVTGAEQGVLSSETQEVTYVYQQVKGAP
FT                   VTVNYQDVNGKILAKPTVLNGAINSTYKTSPAKIANWHVKEIRNKETGIFKSTAQQVTY
FT                   IYEKNKAAPVTVNYVDNNGNILAPPVKKNGLVGDSYKMEAAQIAGWHVKNIVGNESGEY
FT                   TTDPQTVSYIYEENNTDKKKDNDQGMDKKDPLQEKLPNTGDSSTDGLFGILLGLMIITT
FT                   EVLYLFKYNPK"
FT   gene            196421..196768
FT                   /gene="vclX"
FT                   /locus_tag="lse_0191"
FT   CDS_pept        196421..196768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vclX"
FT                   /locus_tag="lse_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0191"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26342"
FT                   /protein_id="CBH26342.1"
FT                   /translation="MYMKGKLIAVLVILAILLCSLLLFFIVKVNIWKENTIKQNDSAQI
FT                   QSVKYIGTCKAVDRKMEIKLFSAKTNLFLESAERNEIIDGTEIDSNNREVFIIIMSEKE
FT                   SGIFQKNGLKY"
FT   gene            196847..197701
FT                   /gene="vclI"
FT                   /locus_tag="lse_0192"
FT   CDS_pept        196847..197701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vclI"
FT                   /locus_tag="lse_0192"
FT                   /product="internalin family protein"
FT                   /function="Leucine-rich repeat (LRR) protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0192"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26343"
FT                   /protein_id="CBH26343.1"
FT                   /translation="MLQVAHASGEIKGEKSINEIFEDGNLALIIAGKLNKSIVDDVTQA
FT                   ELNTIIQFDAEYCDIKSISGVEFLKNLASVNLNSNKIVDLSPLKDLKELKVLNLNNNII
FT                   KQLKPLSNIRTLRVLELNENIISDVDSLKNLSELRILLMNSNKIVDISCVGNMQKLFVL
FT                   EADNNSITNMQPIMKRKEATYSAQNQILYKQPVTVNPNNSFQMLNPVVVGASERNPENL
FT                   APKEISAGGQYDFPDITWKNLASKPETIECSYSHGDRYTLKIIQPLNYKSVAKSNIKKQ
FT                   TKK"
FT   gene            197739..198542
FT                   /gene="vclP"
FT                   /locus_tag="lse_0193"
FT   CDS_pept        197739..198542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vclP"
FT                   /locus_tag="lse_0193"
FT                   /product="phosphoesterase, putative"
FT                   /function="Diadenosine tetraphosphatase and related
FT                   serine/threonine protein phosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0193"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26344"
FT                   /protein_id="CBH26344.1"
FT                   /translation="MEKVRIAIISDVHGNLEALKAVLKDAANERAEQYITVGDIALKGP
FT                   GTDVCLELLEKLNPLTFVLGNHEQVYKDFLDGKSFDHSLKRRMIEDLVKYDYAFLGEEK
FT                   FRYLATLPKKVSIQVFQTKIDVFHAMPNSVSFPIYATEEQAYFDEMFSGTEADVAINGH
FT                   VHRQSLRRTAEDKLIINSGSVGLPGGESRKVKDNLAQYALIDIAETGIVDIHFKKITYD
FT                   IDAEIAFAKKRNLPYVDIYEKTLRSGQYLYIDSQIEQYFSPKFKQ"
FT   gene            complement(198584..198916)
FT                   /gene="vclB"
FT                   /locus_tag="lse_0194"
FT   CDS_pept        complement(198584..198916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vclB"
FT                   /locus_tag="lse_0194"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0194"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26345"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VMW4"
FT                   /protein_id="CBH26345.1"
FT                   /translation="MIVTTSPNIEGKQIIEYKKIVFGEIITGVNFMKDIGAGLRNFFGG
FT                   RSQGYEDELINAREEAIKEMEQRAQDIGANAVIGVDIDYEVLGADNGMLMVTASGTAVV
FT                   IEAQDY"
FT   gene            complement(198986..199657)
FT                   /gene="vclA"
FT                   /locus_tag="lse_0195"
FT   CDS_pept        complement(198986..199657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vclA"
FT                   /locus_tag="lse_0195"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0195"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26346"
FT                   /protein_id="CBH26346.1"
FT                   /translation="MITFDQLDAELSALQNPNTIKIFRNHGCPETLKLYGLKIGDLKKI
FT                   IRREKLNTNHELTVQLIESSNSDLIYLGLLAVDPKKLDVAQIEKWNVAFRETWTMLTFG
FT                   LASVVSKRDDALTFARKWIKSDYDLTKSMGWQIFTDHIKDLPEAAELLEIAKETLQSET
FT                   NRTRYSMNGYIIACGIYKDELYKKALDAAKAIGKVHVDLGKTACKVPDAHSYIEKARNQ
FT                   K"
FT   gene            complement(199733..200674)
FT                   /gene="ldh-1"
FT                   /locus_tag="lse_0196"
FT   CDS_pept        complement(199733..200674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldh-1"
FT                   /locus_tag="lse_0196"
FT                   /product="L-lactate dehydrogenase"
FT                   /function="Malate/lactate dehydrogenases"
FT                   /EC_number="1.1.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0196"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26347"
FT                   /protein_id="CBH26347.1"
FT                   /translation="MKDHQKIILVGDGAVGSSYAFACVNLSIGQEFGIIDIDKDRTIGD
FT                   AMDLSHAVPFSTPKKIYSANYSDCHDADLVVVTAGTAQKPGETRLDLVNRNIKIMKGIV
FT                   DEVMASGFDGIFLIASNPVDILTYATWKFSGLPKERVIGSGTSLDTARFRMSIADYLKV
FT                   DARNVHGYILGEHGDTEFPAWSHTTVGGLPITEWISEDEQGAMETIFVSVRDAAYEIIN
FT                   KKGATFYGVAAALARITKAILNNENAILPLSVYLDGHYGMNDIFIGAPAVVNRQGVRHI
FT                   VEMNLNDKEKEQMKKSADTLKKVLDDAMKQID"
FT   gene            200967..201590
FT                   /gene="ctc"
FT                   /locus_tag="lse_0197"
FT   CDS_pept        200967..201590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctc"
FT                   /locus_tag="lse_0197"
FT                   /product="ribosomal 50S general stress protein L25/Ctc"
FT                   /function="Ribosomal protein L25 (general stress protein
FT                   Ctc)"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0197"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26348"
FT                   /protein_id="CBH26348.1"
FT                   /translation="MATTLEVQKRETTQHSEVTRLRSEGKVPGIIYGYKSENVPVSVDS
FT                   LELIKAVRDNGRNAVFAVTVDGKKLNVLLHEYQVDPLKDTLVHVDLLAVDMNEEVETDV
FT                   RVVLVGNAPGVKAGGVLQQIIHDVKVSATPEKLPETIELDVSSLEIGDVLTTNDLPENK
FT                   DYVVQVEEEETVVTVSAPRAEEEPTTAEAPEPEALHGKDEEPVE"
FT   gene            201679..202263
FT                   /locus_tag="lse_0198"
FT   CDS_pept        201679..202263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0198"
FT                   /product="acetyltransferase, GNAT family"
FT                   /function="Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0198"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26349"
FT                   /protein_id="CBH26349.1"
FT                   /translation="MLDKSVPHIPVVMVNYDATNFPEFSLPEGYSFRFYEQGLEEAWCK
FT                   LQLETGQVASIEVIRERFQTEFGNEKEKLAKRCLFVQTANEEIVGTAMLWNGDTFGELA
FT                   SRIHWVAVLDTHGGKGIAKALLTKILSLNKNDFVYLTTQTGSYQAIYLYQKFGFIKYIG
FT                   ETPLNWKTTNFPEQNEKAWQIIENKISEHKR"
FT   gene            202369..202923
FT                   /gene="pth"
FT                   /locus_tag="lse_0199"
FT   CDS_pept        202369..202923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="lse_0199"
FT                   /function="Peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0199"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26350"
FT                   /protein_id="CBH26350.1"
FT                   /translation="MKLIAGLGNPGKKYERTRHNVGFMVVDELSFRHQTPWKKSKFNGM
FT                   VSEININGEKMLLVKPLTFMNASGVCIRPLMDYYNIPIEDVLIVYDDLDLPVGKIRLRQ
FT                   KGSAGGHNGMKSIIQHVKTQEFNRIRVGVNRPSHGEVINYVLGDFPKAEQPDIIEAIQK
FT                   SADAIEDFARTPFIEIMNKYN"
FT   gene            203046..206582
FT                   /gene="mfd"
FT                   /locus_tag="lse_0200"
FT   CDS_pept        203046..206582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="lse_0200"
FT                   /product="transcription-repair coupling factor"
FT                   /function="Transcription-repair coupling factor
FT                   (superfamily II helicase)"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0200"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26351"
FT                   /protein_id="CBH26351.1"
FT                   /translation="MKGLQQLIYEQKDIRAVLNSLDEKEKAQLVTGLTGSSRALFASVV
FT                   EGASKRPVVFVTHNLYHAQKLYDDLLSLMEADRLFLYPADELISSELSISSPELRGQRV
FT                   EALDFLISGKPGIVIVPVAGLRKMLPPVSLWKHFNISIVEGEEIDPEVLRQQLVTMGYT
FT                   MSGMVNTPGEFSVRGGIIDIYPITEEFPIRIELFDTEVDSLRFFDVETQRSTSRVEEFR
FT                   LLPATEIILDQSYYPDIVNRLEKKMMLTLNELKEKEDKQALVENLEEELEMLRSGVKPD
FT                   MFFKYIGLAYPDPASLFDYFPKNTAILLDEFARILETEESLEKEEAEWQTETLSRMETV
FT                   RDVQVSHSFKKSLEKNHSPKIYLTLFQKQMASMRVSKTTNIVYKQMQQFHGQMNVLKTE
FT                   LESWHKNNYAVVILAPNLERAEKMQQTLADYDMESTILKKESDVPKYGMVQFVVGTFQN
FT                   GFELPLAKVAIISESELFNKKAKKVKKRQKLSNAERIQSYSELKVGDYVVHINHGIARY
FT                   VGMETLDINGVHKDYLLLVYQGEDKLFIPVDQLDLVQKYVGAEGKSPRLNKLGGAEWKR
FT                   VKKKVQASVQDIADDLIKLYAEREAEKGYAFSPDEEMQREFEDAFPYQETDDQLRSIAE
FT                   IKKDMERPRPMDRLLVGDVGYGKTEVALRAAFKAIMDGKQVAFLVPTTILAQQHFETMK
FT                   ERFQGFPIEIGLLSRFRTKKQQTETLKGMKSGTVDIVVGTHRLLSKDVEYHDLGLLIVD
FT                   EEQRFGVTHKEKIKQMRSKIDVLTLTATPIPRTLHMSMLGVRDLSVIETPPANRFPVQT
FT                   YVAEQNNVLVREAIERELARDGQVYYLYNRVETITQKADEISAMVPDARVAIAHGQMGE
FT                   SELESVILSFLEGEFDVLVTTTIIETGVDIPNVNTLFVQDADRMGLSQLYQLRGRVGRW
FT                   NRIAYAYFMYQKDKILREEAEKRLSAIKEFTELGSGFKIAMRDLSIRGAGNILGAQQHG
FT                   FIDSVGFDLYSQMLKEAIEAKKPKEEQKQIVPVEIDIQADAYIPEYYITDGRQKIEMYK
FT                   RFRNIEGLNDFEELQSDMIDRFGEYPEEVEYLFTMTELKVHALEVGIESVKQEQNKITM
FT                   LFSESGTASIRGDVVMQIIGEFGRMVGVGMERTQLKITVNVQNKPLKEWLYQVKNLTEK
FT                   LRGALKEEVASD"
FT   gene            206618..208207
FT                   /locus_tag="lse_0201"
FT   CDS_pept        206618..208207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0201"
FT                   /product="polysaccharide biosynthesis family protein"
FT                   /function="Membrane protein involved in the export of
FT                   O-antigen and teichoic acid"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0201"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26352"
FT                   /protein_id="CBH26352.1"
FT                   /translation="MSERSMKRLMKGAAWLTVASLISKILSAVYRVPFQNMVGDVGFYI
FT                   FQQVYPIYGIAMTLALGGFPVVISKMLAEAEGDLRRQQIIMRAVFRMLRIVSIAIFVFL
FT                   FLFADIIAMMMGDAALSELIRVISFVFLLMPYLAFMRGFFQSTGEMIPTAISQTIEQII
FT                   RVVIILLGAGLALNMGLDLYDAGAMAMSGAIFGGVSGIFVLRHFYNKRLALGQGLQPAV
FT                   FAEKQEKVGIGRDFLRQSMAICVVSSMLILFQLVDSFQVYRLMSDSGIPDFIAKSLKGI
FT                   YDRGQPILQLGLVLSTGLALALVPMITAARVQGQQKELKRSILLAIKITLILSSAETVG
FT                   LIVIMRPLNQMLFQTPDGTFVLQLFMPAVFLSSLIIMLSSILQGFGKIIVPAVGVGIGL
FT                   VVKWIAGSILIPHYATVGASISTCIGLVVILLICYASLKQTIRVPFVEKNMLIRLVAAL
FT                   ILMAIVPCLIEWLVPFETRLGSTFQAIISALIGGGIFLVFALRYKLLGPKDFVFLPFGS
FT                   KLLALSKLVARK"
FT   gene            208230..208508
FT                   /locus_tag="lse_0202"
FT   CDS_pept        208230..208508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0202"
FT                   /product="S4 domain protein"
FT                   /function="Ribosome-associated heat shock protein
FT                   implicated in the recycling of the 50S subunit (S4
FT                   paralog)"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0202"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26353"
FT                   /protein_id="CBH26353.1"
FT                   /translation="MATTMRLDKYLKVSRLIKRRTVAKEVAEKGRIAVNGVTAKPGTNV
FT                   KSGDELVIRFGPKIVTAKIERLEENAKKEQATEMYTIIKEERTDESR"
FT   gene            208734..209120
FT                   /locus_tag="lse_0203"
FT   CDS_pept        208734..209120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0203"
FT                   /product="cell division protein DivIC, putative"
FT                   /function="Septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0203"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26354"
FT                   /protein_id="CBH26354.1"
FT                   /translation="MKKAKTKVARIENRYIKDTATMNKTRSRRRIALFRRLAFMAVIFA
FT                   VVGGLLTITYTQQVLSLKDKKEKQVEVDKKMVATKDEEEALNNQIKKLHDDDYIAKLAR
FT                   SEYYLSKDGEIIFNIPEENSKQKE"
FT   gene            209273..209701
FT                   /locus_tag="lse_0204"
FT   CDS_pept        209273..209701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0204"
FT                   /product="RNA-binding protein"
FT                   /function="Transcriptional accessory protein"
FT                   /EC_number="2.7.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0204"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26355"
FT                   /protein_id="CBH26355.1"
FT                   /translation="MSIEVGNKLQGKVTGITNFGAFVELEGGKTGLVHISEVADNYVKD
FT                   INDILTVGDEVTVKVMNIGDDGKIGLSIRKAVDRPDRPEKSYDRKPKYSKKPAGNYVKP
FT                   AESFEDIMSKFLKDSDERLTTIKRQTESKRGGRGAKRG"
FT   gene            209810..211756
FT                   /locus_tag="lse_0205"
FT   CDS_pept        209810..211756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0205"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted ATPase of the PP-loop superfamily
FT                   implicated in cell cycle control"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0205"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26356"
FT                   /protein_id="CBH26356.1"
FT                   /translation="MDDTTKRVHNYIEKHDLIWSDDKLLVAVSGGPDSLALLHFLQMSN
FT                   LVPKKAISVAHLNHGLRENAIKEQLIVRNYCEKHKIPFFIEEVNVKKRAETMQKGIEET
FT                   ARLARYEFFEKIMAEENINKLVLAHHADDQIETILMRLVRGSSSIGWSGIQPKRSMRGG
FT                   QAIRPFLSITKAEIIDYANRHELTYEIDESNSSPKYTRNRYRKEILPFLTKENPGVYAH
FT                   FERFSEETSEDFRYLEDLASDLLKKNLIKNGEQATLLLTSFKNEANPLQRRAIHLLLRY
FT                   LYNKDAGLITANHIYQIIQMIQSDNPSSSLNLPKKLTAKRSYNELHFQFGERDVPAEFY
FT                   HQLELNDRIELESKASIRLKLKSSVVQTNGLNGMLLDAADITLPLIVRNRVNGDRMTMK
FT                   GQAGSKKLKDIFIDAKIPRQERDNLPVITDYTGKILWIPGVKKSAYDREFSRNKKQYII
FT                   RYTRNLGGNESMHNDIQKVLISEDELQEKIRELGRELTTEYEGRNPLVVGVLKGATPFM
FT                   TDLLKRVDTYLEMDFMDVSSYGNGTVSSGEVKIIKDLNASVEGRDVLVIEDIIDSGRTL
FT                   SYLVDLIKYRKAKSVKLVTLLDKPAGRNVAIEADYVGFVVPNEFVVGYGLDYAERYRNL
FT                   PYIGVLKPEIYSE"
FT   gene            212104..214179
FT                   /gene="ftsH"
FT                   /locus_tag="lse_0206"
FT   CDS_pept        212104..214179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="lse_0206"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /function="ATP-dependent Zn proteases"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0206"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26357"
FT                   /protein_id="CBH26357.1"
FT                   /translation="MNRFFRNAIFYVIIFLVIIGIVASFNSNKEAAKDISYTEFMSKLE
FT                   DGKVKSLTIQPDRSVYTIKGEFKSSDKSSSDDKKTGLGQSKTSSTEFTTYALNSDTSLE
FT                   DLQSTVTKEGVKMDVEPAKQNSGWVTFLTSIVPFVIIFILFFFLMSQSQGGGGGKVMSF
FT                   GKSKAKLYNDDKKKVRFTDVAGADEEKQELVEVVEFLKDPRKFAELGARIPKGVLLVGP
FT                   PGTGKTLLARAVAGEAGVPFFSISGSDFVEMFVGVGASRVRDLFENAKKNAPCIIFIDE
FT                   IDAVGRQRGAGMGGGHDEREQTLNQLLVEMDGFGGNEGIIIIAATNRADVLDPALLRPG
FT                   RFDRQIMVDRPDVKGREAVLRVHARNKPLAKSVDLQAIAQRTPGFSGADLENLLNEAAL
FT                   VAARSDKKEIDMSDLDEASDRVIAGPAKKNRVISEKERRTVAYHEGGHVIVGMVLDEAE
FT                   VVHKVTIVPRGQAGGYAVMLPKEDRFLMTKAELMDRITGLLGGRVAEEVTFGEVTTGAS
FT                   NDFERATELARRMVTEWGMSDKIGPLQFTSGNGQVFMGRDFGSDKGYSDKIAYEIDTEV
FT                   QSLIRYCYDRAKTIITEHQEQHKLIAETLLKVETLDARQIRSLFDDGVMPPDIDTIDVE
FT                   AEYPSEKEELVGKSFEEEKEELKHEEHAVEKQDEPKEVTTEDAPNIEQTPNDKKDE"
FT   gene            214295..215074
FT                   /locus_tag="lse_0207"
FT   CDS_pept        214295..215074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0207"
FT                   /product="transcriptional activator, putative, Baf family"
FT                   /function="Putative transcriptional regulator, homolog of
FT                   Bvg accessory factor"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0207"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26358"
FT                   /protein_id="CBH26358.1"
FT                   /translation="MILVIDVGNTNCTVGVYKQQKLLRHWRMTTDRHRTSDELGMTVLN
FT                   FFSHANIAPADIQGIIISSVVPPIMHAMETMCVRYFNIRPLIVGPGIKTGLNVKVDNPR
FT                   EIGSDRIVNAVAASAEYGTPVIVVDFGTATTFCYIDESGVYQGGAIAPGIMISTEALYN
FT                   RAAKLPRVDIAESSQIIGKSTVASMQAGIFYGFVGQCEGIINEMKKQSNSSPVVVATGG
FT                   LARMITEKSSTVDILDPFLTLKGLELLYRRNKPTTEK"
FT   gene            215090..215974
FT                   /locus_tag="lse_0208"
FT   CDS_pept        215090..215974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0208"
FT                   /product="chaperonin (heat shock protein 33)"
FT                   /function="Disulfide bond chaperones of the HSP33 family"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0208"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26359"
FT                   /protein_id="CBH26359.1"
FT                   /translation="MNDYLVKALAYNGMARVYAAVTTETIKEAQKRHDTWSVSSAALGR
FT                   TMTGTLFLGAMQKEDQKITVKIEGDGPIGPIVADSNAQGQIRGFVTNPHVHFSELNDAG
FT                   KLDVRRGVGTSGMLSVVKDLGFGENFTGQTPIVSGEIGEDFTYYLATSEQINSSVGVGV
FT                   LVNPDDTIEAAGGFMLQLLPGATDEVIDEIEKNLTALPTVSRMIEAGETPETILAKLAG
FT                   GEEKLQILEKIPVSFECNCSKERFGSAIISLGKEEIRSMIEEDHGAEAECHFCRNTYDF
FT                   SEQELEKLYEEAK"
FT   gene            216086..217012
FT                   /gene="cysK"
FT                   /locus_tag="lse_0209"
FT   CDS_pept        216086..217012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="lse_0209"
FT                   /product="cysteine synthase A"
FT                   /function="Cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0209"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26360"
FT                   /protein_id="CBH26360.1"
FT                   /translation="MTIANSITDLIGKTPIVKLNRLPEAGSADVYVKLEFQNPGGSVKD
FT                   RIANAMIENAEKSGALKPGDTIIEPTSGNTGIGLAMVAAAKGYQAIFVMPETMSLERRK
FT                   LLQAYGAKLVLTPGPDGMKGAIAKAEELAKENNYFVPQQFHNPANPAVHEETTGPEIVE
FT                   AFGKDGLDAFIAGVGTGGTVTGVGHVLKKNYPDVKIYALEPEESPVLSGGSPSPHKIQG
FT                   IGAGFVPDTLDTKVYDGILKVSSEDALETAREVAKKEGILVGISSGATIKAALDLAKEL
FT                   GAGKKVLAIVASNGERYLSTPLYNFED"
FT   gene            217719..218534
FT                   /gene="folP"
FT                   /locus_tag="lse_0210"
FT   CDS_pept        217719..218534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="lse_0210"
FT                   /product="dihydropteroate synthase"
FT                   /function="Dihydropteroate synthase and related enzymes"
FT                   /EC_number="2.5.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0210"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26361"
FT                   /protein_id="CBH26361.1"
FT                   /translation="MKKWKKDHLGMVMGILNVTPDSFSDGGKYMQVEEAVIRAVQMAED
FT                   GAAIIDVGGISTRPGFSEVSTDEELARIIPVIKAIREKLPDIWISVDSWRAAVAEQAIL
FT                   AGANMINDQWGAKKEPQIAEIAAKYDVPICLMHNRENKNYENFFEDVKKDLLESVAIVK
FT                   SASVPDEHIILDPGFGFVKTPAQNLEVLRRIDEIVALGYEVLLGTSRKSTIGLILGGTP
FT                   EDRMEGTGATTVYGFAKGCTITRVHDVLPIARMVRMADAITGKLDITKL"
FT   gene            218550..218924
FT                   /gene="folB"
FT                   /locus_tag="lse_0211"
FT   CDS_pept        218550..218924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="lse_0211"
FT                   /function="Dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0211"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26362"
FT                   /protein_id="CBH26362.1"
FT                   /translation="MDKIYLNELAFYGYHGVLSEENKLGQKFIISLVLGLSTKKAGISD
FT                   NVNDTVSYADVYETVKEIAEGKPFKLIEALAEKIATEVLVNYPLLNEVTVKLIKPNPPI
FT                   PGHYHSVAVEIERKRSELNG"
FT   gene            218917..219396
FT                   /gene="folK"
FT                   /locus_tag="lse_0212"
FT   CDS_pept        218917..219396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="lse_0212"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /function="7,
FT                   8-dihydro-6-hydroxymethylpterin-pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0212"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26363"
FT                   /protein_id="CBH26363.1"
FT                   /translation="MAKAFLSIGTNIGERLDNLNSAVSGLAAVEQIKIIKVSSVYETDA
FT                   VGYEDQAAFLNIVVEIETSFAPVELLDFCLALELELGRVRLFKWGPRLIDIDILLYEDV
FT                   KLDTEKLKIPHPYMKERAFVMIPLIEISPDKANIQVNQVVLAEQGVRKSKKQVNW"
FT   gene            219470..220465
FT                   /locus_tag="lse_0213"
FT   CDS_pept        219470..220465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0213"
FT                   /product="dihydrouridine synthase family protein"
FT                   /function="tRNA-dihydrouridine synthase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0213"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26364"
FT                   /protein_id="CBH26364.1"
FT                   /translation="MFQIGNVEIKNQVVVAPMAGISNSAFRLTVKEFGAGLVCCEMISD
FT                   KGIAYRNAKTLDMLYIDEKEKPLSLQIFGGEKETLVEAAKFVAENTTADIIDINMGCPV
FT                   NKIIKCEAGAKWLLDPNKVYDMVAAVVDAVDKPVTVKMRIGWDEEHVFAIENALAAERA
FT                   GAAAVAMHGRTRVQMYEGSANWDVLRDVKRELKIPFMANGDVRTPEDAKRILEHTGADG
FT                   VMIGRAALGNPWMIYRTVKYLETGELLPEPEPREKMQTAMLHLNRLVELKGENIAVREF
FT                   RQHAAYYLKGARGSTRAKVAANQATKQAEMEAILNEFVLQYEEKELTKQN"
FT   gene            220580..222076
FT                   /locus_tag="lse_0214"
FT   CDS_pept        220580..222076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0214"
FT                   /product="lysyl-tRNA synthetase"
FT                   /function="Lysyl-tRNA synthetase (class II)"
FT                   /EC_number="6.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0214"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26365"
FT                   /protein_id="CBH26365.1"
FT                   /translation="MSNENHEELNDQLIVRREKVETLREEGVDPFGGKFIRSISPEEIE
FT                   TKFADKSKEELEEASIEVTVAGRIMTKRVKGKVGFTHIQDRFHQLQIYIRKDAIGEDAY
FT                   AVFKIADLGDIIGIKGTIFRTNTGELSVKATEFTLLSKSLRPLPDKYHGLKDVEQRYRQ
FT                   RYLDLITNEESQNRFVMRSKILKYTRDYMDNQGFLEVETPVLHTIAGGAAAKPFITHHN
FT                   ALDMELYLRIALELHLKRLIVGGMDKVYEIGRVFRNEGTSTRHNPEFTMLESYAAYEDY
FT                   EDVMDLVEGLVSTVCEQVNGTTKITYGEYDVDLTPKWRRIHMADAVKEYVGVDFWNVTS
FT                   DEEAHQLAKEHNVPVTKHMTYGHILNEFFETFVEEKLIQPTFVYGHPVEISPLAKKNKE
FT                   DERFTDRFELFIVGREHANAFSELNDPIDQRERFEAQMKEREQGNDEAHGMDADFLEAL
FT                   EYGLPPTGGLGIGIDRLVMLLTDAPSIRDILLFPTMKHRD"
FT   gene            222532..224069
FT                   /locus_tag="lse_r001"
FT   rRNA            222532..224069
FT                   /locus_tag="lse_r001"
FT                   /product="16s_rRNA"
FT   gene            224324..227253
FT                   /locus_tag="lse_r002"
FT   rRNA            224324..227253
FT                   /locus_tag="lse_r002"
FT                   /product="23s_rRNA"
FT   gene            227334..227448
FT                   /locus_tag="lse_r003"
FT   rRNA            227334..227448
FT                   /locus_tag="lse_r003"
FT                   /product="5s_rRNA"
FT   gene            227457..227529
FT                   /locus_tag="lse_t002"
FT   tRNA            227457..227529
FT                   /locus_tag="lse_t002"
FT                   /product="tRNA-Val"
FT                   /anticodon="(pos:227490..227492,aa:Val)"
FT   gene            227538..227613
FT                   /locus_tag="lse_t003"
FT   tRNA            227538..227613
FT                   /locus_tag="lse_t003"
FT                   /product="tRNA-Thr"
FT                   /anticodon="(pos:227571..227573,aa:Thr)"
FT   gene            227652..227724
FT                   /locus_tag="lse_t004"
FT   tRNA            227652..227724
FT                   /locus_tag="lse_t004"
FT                   /product="tRNA-Lys"
FT                   /anticodon="(pos:227685..227687,aa:Lys)"
FT   gene            227730..227811
FT                   /locus_tag="lse_t005"
FT   tRNA            227730..227811
FT                   /locus_tag="lse_t005"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:227764..227766,aa:Leu)"
FT   gene            227822..227893
FT                   /locus_tag="lse_t006"
FT   tRNA            227822..227893
FT                   /locus_tag="lse_t006"
FT                   /product="tRNA-Gly"
FT                   /anticodon="(pos:227854..227856,aa:Gly)"
FT   gene            227915..228000
FT                   /locus_tag="lse_t007"
FT   tRNA            227915..228000
FT                   /locus_tag="lse_t007"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:227949..227951,aa:Leu)"
FT   gene            228012..228085
FT                   /locus_tag="lse_t008"
FT   tRNA            228012..228085
FT                   /locus_tag="lse_t008"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:228046..228048,aa:Arg)"
FT   gene            228096..228169
FT                   /locus_tag="lse_t009"
FT   tRNA            228096..228169
FT                   /locus_tag="lse_t009"
FT                   /product="tRNA-Pro"
FT                   /anticodon="(pos:228130..228132,aa:Pro)"
FT   gene            228187..228262
FT                   /locus_tag="lse_t010"
FT   tRNA            228187..228262
FT                   /locus_tag="lse_t010"
FT                   /product="tRNA-Ala"
FT                   /anticodon="(pos:228220..228222,aa:Ala)"
FT   gene            228549..230086
FT                   /locus_tag="lse_r004"
FT   rRNA            228549..230086
FT                   /locus_tag="lse_r004"
FT                   /product="16s_rRNA"
FT   gene            230341..233270
FT                   /locus_tag="lse_r005"
FT   rRNA            230341..233270
FT                   /locus_tag="lse_r005"
FT                   /product="23s_rRNA"
FT   gene            233351..233465
FT                   /locus_tag="lse_r006"
FT   rRNA            233351..233465
FT                   /locus_tag="lse_r006"
FT                   /product="5s_rRNA"
FT   gene            233610..234068
FT                   /gene="ctsR"
FT                   /locus_tag="lse_0215"
FT   CDS_pept        233610..234068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctsR"
FT                   /locus_tag="lse_0215"
FT                   /product="transcriptional regulator CtsR"
FT                   /function="Transcriptional repressor of class III stress
FT                   genes"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0215"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26366"
FT                   /protein_id="CBH26366.1"
FT                   /translation="MKNISDIIEAYLKQVLESSEAVEIKRSEIADKFECVPSQINYVIN
FT                   TRFTMERGYIVESKRGGGGYIRIIKVRMNDKLQLLEAIISMVHDKKVSQSFSEDVLLRL
FT                   LEEDVITKKEARLMMAALDREVLSLPLPDRDVLRSRILEAMLVALKYD"
FT   gene            234082..234600
FT                   /locus_tag="lse_0216"
FT   CDS_pept        234082..234600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0216"
FT                   /product="UVR domain protein"
FT                   /function="Uncharacterized protein with conserved CXXC
FT                   pairs"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0216"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26367"
FT                   /protein_id="CBH26367.1"
FT                   /translation="MICQKCGENKAVIAIQQLNDAGKVESLYLCENCAAEEAISSEKDL
FT                   VKAMDTFSEVALDFLTLLQKEENSPEKLVCENCYLTFEDFLQTNRVGCEECYSAFQAQL
FT                   IPIIGRVQNGYKKHVGKVPIEVEHAEDVQNEIIGLQEKLAQLVKNEEFEEAAIVRDEIR
FT                   ALKAGGEAK"
FT   gene            234597..235619
FT                   /locus_tag="lse_0217"
FT   CDS_pept        234597..235619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0217"
FT                   /product="ATP:guanido phosphotransferase family protein"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0217"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26368"
FT                   /protein_id="CBH26368.1"
FT                   /translation="MNVFEPRLSSWLENEGDDDDVVLSSRIRLARNLKGEHFPIYEQKE
FT                   EIVNSIADVFDENFTLFKMNEISKLEKALLVEKHLISPYLMKKSQHGAVLLNEEENVSI
FT                   MLNEEDHLRIQCMTPGLRLFDALEAALQIDNYVEQKLTYAFDKQFGYLTSCVTNIGTGM
FT                   RASVMVHLPGLVTTKRIKNVIEAIRSLGFVVRGIYGEGSMPASNIFQVSNQVTLGKTET
FT                   EIVEDLTQVMEQIIMQERVARTTLKQKFHIALEDRVFRSYGLLRNCRIISIREAADAIS
FT                   DIRLGVELGFFEHISRQKMNELILFSQPAFLRREAGRDMDELEEKVIRAKVIREILGDN
FT                   "
FT   gene            235648..238110
FT                   /gene="clpC"
FT                   /locus_tag="lse_0218"
FT   CDS_pept        235648..238110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="lse_0218"
FT                   /product="ClpC ATPase"
FT                   /function="ATPases with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0218"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26369"
FT                   /protein_id="CBH26369.1"
FT                   /translation="MMFGRFTQRAQKVLALSQEEAMRLNHSNLGTEHILLGLVREGEGI
FT                   AAKALYELGVSSEKVQQEVEGLIGHGEKAVTTIQYTPRAKKVIELSMDEARKLGHTYVG
FT                   TEHILLGLIREGEGVAARVLSNLGISLNKARQQVLQLLGGGDATGAGRQTNTQATPTLD
FT                   SLARDLTVIAREDNLDPVIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQ
FT                   QIVRNEVPETLRGKRVMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNVILFIDELH
FT                   TLIGAGGAEGAIDASNILKPPLARGELQCIGATTLDEYRKYIEKDAALERRFQPIKVDE
FT                   PSVEESIQILHGLRDRYEAHHRVAITDEALDAAVRLSDRYISDRFLPDKAIDVIDEAGS
FT                   KVRLKSFTTPKNVKEMENNLTDLKKEKDAAVQGQEFEKAAALRDKEHKLKKSLEETKAN
FT                   WKEKQGLDHSEVTEDIVAEVVASWTGIPVAKLAETETNKLLNMEKLLHERVIGQDAAVK
FT                   AVSLAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAESMFGDEDSMIRIDMSEY
FT                   MEKFSTARLVGAPPGYVGYEEGGQLTEKVRQKPYSVVLLDEIEKAHPDVFNMLLQVLDD
FT                   GRLTDSKGRVVDFRNTVIIMTSNIGAQEMKQDKSMGFNVTDPLKDHKAMEHRVLQDLKQ
FT                   AFRPEFINRIDETIVFHSLQEKELKQIVTLLTAQLTKRLSERDIHVKLTEGAKSKIAKD
FT                   GYDPEYGARPLKRAIQKEVEDMLSEELLRGNIKVGDTIEIGVKDGKLEVRQKAAPKKKA
FT                   TPKKVKTK"
FT   gene            238262..239635
FT                   /gene="radA"
FT                   /locus_tag="lse_0219"
FT   CDS_pept        238262..239635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="lse_0219"
FT                   /product="DNA repair protein"
FT                   /function="Predicted ATP-dependent serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0219"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26370"
FT                   /protein_id="CBH26370.1"
FT                   /translation="MAKAKRTTKFVCQACGYESPKWMGKCPNCNEWNQMVEALEPSKKS
FT                   RSAFNHTGEVAKATPITQIASEEEARVETRMPELNRVLGGGVVPGSMVLVGGDPGIGKS
FT                   TLLLQVSAQLTLTNKKVLYISGEESIKQTKLRAERLQVSGDNLYVYAETNLEAVQETID
FT                   FVKPDFVVIDSIQTVYHPDVTSAAGSVSQVRECTAALMRIAKMQNIAIFIVGHVTKEGA
FT                   IAGPRLLEHMVDTVLYFEGERHHAYRILRAVKNRFGSTNEIGIFEMRDVGLVEVANPSE
FT                   VFLEERLEGASGSTVVASMEGTRPVLVEIQALVSPTMFGNAKRMATGIDYNKVSLIMAV
FT                   LEKRVGLMLQNQDAYLKAAGGVKLDEPAVDLAIAVSVASSYRDKPTKSTDCFIGELGLT
FT                   GEIRRVARIEQRVQEAAKLGFKRIFIPKNNEGAWKIPKDVQVVGVETIGEALKKALPD"
FT   gene            239769..240842
FT                   /locus_tag="lse_0220"
FT   CDS_pept        239769..240842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0220"
FT                   /product="PIN/TRAM domain protein"
FT                   /function="Integral membrane protein (PIN domain
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0220"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26371"
FT                   /protein_id="CBH26371.1"
FT                   /translation="MLTWVIRVCFLILGGTTGVFSLPMLWMKLGIGHILLINNPYTNAL
FT                   IGALIFYLITFWAVKYVEAALNWLEEKLAKIAITTLIYGGLGLFVGLVIAFFASNALSQ
FT                   TNIPLLNSVVPVILTLVLGYLGFRIGISRRNEFGNFVNNRNAKKKTPEEERTEEKSKKT
FT                   YKILDTSVIIDGRIADILATGFLDGTVVIPLFVLAELQHIADSSDTLKRTRGRRGLDIL
FT                   NRIQKDESIQVEMYEGDFEDTPEVDSKLVKLAKVMGGIVVTNDYNLNKVCEFQNVPVLN
FT                   INDLANAVKPVVLPGEKMTVLMVKDGKEHNQGVAYLDDGTMIVVEDGRKFINETIQVEV
FT                   TSVLQTSAGRMIFAKPS"
FT   gene            240862..241572
FT                   /gene="ispD"
FT                   /locus_tag="lse_0221"
FT   CDS_pept        240862..241572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="lse_0221"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /function="4-diphosphocytidyl-2-methyl-D-erithritolsynthase"
FT                   /EC_number="2.7.7.60"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0221"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26372"
FT                   /protein_id="CBH26372.1"
FT                   /translation="MNYELIFLAAGQGKRMNAKQNKMWLDLVGEPIFIHALRPFLADNR
FT                   CSKMIIVCQDAERKHVEKLMQQLNVAEKRVEIVKGGSERQFSVAAGLERAGSEQVILVH
FT                   DGARPFVTLDIIDRLLIGVEKNRAAICAVKVKDTVKRVKNDIVQETVDREDLWQVQTPQ
FT                   AFELPILQKAHGLAKEEQFLGTDEASLVERLPFPVTIVQGSYYNIKLTTPEDMPLAKGI
FT                   LGEINIESSIINED"
FT   gene            241595..243070
FT                   /gene="gltX"
FT                   /locus_tag="lse_0222"
FT   CDS_pept        241595..243070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="lse_0222"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /function="Glutamyl- and glutaminyl-tRNA synthetases"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0222"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26373"
FT                   /protein_id="CBH26373.1"
FT                   /translation="MSETKRVRVRYAPSPTGFLHIGNARTALFNYLFARHNDGDFIIRI
FT                   EDTDAKRNVEDGEESQMKNLKWLGMDWDEGVDVPGKYGPYRQSERQSIYEPLIQKLLDE
FT                   GLAYKCYCTEEELEAEREKQKANGEMPRYSGKCRHLTKEQQAEKEAQGFKPSIRFKVPA
FT                   NETITFNDMVKEDVSFESNGIGDFVIAKKDGIPTYNFAVAVDDHLMEISHVLRGDDHIS
FT                   NTPKQLLIYNAFGWEPPIFGHMTLIVNESRRKLSKRDGSIIQFIEQYRDLGYLPEALFN
FT                   FIAMLGWSPEGEEEIFSKEEFIKMFDPKRLSKSPALFDNVKLTWVNNQYVKKLPLNDVV
FT                   ELSLPHLQKAGVVSAKLDQAELDWVHKLVSLYHEQMSYGAEIVPLSEMFFADADSITFD
FT                   EEEKAVLAEETVPTVISAFKKELEALEVLEATEVKAAIKRVQKETGVKGKGLFMPIRIV
FT                   TTGEMHGPELPLAIEVLGKEKVINRLDTWLQNN"
FT   gene            243471..244085
FT                   /gene="cysE"
FT                   /locus_tag="lse_0223"
FT   CDS_pept        243471..244085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="lse_0223"
FT                   /product="serine O-acetyltransferase"
FT                   /function="Serine acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0223"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26374"
FT                   /protein_id="CBH26374.1"
FT                   /translation="MPTRLKEDIATIIKNDPATKSFFDAFLTNPGLHALWWHRVANFFY
FT                   RHKMVLFAKVLSQAARFLTNIEIHPGATIGKRLFIDHGAGIVIGETAEIGDDVTIFHGV
FT                   TLGGTGKDCGKRHPTVGDGALVSAGAKVLGPVEIGAGSRIGAGAVVLKDVPPGATVVGI
FT                   PAKVVRLNGRTVGHAVPKMDELTLRIAELENIVEKLLKEKE"
FT   gene            244092..245507
FT                   /gene="cysS"
FT                   /locus_tag="lse_0224"
FT   CDS_pept        244092..245507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="lse_0224"
FT                   /function="Cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0224"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26375"
FT                   /protein_id="CBH26375.1"
FT                   /translation="MAIQIFNTLKREKEPFKPLRDGEVKMYVCGPTVYNYIHIGNARPI
FT                   IVFDTVRRYFTYRGYDVKFVSNFTDVDDKLIKAANELKLTVPEVADRFIGAYFDDVDQL
FT                   NVAKASVNPRVTENMDEIIQLINTLIEKGYAYESAGDVYFRTKKFEDYGKLSGQALSEL
FT                   QHGARVEYNERKQDELDFTLWKAAKPGEIFWESPFGNGRPGWHIECSALAKKYLGDTID
FT                   IHAGGQDLIFPHHEDEIAQSEAATGKTFANYWMHNAFLNIDGEKMSKSLGNFITLHDVL
FT                   KDNDPNVIRFFMLSVHYRKPITLNDAILEDAKNGLERLMIAYQNIDHRIQTDDGEYVEE
FT                   AHQDEWLEQLTELKHAFEEDMDDDFNTANAITTFHELAKRANIYLSKEVVSVNVLREFL
FT                   SMMRLFAEVLGLKLEYTQTESLDDSEVEALIEERLQARNERNFARADEIRDILKEKNII
FT                   LEDTAQGTRFRRG"
FT   gene            245510..245920
FT                   /locus_tag="lse_0225"
FT   CDS_pept        245510..245920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0225"
FT                   /product="conserved hypothetical protein"
FT                   /function="dsRNA-specific ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0225"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26376"
FT                   /protein_id="CBH26376.1"
FT                   /translation="MAEVKDYKQLNGLALAYMGDAVYEKFIREYLLAAGKTKPNQLHKT
FT                   ATKFVSAKGQAVALKQLIADDFLTEEEAGIAKRGRNAKSYTVPKNTDPATYSMSTSFEA
FT                   VLGYLYLAGELNRLQELMEKSLEIVEKGVENN"
FT   gene            245920..246675
FT                   /locus_tag="lse_0226"
FT   CDS_pept        245920..246675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0226"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /function="rRNA methylases"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0226"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26377"
FT                   /protein_id="CBH26377.1"
FT                   /translation="MEQENEQEWIGGRNPVLEVLRSDRDIHKIYVQEGTQKGVLKQVLT
FT                   LAKERKVQVQFVPKQKIEKVVSGVHQGVAAQVAAYQYAELDDLFNAAEAKGEMPFFIIL
FT                   DELEDPHNLGSIMRTADSVGAHGIIIPKRRSVGLTQTVAKASTGAMEYVPVVRVTNMVR
FT                   TMEELQKRGLWIFGTDAKGSSDYRTMDVDMPLAIVIGSEGFGMSRLVREKCDFLIHLPM
FT                   RGKVTSLNASVAASLLLYEVYRKRFPLEK"
FT   gene            246678..247190
FT                   /locus_tag="lse_0227"
FT   CDS_pept        246678..247190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0227"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted RNA-binding protein containing a PIN
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0227"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26378"
FT                   /protein_id="CBH26378.1"
FT                   /translation="MEQILLVDGYNVIGAWPELSYLKERDLEAARDKLIEWMAEYQSYT
FT                   GYRVVVVFDAQFVRGVKRKSVKHRIEVVFTHEDETADEFIEQKAIEWKDARTQIIVATS
FT                   DYTEQWAIFGQGALRISSRELLFEIQEMSKKVGQKIKKIQEEMPKSNLNLNSDVISELE
FT                   KWRRGEQ"
FT   gene            247271..247876
FT                   /gene="sigH"
FT                   /locus_tag="lse_0228"
FT   CDS_pept        247271..247876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigH"
FT                   /locus_tag="lse_0228"
FT                   /product="RNA polymerase sigma-30 factor"
FT                   /function="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0228"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26379"
FT                   /protein_id="CBH26379.1"
FT                   /translation="MDNSVNQEEMTMLELARSGDTDALEYFFSKYQSVIYWKSTQYFLQ
FT                   GAERDDLIQEAMIGLFKAIRDYDKTKEASFRSFAEMCINRQLLSAVKRASRQKNIPLNN
FT                   SVSLDTPMAEDDVDWTLLDVISEKAAETPEDFLIKNEDLTHVARQLEEVTSEFEKQVLK
FT                   QYLEGKSYQEMAVFFGKKEKAIDNALQRVKKKMMKQFD"
FT   gene            247980..248129
FT                   /locus_tag="lse_0229"
FT   CDS_pept        247980..248129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0229"
FT                   /product="ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0229"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26380"
FT                   /protein_id="CBH26380.1"
FT                   /translation="MKKKTSLACSECGSRNYTVNVSGTQKETRLEVKKFCRHCNKHTLH
FT                   RETK"
FT   gene            248149..248328
FT                   /gene="secE"
FT                   /locus_tag="lse_0230"
FT   CDS_pept        248149..248328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="lse_0230"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0230"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26381"
FT                   /protein_id="CBH26381.1"
FT                   /translation="MSAIARFFRNVSSEMHKVTWPTRKELLTYTVTVVITVILFAVFFM
FT                   VIDFGIEQLIQLIM"
FT   gene            248540..248989
FT                   /gene="nusG"
FT                   /locus_tag="lse_0231"
FT   CDS_pept        248540..248989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="lse_0231"
FT                   /product="transcription antitermination factor"
FT                   /function="Transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0231"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26382"
FT                   /protein_id="CBH26382.1"
FT                   /translation="MGMSDKIFRVIVPEEEETEIKNGKTKTIKRKVFPGYVLVEIVMTD
FT                   DSWYVVRNTPGVTGFVGSSGSGSKPTPLLPEEADRILKSMGMVEKRAEADFEIGETVMV
FT                   KEGPFADFSGKVDEMDNDKGKAKVMVNMFGRETPVEVDFNQIEKI"
FT   gene            249047..249517
FT                   /locus_tag="lse_0232"
FT   CDS_pept        249047..249517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0232"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0232"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26383"
FT                   /protein_id="CBH26383.1"
FT                   /translation="MKQAKEIYLELKREAYFFELDFPLYLGNGQGAGELCMDYNEEDGY
FT                   MLYGYERGKRFSEFKTNDLEEFRYEVFLHLCWYMGMEFELRHRKEDIKRDDNILETDTR
FT                   KIAFEKTLQLLKIVNPAWIDKAALGYTAYLNLWRKKQNVYFDKEAMEFKVNP"
FT   gene            249642..250067
FT                   /gene="rplK"
FT                   /locus_tag="lse_0233"
FT   CDS_pept        249642..250067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="lse_0233"
FT                   /function="Ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0233"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26384"
FT                   /protein_id="CBH26384.1"
FT                   /translation="MAKKVIKEVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNAR
FT                   TADQAGLIIPVVITVFEDRSFTFITKTPPAAVLLKKAAKVEKGSGEPNKTKVASVTRAQ
FT                   VQEIAETKMPDLNAANVESAMLMVEGTARSMGITIQD"
FT   gene            250107..250796
FT                   /gene="rplA"
FT                   /locus_tag="lse_0234"
FT   CDS_pept        250107..250796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="lse_0234"
FT                   /function="Ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0234"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26385"
FT                   /protein_id="CBH26385.1"
FT                   /translation="MAKKGKKYQDALKQIDANKVYTAEEAVELAKKIDFAKFDATVEVA
FT                   FRLGVDPKKADQQIRGAVVLPNGTGKTQRVLVFAKGEKAKEAEAAGADYVGESEFVEKI
FT                   NQGWFDFDVIVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTMDVTKAVNEIKAGKVEY
FT                   RVDKAGNVHAAIGKVSFDAAKLVENFRTVNDVLQKAKPAAAKGTYVKNLSVTTTFGPGI
FT                   QVDPASL"
FT   gene            251043..251543
FT                   /gene="rplJ"
FT                   /locus_tag="lse_0235"
FT   CDS_pept        251043..251543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="lse_0235"
FT                   /function="Ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0235"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26386"
FT                   /protein_id="CBH26386.1"
FT                   /translation="MSKVLEAKQSAVEEIKGKLSASASTVIVDYRGLNVGEITELRKQL
FT                   RDAGIEFKVYKNSLTRRAVEANGYEGLEGALTGPNAIAFSNEDVVAPAKILNDFAKDHE
FT                   ALEIKAGVIEGKVASLEEIKALATLPSREGLLSMLCNVLQAPVRGLAIATKAVADQKEE
FT                   QEA"
FT   gene            251623..251985
FT                   /gene="rplL"
FT                   /locus_tag="lse_0236"
FT   CDS_pept        251623..251985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="lse_0236"
FT                   /function="Ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0236"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26387"
FT                   /protein_id="CBH26387.1"
FT                   /translation="MALNIEEIIASVKEASVLELNDLVKAIEEEFGVTAAAPVAVAAAG
FT                   GAAAEQTEFTLELSSAGDSKIKVIKVVREITGLGLKEAKELVDNAPKALKEGVTKEEAE
FT                   ELKAKLEEVGANVEVK"
FT   gene            252153..252536
FT                   /locus_tag="lse_0237"
FT   CDS_pept        252153..252536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0237"
FT                   /product="transcriptional regulator"
FT                   /function="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0237"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26388"
FT                   /protein_id="CBH26388.1"
FT                   /translation="MSIKSISKSEFEVMKVIWDFGRAVQYVDVAEKLAEKDYSWKKNTI
FT                   LTFLTRLVEKKLLRVKKIGRKNEYYALVSESEYLGQQTENFLEDIYEGDVKGLITNLVQ
FT                   KDLITADEIDDLQQYWKRMKSTE"
FT   gene            252731..253573
FT                   /locus_tag="lse_0238"
FT   CDS_pept        252731..253573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0238"
FT                   /product="membrane protein, putative"
FT                   /function="Antirepressor regulating drug resistance
FT                   predicted signal transduction N-terminal membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0238"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26389"
FT                   /protein_id="CBH26389.1"
FT                   /translation="MWLNRTGFEGVTSIVMDGKGLNMEHDAKITFWMTLLDYLWLIWLV
FT                   VFLLIFIYRIASYGNFKKYVFSGAQNVENINQLNMLAEISESLKIKKTVELLVNPLISS
FT                   PIFIGLKKQVIILPDKSYSVKELRYIFRHELVHCKRKDMFYVWAAQFYTCVYWFNPFMY
FT                   LMNKRIQKDRELACDEAVLNAISANEFFGYGDTLLSSLTKAGNYKEAHVSVSLHENAKA
FT                   LKERLEFIANYKKTTKPLKFILPIFLIVFCSIGITLSAYQAEILVKEKQKGIVIKKEW"
FT   gene            253697..254359
FT                   /locus_tag="lse_0239"
FT   CDS_pept        253697..254359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0239"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26390"
FT                   /protein_id="CBH26390.1"
FT                   /translation="MFGRKSVAIPKEYERFNQFSAEKERLLCIGSSTTECKHKVETKVD
FT                   GSNKALKLYYPKNRGAKVMKYWLPMFGINDSYSASQVISSWIEVNDYYSVIAAGDCSSV
FT                   LREITKTCQKNDYDEAELLASAGKIKIYGAFDIERLGYLVRVCFSLDLLSEQQAWNFLE
FT                   QLWDAAVLHYDNWDDYIVSFVNGQEGLGTNWYSDTLVSYVQLKKDTTSLLNKYQLKE"
FT   gene            254377..254862
FT                   /locus_tag="lse_0240"
FT   CDS_pept        254377..254862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0240"
FT                   /product="lipoprotein, putative"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0240"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26391"
FT                   /protein_id="CBH26391.1"
FT                   /translation="MKRVLSLVGVLLLALLVTGCGNSTSEEKVEEDTYVADIEGAQLEA
FT                   TFSHVGDNLRKVEQTMVYPMSYLGYEEGEKLDDATKKKLTEQVEAQYSEYKDGEGTSLE
FT                   TKFTDDGLELTMTVDLYKADASAISSLLGGGSTDPKNISYKETIADFESQGFKKKES"
FT   gene            254954..255559
FT                   /locus_tag="lse_0241"
FT   CDS_pept        254954..255559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0241"
FT                   /product="conserved hypothetical protein"
FT                   /function="16S RNA G1207 methylase RsmC"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0241"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26392"
FT                   /protein_id="CBH26392.1"
FT                   /translation="MANNHYYTNDETLKHNRKTWQIMLKGFNMQFTSDNGVFSKNTVDF
FT                   GSQVLIESFSLQEVSGKILDVGCGYGPMGLTVAKEFPESQVDMVDVNLRALELAGENAK
FT                   LNQITNVRIYESSVYENVADEDYQAIISNPPIRAGKQVVHAILEGAHAHLKVGGELWIV
FT                   IQKKQGGPSAKAKMETVFGNVEQVTKEKGYFIFKSIKE"
FT   gene            255909..257087
FT                   /locus_tag="lse_0242"
FT   CDS_pept        255909..257087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0242"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0242"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26393"
FT                   /protein_id="CBH26393.1"
FT                   /translation="MLTLKGKYNEAKVFTDNLDESTIGQIITICNQEFAKERKIRIMPD
FT                   THRGHGCVIGTTMTIQDKIVPNLVGVDIGCGLHVVKLKSGKLKMNFEKLDKVIRERIPS
FT                   GHSTHDKAIAVFDLENVIAPIHRGWASRSIGTLGGGNHFIEVNQGVDGIYLVIHSGSRI
FT                   LGKEIAEYHQEVAYQKLSQLRKEFKISATDAKKQGNLEDETWWNEARELIKLPYELSYV
FT                   TQTDLDNYLADMEIAQTFAAYNRSVMAETILKAMKWDKAVVSSFDCVHNYIDLENKMLR
FT                   KGATSAQLGEQIIVPLNMRDGSILATGKGNADWNYSAPHGAGRILSRSKAKAQISLESY
FT                   QAAMKNIWTTSVSKKTLDEAPKAYKSAKQLLADVEDTMEIQEIIKPLYNFKG"
FT   gene            257586..261140
FT                   /gene="rpoB"
FT                   /locus_tag="lse_0243"
FT   CDS_pept        257586..261140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="lse_0243"
FT                   /product="DNA-directed RNA polymerase beta subunit"
FT                   /function="DNA-directed RNA polymerase, beta subunit/140 kD
FT                   subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0243"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26394"
FT                   /protein_id="CBH26394.1"
FT                   /translation="MSGHSGHDVKYGRHRTRRSFARISEVLELPNLIEIQTASYQWFLD
FT                   EGLREMFRDISPIEDFAGNLSLEFIDYDLGEPKYSVEESKNRDANYAAPLRVKLRLINK
FT                   ETGEVKDQEVFMGDFPLMTEMGTFIINGAERVIVSQLVRSPGVYFNGKLDKNGKKGFGS
FT                   TVIPNRGAWLEYETDAKDVVHVRIDRTRKLPVTVLLRALGFGSDQEIIDLIGDNDYLRN
FT                   TLEKDNTDNAEKALLEIYERLRPGEPPTVDNARSLLVSRFFDPKRYDLASVGRYKINKK
FT                   LHLKNRLFNQTLAETLVDPETGEIIASKGDILDRRNLDQIIPNLENGVGFRTLRPADGV
FT                   MEDSVLVQSIKIYAPNDEEKEINIIGNAYIEENVKHITPSDIISSISYFFNLLHGVGDT
FT                   DDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDMTTITPQQLINIRPVVAS
FT                   IKEFFGSSQLSQFMDQTNPLGELTHKRRLSALGPGGLTRERAGYEVRDVHYSHYGRMCP
FT                   IETPEGPNIGLINSLSSFAKVNKFGFIETPYRRVDPGTNRVTDKIDYLTADEEDNYVVA
FT                   QANSKLDEHGTFTEEEVMARFRSENLAVEKERIDYMDVSPKQVVSVATACIPFLENDDS
FT                   NRALMGANMQRQAVPLMHPEAPFVGTGMEHVSAKDSGAAVTAKHDGIVEHVEAREIWVR
FT                   RVSLVDGKEVTGGIDKYTLRKFVRSNQGTCYNQRPNVAEGDRVVKGEILGNGPSMDSGE
FT                   LALGRNVLVAFMTWDGYNYEDAIIMSERLVKDDVYTSIHIEEFESEARDTKLGPEEMTR
FT                   DIPNVGEDALRDLDERGIIRVGAEVKDNDLLVGKVTPKGVTELTAEERLLHAIFGEKAR
FT                   EVRDTSLRVPHGGGGIVLDVKIFTREAGDELPPGVNQLVRVYIVQKRKIHEGDKMAGRH
FT                   GNKGVISRILPEEDMPFMPDGTPVDIMLNPLGVPSRMNIGQVLELHLGMAARALGIHVA
FT                   TPVFDGANEEDVWSTVEEAGMARDAKTVLYDGRSGEAFDNRISVGVMYMIKLAHMVDDK
FT                   LHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTIKSDDVVGR
FT                   VKTYEAIVKGESVPEPGVPESFKVLIKELQSLGMDVKMLSADEEEIEMRDMDDDDFTNQ
FT                   NDAFNIVQPENAAAEKTE"
FT   gene            261314..264919
FT                   /locus_tag="lse_0244"
FT   CDS_pept        261314..264919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0244"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /function="DNA-directed RNA polymerase, beta' subunit/160
FT                   kD subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0244"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26395"
FT                   /protein_id="CBH26395.1"
FT                   /translation="MLDVNNFEYMKIGLASPDKIRSWSHGEVKKPETINYRTLKPERDG
FT                   LFCERIFGPMKDWECSCGKYKRVRYKGVVCDRCGVEVTKSKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVMDMSPRALEEIIYFASYVVTEPGDTPLEKKQLLSEREYRVYREKYG
FT                   KGFSAGMGAEAIKKILADIDLEKETNDLKEELKSAQGQRRTRAIRRLEVMEAFRNSGNN
FT                   PSWMVLDVLPVIPPEIRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVGRGLAHNIKSAKRKIERMSPEIWD
FT                   VLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVH
FT                   VPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLEREKAVGEGTIFK
FT                   DINEAQLAYQNGYVHLHSRIAVFAGSIPNERFTDEQRNQLLITTVGKLIFNTILPKSFP
FT                   YINEPTKFNLEIETPAKYFVDTTTDVRAHIAAQELIDPFKKKILGNIIAEVFKKFHITE
FT                   TSKMLDRMKDLGFKISTKAGMTVGIADILTLEEKHEILEKAHDTVEKITKSFRRGLITD
FT                   DERYERVIAVWNAAKDEIQGKLILSLDRLNPIFMMQDSGARGNISNFTQLAGMRGLMAD
FT                   PSGRIVELPITSNFREGLTVLEYFISTHGARKGLTDTALKTADSGYLTRRLVDVAQDVI
FT                   IREDDCGTDRGLTIKAIREGTEIIEPLEERLEGRYSRKTIRHPETNEVIARENDLITEA
FT                   IATQIVEAGIEEVTIRSAFTCNTKHGVCKKCYGKNLATGTEVEVGEAVGIIAAQSIGEP
FT                   GTQLTMRTFHTGGVAGDDITQGLPRIQEIFEARNPKGQAIITEVGGEVVSIEEGRDRQQ
FT                   EITIQGTDDRRSYNIPYTARLRVEEGTIVERGEALTEGSVDPKALIRVRDVLSVQEYLL
FT                   AEVQKVYRMQGVEIGDKHVEVMVRQMLRKIRVMDTGDTSILPGTLMDIHTFTEANREAI
FT                   LNGSQPATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVI
FT                   LGKLVPAGTGIGRYRKLKSEVIKETAEVTDEITNI"
FT   gene            264995..265543
FT                   /locus_tag="lse_0245"
FT   CDS_pept        264995..265543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0245"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0245"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26396"
FT                   /protein_id="CBH26396.1"
FT                   /translation="MITHVIWDMGETLNTVPNTKYDHHPLDTYPEVVLRKEACETLEKV
FT                   KQLGFKQAILSNTASSNTEIVKRVLANFGILDFFEFVYASNSELQPGKMEKPDKTIFDY
FT                   TLNELNIEASQAVMVGNTFESDIIGANRAGIHAIWLQNPEVCLQGERLPVVAPPFILPV
FT                   WDLSDVPDALVLLKKLTAH"
FT   gene            265623..267083
FT                   /locus_tag="lse_0246"
FT   CDS_pept        265623..267083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0246"
FT                   /product="glycosyl hydrolase, family 1"
FT                   /function="Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase"
FT                   /EC_number="3.2.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0246"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26397"
FT                   /protein_id="CBH26397.1"
FT                   /translation="MTEMKKQFPKGFLWGGATAANQVEGAYDVDGKGLSTADMVKFIPK
FT                   EERTQDHALDVSREEIEAIIAGKVEGRFPKRDGVDFYHHYKEDIALFAEMGFKTFRLSL
FT                   NWARIFPNGDDKEPNEKGLDFYDKVFDELLKYDIEPLVTLSHYETPLNLTLKYNGWADR
FT                   RVIGFFTNYAETVFKRYKNKVKYWLTFNEINVISLSAYTGGGVLLEGEENPLEVSYQAA
FT                   HHQFVASALATKLAHEIIPGAQVGCMLARMATYPATNNPDDVLKAQYENQQNLFFTDVH
FT                   ARGEYPSFMNRFFLENDINIVKEVGDDEILKAHTVDFISFSYYMSLSATASPEGDRSAG
FT                   NLMGGVKNEYLESSDWGWQIDPKGLRWTLNDLYSRYELPLFIVENGLGAYDTVEADGKI
FT                   HDDYRIDYLRKHIEQMKEAIADGVDLIGYTSWGPIDLVSASTSEMSKRYGFIYVDQDDW
FT                   GKGTLERSRKDSFFWYKKVIETSGEDLG"
FT   gene            267121..268329
FT                   /locus_tag="lse_0247"
FT   CDS_pept        267121..268329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0247"
FT                   /product="peptidase, M20/M25/M40 family"
FT                   /function="Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /EC_number="3.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0247"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26398"
FT                   /protein_id="CBH26398.1"
FT                   /translation="MQFFPVYKQKIKGKTRWKEGEEMEQEKKLQILKDIININSTNGHE
FT                   EQVANYLQKLLAEYNIKAEKVQYDKDRASLVSEVGTDNGPVLAFSGHMDVVDAGDVSKW
FT                   TFPPFEATESDGKIYGRGATDMKSGLAAMVIAMIELHEEKTKLNGKIKLLATVGEEVGE
FT                   LGAEQLTTQGYADDLDGLIIGEPSGHRIVYAHKGSINYTIKSIGKNAHSSMPEFGVNAI
FT                   DNLLLFYNEVEKYTKSVQTTNEILGDFIHNVTVISGGNQVNSIPEKAELQGNIRSIPEV
FT                   DNETIKQNLVKIINELNKKENVKLELIFDYDKLPVFSDKNSELVKIAKNVAKDIIKEEI
FT                   PLLGISGTTDAAEFTKAKKTFPVIIFGPGNETPHQVDENVSIDNYLEMVDVYKRIAVDF
FT                   LNK"
FT   gene            268458..268874
FT                   /locus_tag="lse_0248"
FT   CDS_pept        268458..268874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0248"
FT                   /product="transcriptional regulator, MarR family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0248"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26399"
FT                   /protein_id="CBH26399.1"
FT                   /translation="MVKKEERLGVLLWFRFSRFYNRNMKLTNQNLRAAGISTAQFDCIA
FT                   QIGLDGEITQQQLAEKLVVTKGNVTQLLTKLEEMGYLTRTKAGREKHIVLTEKGKACYN
FT                   ENVPKQEAFQQSQFDKLTRKEQKVLLQLLKKLGE"
FT   gene            268881..269840
FT                   /locus_tag="lse_0249"
FT   CDS_pept        268881..269840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0249"
FT                   /product="glyoxalase family protein"
FT                   /function="Lactoylglutathione lyase and related lyases"
FT                   /EC_number="1.13.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0249"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26400"
FT                   /protein_id="CBH26400.1"
FT                   /translation="MKLAGIHHVSVFTADARANFDFYTKIMGLRLVKKSVNQDDPYTYH
FT                   LYYGDEIGSPGTALTFFEVPNMAKNKPARNTISGLSLRVPNDEALRYWDKRLDDKRVFH
FT                   SKPIDQFGRKIIRLKDVDGLPISLISDETSTDVTEVSPWTDSPVPAEYAIRGLGPVRFS
FT                   VFKKEKTDQLLTKVLGFERIGAYEEDDKLVTVFKTGAVGLGGEVHVESRPDLEQGNLGA
FT                   GGIHHVAFRVPTDSDLIGWTEMIQDLGYHNSGYVDRFYFHSLYFRESNGILIELATDGP
FT                   GFQTDFSKENGTYVDLPPHLEDRREEILTHLQPLDTNK"
FT   gene            269912..270547
FT                   /locus_tag="lse_0250"
FT   CDS_pept        269912..270547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0250"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /function="Fructose-2,6-bisphosphatase"
FT                   /EC_number="5.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0250"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26401"
FT                   /protein_id="CBH26401.1"
FT                   /translation="MAEGLRTIYFVRHGKTEWNMTGQMQGWGDSPLVAEGIAGAKAVGE
FT                   VLKDTQIDAVYTSTSKRTKDTAAYILADRDIEIRALEELKEMNFGTWEGVTVTEIDEKH
FT                   PEERAKILHSPATYKAEVNGGETYYELAERLLQGVQKIVSETKSGNILVVSHGMSLTLL
FT                   LYLLQGGTVEDHRKEAPRILNTSISVVDYENGEFTLRKLNEIGHLDLK"
FT   gene            270629..272518
FT                   /locus_tag="lse_0251"
FT   CDS_pept        270629..272518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0251"
FT                   /product="transporter, putative"
FT                   /function="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0251"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26402"
FT                   /protein_id="CBH26402.1"
FT                   /translation="MKKVVKIFLHYFLGIIGIILISCVPAIFSKVTSWSSGTYVEALKS
FT                   IFSAIMHPTTWEITYQGSAEIFHVSLGDFITGPYAYTMKIIIASLLISLLIAYLLVILT
FT                   FRGPKWLRQALAGFSSLLQAFPDFSFIFLIQMLVVYIYQQTGIFTLNFYSLNGEQIYAA
FT                   PIVCLSIIPTVLFYKMMMLLMKNEWQAEYIELARGKGLTNTTILLRHATPNMAQSLFYQ
FT                   SKTIIWFILSAYLIVEFLFGIEGVLYYLLAGFNPVNTFLILALIFTPFYFFYALVDLWI
FT                   SRGKTLTSATITKIPLHWNSFQKTAAEKVDLKSRWRKSTLTIWKCLKRPSFSIPLAILT
FT                   IMLVVSLIYGLMGDTIHTLKFISDSSGKVTGMAPFKPNAEVWLGTDGAGNSILDQLLVG
FT                   VKYTLIIAVLIATLRVFIGYFLAVPLAFFSKRRTRSFVQSLADGMHYLPLSLLVFIVMV
FT                   NEYISYSGVFETSLFTRIAFQVLIMVVIVLPITTNRISSEISQVLKKEFVLNSLVFGGN
FT                   ARWILTKHINPQIWSKLILIWLEQLVQVLQMFVHLAILGIFIGGAVKGADDGMLNPVIP
FT                   ELSGLIANAKFVFANHQFWIILPALLIFMVLILCFQMIASSLLKMEEEGDRGY"
FT   gene            complement(272565..273659)
FT                   /locus_tag="lse_0252"
FT   CDS_pept        complement(272565..273659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0252"
FT                   /product="leucine rich repeat domain protein"
FT                   /function="Leucine-rich repeat (LRR) protein"
FT                   /EC_number="4.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0252"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26403"
FT                   /protein_id="CBH26403.1"
FT                   /translation="MKKFVLTTIACTALISFSPLGDQIEANASTPVNDTTNTQIKNLQV
FT                   SPPAAVNEIFPDDALSYKIAQKLGVSEDTVVTQDQLNTITELVYVDFGVEDLTGMEYLS
FT                   NLNTLNLSQNNISNLDSLANLSNLEVLSLNSNKITNLTALMNLPKLNDLELGINQISTL
FT                   PSFENLTNLEILNLSSNQLDDISELKTAPGLTNLSVSSNNITDISVVSELDQLQVFYCD
FT                   YNEITSLEGFRDNTTLTDLSASFNKITDITPLSSIPTLRSLTIEVNQISDFSSLENQLL
FT                   TTFDATGQEVYLPSVALGESTDIVIKDNKGATLTDWVWYTPGTYENNTLIWENAGNNSA
FT                   YFVNNVYPEFPSVTVDVYQTVTPN"
FT   gene            complement(273870..275306)
FT                   /locus_tag="lse_0253"
FT   CDS_pept        complement(273870..275306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0253"
FT                   /product="glycosyl hydrolase, family 1"
FT                   /function="Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase"
FT                   /EC_number="3.2.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0253"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26404"
FT                   /protein_id="CBH26404.1"
FT                   /translation="MEHQKRSAFPKDFLWGSASAAYQIEGAWDTDGKGKSVWDEYVRIP
FT                   GTTFKGTNGDVAVDHYHRYKEDVKLMAEAGLKAYRFSIAWTRIFPNGKGEVNEAGLQFY
FT                   DNLINELIKYDIEPLVTLYHWDIPQALFDEYGGWESRQVIEDFTNYSTTLFKRYGDRVK
FT                   YWISLNEQNIFVGMGYGQALHPPKVSDPKRMYAVNHIANLANASVIKAFHEIVPDGKIG
FT                   PSFAYTPHYPIDTDPKNVQAADDAEELNSYFWMDMYAFGRYPKAVWKYLEENDIAPVIE
FT                   DGDMELLASAKPDFMGVNYYQSATVAYNPLDGVGQNNEMNFTGKKGSTKETGVPGVYKK
FT                   LVNPFVKTTNWDWTIDPKGLQIALRRINSRYALPILITENGLGEFDKLVDGEVNDDYRI
FT                   DYLSAHATAIRDAISDGVDMLGYCTWSFTDLLSWLNGYQKRYGFVYVDRDVEDDAPMTR
FT                   IPKKSYYWYKKVIETNGEEL"
FT   gene            complement(275506..276318)
FT                   /locus_tag="lse_0254"
FT   CDS_pept        complement(275506..276318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0254"
FT                   /product="hydrolase, haloacid dehalogenase-like family"
FT                   /function="Predicted hydrolases of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0254"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26405"
FT                   /protein_id="CBH26405.1"
FT                   /translation="MYKLIAIDIDGTLLTDDHKVTTEVKDAIRQAKQKGVKVVLCTGRP
FT                   LVGVENYLTDLELREEGDYVISFNGAFVQDTFTKEVISHLTLGIEDLKEIYQVSLDSNL
FT                   HMHFFDDKALYTPNREIGKYTIVEAYLTGSQLIFKEIENVPDDFIMSKAMFIEEAPKLE
FT                   AGMEKMPESFKEKYHLVRSTPFYLEILNRDASKGNAVRELSEKLGIKQSEVICIGDQEN
FT                   DVTMLEFAGLGIAMGNAPEHIKELADYTTASNNDSGVAKAIQKFVLDK"
FT   gene            276455..276958
FT                   /locus_tag="lse_0255"
FT   CDS_pept        276455..276958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0255"
FT                   /product="acetyltransferase, GNAT family"
FT                   /function="Acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0255"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26406"
FT                   /protein_id="CBH26406.1"
FT                   /translation="MKRNYHVKFLNEKDVALAEAVCSASEDYYLMEQDKPASKSDALKI
FT                   ITEIPNGKTRFDKFVLAVLDENEQPIGLVDIVSDYPRKGRWFIGLLLLTPAARGNGLGK
FT                   VLHQTIKEWANDGGADSLTLGVLAENEKARGFFEHLGYTKAETKEATYGGKEHQVDIYA
FT                   LEIK"
FT   gene            complement(276994..277262)
FT                   /pseudo
FT                   /locus_tag="lse_0256"
FT   CDS_pept        complement(276994..277262)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0256"
FT   gene            complement(277227..277442)
FT                   /pseudo
FT                   /locus_tag="lse_0257"
FT   CDS_pept        complement(277227..277442)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0257"
FT                   /function="cAMP-binding proteins - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinases"
FT                   /db_xref="PSEUDO:CBH26408.1"
FT   gene            complement(277665..278507)
FT                   /locus_tag="lse_0258"
FT   CDS_pept        complement(277665..278507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0258"
FT                   /product="competence protein ComEC/Rec2-related protein"
FT                   /function="Predicted hydrolase (metallo-beta-lactamase
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0258"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26409"
FT                   /protein_id="CBH26409.1"
FT                   /translation="MKKGFLKVLLVFGLVTGLAIPSSIQAEAAAPSIKVHFIDVGQGDA
FT                   IYIKAPSGEDILIDAGNKGKGKTVVNYLKKQKVKDIEIMIASHPDADNIGGLPEVMNSI
FT                   KVKSLYAPKFTNTTAAYKNFVNTAKKKKLTIRNAKAGVKLPIKGVTAQFVGPVKSYGKT
FT                   DRNNWSAVLHVAYKKNTFLFTGDAQAKAEKDMINAKKKLRADVLKVSTQGSKVATSSTF
FT                   VNAVKPKYAIISVGKNSYDHPNSQTVKTLTKAKAKVYRTDKNKTIVVTGNGSSYKIGK"
FT   gene            complement(278525..279343)
FT                   /locus_tag="lse_0259"
FT   CDS_pept        complement(278525..279343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0259"
FT                   /product="hydrolase, haloacid dehalogenase-like family"
FT                   /function="Predicted hydrolases of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0259"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26410"
FT                   /protein_id="CBH26410.1"
FT                   /translation="MTKQYLICSDIDGTLLRSDQTVSEKTRDLIQKLENDGHIFSISTG
FT                   RMYRSAREVGFQVSDSGHVIASNGSYAAIRDEQLLKTTLAEKAIRDTYHIMRDFDLPLF
FT                   FFSTNTLFYTKEPPAFFQSLADKSRLDTGHDRFSLVSINDSSAFDENLHQFLNAIVVAE
FT                   EDASRLTDVRSALNEASGIRVLSSHHNNLEILPANSDKKTAVEALGKHYNIPRERIITF
FT                   GDGENDIGMLEYAGIGVAMENASDNVKAAANTITDTNEADGVYKFLKEFI"
FT   gene            279480..280451
FT                   /locus_tag="lse_0260"
FT   CDS_pept        279480..280451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0260"
FT                   /product="oxidoreductase, Gfo/Idh/MocA family"
FT                   /function="Predicted dehydrogenases and related proteins"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0260"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26411"
FT                   /protein_id="CBH26411.1"
FT                   /translation="MNELNWAIIGPGSIAHRFAEGMKQLNREIYAVGARSLEKGQAFAN
FT                   QYDIKNVYSDFDEMLTNPEIDVVYIATPHSNHYEFIMKSLHNGKHVLAEKAITVSSAEL
FT                   EEINTLAKEKSLIVKEAMTIFHMPLYKKLREIVDSGSIGKLKLIQVAFGSAKEKDPNNR
FT                   FYNMDLAGGALLDIGTYALSFARYFLTEAPNEVLTTMKKFETGVDEQSGILLKNKEEEL
FT                   AVVSLSFRAKVPKRGIVACEEGFITVDEYPRASRATVTNTTTGKVEEIVAGETDKALEY
FT                   EIIAMEESVATGENTTSELTNDVIAIMTDVRNQWGIKFPFEK"
FT   gene            complement(280494..281594)
FT                   /locus_tag="lse_0261"
FT   CDS_pept        complement(280494..281594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0261"
FT                   /product="sugar ABC transporter, ATP-binding protein"
FT                   /function="ABC-type sugar transport systems, ATPase
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0261"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26412"
FT                   /protein_id="CBH26412.1"
FT                   /translation="MAQLSLEHIYKIYDNKVTAVSDFNLEIDDKEFIVFVGPSGCGKST
FT                   TLRMIAGLEEISKGELSIDGKVMNNVAPKDRDIAMVFQNYALYPHMTVYDNMAFGLKLR
FT                   KMPKDAIKERVEHAANILGLTEYLKRKPSALSGGQRQRVALGRAIVRDAKVFLMDEPLS
FT                   NLDAKLRVQMRAEITKLHQQLDTTMIYVTHDQTEAMTMATRIVIMKDGVIQQVGSPKQV
FT                   YDHPVNMFVAGFIGSPAMNFFKGRLDGSNFIGDDFTIAVPEGKLKLLKDRGFDGKDIVF
FT                   GIRPEDIHDEPIVIEANPGYTFKATTIVAELTGAEFMLHSRVGTHEFVARVDARSEHQP
FT                   NEVLTLAFEMSKSHFFDPETEDNLTD"
FT   gene            281887..284037
FT                   /gene="nrdD"
FT                   /locus_tag="lse_0262"
FT   CDS_pept        281887..284037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdD"
FT                   /locus_tag="lse_0262"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /function="Oxygen-sensitive ribonucleoside-triphosphate
FT                   reductase"
FT                   /EC_number="1.17.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0262"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26413"
FT                   /protein_id="CBH26413.1"
FT                   /translation="MYVEQLNEQMVIKRDGRKASFDLIKIRNAIEASMKAINLEDEPFL
FT                   EEVLLEVVSELPNKADMTIDEIQNSVENTLMKSTYPDVARAYIEYRHDRDHERENITDM
FT                   HKSVEKLLQKDKTVINENANKDATVFNTQRDLTAGAVAKSYALKYMLPKHVSNAHLKGE
FT                   IHFHDLDYSPYHAMTNCCLIDIEGMLSKGFTIGNANVESPKSIQTATAQIAQIIANVAS
FT                   SQYGGCSVDRIDEVLSVYARLNFEKHQKDAAEWVVPEKQEGYAEEKTRKDIYDAMQSLE
FT                   YEINTLYTSNGQTPFVTLGFGLGKDWFAREIQKAILKVRIGGVGKDKHTAIFPKLVFSI
FT                   RRGTNLNAADPNYDIKQLALECSSKRMYPDVLNYDTLVRLTGDFKVPMGCRSFLPAWIN
FT                   ENGEHVNAGRNNLGVVTLNIPRIAIQSGGDKERFWEIFHDRMKTVKDALLFRLNRVRQA
FT                   RPENAPILYKYGAFGKRLQDGENVDQLFNKERSTISIGYIGLYEAATVFYGGEWEGDTA
FT                   AKDFTLNILKELKAYADNWKDEYGYWFSVYSTPSESLTDRFNRLDKEKYGVIKDITDKD
FT                   YYQNSFHYDVRKKITPFEKIDFEKDYPEYCSGGFIHYCEYPKMVHNTKALEAVWDYSYD
FT                   RVAYLGTNTPIDKCYECDFEGEFVPTEEGFKCPSCGNTDPEKADVVKRTCGYLGNPMKR
FT                   PMVHGRHVEISNRVKHMENLGE"
FT   gene            284030..284581
FT                   /gene="nrdG"
FT                   /locus_tag="lse_0263"
FT   CDS_pept        284030..284581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdG"
FT                   /locus_tag="lse_0263"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /function="Organic radical activating enzymes"
FT                   /EC_number="1.97.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0263"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26414"
FT                   /protein_id="CBH26414.1"
FT                   /translation="MNNPKPCEWKSTELSRGYIADYKSFNFVDGEGVRCSLYVSGCPFH
FT                   CEGCYNKAAQSFKYGKPYTKELEDDILKDIGHESVQGLTLLGGEPFLNTATCLSVVKRI
FT                   RTTYGHAKDIWSWTGYTWDEMMQETDDKLELLSLIDVLVDGRFEQKLFDPNLAFRGSSN
FT                   QRIIDVQKSLSQNEVVLYQL"
FT   gene            complement(284621..285292)
FT                   /locus_tag="lse_0264"
FT   CDS_pept        complement(284621..285292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0264"
FT                   /product="conserved hypothetical protein"
FT                   /function="cAMP-binding proteins - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0264"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26415"
FT                   /protein_id="CBH26415.1"
FT                   /translation="MKTIFNYQQFIQLSEKGNINFEKIIIPKRTQLIDNKEMSAHYVYL
FT                   IIDGYVATSLGQEATSIYTILGKGSFINYSNLLELNTQKFTFKTLSECVIYKYSFSDLE
FT                   YFLSMFPENFGFQFFIMKEISRHSFLKSLLSDCIPANKLELSFSNIGKFHGEPLEPNSV
FT                   MLPKAIRTKVIAAYSGLSKSSFYKQLALLTEQGKIEKTDNCWIVHDSELYEYVKTHGEE
FT                   N"
FT   gene            complement(285352..286131)
FT                   /locus_tag="lse_0265"
FT   CDS_pept        complement(285352..286131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0265"
FT                   /product="nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase familiy protein"
FT                   /function="Predicted amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0265"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26416"
FT                   /protein_id="CBH26416.1"
FT                   /translation="MWKLALCQTDVAFKYPDANYARMEKAITEAAKNGADVAILPEMWN
FT                   TGYALNELAGLADLNGERTKDFLSGLAEKHQIAIIGGSVAISERNKFSNTMYAFDRYGS
FT                   LLSSYKKVHLFQLMNEHLFIEPGNDTNLFRLNDVSCAGFICYDVRFPEWIRKHTSEGSE
FT                   VLFVSAQWPAERIVQWEQLLIARAIENQAFVVAVNRVGDDPQNHFNGHSLVIDPLGNII
FT                   ANAGEEEGNLYAEIDLNLVAETRGIIPIFTDRRPELY"
FT   gene            complement(286231..286893)
FT                   /locus_tag="lse_0266"
FT   CDS_pept        complement(286231..286893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0266"
FT                   /product="ABC transporter, permease protein"
FT                   /function="ABC-type metal ion transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0266"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26417"
FT                   /protein_id="CBH26417.1"
FT                   /translation="MSSFFEEWGPILWQGFLETLTMTGITLVIALAIGLPLGVFLILTR
FT                   KGGQSENLVVYSVLNWVINILRSLPFIILLFLMIPVTRAVVGTTIGIQGVILPLVVFTA
FT                   PYIARLMESALLEVDKGVIEAYQAMGISTPKIIWSVVIREARSGIVLGLTIATIGLIGA
FT                   TAMAGLVGAGGLGTIAYQYGFQRFEPTVMYTTIIILIIMVQALQSFGNFLSRRLKKD"
FT   gene            complement(286890..287906)
FT                   /locus_tag="lse_0267"
FT   CDS_pept        complement(286890..287906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0267"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /function="ABC-type oligopeptide transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0267"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26418"
FT                   /protein_id="CBH26418.1"
FT                   /translation="MIELHQVSKTFNVNGKTVEAVKNVSIKVKKGEIFGVVGYSGAGKS
FT                   TLVRCINLLERPDEGQVLIDGKNLSTLSSKELRVARRKIGMIFQGYNLLKTATVYDNIA
FT                   KPLQLEGVPKADIETRVNKYLSIVGLEDKRNNYPSQLSGGQKQRVAIARALAHEPEILL
FT                   SDEATSALDPETTEAILQLLLKINAELGITIFLITHELDVIQRICDRVAVMENGHLVEQ
FT                   GTVLDIFTKAKHATTKRFVGSEASFDIPQDLLEKYIATGKLVSLHFIGDEADEPALALV
FT                   SRKFDVLPSILAGGIDHLKNGTLGKLLVHLKGNEEEYNKAIAYLKESGVVVEEVELL"
FT   gene            complement(287921..288742)
FT                   /locus_tag="lse_0268"
FT   CDS_pept        complement(287921..288742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0268"
FT                   /product="ABC transporter, substrate-binding protein,
FT                   putative"
FT                   /function="ABC-type metal ion transport system, periplasmic
FT                   component/surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0268"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26419"
FT                   /protein_id="CBH26419.1"
FT                   /translation="MKKSTKGLGLLLASSLILGLAACGGGSDDKALSTKEITIGTTAGP
FT                   HQQIAEEVQKLAKKDGLEIKIKTFDDYNTPNTALNDGDLDANNYQTIPFLEQQKKDKGY
FT                   ELDVAFKTVAFPMGVYSNDIKDLKDLKKGDKIAVPNDPSNEYRGLKLFEDAGIIKLKDG
FT                   VEEKATKKDIAENPLDLEIVELEASQIPAQLDEVAAAAINTNFAMGAGLSINKDAIYHE
FT                   PTEDNPYPNVFVVRTENKDDEVVKTLEKYYHSDEVRDFIEKEFNGSVVPAF"
FT   gene            289119..290300
FT                   /locus_tag="lse_0269"
FT   CDS_pept        289119..290300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0269"
FT                   /product="aminotransferase, classes I and II"
FT                   /function="Aspartate/tyrosine/aromatic aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0269"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26420"
FT                   /protein_id="CBH26420.1"
FT                   /translation="MKISKRLQNLPDQFFSSLVEKVGKKVAAGHDVINLGQGNPDQPTP
FT                   AHIVAALKAASEKPNNHKYSLFRGKHELKQAAADFYAREYNVTVNPATEVAILFGTKTG
FT                   LVELPMCIMDPGDVMLLPDPGYPDYLSGTVLGEVQFETMPLIAENQFLPDFTKIPAKIA
FT                   EKAELMYLNYPNNPTGAIATADFFEETVAFAKENDITVAHDFAYGGIGFDGKKPISFLQ
FT                   TPGAKDIGIELYTLSKTYNMAGWRVGFAVGNKEVIEAINLIQDHMYVSLFPGIQDAAIE
FT                   ALSGDQTCVSQLNARYESRRNAFITACEKIGWTVVAPAGSFFAWMPVPEDFTSSEFADF
FT                   LLEEVSVAVADGSGFGEFGEGYVRVGLLMDEARLEEAVERVAKLHLFDKVPQG"
FT   gene            290508..291221
FT                   /locus_tag="lse_0270"
FT   CDS_pept        290508..291221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0270"
FT                   /product="two-component response regulator"
FT                   /function="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0270"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26421"
FT                   /protein_id="CBH26421.1"
FT                   /translation="MAEKKILVVDDEKPIADIVKFNLNKEGFDVYCAYDGDEALELVEE
FT                   VQPDLILLDIMLPGRDGIEVCREVRKKYDMPIIMVTAKDSEIDKVIGLELGADDYVTKP
FT                   FSNRELIARVKANLRRHSQVSSSAAEEEENSELEIGSLIIHPDAYVASKRGETIELTHR
FT                   EFELLHYLAKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPAWLV
FT                   TRRGVGYYLRNPEQE"
FT   gene            291409..293241
FT                   /locus_tag="lse_0271"
FT   CDS_pept        291409..293241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0271"
FT                   /product="two-component sensor histidine kinase"
FT                   /function="Signal transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0271"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26422"
FT                   /protein_id="CBH26422.1"
FT                   /translation="MHKMRFFQSVQFKLVIMYLLLIIVAMQVIGAYFVRELEGQLEKNF
FT                   QDSITNSITLLDYNAREEILKNTDNTVKLQNDIRELLVDYSRASSNIIEVRIVDEKGKI
FT                   LGTSNLNNQGVVGQKSNDPLVKRTLSLGTTSEDKIYKDESNKNNRVWVNVSSIKNKGEV
FT                   IGAIYLVADIESVYKQVDDITNIFITGTLIAMIITAVLGILLSRTITKPIVEMKRQAYA
FT                   MARGNYSRKVKVYGVDEIGELADSFNTLTKRVQEAQAMTERERRKLSSVLAYMTDGVIA
FT                   TDRRGKVILINTPAEKMLRVKHESANGRSIIDVLDIGDNFQFEDLMEVDGSLTMDRSTS
FT                   DKPYILRANFSVIQRETGFNNGVIAVLHDITDQEKVDQERRDFVSNVSHELRTPLTSMH
FT                   SYLEALSDGAWEDKEIAPRFLEVTQNETERMIRLVNDLLKLSRMDGGREQLEKSFVNFT
FT                   DFFNHIIDRFEMMKKETIMFKRHIPKEPVIIEIDEDKVMQVLDNIISNANKYSPDGGRI
FT                   SFYLKKYENEIEVSIADEGLGVPDEDLATIFDRFFRVDKARSREMGGTGLGLAIAREVI
FT                   EAHGGRIWAERNKSKGTIIKFTLPYSDLPEDDWE"
FT   gene            293241..294554
FT                   /locus_tag="lse_0272"
FT   CDS_pept        293241..294554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0272"
FT                   /product="putative secreted protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0272"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26423"
FT                   /protein_id="CBH26423.1"
FT                   /translation="MKKTGFRSFVLTLLVILSVVLSYLIWKGQPDYEAINVKEVEKTTI
FT                   DKTMTTSQVFRPYKLAVNSNGKNYQSLNADLLNELIAQGKSFSFSEVVLANKKNNEEYE
FT                   KLIHKNGTIEIIYPNNIPFSIFAQIFQVEGEGLESAFFNRIIFDINDTDTGLHSVYFAN
FT                   DDQDNIYQSSLQNKDIDKIEKIVKANESKLTENDKLILNKRNLFLSSDETKLNRKKYII
FT                   DSLEINQFTAALFQDSGAVKSEGNTYTDGSSVIEMDTENKVLEYVNPSQERTNPEDLSS
FT                   VKRAGLIQDSFNFINDHAGWTGDGAYYFTGYNGESATTNFSLFVDNLQVYNENGMADMS
FT                   VTEGIEAVYKYMRPYFRLDTDVPGEKKEETLPSSYSVYEELSSNPNLRAEDIQEIVPGY
FT                   HMTRSESSGMNRIVTLEPTWLYKYHNKWFIFQQTKEGE"
FT   gene            294557..295396
FT                   /locus_tag="lse_0273"
FT   CDS_pept        294557..295396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0273"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0273"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26424"
FT                   /protein_id="CBH26424.1"
FT                   /translation="MDWRRTQLIFIVTLLILNVFLAVIYFNKQLSDDPDTIGNETLEER
FT                   LKADNITYPNLSSKPTNGAIFTTERAAFTAKDVSDLSGQSITLKDNNKEIYSVLQTPIK
FT                   AGKKGNSADFKKFMETEIYRGESYEFWDYDKEAKTLTFNQLINNNMVLFDEAGQITFYL
FT                   DSNDQVVSYEQTWMSKQDDLKEKTNLMSAADALEAVYQHGELKQDSDVVSATFGYYTTV
FT                   QLPSGNVYFPVWCFEVEHADKTNYILVNAKDEQVINQSDNQTTTTPVSELSSRQNVK"
FT   gene            295515..296345
FT                   /locus_tag="lse_0274"
FT   CDS_pept        295515..296345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0274"
FT                   /product="metallo-beta-lactamase superfamily"
FT                   /function="Metal-dependent hydrolases of the beta-lactamase
FT                   superfamily I"
FT                   /EC_number="3.1.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0274"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26425"
FT                   /protein_id="CBH26425.1"
FT                   /translation="MFANKILTEKDTEQIRFSILASGSSGNATLVETGDQKILVDCGLS
FT                   GKKMEGLFAQVGRDMSDLDAILITHEHSDHIKGLGVLARKYKLPIYANAKTWQAMDNMI
FT                   GEVSSDQKFQFDMETVKSFGSMQVESFGVSHDAIEPMFYIFHKGNKKFVMITDTGYVSD
FT                   RMKGHIAGADAYLFESNHDVEMLRMGRYPWNVKRRILGDEGHVSNEDAAIAMSEVITDQ
FT                   TKRIYLGHLSKDNNMKELARMSVTQTLMAEGIDVGGNLEIFDTDPENATSIFTI"
FT   gene            296400..297932
FT                   /locus_tag="lse_0275"
FT   CDS_pept        296400..297932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0275"
FT                   /product="serine proteases"
FT                   /function="Trypsin-like serine proteases, typically
FT                   periplasmic, contain C-terminal PDZ domain"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0275"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26426"
FT                   /protein_id="CBH26426.1"
FT                   /translation="MKYINAKFAERKEDMDEKEKDLNENTEKESTPRKEVEDTLHTPES
FT                   SQPVQETPIVEGVTPEGEKFAGATEEAAEASSTHAFFEEASKEPAKPAPGPRRPGNAGG
FT                   GVPPNRVTTGGSGSGNGQPPKRGKHFVGYFLTALIGVIIGGLIIFFVAWDNGDNADNSS
FT                   TNGNKASKVEKVSVNTTSDVTKAVDKVQDAVVSVLNYQSTASLDGTTTSEQEASSGSGV
FT                   IYKKENGKAYIVTNNHVVADANKLEVTFTNGKKSEAKLLGTDEWNDLAVLEIDDKNVTT
FT                   VAAFGDSDSLKLGEPAIAIGSPLGTEFSGSVTQGIISGLNRAVPVDTNGDGTEDWEADV
FT                   IQTDAAINPGNSGGALINIEGQVIGINSMKISMENVEGISFAIPSNTVEPIIEQLETKG
FT                   EVERPSLGVSLRDVDTIPETQQQNVLKLPDGVDYGAMVQQVVSGSAADKAGLKQYDVIV
FT                   ELNGEKVTNSMTLRKILYGDEVKIGDKVKVKYYRDGKEKSTNIQLEAAKTTT"
FT   gene            298661..299140
FT                   /locus_tag="lse_0276"
FT   CDS_pept        298661..299140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0276"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0276"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26427"
FT                   /protein_id="CBH26427.1"
FT                   /translation="MNIQIVTVGKLKEKYLVQGIAEYLKRLSAYAKVNIVEVADEKAPE
FT                   VLSEAEMKQVKEKEGARILAKIPEDAYVIALAIDGKMKSSEEFAADLDKLATYGRSKVT
FT                   FVIGGSLGLSEAVLKRSDERISFGRLTLPHQLMRLVLVEQVYRAFRIVRGEPYHK"
FT   gene            299190..300404
FT                   /locus_tag="lse_0277"
FT   CDS_pept        299190..300404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0277"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26428"
FT                   /protein_id="CBH26428.1"
FT                   /translation="MEEIEMLVKNLQKEENLNEIRYLLCNTKLIDEWKFLFFRENSGVA
FT                   IPTNIFFQEAKLVSLGINGHENFSFLDKKQALDLSTQKKSQFGFVNCVNFDSNIISYMD
FT                   RLFLTRDKDNNLDLFLFLRNLLKYRRGDFTCYPYMYENCTKLDDSNILEGVRSSLKAFF
FT                   TFKEFNNVEEFDNYFYNEQVKEYPQNICKESEDFIQMMFQKKNEIDNKQELLFQKPIQA
FT                   LILQSAIIKFSSNKGIKFKIEQLFDFFVNQLGRFFERELAVCYLYLKNDRRTTRFFGKI
FT                   QKNSKNILNVIEGMSWDLYHIRQLEELMTRSEYEKADFEMHSLATFDNGLKEMLTIYPV
FT                   KSISFFESQRNVVFVYDFPNFIEEVDFHQYWSKRSPKKRNTIFEKTDWNYFVKSKEREL
FT                   LNLMN"
FT   gene            300568..301230
FT                   /locus_tag="lse_0278"
FT   CDS_pept        300568..301230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0278"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0278"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26429"
FT                   /protein_id="CBH26429.1"
FT                   /translation="MSFLKKYGFYFLLLGVLSDFLTPYILGIFYPGLNQMTMVMSVFGD
FT                   VASPVRGAFLVWSVVSGVLFVLALPAIYQSAFEQSRTLAILLVSAIGLYGIGDCIFTGL
FT                   FSIDTEQVTWTFSTWVHNIGSGLGYMGFLLFPLFLVLLYRKTGETVYSKLYLVLLIVSL
FT                   LSAGVYGLARIPAVNYLPVLDKIGFCQRVSFFFNYLPIVVFGVEGIRRNTQKFLVTK"
FT   gene            301552..304128
FT                   /locus_tag="lse_0279"
FT   CDS_pept        301552..304128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0279"
FT                   /product="type I restriction-modification system, M
FT                   subunit"
FT                   /function="Type I restriction-modification system
FT                   methyltransferase subunit"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0279"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26430"
FT                   /protein_id="CBH26430.1"
FT                   /translation="MITSEEIKRRLWDGANELRGSMDASRYKDYMLGLMFYKFLSDKTL
FT                   EIFKANSDCGQVSESELVEEYAKARADYGESLDKMIQGVLGYFVLPEYLYQTWLKDIAI
FT                   GEFEVQKVIDSLNNFERTISVSGDSDDFQGLFSSSTIDLTDTALGSNLNERSKNIKALI
FT                   ELFQDLNMVALQKSDVLGDAYEYLIGQFAMESGKKAGEFYTPRQVSEVMAQIAAKTSNI
FT                   TSIYDPTVGSGSLLLTVKKHLKEDVQKDLNYYGQEKNTATYNLTRMNLLLHGVRPEKMS
FT                   VKNGDTLSEDWPEDPNRPAEGVLFDAVVMNPPYSLANWNKSNLKVSDPRFEIAGVLPPD
FT                   SKGDFAFLLHGLYHLGQTGTMAIVLPHGVLFRGGTEGEIRKRLLNKNYIDTIIGLPGNL
FT                   FTNTGIPVCVLILKKNRTISDPVLVIDASRNFIKVGKQNVLQEKDIARIVDTYVERAEK
FT                   TGYSHLASREEIIENEYNMNIPRYVEAIDEEIPHDVDAHLYGGIPQANIDELKTLQTTV
FT                   KNVLDSSLKSIRDGYVQLEKPMDELTKEVLTDKNIIAKSDLIREKSQAFIENYWKKLHE
FT                   INNILDVNPLMEEMLVGIKELLSPFDGIDVYDGYQIIAEVWKKDLTHDAELIAGGGFYT
FT                   IGRIREANMVTKGSGNKKREEQDGWIGAILPNELIAKHLYSEELQVIEDKKARLAAVEA
FT                   ELSELVEATKVEDSDENVALYESLKKNTEGEPQDSFESKTVKAELKKITKESSSYALLK
FT                   QVDGLIAEKSVLGKEIKTKESELKEAVYERILVLTNEEIDELVFEKWFGTTVNELVKLI
FT                   ELPLKKELNILEQLHKRYAETLDDLDEESTKLEAELEKMMSELVVR"
FT   gene            304129..305418
FT                   /locus_tag="lse_0280"
FT   CDS_pept        304129..305418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0280"
FT                   /product="type I restriction-modification system, S
FT                   subunit, putative"
FT                   /function="Restriction endonuclease S subunits"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0280"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26431"
FT                   /protein_id="CBH26431.1"
FT                   /translation="MSDSKKKVPKRRFEEFSNANDWELRKLGGLMNITSVKRIHQSDWT
FT                   DKGVRFLRARDIVSASKGKNPSEYLYISKKLYDEHSKISGKVGVGDLLVTGVGSIGIPM
FT                   LIKHEEPLYFKDGNIIWFQNKKNIDGGFFYYSFNSHSIQKFIRDSAGIGTVGTYTIDSG
FT                   GKTPIYLPNKKEQQRIGTFFKQLDNTIALHQRKLEKIKALKTAYLSEMFPAEGETKPKR
FT                   RFAGFTDDWEQRKLDNSIKVMDGDRGSNYPHDSDFFDNGDTLFLDTGNVTKNGFKFDNV
FT                   KYITKEKDGQLRAGKLEKNDFVLTSRGTLGNVGFYDKFVYKRHPKLRINSAMLILRNTD
FT                   EQLSCSYLHTLLKGNLISDFMRKNQVGSAQPHITKSEFLKLDLNVPCDVKEQNKIGDFF
FT                   KNLDNTITLHQRKLQKLQNIKKAYLNEMFI"
FT   gene            305434..308541
FT                   /locus_tag="lse_0281"
FT   CDS_pept        305434..308541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0281"
FT                   /product="type I restriction-modification system, R
FT                   subunit, putative"
FT                   /function="Type I site-specific restriction-modification
FT                   system R (restriction) subunit and related helicases"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0281"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26432"
FT                   /protein_id="CBH26432.1"
FT                   /translation="MGNTIKKASEKAFQENFVKELQNYKWDAPDFLDGNKQKVTVNDLI
FT                   NHWRGELNRLNADQLEGVPLTDGEFKQVMSKVNKIKNSYDAAKLLAIEEGKGKIDGIYR
FT                   DDNPKVTRKQITLTIFKKAEVRGGESSYKIAREVEAPMTDEKDKTNRFDIVLLINGLPL
FT                   INVEQKRADKPLDEAFEQFKRYYRNGEYTNNFMAFSQMMVMTTEIETRYFATPKSIKDF
FT                   NQSFVFHWSDKNNKPMNNWKQIVANFLMIPMAHQMVGDYLIIDEAKEQENKRHMLMRPY
FT                   QVYALQAVEGAAFGWDQEDKIPHGGFVWHTTGSGKTITSFKTALFLSTRAGFDKVVFLV
FT                   DRRELDNRTSANFKSYATFESVSVDDTEHTYHLKKELKSSKAGIIVSTTFKLNSLVKEL
FT                   EESHDNSLADKKIVFIIDEAHRTTMGQMMGNIKKYFKKKGLFYGFTGTPLFDENEVKGK
FT                   VNDKSELINTTEKLFGKKLHNYTIDEAIADGNVLGFNVDYINTGEFENYDALRDKLIER
FT                   MLLEKPESGVKETTRLVCEYSELEVEKEAVKIGLLAYHDDTHIPRVVEEILANWETQSQ
FT                   AQTFNAILTVAYKKRVIAYYNEFKKQQQSSDKKINIAMTFSFGSENDPDNVAPETIEKM
FT                   FSDYAEFTGINLVAGDKKHGEAAYFEDVVERATRGGSGRNEKNIDLIIVADQLLTGYDS
FT                   KYLNTLYVDRHLKRQSLIQAYSRTNRVLDKRKEFGSVVNFQYPRMTEEEVNKALKLYGN
FT                   GGKSSLAIVDIYDTAVKKLRIKINKMILTLPDPTAWATLENDEIGKKEFFEAFRDAAIQ
FT                   WRKVEQYYEYVWKAGTFGTDEHTWLLYMGAYNNLMKEDQIPHEESISEPLPGKTRLSRN
FT                   QKIDAAHILSLIDSKVDSSGTTQFADKETLRLIYEDIQELSNRGEHNQAMLLKDFVEQE
FT                   LVPGKITSDITFDDAFEAWKREQEQVVIHAFAKEWGIIDQGDLLAKSVMAYSEMQPEVI
FT                   PYFEDLIGSVEYEIAENKVAGNQLEHKMKLREKMPEWIAETRQRYN"
FT   gene            308593..309552
FT                   /locus_tag="lse_0282"
FT   CDS_pept        308593..309552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0282"
FT                   /product="putative Mrr restriction system protein"
FT                   /function="Restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0282"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26433"
FT                   /protein_id="CBH26433.1"
FT                   /translation="MNKDWTKLKQSANGLPTFDSIIPYILEVLKNGEEATINTIRNRVY
FT                   EYLNIPAEIKMVIYPETKDFILANRFSFALSELYKAGALCRPKRGIYQLTASGKYLLKT
FT                   KGDKLTKKMLEEAPDYINYIKELSIRNERKGISTNVSEDIEKENPKKEVGNIIDNMNNE
FT                   VSIELLDKIRNSNPYFFEQLVVDLLSRMGYSGEGGSAKVTSRSNDGGIDGIINQDPLGT
FT                   STVYLQAKRYKEDNKINRADVQSFYGALASVRADRGVFITTSSYTSGAKEFAVNQGIVL
FT                   IDGIQLTELMLEYKVGVEAENQYTIFRIDNDYFELNNM"
FT   gene            309609..313214
FT                   /locus_tag="lse_0283"
FT   CDS_pept        309609..313214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0283"
FT                   /product="hypothetical protein"
FT                   /function="Superfamily I DNA and RNA helicases and helicase
FT                   subunits"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0283"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26434"
FT                   /protein_id="CBH26434.1"
FT                   /translation="MKKLELKAMEIIEFWRLIEFLNQKAFPVQSKDERKIQISTPEEIN
FT                   QNKLTVFEEITSQQTIKEKIQANEKLNEQLPITSTNFHILVGRMERKVIIDTLYQKFKD
FT                   RDTVENNPEKIAMYALKVNAEGKYIKGSLRLSPLLWGMTICCYYPDKLKTKLKLEEYYK
FT                   TIAIIEAKFFSEDENENEITTDILEDIFNYILKWFVNNYIHVNKTNYAVYCNKLIYTCF
FT                   KNQEEFDKYDETLEDHSELMLGFFQSDFEMVLNKLKIEGANSDFINYVTSLYEEGKQKN
FT                   LEQNRRNIREDDNLLYNILDPLKTPKGKWPSKYSPVLMQQVAINAYLQNKEKIFSVNGP
FT                   PGTGKTTLLKEVIAHNVVERAALFAEYKKADDAFETLSFRDGGKRFNSYDKFYSRYYDL
FT                   KNSNINDFSMLVTSSNNAAVENITKELPDYKELMNGIESEETAEIKSLFDQHKQQSELS
FT                   FNISRRDKNNKVNRGLVKRKDVYFTLLAHLLKHNNDKLEDKEILDEWGIISAPLGKRAN
FT                   LANYYYQVMMPIISHKDDARKLQKDFEIAKRKFKNQYQKVQELQQILHENTRINENKII
FT                   KLREIDHESKLIYDKISKQHNKIEYWKREDIKSKHEINQFSPELKQAGFQFEREKSKLI
FT                   SLKAETNVFERRKSEITHEIIKLEDKRKLREILLQKFVKSQRLLEIENLKVELFALSEN
FT                   EKLAIVAERQQSGVISDQIKEINELEQRKSVLENKCIDCQREINLSTHQIQWNRTELIK
FT                   LKKDAENVELESMQALKNLENNGTVLLDNEFFNKLHEQNVTVQLEAQLSNPWTTKQYDR
FT                   EREKLFYLALQVNKHFVLSSKNVKANLVNLSYLWGFKKNTDEEFCHFSARDRKSSFKAL
FT                   LNTLFLVTPVISTTFASVSRFLADIDEPDSLGQLIIDEAGQATPQMAVGALWRFKKAIV
FT                   VGDPKQVEPIVTDDIRLLMELFAREELSWYKGKLISVQSFADSLNYIGSYLSSNNQSEK
FT                   QWVGCPLVIHRRCLNPMFTISNKLSYDNTMLFQTAEPKENIKSGLVMPKSMWFSITGSE
FT                   VGNKNHHVPEQANKAVEIVEEAFRKQNGEADIYIISPFTSVIRGFVRGAQKSPILNKYG
FT                   KMGLDSWLNSHCGTVHKFQGKEAKEVIFLLGCDGTAKGAVNWVNENIVNVAVTRAKYRL
FT                   YVIGDVAIWKKNHSMLIVQNELEIMNPHVYEPAPT"
FT   gene            313250..313837
FT                   /locus_tag="lse_0284"
FT   CDS_pept        313250..313837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0284"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26435"
FT                   /protein_id="CBH26435.1"
FT                   /translation="MQIFEGTSFRFKFTYFITAMSPAYILFGLQVQMQQKAGDDETSYW
FT                   IIGTFLLVSVCMLFCLKKLLNKRYKEKSGLNLKLTIKNKRQIVKKNGDVVAFLMGTILP
FT                   SVLVIDGHTKETLVIFVILQVLIFILTTRSSNVFPNIVLMLAKVDIYELDDGKYILTLN
FT                   ERLKTSESSTMIVSLGDSEFCNTYLIAEENRK"
FT   gene            313834..314772
FT                   /locus_tag="lse_0285"
FT   CDS_pept        313834..314772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0285"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26436"
FT                   /protein_id="CBH26436.1"
FT                   /translation="MNYFNAWIGMNRNSRLDRLQLLYMGQKDRDRIVNHLENISELLNV
FT                   EDLKKYSSESLLFDDGYYIRLDEMGENHFLDDFADHILIPDKLGAYGDTIPISNNKKYR
FT                   KNIDLDKDKFKFLILESTNDLLFLPIQSRGLVRPKTIMRIPTGSSTGNKSVVYDIGAGV
FT                   TVPTTVCAQFNKDKKCLYVFNNIDFEMMLGTFEQKKTVAQKNLLRFKGKEFKVGTEKYS
FT                   VEFEKYENIEKAILNSKRTTVRLSKFDETGTDFDINKIQKAVKRLPETNQVSFCNERKV
FT                   IEVNAENYKTFIGIIHNSIVERLISGEVGVI"
FT   gene            314802..315086
FT                   /locus_tag="lse_0286"
FT   CDS_pept        314802..315086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0286"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0286"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26437"
FT                   /protein_id="CBH26437.1"
FT                   /translation="MKTKRVNGWEIISSLDVRIYEDEAGVAILVDREEFGDQSPVILDF
FT                   DEDSVVVKSISHLTKKVRISLDRKVFIDWRDEYFGEIVQNMDIVEFERD"
FT   gene            315329..315571
FT                   /locus_tag="lse_0287"
FT   CDS_pept        315329..315571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0287"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26438"
FT                   /protein_id="CBH26438.1"
FT                   /translation="MYSYETESEKANVQKNLEALKAKDNINIIKSEQKGDEYRTELKDE
FT                   EDNFVISFEIQSGKLIFKKLDKKENVLIKQTYTKQ"
FT   gene            315722..316966
FT                   /locus_tag="lse_0288"
FT   CDS_pept        315722..316966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0288"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0288"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26439"
FT                   /protein_id="CBH26439.1"
FT                   /translation="MDFVALLKYMQENYGEQITNHPMAGNEVAKNFKQGAKTAVPIALL
FT                   GEDYKVSASIGKGVWANVPWIAVHDKAISTSVKQGVNIVYLFTNDYNGVYLSLNQGYTF
FT                   INDNYKDTKTTLKKIAYFWQDNLSTLKTDDNFTTEPINLGINAKRYNTRVKGYENCNIY
FT                   SKFYDISQLTEDDNNLLLQDLLHMITVFKELKMHLIPDKENSVKATIDFILTNGDYVEL
FT                   NEKAKSEKINNLEKERKLVLVKEETKQKGILIKEGSVEYETKRDYVKEAIRNTEKGLQG
FT                   EILVLNFERERLLKNPVTKPYVEKITHVAENGDGHGYDIISYDVDPISSDKVIEIYIEV
FT                   KTTIGSRNAPFYISENELNVAKLKEDRYKIYRVYNYNGMPKLKIIDDLFTDKFIVEPIN
FT                   YIVKGVNQNDKHTEI"
FT   gene            316944..318017
FT                   /locus_tag="lse_0289"
FT   CDS_pept        316944..318017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0289"
FT                   /product="threonine aldolase, putative"
FT                   /function="Threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0289"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26440"
FT                   /protein_id="CBH26440.1"
FT                   /translation="MTNTLKSSYQKTPYKLSGNGPRNISVLKEAFQNIDENLESDIYGN
FT                   GAIIEDFQTKIAKILGKEEAVFFPSGTMAQQIALRIWADRKDNRRMAYHPLSHLEIHEQ
FT                   DGLKELQQINPILLGTAERLLTIEDIKALQEPVSSVLLELPQREIGGQLPSFEELEEIS
FT                   QYCKAQGIALHLDGARLWEITPFYEKSAEEICALFDSVYVSFYKGIGAIAGAILAGDAD
FT                   FVQEAKIWKRRYGGDLISLYPYILSADYYFDKRIGKMASYYAAAKKLAERFNACDGVKT
FT                   VPEVPVSNMFHVHFEKSVDVIGTKLAEIQDETGVGISGYLQEKAEDVCGFEVSVGDSLA
FT                   EIPEENFNSLFEKLAKL"
FT   gene            complement(318087..319502)
FT                   /locus_tag="lse_0290"
FT   CDS_pept        complement(318087..319502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0290"
FT                   /product="glycoside hydrolase, family 1 protein"
FT                   /function="Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase"
FT                   /EC_number="3.2.1.86"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0290"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26441"
FT                   /protein_id="CBH26441.1"
FT                   /translation="MHTNTGFPADFLWGGAAAANQFEGAYNVDGKGLTVQDVTPKGGFG
FT                   HITDGPTPDNLKLEGIDFYHRYKDDVKLFAEMGFKVFRTSIAWSRIFPNGDETEPNEAG
FT                   LQFYDDLFDELLAHNIEPLITLSHYETPLHLSKTYDGWVNRKMIDFYENYVRTVFNRYK
FT                   GKVKYWLTFNEINSILHAPFMSGGISTSPDKLSQKDLYQAVHHELVASALATKIGHEIM
FT                   PEAKIGCMVLAMPTYPLTSNPDDIIAVMEAERKNYFFSDVHVRGTYPGYMKRYFAENNI
FT                   ELDVTEEDLEILKNTVDFISFSYYMSTTETADESKREKGAGNILGGVQNPYLEASEWGW
FT                   QIDPKGLRVVLNDFWDRYQKPLFIVENGLGAIDKLEEDADGNLTVNDDYRIDYLSSHLS
FT                   QVKEAIKDGVELMGYTSWGCIDLVSASTAEMKKRYGFIYVDRNNDGSGTLNRYKKKSFD
FT                   WYKNVIASNGEDL"
FT   gene            319762..320421
FT                   /locus_tag="lse_0291"
FT   CDS_pept        319762..320421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0291"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0291"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26442"
FT                   /protein_id="CBH26442.1"
FT                   /translation="MDSAISAILSPAVGILISPFPIVGLILILLSNKARINSIFYTVGW
FT                   IVGNIAIFFIGLFLMGSAVSSSGDQSMLVKIVLIVLGVLLILLGAHDFMKRPRNGEKAT
FT                   TPKWFEKMSNIKPGGAMIFAFVLSAVNPKNMLLSLTAGVSVGTLNLAGGQEITATIIFG
FT                   IIACCSIYIPTIAFLIAGHKLNNVLDSARKWLIQNNSVIMAVLFLFIGLSVISKAF"
FT   gene            complement(320459..322456)
FT                   /gene="tkt1"
FT                   /locus_tag="lse_0292"
FT   CDS_pept        complement(320459..322456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tkt1"
FT                   /locus_tag="lse_0292"
FT                   /function="Transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0292"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26443"
FT                   /protein_id="CBH26443.1"
FT                   /translation="MSRIDEQMVNSIRVLSMDMIEKANSGHPGLPMGAAPMAFSLWKNH
FT                   LKFNPEHPTWFNRDRFVLSAGHGSAMLYSLLHLFGYDLPMSELKNFRQTGSKTPGHPEF
FT                   GHTVGVDATTGPLGQGFAMGVGMAMAEAHLGAKFNQPDLPVVDHHTYVLCGDGCLMEGI
FT                   SYEAASLAGHLKLGKLVVLYDSNDISLDGDLNESFSEDIELRFRSAGWQTLRVDDGNNL
FT                   DALDAAIHLAKTEKSRPTLIEVKTVIGYGSPGKAGKSAAHGSPLGEKELKLAKEAYDWQ
FT                   MPPFELPKTVENQKEFYHSKGRARESSWLRTFNAYKQKHPELAEDLQQLIDGNLTPDWD
FT                   EELPVFHEKDDPAIATREVSGVVLQELEKKLPNLFGGAADLASSNKTNLKASERFSPDN
FT                   YAAKNISFGVREFAMGAAVNGMTLHGGVQAFGATFFVFSDYLRSAIRSAALMGIPSTFI
FT                   MTHDSIAVGEDGPTHEPIEHLASFRAMPSLTVIRPADGNETVEAYRHAFTQTTQPTMLV
FT                   LSRQNLPILPNSAEKAKIGLAKGAYILADSPLDKLDIILLASGSEVHLMTAVRENLSKK
FT                   GYGARVVSIPSFDLFDKQSPEYKEAILPKAVKKRFAAEMGASYGWHKYLGGEGNMLAID
FT                   SFGMSGPGDELAKHFGFTVENLTKLALQQL"
FT   gene            complement(322458..323114)
FT                   /gene="talC"
FT                   /locus_tag="lse_0293"
FT   CDS_pept        complement(322458..323114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="talC"
FT                   /locus_tag="lse_0293"
FT                   /product="transaldolase C family protein"
FT                   /function="Transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0293"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26444"
FT                   /protein_id="CBH26444.1"
FT                   /translation="MKFFLDTASVTEIKRISELGLVDGVTTNPTIIAKEGRPFEEVIKE
FT                   ICSIVDGPVSAEVIGLEADKMIEEARVLAKWAPNVVVKIPMTEEGLKAVHTLTAEGIKT
FT                   NVTLIFTVSQGLMAAKAGATYISPFIGRLDDIGTDGIILIKNLKTVLDNYGLKAEIISA
FT                   SIRHIGHLEEAAEAGAHIATIPGSLFPKLWSHPLTDKGIEGFLKDWEAFSQKEGN"
FT   gene            complement(323160..323924)
FT                   /locus_tag="lse_0294"
FT   CDS_pept        complement(323160..323924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0294"
FT                   /product="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /function="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /EC_number="1.1.1.125"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0294"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26445"
FT                   /protein_id="CBH26445.1"
FT                   /translation="MTFKGFDKDFNITDKVAVVTGAASGIGKAMAELFSEKGAYVVLLD
FT                   IKEEVKDIAAKINPSRTLALQVDITKKENIEKTVAEIKKVYPKIDILANSAGVALLEKA
FT                   EDLPEEYWDKTMELNLKGSFLMAQIIGREMIATGGGKIVNMASQASVIALDKHVAYCAS
FT                   KAAIVSMTQVLAMEWAPYNINVNAISPTVILTELGKKAWAGQVGEDMKKLIPAGRFGYP
FT                   EEVAACALFLVSDAASLITGENLIIDGGYTIK"
FT   gene            complement(323948..324394)
FT                   /gene="rpiB1"
FT                   /locus_tag="lse_0295"
FT   CDS_pept        complement(323948..324394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiB1"
FT                   /locus_tag="lse_0295"
FT                   /product="ribose 5-phosphate isomerase B"
FT                   /function="Ribose 5-phosphate isomerase RpiB"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0295"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26446"
FT                   /protein_id="CBH26446.1"
FT                   /translation="MKIAIGCDEMGFELKQVLIARLKEKNIEFTDFGSFENEKVLYPSI
FT                   AEKVALEVKNNDYDRGILICGTGIGMAITANKIHGIRAAQIHDSYSAERARKSNDAHIM
FT                   TMGALVIGPSLAVSLLDTWLDSDFSGGRSQAKVDLMEEIDQKNR"
FT   gene            complement(324400..325164)
FT                   /gene="tpiA"
FT                   /locus_tag="lse_0296"
FT   CDS_pept        complement(324400..325164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /locus_tag="lse_0296"
FT                   /function="Triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0296"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26447"
FT                   /protein_id="CBH26447.1"
FT                   /translation="MRKPLVGINMKNYINTRKETANWLESTIPLLENFSDVDTFIFPSM
FT                   GTLETTATILAGKSFGFGPQNMAPEKSGPLTGEFSVESIIDLKANYVEIGHAERKNIFH
FT                   EEASQIAKKIKLALDEQITPVVCIGEQVKATTTVDLKDALKKQIDALFQMIALSDWQKI
FT                   VLAYEPEWAIGKASSADTNYIETAHQALRDIIRETGGNEKLVRIIYGGSVSKENAADIV
FT                   RQKNVDGLFVGRFGHKPQNFADIVAIVSQMKG"
FT   gene            complement(325168..325818)
FT                   /locus_tag="lse_0297"
FT   CDS_pept        complement(325168..325818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0297"
FT                   /product="dihydroxyacetone kinase (DAK) phosphatase domain
FT                   protein"
FT                   /function="Dihydroxyacetone kinase"
FT                   /EC_number="2.7.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0297"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26448"
FT                   /protein_id="CBH26448.1"
FT                   /translation="MSELVLDSTFFGQVLQDMGALIEKERDYLTGLDSDIGDGDHGINL
FT                   SIGFREVNKQLDELLAATPDIATLLKKSGMILLGKVGGASGPLYGSFFMKCGADVAGKT
FT                   ELNFDDLCGMIINGAAAVQHRGKAELGDKTMMDAFLPGIEVLENRDADADPVVTFTAFV
FT                   EAMHAGAQSTIPLIAKKGRALRLGERAIGHIDPGSESSWMLMNVILENLKKAV"
FT   gene            complement(325840..326835)
FT                   /locus_tag="lse_0298"
FT   CDS_pept        complement(325840..326835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0298"
FT                   /product="dihydroxyacetone kinase (DAK) kinase domain
FT                   protein"
FT                   /function="Dihydroxyacetone kinase"
FT                   /EC_number="2.7.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0298"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26449"
FT                   /protein_id="CBH26449.1"
FT                   /translation="MRRLVNDGYEAVEEMLAGYVAAQGKYVDFAENDKRVIVSKQMSEE
FT                   PRVRIIVGGGSGHEPLFLGYVGKDFADAAVVGNVNTSPSPEPCYNAVKAVDSGKGCLYM
FT                   YGNYAGDVMNFDMGAEMAADDGIRVETVLVTDDIYSAEKVEDRRGVAGDLIVFKAAASA
FT                   AAKGLDLDAVKQAAEKANANTYSMGVALSSSTLPVTGKAIFEMNEGEMEVGMGIHGEPG
FT                   IKRSSIEPADKVVDQIMGYLIEEMKLTSGEEVHVLINGLGGLPVMDQYICYRRVDEILK
FT                   EKGVHIHHPLVGNYATSMDMIGMSITLVRLDDELKELLDAPCDTPYFKLD"
FT   gene            complement(326857..327198)
FT                   /locus_tag="lse_0299"
FT   CDS_pept        complement(326857..327198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0299"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0299"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26450"
FT                   /protein_id="CBH26450.1"
FT                   /translation="MSIGIALATIAGGFLFPFAIRMMWGKMVDEWGAIGGWMAAAFIVG
FT                   TVWTINHGIPKSMIYQSGTVWVDMAVAAGIGVFTASLLTGGKFSKSVVNLAAAVVGGTI
FT                   GGFLLSLFL"
FT   gene            complement(327214..327645)
FT                   /locus_tag="lse_0300"
FT   CDS_pept        complement(327214..327645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0300"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26451"
FT                   /protein_id="CBH26451.1"
FT                   /translation="MKFFRGTIGFCIAGMIVMSVWTPLAANYGIFGGYLAAFIIIGPMW
FT                   FMNHYVGLIENDEDAAFVDMAVGIGICGIMRDVFMQGGRELVSSLPTIGLVAIGAVLAG
FT                   IVAAIIEKDMAKKHEAKQEKTEPGMNIQEEERLNENQLV"
FT   gene            complement(327728..328105)
FT                   /locus_tag="lse_0301"
FT   CDS_pept        complement(327728..328105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0301"
FT                   /product="dihydroxyacetone kinase (DAK) phosphotransferase
FT                   subunit, putative"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0301"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26452"
FT                   /protein_id="CBH26452.1"
FT                   /translation="MISIILVSHSQKITEGLQEMIVEMVGDTVHIISSGGTGDGRLGTN
FT                   ALMIADNITACADSEHIYIFCDIGSAILSAETSLELLEPALLEKTTIIDAPLVEGAFTA
FT                   AVQSLVNPSKEAILHELTNVH"
FT   gene            328288..329052
FT                   /locus_tag="lse_0302"
FT   CDS_pept        328288..329052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0302"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /function="Transcriptional regulators of sugar metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0302"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26453"
FT                   /protein_id="CBH26453.1"
FT                   /translation="MFPFERQNKIIHLLDQNNKITVPELSRILDVSISTIRNDLSSLEE
FT                   SGMIKKVHGGAVLLKSEEKFTNFNDRIIRNIEEKEAIAKEAATLVKNNQTIILDASSTA
FT                   LALAKELHGFTRLTVITSGLYTAIELKDNPNISVILTGGIVTTNSFTLEGILGSNLIEN
FT                   IHADVCFMSAKGFTMEEGLTDFNIYETELKRLLAKRTNKLVALLDHTKMGVISTASITA
FT                   AENIDLLITDSKINRVLYKKFQDAGLPVKIAE"
FT   gene            329253..329501
FT                   /locus_tag="lse_0303"
FT   CDS_pept        329253..329501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0303"
FT                   /product="acetyltransferase, GNAT family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0303"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26454"
FT                   /protein_id="CBH26454.1"
FT                   /translation="MAMGWIIFIVSDVAVLPELQGNGLGKVIMGKIQAYIETNLDKTAC
FT                   VTLLADVPADNLYKQFGFCESAPASIGMIYQMISKNR"
FT   gene            329706..330539
FT                   /locus_tag="lse_0304"
FT   CDS_pept        329706..330539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0304"
FT                   /function="Transcriptional antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0304"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26455"
FT                   /protein_id="CBH26455.1"
FT                   /translation="MKIERIFNNNIVSARSEDAQELLILGKGLGFKSKVGDEINESLVE
FT                   KIFQLQDEAVSNKFKMIIDEIPLAIIEITDDVVQLAKQNISKTISDVIYISLSDHLYFT
FT                   TQRMEQNLVIQNPLSWEVKRYYPEEYAVAKEAAKIVEKRLGLDLPDEEISNIALHFVNA
FT                   EINNSMNDVTHIMQLLQEIMNIIKYHFVIEFDEDSTSYFRFMTHLKFFCQRVITGEAMD
FT                   ETEDYLYQVMYKNLPDIFACIDKIAVFLENNYSFKMSHSEQLYLGIHLDRVLNRK"
FT   gene            330651..332510
FT                   /locus_tag="lse_0305"
FT   CDS_pept        330651..332510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0305"
FT                   /product="PTS system, beta-glucoside-specific, IIABC
FT                   component"
FT                   /function="Phosphotransferase system IIC components,
FT                   glucose/maltose/N-acetylglucosamine-specific"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0305"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26456"
FT                   /protein_id="CBH26456.1"
FT                   /translation="MDYNQLAKEIIQAVGGKNNVNEVFHCITRLRFQLKDQSKVDVAKL
FT                   KSLDKVMGTNVSGTQFQIIIGNDVPKVFDAMTEENPAWKNKSDKATKPKTKGVKGFFSN
FT                   MFDAISGVFAPILPAIAGAGLLKGFMALFVSFGWLATNTETYRILMAIGDGVFYFLPIL
FT                   VAVSAARKFGANMYVGLAVSAALLYPDLTALLGEGVTTHFLGLPVTSVAYAYSVIPILI
FT                   AMWFMAVVERNVDKIIPSSLKLLFVPLITMFIVVPVTLIVIGPLGTFVGDGISGGINWL
FT                   LNNGGLFAGLILGGAMAIIVMTGMHYAIVPFVISNLAKYGYDKFLPLTYISNMSQAGAT
FT                   FGVFFRSKDKKVKSLAFSTGLTALMGVTEPAMYGINIVYKRPFMASLIGGAAGGGFAML
FT                   FGVKAYVLTGNGGLPGLPGLVGDTFVYALIAMALAFVVSLIFSYIFGIDETVAISDLEE
FT                   TPNTVQVDETLNAPVYGEIKNIKEVSDATFADEMMGKSAAFLPTEGKLFSPVNGTIISL
FT                   FKTKHAIAIKSDSGAEILLHVGIDTVKLDGEYFEAHVKTGDIVEQGDLLLTFDMDKIKE
FT                   NYDLTTIMAVTNTNDYAAVELVGAGVMTPKSQVLELRSEANNE"
FT   gene            332503..333945
FT                   /locus_tag="lse_0306"
FT   CDS_pept        332503..333945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0306"
FT                   /product="glycoside hydrolase, family 1 protein"
FT                   /function="Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase"
FT                   /EC_number="3.2.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0306"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26457"
FT                   /protein_id="CBH26457.1"
FT                   /translation="MNKSVFPADFLWGGATAANQFEGGYNLDGKGLAAADLFSSGTHTE
FT                   PRKITAEIDENLFYPSHEAVDFYHHYREDIKLMAEAGFKTFRMSINWTRIFPTGMESEP
FT                   NEKGLQFYEDVFLELKKYNIEPLVTIAHFDIPIQITNELNGWASRKVIDYYLQFCETIF
FT                   TRYKDTVKYWLTFNEINTATMEIGNYLTLGIRNAEGDFLHQKDDPTMRYQALHHQFVAS
FT                   AKAVELGHAINPDFMIGCMIAYMPRYPRTCEPSDVLLAKQTENMHSHFCGDVQVKGAYP
FT                   FFAKKYFEQHGIKIEFADGDEEILRKGTVDFYTFSYYLSLCASNDPAYKDTGKSVIGGA
FT                   ENPYLQTNAWGMQTDPVGLRISLNDIYARYNVPIMVVENGLGAYDKLEEDGTIQDDYRV
FT                   DYFRDHIIQMKKAVEDGVDLIGYTIWGCIDLVSASTGEMAKRYGIIYVEKYDDGTGSYA
FT                   RRKKNSFYWYKKVIETSGEDLA"
FT   gene            334163..335770
FT                   /locus_tag="lse_0307"
FT   CDS_pept        334163..335770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0307"
FT                   /product="cell wall surface anchor family protein"
FT                   /function="Predicted outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0307"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26458"
FT                   /protein_id="CBH26458.1"
FT                   /translation="MKKSKIGALILGTALVVQAPFQVYAATTNTVSQDNVETAVPVIYM
FT                   NNKALTATSDLELTVGKAMTKTLHIHDKATEESEWGSNISDVKVVLTNMDGLDYSVKYG
FT                   PKSEDGTHYQYADVTISGTPTKAGAGSFSLEFYDGAGNGGVYSYTSNVQSTTTVEYVDQ
FT                   NGTKIADDTVQSGDLNVAYTTEPKTIDGYTLDETQLPSNQNGQFGETNQTVTYKYTKNE
FT                   SEVNKGTVGISFYSTDDKSKELVSSLDLSYAYPDGVPTDTVTFGDLAKDATYNDLRPGT
FT                   LDSDILWSDVLQNMVAYMNGNITAEQFTKAVGATPGQFDLDGIAANFEGYEFDEATYQE
FT                   NLSKMVTFEQNGGRVNLQVPFKKVAEVHAGADVTVKYEDKDGNELAMEETLSGNVDADY
FT                   TSTAKTIEGWTLKETPTNATGEFSDEAQTVIYVYEKNADNNDVTPTPVNPADKGDNNTS
FT                   DNSNNINTNDDLAKTPQITVKTPTVKTQANDPASTTTMNNSLPKTGDNALESSLLVGLG
FT                   AVLLGALFVFMRKTRKVK"
FT   gene            336004..337512
FT                   /locus_tag="lse_0308"
FT   CDS_pept        336004..337512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0308"
FT                   /product="hypothetical protein"
FT                   /function="Kinesin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0308"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26459"
FT                   /protein_id="CBH26459.1"
FT                   /translation="MTIWDVLEIEETRDKKTIKKAYAIKLKKTRADEQPKEFQALKDAF
FT                   DAALKFSEQGPKEENKIIKQVAQADLMEDELGSISGEINLESIELGKTFMQEVYLVVQN
FT                   YETRIDIDVWRKVCELNGNWEYHIFVEKQRVICQILSKYFKIMPRSIILFLFEHFELLS
FT                   LKTSQGPDETINKFVEQLKQIYEVPNFQFLNYIKIPKEERDDYYVFRYDYYYNLNVVLS
FT                   SNFDIKEMFEKAEATQVEDADFLNLLAQTIINSYFPKFIRERRIKKYVKQALEIDKTNP
FT                   TSNFLHYYYQAVRNYKISKKGIKFLESKPIINIESDLQLCLSGFIYYYGLDNYTALECW
FT                   EQVINPRFAPAFQKEVEIIRASKAKETEKANNRAAEQAKRDKIKKEKEAEEAKKRAIEQ
FT                   AKRDKIKKEKEAEEAKKRAIEQAERIAKKKARMEELSLETEQNSNGKWKRWIYIFLLLA
FT                   ILAVGFKSYYYIKGVDGNQPNISEKQQKSINKSIEKPKLDLNGR"
FT   gene            337538..339229
FT                   /locus_tag="lse_0309"
FT   CDS_pept        337538..339229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0309"
FT                   /product="Hsp70 family protein"
FT                   /function="Molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0309"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26460"
FT                   /protein_id="CBH26460.1"
FT                   /translation="MIGIDLGTSNSLVSYWKDGKAELIPNVFGEVLTPSIVGIDDNNEL
FT                   LVGKIAKERLTMYPNKTASVFKRNMGTEKKYSLGDFTFDSTDLSAFILKSLKADAEKFL
FT                   GRMCEKAVISIPAYFNNLQRQATLDAAYLAGLEVELLISEPTAAAIAYGIHEQDADTIF
FT                   AVLDLGGGTFDVSILEMFNGIMQVVAISGDNYLGGEDFTNQIMKFFLDKLGLREASLTL
FT                   EERALLVKQAEMSKIAIGGQSEVSSQVIIAGETRELVITSDEFELISKPLLAKMRAPII
FT                   QALNDSKLKPDDLEQIILIGGATKMPIVRSFCSRFLGKIPFTSINPDETVARGVAVQSA
FT                   LKEKHFELADFMITDVCSHSLGIETIRNLGRGEHLEGVFSPIIDRNTTIPVSRTKHFCT
FT                   SHDFQETVNITIYQGESRHVSENLELGSLDIEIPLEKEGYPIDVQFTYDKNGLLEVLLI
FT                   LPLTGETKQLIIQNGIENLSNEELEEQLKRLEAVKIHPRDRSENRLLLAKADRIYQTML
FT                   DDDRYYLEKEIIEFERVLSKQNNNSIKHARKRLEIILEKLERKAFW"
FT   gene            complement(339314..340840)
FT                   /locus_tag="lse_0310"
FT   CDS_pept        complement(339314..340840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0310"
FT                   /product="AMP-dependent synthetase and ligase family
FT                   protein"
FT                   /function="Acyl-coenzyme A synthetases/AMP-(fatty) acid
FT                   ligases"
FT                   /EC_number="6.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0310"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26461"
FT                   /protein_id="CBH26461.1"
FT                   /translation="MINKYEPLNLYTNFKNASERYPEMPIHFDEELVTFPELGLHTTYK
FT                   KCEEAIIQKAAHLHKFGVRKAEKVIVYKSAKFDSYILAVAISYLGAVPIMVSPHLPATT
FT                   IDIFVNRLDEPWLLFDGETSDKSHQLNNLPDERLINAEQLFKAPIGDYACEQEELPKDM
FT                   IAYMTHTSGTTGVPKLIAHSANSMGWRTKYQRRILNFIKPRELVAFHISPVHSRFNIGI
FT                   SSLMSLGFPLLPIANPSKENITKILREYKPYVLETHPNHFVQWASLAREKPDVFESIKF
FT                   YHSTFDAINKETMATFLRTSSHKKPIFLQIYGQSECGPMILRAHTLKSIETLNARDMGI
FT                   GMPGLTEVRIVDQEGNTVPAGVSGNIQMLSKGRAITYYKEEARFEENVYGPWWDSGDYG
FT                   MKDELGQLFLQDRQVDLVETIDSTLAIEDKLLDTLTFLDEVVIIRGKNGSPQPIIAVHG
FT                   DKEMNWDAWWDAVSDLPHMNEPIVMKYEDIPRTATMKVQRLQMERELQNK"
FT   gene            341068..342591
FT                   /locus_tag="lse_0311"
FT   CDS_pept        341068..342591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0311"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein, putative"
FT                   /function="Succinate dehydrogenase/fumarate reductase,
FT                   flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0311"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26462"
FT                   /protein_id="CBH26462.1"
FT                   /translation="MKKRLSITLIMLLSLALVFAGCGSNDTSKSDKTETKDKEKTEVTS
FT                   GASKTSYTDPSELKEEYDIVIVGAAGAGLSAALEAKAKGMNPVILEKMPQAGGNTLKAS
FT                   SGMNASETKFQKEQGINDSNDKFYEETLAGGHGTNDKEMLRFFVDNSASAIDWLDSMDI
FT                   KLNNLTITGGMSEKRTHRPEDGSAVGKYLVDGLLKNVQEEKIPVFVNTDVKEITQKDGK
FT                   VTGVKVRLNNKEDKTISSDAVIVTTGGYGANKELIEKERPDLKGYVTTNQEGSTGDGIK
FT                   MIEKLGGTTVDMDQIQVHPTVQQEKSYLIGEAVRGEGAILVSQEGKRFGNELDTRDNVT
FT                   AAINKLPEKSAYLVFDSGVKDRVKAIAQYEEMGFVEEGATIDELASKIDVPKEELSKTL
FT                   DTWNASVKNKKDEAFGRTTAMDNDLSKAPYYAIKIGPGIHYTMGGVKINTNTEVLDKDG
FT                   KPITGLFAAGEVTGGLHGENRIGGNSVAEIIIFGRQAGDKSAEFVKEQQ"
FT   gene            342748..343764
FT                   /locus_tag="lse_0312"
FT   CDS_pept        342748..343764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0312"
FT                   /product="oxidoreductase, Gfo/Idh/MocA family, putative"
FT                   /function="Predicted dehydrogenases and related proteins"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0312"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26463"
FT                   /protein_id="CBH26463.1"
FT                   /translation="MLKMGFIGNGKSTNRYHLPFILERENIQVKTIYNRNPKTATWDKI
FT                   EGIHYTTDLDELLTDPEIKLITISTTQSSHYEYAKKVLENGKNVLVEKPFMMTYAEAEE
FT                   IFELAKERGLIVQCYQNRRFDSDFLTAQKMIESGKLGELLEVEMHYDYFRPEIPESVHE
FT                   FKFYDSYLYGHGCHTIDQVLSYFGKPDDIHYDVRQLLGAGRMNDYFDLDFYYGITKVSV
FT                   KSSYFRIKARPSFVLYGKKGMFTKETKDRQEEHLKLFYMPSNEDFGIDLPEHYGTLTYV
FT                   DDAGVWHEEKVISEVGDYGRVYDDLYEAIINGKPKKVTDEETLLQMQILEKGVEGCK"
FT   gene            343962..344408
FT                   /locus_tag="lse_0313"
FT   CDS_pept        343962..344408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0313"
FT                   /product="PTS system, IIA component"
FT                   /function="Phosphotransferase system
FT                   mannitol/fructose-specific IIA domain (Ntr-type)"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0313"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26464"
FT                   /protein_id="CBH26464.1"
FT                   /translation="MNISNLINENRIIFDNRIQTKQLLFEKVAEVLEQEGAITNHKKFV
FT                   RDLYKREEETSTGIESGFGIPHTKSKYVKEPLIVFVHSGIIADYFGLDDAPIECSFIIG
FT                   VPKKAADTHLEILSNLSRKLMNNEFIEKLKKSKNKEEIMTILSE"
FT   gene            344422..345816
FT                   /locus_tag="lse_0314"
FT   CDS_pept        344422..345816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0314"
FT                   /product="PTS system, IIBC component"
FT                   /function="Phosphotransferase system, fructose-specific IIC
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0314"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26465"
FT                   /protein_id="CBH26465.1"
FT                   /translation="MKIVGVTACPTGIAHTYMSAEKLTMTAEELGYEVKIETQGAKIEN
FT                   ILTKEDIETADYVILAVDKEIDTSRFAGKKIKRVSTSRAIKEADVVINEAISGKGIISY
FT                   EAKNADNSSEQPPKASLYNHFMNGVNYMLPFVIAGGILIAISFAFGIDASNPDSDSYNA
FT                   IAAAFSKIGGDTAFALMVPALAAGIAVSVAGRAGFAPGLVAGTLATAGGSGFLGGMIGG
FT                   ILAGYVAHFFANKVNVTKSLASIYQLIVVPLLGITIVGLAMVFVIDTPIAWVLDALTGW
FT                   LNGLGETSGVVFGLLIGVMMAADMGGPINKSISTFSIGLMSAGVTAPIAACMAAGMVPP
FT                   LGLALATLIFKNKFTKEEKTAGNSCWVLGASYITEGAIPFAVADPLRVIPSLMLGSATA
FT                   AAISMGAGVTSMAPHGGIWVMFIPNVINHLFIYLIAIAAGTVVTAISVGLLKTPLNKRK
FT                   NKQEMI"
FT   gene            345816..346676
FT                   /locus_tag="lse_0315"
FT   CDS_pept        345816..346676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0315"
FT                   /product="fructose-bisphosphate aldolase class II family"
FT                   /function="Fructose/tagatose bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0315"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26466"
FT                   /protein_id="CBH26466.1"
FT                   /translation="MLYTMKDLLEVGKKHQFAVPAFNICSFDMLKAVMEQVEESNAPVI
FT                   IEIHPDEIAYLGDNFVATVREYALRSKVPVVIHMDHGATIQDVMRAIRNGYTSVMIDAS
FT                   RASYEDNIALTKEVVSLAHKVGVSVEAELGTIGNNGSAEGGADTIVYTDPDQAEDFVKR
FT                   TGIDTLAVAIGTAHGLYPKDKKPELNMPLLKELNKRLDIPFVLHGGSGNPDKEVGESVQ
FT                   YGVRKVNLSSDLKSVFFEEIRQVLTKNPGMYEPNQVYPSANEKVKEVVRHKLNILNTVG
FT                   QADKY"
FT   gene            346733..347503
FT                   /locus_tag="lse_0316"
FT   CDS_pept        346733..347503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0316"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /function="Transcriptional regulators of sugar metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0316"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26467"
FT                   /protein_id="CBH26467.1"
FT                   /translation="MLSTAKERQLKIVNRLKIEQFMRIIDLVELVNYSEATVKRDLVEL
FT                   EKEGLVRRTRGGAMIIDNKKIDLPYLMKMNERSNETNKIRIADIAKSLIRDDMVIFLDS
FT                   SSTSLYLIDVLSKFEGLQIITNGVMTASMLSEFTSARVSILGGSILTKRYTVNGAKAYN
FT                   DALTYNADIAFVSCRGVDYDTGATETHEGEALIKQAFRRQSSELVLLVTEEKVGHKFMH
FT                   QSLACHDIDYLITDFKLDAEVEKQFKAHQITCLY"
FT   gene            347592..348101
FT                   /locus_tag="lse_0317"
FT   CDS_pept        347592..348101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0317"
FT                   /product="MutT/NUDIX hydrolase family protein"
FT                   /function="Isopentenyldiphosphate isomerase"
FT                   /EC_number="3.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0317"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26468"
FT                   /protein_id="CBH26468.1"
FT                   /translation="MEKWDLYDNQRQVTGKTHIRGEKMQPGELHLVVHVCIFNAENQLL
FT                   IQKRQKDKESWPEYWDLSAAGSALKGETSQQAAEREVHEELGITIDLSNERAKFSFHFD
FT                   NGFDDYWFITTNIELNDLKLQQEEVADARFVTKAELENLSTTGEMIPYFFLDKLFDLKN
FT                   ATSSHF"
FT   gene            348199..348918
FT                   /locus_tag="lse_0318"
FT   CDS_pept        348199..348918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0318"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0318"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26469"
FT                   /protein_id="CBH26469.1"
FT                   /translation="MGRKWANIKEKKASKDKTNSRIYAKFGIEIYVAAKSGDPDPHSNQ
FT                   KLRFVIERAKTYNVPKHIIDRAIEKAKGTGDETYSELRYEGFGPSGSMIIVDALTNNVN
FT                   RTASDVRAAYSKNGGNMGVSGSVAYMFDNTAIFGVEGKDADELLELLMEADIDVRDISD
FT                   EDGQAIIYAEPEDFHAVQEGLKAAGIEEFTVAEIEMIPQNDIQLSGEDLEKFEKLIDAL
FT                   EDLEDVQKVYHNVELED"
FT   gene            348955..349293
FT                   /gene="phnA"
FT                   /locus_tag="lse_0319"
FT   CDS_pept        348955..349293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnA"
FT                   /locus_tag="lse_0319"
FT                   /product="alkylphosphonate utilization operon protein PhnA"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0319"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26470"
FT                   /protein_id="CBH26470.1"
FT                   /translation="MPKLPNCPECNSEYAYEDRGLLICPECGHEWSASAAAETSAEKVF
FT                   KDSNGNILTDGDSVTVIKDLKVKGASNPIKMGTKVKNIRLVDGDHDIDCKIDGFGPMKL
FT                   KSEFVKKI"
FT   gene            complement(349338..350051)
FT                   /locus_tag="lse_0320"
FT   CDS_pept        complement(349338..350051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0320"
FT                   /product="transcriptional regulator, GntR family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0320"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26471"
FT                   /protein_id="CBH26471.1"
FT                   /translation="MSGMAKYMEIYIDIRDKINQNKYTINEKLPDGDTLARDYGCSKLT
FT                   VKKALDMLVQEGMIIRRRGAGTFVKSHSTNGGEFALGPMSGLVKTFGKDNIKSKVILFS
FT                   IEKPSKEVAEKLEMQDDYIYRIIRMREVGHKAYSIEHTYMPLAIIPGLEPRHLEDSIYN
FT                   YIREDLKLKMQSAHVWVRGDKSNQEDSKLLGLEEPTFMMEIEKLAHLEDGRVFEYSITR
FT                   HTYESFVFETVFVQN"
FT   gene            350208..351641
FT                   /locus_tag="lse_0321"
FT   CDS_pept        350208..351641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0321"
FT                   /product="glycoside hydrolase, family 1 protein"
FT                   /function="Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase"
FT                   /EC_number="3.2.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0321"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26472"
FT                   /protein_id="CBH26472.1"
FT                   /translation="MKELLTFPKDFWWGSAWSAEQAEGRGDTGKAKTVWEHWFETEPNR
FT                   FYEGVGSEVTTDHFNRYKEDVQWMKKTGHNSFRISISWARMFPNDGVGEVNPKAIAFYR
FT                   DLLTEMNENGIKPFANLYHFDMPVALQDAGGWESREVVDAYVHFADTCFKEFGDLVYHW
FT                   FTFNEPLGPILGGYLEDFHYPNQIDFKRGAQAGFNTILAHALAIKAFKKLNLTSKIGVI
FT                   LNLSPTYPRSQNPYDLEAAEICDAFYTRSFLDPMVKGTFPAKLVEIMREYDQMPEYTEA
FT                   DLVTIKENTAQILGLNYYEPRRVKARLTAINEKSPFLPDWFFEPHNMPGKRMNIYRGWE
FT                   IYERGIYDLCIDIRDNYGNIESFISENGMGVANEERFLNAEGQIEDDYRIEFVKDHLAY
FT                   VHQAIQEGCDIKGYHLWTFIDCWSWINAYKNRYGLVSLDVKTGKRTMKKSGEFYKKMSD
FT                   ANGFEYETSKIVGTKKGRK"
FT   gene            351645..352979
FT                   /locus_tag="lse_0322"
FT   CDS_pept        351645..352979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0322"
FT                   /product="PTS system, IIC component"
FT                   /function="Phosphotransferase system cellobiose-specific
FT                   component IIC"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0322"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26473"
FT                   /protein_id="CBH26473.1"
FT                   /translation="MAESKKKSIVNGFINVAQKLGGQIHLRSLRDAFASIMLFMILAGF
FT                   VTLINYVILEPTGFMGKIVNPDTLRTWQEIGISIGNGTLSVITLLVTVAISYHLCLNRG
FT                   YKNVIAPILVALSSFIVVTPIATTFLPEGATKSIEVPNVIPVSYTGAAGMFVGIIVGLI
FT                   ATDLFIKLSKNKRMQINLTGNIPPAVIKSFNVLIPIMITVIIFSVVSFAVNQIFSMDFN
FT                   TLVTTIITKPLSYVTTSLPGFLLITSIANLFFGLGIHQAVISGPLLDPFLLQNMQENMV
FT                   AYANHQEIPHIINMAFKDTFAVMGGSGNTIGLLIAIFIFGKRKDYKDISKLSAAPSLFN
FT                   ISEPIIFGLPIVFNPLLIIPFVLAPIFSLTTAYYATAAGWINHVVVQTPWTTPPIISGF
FT                   LATGGDWRASVLQVIIIIVTVFIYLPFLRMDEKVAFATAQKAEEK"
FT   gene            352997..353299
FT                   /locus_tag="lse_0323"
FT   CDS_pept        352997..353299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0323"
FT                   /product="PTS system, IIB component"
FT                   /function="Phosphotransferase system cellobiose-specific
FT                   component IIB"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0323"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26474"
FT                   /protein_id="CBH26474.1"
FT                   /translation="MKNILLVCNAGMSTSFLVEKMKAAGTEQGIEANIWAVSDAELHEN
FT                   WEKADVILLGPQVGYLKGNTEKVVGGKIPVEVINMLDYGRVNGAAVLDRAMELIG"
FT   gene            353389..353583
FT                   /locus_tag="lse_0324"
FT   CDS_pept        353389..353583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0324"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0324"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26475"
FT                   /protein_id="CBH26475.1"
FT                   /translation="MKYIKSQMKELVKDSVDLQERLQKLMKEMDLEKSFALKALYHSEV
FT                   ADGGHYQTAYQDLDYKYKD"
FT   gene            complement(353625..354545)
FT                   /locus_tag="lse_0325"
FT   CDS_pept        complement(353625..354545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0325"
FT                   /product="transcriptional regulator, putative"
FT                   /function="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0325"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26476"
FT                   /protein_id="CBH26476.1"
FT                   /translation="MKIERLIGIIMLLLQRELVSASEMAGMFEVSKRTIFRDIDTLSMA
FT                   NIPIYTIAGTKGGIGIMPTYKVDKKLLTTEDLHAIITSLDGMEQLLSSIEIKKTLQKMK
FT                   NMLDPTSESPASSISVDFSNLTTKSDSNSQVEKLYLAIKKRQLVELCYIDRSGNQTIRK
FT                   TEPYHLLFRNRSWYLQGYSLERSDFRTFKLSRIIEFSVLLGTFEARPFAVKPIGTIPSQ
FT                   PHFLMHEVSLIVDKIAREQIVERFNLVEIKRHDEEHFFAKVTLPDHEAGYRFILQLGTH
FT                   VTVQNRDDFYDNFVAYLNEIQGKYL"
FT   gene            354648..355064
FT                   /locus_tag="lse_0326"
FT   CDS_pept        354648..355064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0326"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0326"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26477"
FT                   /protein_id="CBH26477.1"
FT                   /translation="MAFEIVELKEETFTGTKSEIPEFDPQKGFGPMSEIKEAAFTKFAK
FT                   NEKDYVGINASLDGLQYYIVASVDGTGDTTFSIPAGKYAKFVTSETDRPALDGFIGGAY
FT                   GEVSQSSDVAIAGSFNLEDLREAKFTIYIQVVAK"
FT   gene            complement(355113..355523)
FT                   /locus_tag="lse_0327"
FT   CDS_pept        complement(355113..355523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0327"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0327"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26478"
FT                   /protein_id="CBH26478.1"
FT                   /translation="MRKYHIKRIGITILLTFYFFMLTPIMQGEKPFSTSADYFALILAI
FT                   IVGVLASLFIFDERIKKEYEQDKVEKDERYLKNRAIFNFYFIVALGLVIPVVFAFMSIS
FT                   DMEQLSLIFLAKSFIFVSLAYTILLEIVKKKA"
FT   gene            complement(355526..355729)
FT                   /locus_tag="lse_0328"
FT   CDS_pept        complement(355526..355729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0328"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0328"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26479"
FT                   /protein_id="CBH26479.1"
FT                   /translation="MKVINRVKALREEKGIAQNDLASILEVSRQTIHAIEKGKYNPSLE
FT                   LSLKIAKYFELTVEEIFQLEEE"
FT   gene            356011..357477
FT                   /gene="iolA"
FT                   /locus_tag="lse_0329"
FT   CDS_pept        356011..357477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolA"
FT                   /locus_tag="lse_0329"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /function="NAD-dependent aldehyde dehydrogenases"
FT                   /EC_number="1.2.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0329"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26480"
FT                   /protein_id="CBH26480.1"
FT                   /translation="MTKVRKIKNYVNGEWVASKTEKYENVINPATGEILCQVPISTRAE
FT                   LDEAAEISEKAFEKWSQVAVPRRARILFSFQQLLIQHKEELARLITLENGKNLSEARGE
FT                   VQRGIENVEFAAGAPTLMMGDSLASIATDVEAANYRYPVGVVGGIAPFNFPMMVPCWMF
FT                   PIAIALGNSFILKPSERTPLLMEKLVELFTEAGLPNGVFNVVYGAHDVVNGILENDKIK
FT                   AVSFVGSKPVGEYVYKTGSANLKRVQALTGAKNHTIVLNDADLEDTVTNVISAAFGSAG
FT                   ERCMACAVVTVEEGIADEFLEALRIAARNVKIGNGLDDGVFLGPVIREENQKRTLTYIE
FT                   KGVEEGAKLTVDGRETGISKGHFVGPTILEEVTTDMTIWKEEIFAPVLSVIRVKNLQEA
FT                   VKIANKSEFANGACIFTNNAKAIRYFREKIDAGMLGVNLGVPAPMAFFPFSGWKSSFYG
FT                   TLHANGKDSVDFYTHKKVVTARYSLKGYEE"
FT   gene            357490..358302
FT                   /gene="iolB"
FT                   /locus_tag="lse_0330"
FT   CDS_pept        357490..358302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolB"
FT                   /locus_tag="lse_0330"
FT                   /product="IolB protein"
FT                   /function="Uncharacterized enzyme involved in inositol
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0330"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26481"
FT                   /protein_id="CBH26481.1"
FT                   /translation="MTQLLRKPLNETLTPGVKLIHDINEPLKYVGFRLIEIERGGVYEE
FT                   QLTELECCVVVLTGKVTVSEGENTFAEIGTRASVFEKIPTDSVYISGGKSFSVKGSSEK
FT                   ACVALCYSQATQVLPTTLIKASDNSIEMRGKYQNKRLVHNILPDTSEIASSLLVVEVYT
FT                   DGGNFSSYPPHKHDQDNLPHESFLEESYYHEINPQQGFVFQRVYTDDRALDETMAVEHR
FT                   NAVVVPEGYHPVGVPDGYDSYYLNVMAGPKRIWKFHNDPDHEWILDRD"
FT   gene            358318..359295
FT                   /gene="iolC"
FT                   /locus_tag="lse_0331"
FT   CDS_pept        358318..359295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolC"
FT                   /locus_tag="lse_0331"
FT                   /product="IolC protein"
FT                   /function="Sugar kinases, ribokinase family"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0331"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26482"
FT                   /protein_id="CBH26482.1"
FT                   /translation="MELTKHSERELDLITVGRACIDLNAVEYNRPMEETMTFSKYVGGS
FT                   PANIAIGTAKLGLKVGFIGKISADQHGRFIEKYMRDLAIDTTGMVQDTEGRKVGLAFTE
FT                   IKSPDECSILMYRENVADLYLEPAEISEDYIKDARVLLVSGTALAQSPSREAVLKAVHL
FT                   ARKNDVVVAFELDYRPYTWKNEAETAVYYSLVAEQSDIIIGTRDEFDMMENQVGGNNEA
FT                   TKVNLFQHQAEIVVIKHGVEGSYAYTKAGETFQAKAYKTQVLKTFGAGDSYASAFLYGL
FT                   FSGENIETALKYGSAAASIVVSKHSSSDAMPTAAEIKALIANAD"
FT   gene            359308..361224
FT                   /gene="iolD"
FT                   /locus_tag="lse_0332"
FT   CDS_pept        359308..361224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolD"
FT                   /locus_tag="lse_0332"
FT                   /product="IolD protein"
FT                   /function="Thiamine pyrophosphate-requiring enzymes
FT                   [acetolactate synthase, pyruvate dehydrogenase
FT                   (cytochrome), glyoxylate carboligase, phosphonopyruvate
FT                   decarboxylase]"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0332"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26483"
FT                   /protein_id="CBH26483.1"
FT                   /translation="MTGKTIRLTTAQALVKFLNQQYIEVDEIAAPFVDGIFTLFGHGNV
FT                   VGIGQALEENPGHLKVYQGKNEQGMAHAAIAYAKQKKRQRIYACSTSAGPGSANLITAA
FT                   GTAFANNLPVLFLPADTFATRQPDPVLQQLEHESSAAITTNDGFQAVSRYFDRVQRPEQ
FT                   LMSALIRAFEVMTNPATSGPATICISQDTEGEAFDYPEVFFQKRIHYLNRQTPTERELT
FT                   EAARIISASEKPVIIVGGGARYSEARAELITLSEQCNIPLVETHAGKSTVEFGFPNNLG
FT                   GTGILGTLAANKAIRDADLVIGIGTRYTDFTTSSKTAFNPETKFLNINVSRMQTYKLDA
FT                   FQVVGDAKATLQRLTPLLTNYKTQFGDTIAEYKTEWLAERTRLGNTKFNRDNFSPEIKD
FT                   QFDQATLNEYADRLQTEFTQTEALVTINESVADNSIVVCSAGSLPGDLQRLWNPAAPDT
FT                   YHLEYGYSCMGYEINGALGAKMAAAENQEVYSIVGDGSFCMSHSELLTSLQYGHKINIM
FT                   LFDNSGFGCINNLQMANGSDSFFCEFRDSDNQIMQVDYAKIAEGYGAKVYRVNTKADLI
FT                   VALEDAKKQPRTTLIEMKVLPKTMSEGYLSWWNVGVSEVSGKASINEAYENKQANLKKA
FT                   RLY"
FT   gene            361337..361708
FT                   /locus_tag="lse_0333"
FT   CDS_pept        361337..361708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0333"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0333"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26484"
FT                   /protein_id="CBH26484.1"
FT                   /translation="MEVFAEYLAGIDNPDHRERTKEVLTWVAETFPNLKPEIKWNTPMF
FT                   SNNGTFIIGISVAKQHMSISPEVAGIERFEEDLKQAGYSHTKGLFKITWAKPVDFSLLE
FT                   KIIQFNIQDKANYTSFWRV"
FT   gene            361803..362171
FT                   /locus_tag="lse_0334"
FT   CDS_pept        361803..362171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0334"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0334"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26485"
FT                   /protein_id="CBH26485.1"
FT                   /translation="MRIFCGIMSIQAGFIGGLAEIISPDSKKINLFMIPDNLASSSGYL
FT                   MSFAMIVAGILIICAYRNDFLIFMALILWLFGLIFGLIFTPSYSGFYFRPVVCLISFLM
FT                   GLFIFTDYTRHRDSEEER"
FT   gene            complement(362300..363418)
FT                   /locus_tag="lse_0335"
FT   CDS_pept        complement(362300..363418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0335"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0335"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26486"
FT                   /protein_id="CBH26486.1"
FT                   /translation="MGERKVSWLELFFDLIFVTAVASTTHLLLSIDNHPDKTAVYFGEY
FT                   LLMVTPMFWAWVGQTMFFNRFGEKIKWPELYMLPQMFFLILMTASFDLTFSNTYYTFLI
FT                   GYLGIRLITVIQYFVISRKLLGDARKVALMLGAVFLLGVITTATSMFFDGFWRYFVMYL
FT                   GISVDIILPLFLSTTLRKVPVDFPHLAERFGLFVIITFGESIVAITTILVGHTLDWYTI
FT                   CYAGLGFLIISTLWASYFYSFEKVVDHHKETHGQFLIYGHFFIIVSVMLLAANLHLLFE
FT                   GHLAKDVLLLMLFGSVAVFFISKQLVFAAHKKADVRFYVWKDVCLLGLLVGLFLVNLIG
FT                   DLPVFVGLGSVLVCGVVDFWVQVGVGRGVRGE"
FT   gene            complement(363431..363532)
FT                   /locus_tag="lse_0336"
FT   CDS_pept        complement(363431..363532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0336"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26487"
FT                   /protein_id="CBH26487.1"
FT                   /translation="MSAIQLYLFFEAAVKSPHDFYFSFAWYNFEKEN"
FT   gene            363558..364220
FT                   /gene="ung-1"
FT                   /locus_tag="lse_0337"
FT   CDS_pept        363558..364220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ung-1"
FT                   /locus_tag="lse_0337"
FT                   /product="uracil-DNA glycosylase"
FT                   /function="Uracil DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0337"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26488"
FT                   /protein_id="CBH26488.1"
FT                   /translation="MVKTWDEFLEQEATQPYFIDLMKEVAGARAKGNVYPSEEDMFSCF
FT                   RLCPYDKVKVVILGQDPYHGPGQAHGLSFSVQKGVRIPPSLRNIYKELKTDLDIEPADH
FT                   GHLAKWAEQGVLLMNTSWSVEEGKAGSHKKLGWATFTEHVLEELNNYEKPLVFILWGNH
FT                   AIKAASGITNPKHLLIEGVHPSPLAASRGFFGSKPFSKTNDFLEKAGRTPINWDLKE"
FT   gene            364312..364668
FT                   /locus_tag="lse_0338"
FT   CDS_pept        364312..364668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0338"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0338"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26489"
FT                   /protein_id="CBH26489.1"
FT                   /translation="MVITGESKNLKKFLKKVTGLKHNFTEDDFVYGDSWGLVHRGVLED
FT                   KEIERMKVLRDKVVGKKGVAATTLKPIGSVKIDGEVYEARLKTGYLEVGKPIVAVAIDF
FT                   GYVLVNEDIQEEEK"
FT   gene            364665..365609
FT                   /locus_tag="lse_0339"
FT   CDS_pept        364665..365609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0339"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0339"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26490"
FT                   /protein_id="CBH26490.1"
FT                   /translation="MTMIGPIIIAVLIIIFLIVFFTLVPVGLWISALSARVPVGLGTLI
FT                   GMRLRRVVPSRVVKPLIKAVKAGLDLEVNQLESHYLAGGDVDNTVDALIAAHRANIELD
FT                   FSRAAAIDLAGRDVLEAVQTSVTPKVIRTPEFTGVAKNGVEVKVITQITVQSNIERIVG
FT                   GAGEDTVIARVGEAVVSTVGETREHTDVLENPNSISKKVQEQGLGDGTAYTILSIDIAE
FT                   MRIGDNIKAKLDIEKANADMEVAQAAASKRKAEAIALEQENRAAVVAAEAEVPRALSQA
FT                   LEAGNLGVMDFYKMENVQSDTAMRESIAHEDEK"
FT   gene            365645..366073
FT                   /locus_tag="lse_0340"
FT   CDS_pept        365645..366073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0340"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0340"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26491"
FT                   /protein_id="CBH26491.1"
FT                   /translation="MDLSSFLEGGWESLLVVIGILGFIISFFSKSNSATKEQAKPAPPK
FT                   PKHVHTQVTKKPAKRTVTQGTFTQNKQQDKELAEQRAALQNSIREVEREASRKRKTKSF
FT                   QSGTTYSNKRARKLRGRLQEAIITKEILDKPVSLRKDR"
FT   gene            complement(366121..366960)
FT                   /locus_tag="lse_0341"
FT   CDS_pept        complement(366121..366960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0341"
FT                   /product="polysaccharide deacetylase family protein"
FT                   /function="Predicted xylanase/chitin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0341"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26492"
FT                   /protein_id="CBH26492.1"
FT                   /translation="MRKKRLKTYKLLALILIVLIPLCLVSSIFVLKSFASDESAISENP
FT                   PAKEQPKKKYVNKELTDKMQPQKIKRPQKPTGKTVYLTFDDGPTPYLNNFISVLKKEEV
FT                   PGTFFFVGSTLTQMSKETASTIVKSGFSIGLHSYTHDARQLYRETSPTFIPEMERLKKD
FT                   VQKKTGVTTNLVRAPYGSTYLTDKEYQKVKQAGFKLLDWNIDSNDWRYKDNSNSVIQSV
FT                   MTQVKHMEKSNEPLVILFHERKNTLNALPTIIKQLKEKGYTFAAYFENTPFTEIFKE"
FT   gene            complement(366974..367822)
FT                   /locus_tag="lse_0342"
FT   CDS_pept        complement(366974..367822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0342"
FT                   /product="anti-sigma factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0342"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26493"
FT                   /protein_id="CBH26493.1"
FT                   /translation="MNKLRQDYKNTPIPDKLDKVVQDSLHKTRHKKFFSVKRSVLTTAM
FT                   IGIAIFIITIATNTAVANAMLQVPIVKNIVQVFVGKEYEEKTAKTELKLKIPQINGLKQ
FT                   EELQRLINKSYIATGEQLLEEYKASVKSGDEHVQISSDFEEIVNTDEILTIRLTTEKTR
FT                   GSSYTENHYLTLDKENQKILKLHDLFKDDHYLKLIQDNIVSQMNTQMKTDPNKIYWDIN
FT                   ELEPSFTAKNLDDHFYINKQNKLVISFNEYEVAPGYMGVSEFEIPTNIIQNSLKNNHFI
FT                   K"
FT   gene            complement(367815..368318)
FT                   /locus_tag="lse_0343"
FT   CDS_pept        complement(367815..368318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0343"
FT                   /product="RNA polymerase ECF-type sigma factor"
FT                   /function="DNA-directed RNA polymerase specialized sigma
FT                   subunit sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0343"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26494"
FT                   /protein_id="CBH26494.1"
FT                   /translation="MKENMQDYFVDCITKHKADFYRLAFSYVKSEADALDIIQDSIQKA
FT                   LTSIHTIKNKDAIKSWFYKIVVRTSIDHLRKSKKIIVMNQENLVHLNGLVEDNYENIDL
FT                   KIQLDRLPVKYKTVIVLRYFEDLSLEEISYIIGKNLSTTKTRLYKAIKLLRQNISKEEL
FT                   NNHE"
FT   gene            complement(368499..369128)
FT                   /locus_tag="lse_0344"
FT   CDS_pept        complement(368499..369128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0344"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0344"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26495"
FT                   /protein_id="CBH26495.1"
FT                   /translation="MEKQWEVILEDLERNKADNDWVTDDTLLAGQTLENRHLLKHFLIL
FT                   EKGTLHLENQNSQILQFFTTGDIVFLSPYDMNVDTQLKLVCDQTAKIIFVDREYFLNFA
FT                   ANKASYMEWLLTSVLSNTSALCFELMKHDLPADERIVYTLQRLCQKTQPVAKEEYYEVP
FT                   NFLNKTKMAQYGAMSRKNLYNKLEVLEESEQVKQKNEKVFVTTAVI"
FT   gene            complement(369213..370520)
FT                   /locus_tag="lse_0345"
FT   CDS_pept        complement(369213..370520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0345"
FT                   /product="glycosyl transferase, family 2 protein"
FT                   /function="Glycosyltransferases, probably involved in cell
FT                   wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0345"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26496"
FT                   /protein_id="CBH26496.1"
FT                   /translation="MNLSVIDTGMPAINILITFLFVILLTYPILGGFAWFVGAFCYTFL
FT                   FKYKQRNWTDIPTTVEPFITIMIPAHNEEIVIENTIEYLMNKINYTNYEILVTDDGSTD
FT                   STPDILARLMDKYDNLRVVRIEKNKGKAHAFNIGTAFAKGELILSNDADTVPEPDALWK
FT                   YVNYFIREDAHNIAAVTSNMDVQNRSTLVGKSQTVEFSSIVGIIKRTQTSVFGVIYAYS
FT                   GANTMYRKDALMDVGMFRQDRATEDISIAWDHQFDGWLSLFATDIIFFMEVPETLNMLY
FT                   KQRKRWAKGGTEVWLTNFKRVLRHPFQNIGRTSLFIDQTLSISWTFFFWISSAIFFVRF
FT                   LHLLFIWDTQQILFMLTVAFVFVCFEMVAGILQLLAALLIDDKGNKLKYFMFTPLYLLF
FT                   YWIMNAVTILMTFIPAIKTILGFGSGVWTSPERRQK"
FT   gene            complement(370517..371029)
FT                   /locus_tag="lse_0346"
FT   CDS_pept        complement(370517..371029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0346"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26497"
FT                   /protein_id="CBH26497.1"
FT                   /translation="MSEERATRTEMNEEFIEDKFFKKGHIGLKVKQLLITILAWIGLLL
FT                   PFGLVLFPILFFKDKVIVFDAFQTAIRLFQLMDEFLLTAAIFIIIFFLVLTYRNNKRFK
FT                   NLLQKKKTYDEEILDTRKAVLEQYFTENFGPKEEREATKFISIPEEKNMQTSTIRDLYE
FT                   ENGVPLK"
FT   gene            371219..371902
FT                   /locus_tag="lse_0347"
FT   CDS_pept        371219..371902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0347"
FT                   /product="NLP/P60 family protein"
FT                   /function="Cell wall-associated hydrolases
FT                   (invasion-associated proteins)"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0347"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26498"
FT                   /protein_id="CBH26498.1"
FT                   /translation="MKIIATRRKIFFAFIALMISFSVLFLPTNKAFAATTYKMTTTADV
FT                   NIRTTDNTKGKIIGLYKKGTTVTFTAKTKNNWYKTTYKGKVGYVSGKCVTTYKAPVATT
FT                   QSFAALNNEAKKHIGKRYKMGATGPSCFDCSGYTQYVYSKGIKKSIPRTAKQQYASAKK
FT                   IKASELKNGDLIFFNYGKGIAHVGIYVGNGKMLNAQNNGVKYDTIKSGYWKKYIAGYGR
FT                   VTNLK"
FT   gene            372269..372361
FT                   /locus_tag="lse_0348"
FT   CDS_pept        372269..372361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0348"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26499"
FT                   /protein_id="CBH26499.1"
FT                   /translation="MLIVKEGPIFIETFFLAYGQRVITRFLSMK"
FT   gene            372377..372802
FT                   /locus_tag="lse_0349"
FT   CDS_pept        372377..372802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0349"
FT                   /product="acetyltransferase, GNAT family, putative"
FT                   /function="Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0349"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26500"
FT                   /protein_id="CBH26500.1"
FT                   /translation="MEFQIKALPLEEVESKIVDGLLDHKSRLGYDIPKTDTTYISLAAL
FT                   NADSEIVGGVTAKISYGELHVSLLSVDKDLQVSGVGTALMNEIAAYGKAHNCHHISLTT
FT                   FSYQAPEFYKKCGYSELGRIQNFPLKGVEKYFFVKYL"
FT   gene            complement(372808..373608)
FT                   /gene="proC"
FT                   /locus_tag="lse_0350"
FT   CDS_pept        complement(372808..373608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="lse_0350"
FT                   /product="delta 1-pyrroline-5-carboxylate reductase"
FT                   /function="Pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0350"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26501"
FT                   /protein_id="CBH26501.1"
FT                   /translation="MKKIGFIGAGNMGTAMIRGLAKTDRIDRKNLFVCGRNIEKLQPLE
FT                   TEFQGIQLTTSIEELAEHADIIILSVKPYTIPEVLTSIKNKLSKDKIIISVAAGVTIQD
FT                   LESLTTKETKIVRVMPNTPALVGEAMSSITPNGSVTAEETEIITTIFASFGKAEVVPES
FT                   SMDAVVGVSGSSPAYVYMFIEALADGAVLNGLPRDKAYKFAAQAVLGAAKMVLETGEHP
FT                   GKLKDMVTSPGGTTIEAVKSLEDSGFRSAVINAVQAAAEKNSNM"
FT   gene            374088..374189
FT                   /locus_tag="lse_0351"
FT   CDS_pept        374088..374189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0351"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0351"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26502"
FT                   /protein_id="CBH26502.1"
FT                   /translation="MTFFLQLLGNFSGAINFPDVTEVLNNLIRGIFG"
FT   gene            374224..374325
FT                   /locus_tag="lse_0352"
FT   CDS_pept        374224..374325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0352"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0352"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26503"
FT                   /protein_id="CBH26503.1"
FT                   /translation="MNFFLQLLGSFSGAFRFPDVTEVLNNLIKGIFG"
FT   gene            374409..375644
FT                   /locus_tag="lse_0353"
FT   CDS_pept        374409..375644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0353"
FT                   /product="cell wall surface anchor family protein,
FT                   putative"
FT                   /function="FOG: PKD repeat"
FT                   /EC_number="3.4.24.28"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0353"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26504"
FT                   /protein_id="CBH26504.1"
FT                   /translation="MKKIITLLATVALASIVVFNFIPGIVASAANTSESNLTYKDVKSG
FT                   FYFVGYENVQLEKGKSYKYTVAYEANVDMTMNNTITGQNAKAGLFTPKSSGAELNSNYV
FT                   TRTNGNVTDVADANRKVFTHTFEFTAKENTKADIGVFLTPGSVLPNAPDSTLIWKSVSV
FT                   VDETPAEQPEAPVISATDKTIKQDDSFNPLAEVTATDKKDGDITKDVKVTKNTVDTSKA
FT                   GVYDVDYSVTNSSNLTTTKSIKVTVEAGDAKVNTAPVINAKDQTIKVGDAFNALKDVTA
FT                   TDKEDGDLTAKIKITKDTVNNSEKGVYQVTYTVTDSGNLSATLTIKVTVTKDGEISIEP
FT                   TDPKDPTNPSEPTVPKKPNDDPTNVKKVSKTADVKTAKIPKTGDNSMIWIVLSGLGLVA
FT                   IGITTYRKKSTR"
FT   gene            375768..376418
FT                   /locus_tag="lse_0354"
FT   CDS_pept        375768..376418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0354"
FT                   /product="transcriptional regulator, GntR family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0354"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26505"
FT                   /protein_id="CBH26505.1"
FT                   /translation="MPKIAKGDRLESVAFEYIKNKITTGEYPTGYRVVEAKLSQELNMS
FT                   RTPIRRAIINLCHSGFLVHQYNRGAFVQNTEINITEFFSRMKLVELLIYESTEKLILRE
FT                   DYIVVDDIIKIAEKVIYYEKNREYELMRGAFEDFISIFIGKLNNDYFNRVIQDLWNEVK
FT                   DNATNEVRLIIVSASDRIAEELANMIGILKSWNYGQLKDCFQHIMNAMILIAF"
FT   gene            376436..377062
FT                   /locus_tag="lse_0355"
FT   CDS_pept        376436..377062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0355"
FT                   /product="conserved hypothetical protein"
FT                   /function="Membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0355"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26506"
FT                   /protein_id="CBH26506.1"
FT                   /translation="MKKISWLIIILIIIAGSVGYYFIKENEEKTPQAITYKTTQAKKGD
FT                   LRVYVSAEGHVIKIPNEWPDYKDFAAQIMVDELEINQIKEKQTAEVHVEAVGDKTYKGS
FT                   VDEINEKGVINGSVTSYVVTIDLDNQANLKENMSVSADVLVALEKNTLIIPIEAVHTDK
FT                   SAKEYVNIVDENNQKKKVFIETGKHNTKSIQVLKGLEEGRLVIIP"
FT   gene            377086..377760
FT                   /locus_tag="lse_0356"
FT   CDS_pept        377086..377760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0356"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /function="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0356"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26507"
FT                   /protein_id="CBH26507.1"
FT                   /translation="MIQLVNISKSYQMGANKVEALDDVSFCIKPGEFIAIVGPSGSGKS
FT                   TLMNILGILDKATLGEYYLNKKNLTGLSPKKVAKIRNENIGFIFQQFNLMPRLTAFENI
FT                   ELPLVYRGVGKAERKREVLNSLKRVGLLDKQKHLPTQLSGGQQQRIAIARAITGKPEIL
FT                   LADEPTGALDSKTGAEVMALLKEIHQEGNTLIIITHDINIAKQAERILEIKDGKLREWV
FT                   EA"
FT   gene            377757..378923
FT                   /locus_tag="lse_0357"
FT   CDS_pept        377757..378923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0357"
FT                   /product="ABC transporter, permease protein, putative"
FT                   /function="ABC-type antimicrobial peptide transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0357"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26508"
FT                   /protein_id="CBH26508.1"
FT                   /translation="MKIYQNVKLALKQLLSAKFRTFLTMLGIIIGVFSVILLISIGTAI
FT                   SKNVSTQLGDMGSNLVSVSFYPNNPTEKFTYKEATNLLEDGEIGSPEVMQTKAVRTNEH
FT                   TDDMQVTGINDAYANIKNLELARGRFCSEVDVRYAQKVTVIGADVAKSYFKEQNPVGKY
FT                   MRISGARYLVIGVLKEKGESLFGSADKKLFIPITSAERLFKTDSIDLYYIQAKSPNQVP
FT                   SVVKQVDHKMSRLFPNDKDAYSVVNQQEALDTFDSITKTLTVGLGAIAGISLLVGGIGI
FT                   MNIMLVSVSERTREIGIRKAIGARDSDILLQFLIESVVLSLLGGGIGILLGIFSAQLVT
FT                   ILTDFEMIVSIPTILLAVGFSMFIGVVFGVVPAHKASKKMPIDALRAE"
FT   gene            378942..379085
FT                   /locus_tag="lse_0358"
FT   CDS_pept        378942..379085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0358"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0358"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26509"
FT                   /protein_id="CBH26509.1"
FT                   /translation="MEKEQQTNDAWVLIEILSFITNVERKRLRELSYEDLEAFYERVVK
FT                   EN"
FT   gene            379155..379637
FT                   /locus_tag="lse_0359"
FT   CDS_pept        379155..379637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0359"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0359"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26510"
FT                   /protein_id="CBH26510.1"
FT                   /translation="MKEIIKKQADGTAEVRLEFEVNNSATRVFELLTTNEGLAQWFNEL
FT                   EVGKLGNGGYLLFVMTPEERITMPILVWEPNQKLGIEWDKDSVTFELTEVAENKTVVSF
FT                   TEQLHVISEHSPRDISGWYICLKRLQAVAAGSQYDFDKTEFETLFLKYQKALNNEK"
FT   gene            379642..380169
FT                   /locus_tag="lse_0360"
FT   CDS_pept        379642..380169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0360"
FT                   /product="PTS system, IIA 2 domain protein"
FT                   /function="Phosphotransferase system
FT                   mannitol/fructose-specific IIA domain (Ntr-type)"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0360"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26511"
FT                   /protein_id="CBH26511.1"
FT                   /translation="MIKISNIPTNEELKMLGAIIQEQTDFNGGFLADFFGADFFARSKL
FT                   TSKSAILEEMVNSLRAQDIVGADFLSSVLEREQLGSTVLGTGIAIPHPLGLMAKETKIV
FT                   IRILDKPIKWGQKQTIQVIFLLCISKNDYEEAINIYELLVELVREEYLEKLANLAGFKE
FT                   FIRLAEEVLKKK"
FT   gene            380286..380705
FT                   /locus_tag="lse_0361"
FT   CDS_pept        380286..380705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0361"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0361"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26512"
FT                   /protein_id="CBH26512.1"
FT                   /translation="MNRQAEFILVIIGASFSILSFFVAILYAAIFGINAVMMTTGNSYM
FT                   YADSSETIVFWIFTVGAIIAVIFTVISAIFGFIGAFKIKNDVPKVKLFGICFIILGGLQ
FT                   IFTISGILFVIAGILTLTKKEYKTNHKEDEGIKWE"
FT   gene            380696..381100
FT                   /locus_tag="lse_0362"
FT   CDS_pept        380696..381100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0362"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0362"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26513"
FT                   /protein_id="CBH26513.1"
FT                   /translation="MGVAVIVIFLIFTMLLGLAAKALLAIWIYKDAEQRGMNAILWCLL
FT                   MVFVSVFIILVIYLIIRRKGEVMKKNLGLLISGLGVAVVNTVIVIFCMVGLIFSFASDN
FT                   GMHNMMDGYNYDDSYNYDFDYDTDSWNDEL"
FT   gene            381207..382214
FT                   /locus_tag="lse_0363"
FT   CDS_pept        381207..382214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0363"
FT                   /product="phosphate transporter family protein"
FT                   /function="Phosphate/sulphate permeases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0363"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26514"
FT                   /protein_id="CBH26514.1"
FT                   /translation="MDTVILITIIIVFMGLAFDFINGFHDIANAVATSISTRALKPRVA
FT                   IGLAAIMNFLGAISFTGVAESLTKSIVDPFSLNNGEFVVLCGLIAAVIWNLMTWLVGMP
FT                   SSSSHALIGAIAGASIASASSFSVLNWSGFTTIIIALIVSPIIGFTVGYLIYSLFKNLF
FT                   HDKKLGKMNRRFRFIQIGTAAMQAYWHGTNDAQKTMGIITLALVASGLLQESAGIPFWV
FT                   QLSCAASMAIGSSVGGYRIIKTVGTKIMKITPVTGVASDLSSLTVIMTATLIHLPVSTT
FT                   QVIDSSIMGVGTANHKKEVNWRTGKNMVVTWFITLPLAGLLAAVVYWISAAIFL"
FT   gene            382230..382610
FT                   /locus_tag="lse_0364"
FT   CDS_pept        382230..382610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0364"
FT                   /product="glyoxylase family protein"
FT                   /function="Lactoylglutathione lyase and related lyases"
FT                   /EC_number="4.4.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0364"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26515"
FT                   /protein_id="CBH26515.1"
FT                   /translation="MKIEHIALWTSDLEKMKDFYVTYFRATANDLYENKTKGFSSYFLS
FT                   FETGARLELMKRTDVSEEVTEEKLGWAHIAVATESKTAVDELTEKLRAAGFEVVGEART
FT                   TGDGYYESVVLDPEGNRIEITC"
FT   gene            382677..383069
FT                   /locus_tag="lse_0365"
FT   CDS_pept        382677..383069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0365"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0365"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26516"
FT                   /protein_id="CBH26516.1"
FT                   /translation="MDIVTDKIVVEKYNFETILEENGQIENKIELEVHEVEPIGGNEEL
FT                   MAKGKIFKITIPFVLALEKFRIDGRISRIVQVKDYFGQFSDLAIPDVEGLSNPLIDYIK
FT                   RLTYDVTEIAFDEPGISLDFNANHKS"
FT   gene            383082..383504
FT                   /locus_tag="lse_0366"
FT   CDS_pept        383082..383504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0366"
FT                   /product="putative secreted protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0366"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26517"
FT                   /protein_id="CBH26517.1"
FT                   /translation="MRQYMKMVRPFDFIIIIVLILGSFLPLIFFTAAEAKNAGDDVVAI
FT                   VSQDGKVIREITLTGHQGNEQFTIKGKGTQYNLMEVDGERIRIKEDNSPDQVGVMMGWK
FT                   SDPGDTIVCLPHKVFVEIKSANKDSKDPGTDLIVPN"
FT   gene            383792..385171
FT                   /locus_tag="lse_0367"
FT   CDS_pept        383792..385171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0367"
FT                   /product="leucine-rich repeat domain protein"
FT                   /function="Leucine-rich repeat (LRR) protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0367"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26518"
FT                   /protein_id="CBH26518.1"
FT                   /translation="MKTFLKVFVGIFSIAIFFLGAPVAGNASASLPAKISEVFPDDDLA
FT                   NAIANNLNVSVDTIVTQQILADISTFSMQSHEVSNLEGLEYLTGANSIDLYGGKNITDL
FT                   SPLSGLNNLTNLDIAFNNVTDLSPIANLNNLYSFSATGNSINDISPLANMTTLRYLSLN
FT                   SQTITNPELNYTSLISIPNNIINLNGTIIAPSTISDNGVYEEPNVEWDLPAYLPAVSYK
FT                   FSKYVSVANAEATFSGTVNQPLKEVLDYTVDFDVDGVVSDTESITEGNLITAPAEPTKT
FT                   GYTFLGWYDAAEGGNKWDFSSDKMPASDITLYAQFSLNSYDVNFDVDGTTSSETVDYNE
FT                   LIQEPQNPIKPGYTFTGWYDAKEGGNKWNFETDKMPANDVTLYARFSLISDTPNNNQGG
FT                   ATPKGPKQKHTLTIKTESSTKTKEVARKTLPVTGDANSLPLLITGMVLLSSVLFICRKR
FT                   V"
FT   gene            complement(385211..387808)
FT                   /locus_tag="lse_0368"
FT   CDS_pept        complement(385211..387808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0368"
FT                   /product="PEP/pyruvate-binding protein"
FT                   /function="Phosphoenolpyruvate synthase/pyruvate phosphate
FT                   dikinase"
FT                   /EC_number="2.7.9.2"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0368"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26519"
FT                   /protein_id="CBH26519.1"
FT                   /translation="MKPYVLKFHEIDEINQLLVGGKGGNLGECSKIKGTLVPPGFSVTT
FT                   EAYKEALQAQAPFLALLQQLNSQTTSNLSMIREISTAIRALIEATPIPTNITEEINQAL
FT                   LDFDANEAFAVRSSATAEDLLTASFAGQHDTYLNIIGKPALFRHIKKCWASLFTERAII
FT                   YRIQNNFDHSKVYLSVIIQKMVFPQASGILFTADPITANRKSISIDASFGLGEALVSGL
FT                   VSADAYKVQENKITEKIIPTKKIAIYGLTDGGTETRQIDSIKQTEQTLTDEQILKLAKL
FT                   GRKIETHFGKPQDIEWCLVNNDFYIVQSRPITTLFPIPEVSDQENHVYVSVAHQQMMTD
FT                   AMKPLGLSFYLMTTPASMYPAGGRLFVDITQSLSSPATRDIMVNSLGASDPLMKNALET
FT                   IVDRENFIKMQTDANSNKPTAAPVKLANRNVPEPSVVSELITKNQASLEKLKQTIQTKS
FT                   GTELLDFIAEDLQELKNVLFNPSSVDAIMAGMDASAWLNEHINKWLAEKNVADTLSESA
FT                   PNNITSQMGLELLDVADAIRPNPEVINYLEHTTNIHFLDNLNTLAGGKEARKAIETYLK
FT                   KYGMRCPGEIDLTKTRWIENPTALIPLILSNIKNFEPNASKKKFEQGEAAARNKQQEIL
FT                   ERLKQLPDGEQKAAETREKIAILRHFIGYREYPKYGMINRYFIYKQALLKTAEQLVQSN
FT                   IIKEQEDIYFLYFEELQEVVQTNKVDYDLIYKRKTDFASYEKLTPPRIITSDGEIISGK
FT                   YHRGDIPEKALIGLPVSSGIIEGRARVILDIEHADLEPGDILVTAFTDPSWTPTFVSIK
FT                   GLITEVGGLMTHGAVIAREYGLPAVVGVENATKLIKDGERIRVNGTEGYVEIL"
FT   gene            complement(388008..388880)
FT                   /locus_tag="lse_0369"
FT   CDS_pept        complement(388008..388880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0369"
FT                   /product="conserved hypothetical protein"
FT                   /function="Molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0369"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26520"
FT                   /protein_id="CBH26520.1"
FT                   /translation="MTGLGTLLFLAGVVVLIFGILRYRKRNWPRRKTQIVIISSILAII
FT                   IGIGIIPSSETEKASNEKPKQTEKTVKKNDKAFIKTDKTFSTNDEGTLTIKGETIPGGE
FT                   VRLALEGATELVTDADDDGNFEFSLMNFDQSREAVLSMTFRGETTEFPVSLSVSPGYET
FT                   KLAEEKKAETERVAAEKAEAERIERERLAAEEQKAQEAKIAAEKKAEQDRIAEAEKAKA
FT                   AETKRAEAERAAAQPDTSNKQGETVYITATGSKYHYSQSCRGLNNSNGETAVTVDEAKA
FT                   QGFTLCGFE"
FT   gene            complement(388967..389212)
FT                   /locus_tag="lse_0370"
FT   CDS_pept        complement(388967..389212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0370"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26521"
FT                   /protein_id="CBH26521.1"
FT                   /translation="MKAVTERMIPIEKNLKELAKIAFYFIPIVFLLAISNPVLAFFHIN
FT                   SPLFSSKLWMQAATIFIVILLFCGILFSALAERLKK"
FT   gene            389313..389492
FT                   /locus_tag="lse_0371"
FT   CDS_pept        389313..389492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0371"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0371"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26522"
FT                   /protein_id="CBH26522.1"
FT                   /translation="MTKSLDEISVKAEKVARKTGEVTGTVAKISVYSSVWAVKTSVDKS
FT                   RAFVKGFKQGWSSK"
FT   gene            389519..390328
FT                   /locus_tag="lse_0372"
FT   CDS_pept        389519..390328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0372"
FT                   /product="ZIP zinc transporter family protein"
FT                   /function="Predicted divalent heavy-metal cations
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0372"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26523"
FT                   /protein_id="CBH26523.1"
FT                   /translation="MLNYLSSLNPVLLALFAGIFTWACTAAGASLVFFFKNLNKKWGNV
FT                   MLGFAAGVMLAASFWSLLAPAIEMSKDLGRLSFMPALIGFLLGGIFLRVIDRIIPHLHF
FT                   GFPEQEKEGPKTSLRKSILLVLSITIHNIPEGAAVGVAFGAVITGDTETLITAIVLALG
FT                   IGIQNFPEGAAVSIPLRGEGLSRGKSFWYGQLSAVVEPIFAVLGAVLVVFATPVLPYAL
FT                   AFAAGAMIFVIVEELIPESQVEGSTDLATAATMAGFAVMMVLDVALG"
FT   gene            390603..391922
FT                   /locus_tag="lse_0373"
FT   CDS_pept        390603..391922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0373"
FT                   /product="polysaccharide deacetylase family protein"
FT                   /function="Predicted xylanase/chitin deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0373"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26524"
FT                   /protein_id="CBH26524.1"
FT                   /translation="MKIRWIRVSLVAILIIAVVFIGVKGFQRHQFTKSRNKVIVQIDKL
FT                   MEEKNGSDFRKSDEKENGIQVISYIPTTATKKDNNTIQKEMKMATDKEKMMLKDKEGIL
FT                   FYTFQKQKTAKNAISYKVEQYVYLKEGQTKLALSNEKDICTNLVTDEETGALLTLGNVL
FT                   VKSDEAKLAIKTLLEQEIIKSGKIPLKDIGNLGEVKSPAKWNDTNFGLTNSELVLPINV
FT                   PGYPKIKVVKLKLADIASYVNKRYLPDDIQIPAIPKAKAGKKIALTFDDGPSPAVTPKV
FT                   LATLKRYNAKATFYVLGSQVLANPGLVKRELDEGHQVGSHSWDHPQLTKLPKKEVYDQI
FT                   LKTQKVVYDQTGYFPTTMRPPYGAVNKEVAEEIGIPIVQWSVDTEDWKIRNPKAVTMKV
FT                   MANASDGAIVLMHDIHPTTGESLDKTLKLLKKTRLSICHC"
FT   gene            complement(392065..393333)
FT                   /locus_tag="lse_0374"
FT   CDS_pept        complement(392065..393333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0374"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein containing a NRPS
FT                   condensation (elongation) domain"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0374"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26525"
FT                   /protein_id="CBH26525.1"
FT                   /translation="MTKITSYPAEPSDVKHFISAENMKNDHHLHTVLTFDNHLNISTLK
FT                   KAVQLSAEKLPLLLCHFKETSNGASWQESVFSTDDLVFLVETTTPYEEVNQALIKKLST
FT                   ENGPQIRLTVIRTKTSDQLVIILNHMLADGAGFKQYLYLLSDLYSKLLENPEYQVKLSP
FT                   GSRGLKQVFDQFSRKQKQEILTKQKNQLPVQNPITPLQGDANNPKIIWTKTSKQQFASL
FT                   ISYAKKHDATVNDVFFTAMALTIHQVTDQTAMSIDCPVDLRKYLPKNRTPGITNLTANI
FT                   TCQIAATDSLTSFEETLHIVKKSLQPQKNSLAALRIYYLLEIIFQKKSYAIAKKASEKL
FT                   YSIPKTSFTNIGIIDEDKMVFKNSYLQECFICGSLKYAPFFQVAATTFRGELTLSTNLH
FT                   GTSHDHLWQADFLQKMIQQFPRI"
FT   gene            complement(393449..395485)
FT                   /locus_tag="lse_0375"
FT   CDS_pept        complement(393449..395485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0375"
FT                   /product="penicillin-binding protein"
FT                   /function="Cell division protein FtsI/penicillin-binding
FT                   protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0375"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26526"
FT                   /protein_id="CBH26526.1"
FT                   /translation="MANLNGKKGNNKKALIIGSIAVVIVLIGVAIYFFIQNQHKDEKNA
FT                   LRAAETFTSNIAKEKYDKLGNNVTNASLKKVEVTAKEMEAKYQAVYSGIGAENIKVKNL
FT                   KSVYDDKENKFNLTYELEMRTSLGKLATQKYKTTISKQNDDWKIDWKPALIFPGMVKTD
FT                   KVRITEDSATRGQIVDRNGTPLATKGQFAEAGVVPSKLGEGDEKTKNIQDISKKLDIST
FT                   EYINKQLAQKWVQADSFVPLVTLDEDKLPEATGLTYAQKELRTYPLNEATSHLIGYVGE
FT                   VSAEDIEKNPKLGVGDVIGKSGLERYYDKQLRGKDGGEIKIINDQTKQEDTLQKIDRKD
FT                   GEEIKLTIDAAVQKKAFDSLGSETGAVTMINPTNGELLALVSTPSYDANQMVLGITADD
FT                   YAKYNDDKRLPFLARYANRYAPGSTFKTITATIGLDTGITKPDKVREISGLKWQKDASW
FT                   GKYFVTRVHDVPKVNMTDALVHSDNIYFAQEGLEIGKDKLTAGLKKFDFDKEYNLPFTM
FT                   EPAQISNDGLNSDILLADTSYGQGELLMSPIQQAIAYSAIANNGKMPYPKLETKEATGK
FT                   STQATEATSANQVKDALIKTVSDPAGTAHGLQIQGHNIAAKTGTAELKEKQGEDGLENG
FT                   FVYAFDADNPDYLMVGMIENVKGRGGSGLVIDKLKPVIESMYK"
FT   gene            395657..395983
FT                   /locus_tag="lse_0376"
FT   CDS_pept        395657..395983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0376"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0376"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26527"
FT                   /protein_id="CBH26527.1"
FT                   /translation="MEEMEQPEKKVVIRGKGIHNKWKWSTIIVSILSVIIISVLSYQLY
FT                   SVSQNSPGNNTGTMQQGPGGNGAPSGNPPSGEPGQNPGSSDDSTDSGTSESGTSDSTSS
FT                   DNSI"
FT   gene            396116..397051
FT                   /locus_tag="lse_0377"
FT   CDS_pept        396116..397051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0377"
FT                   /product="cell envelope-related transcriptional attenuator
FT                   domain protein"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0377"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26528"
FT                   /protein_id="CBH26528.1"
FT                   /translation="MARHAQKKKRRTRKGRVFVTILLALLILVGVVAVIGYFQYQSSLK
FT                   EAQSNSKLKDYTFNGVKADGDAINVLLIGSDSRGADQGRSDSLMIAHYDKKTNTPKLVS
FT                   IMRDTYVDIPGHGKNKINAAYSYGGPELVRQTIKENFGVDVEYYVVANFEGFPKIVDTL
FT                   APEGIKINAEKDMSQNIDVSIKKGEQVMDGKTLLQYARFRKDAEGDFGRIRRQQQVLEA
FT                   LKEQALDVGDVTKIPDIIGQLQGYTSTNLPTSTLMSVGSDFLLGKTETMEKFAIPVEGK
FT                   WHNERIEGAGAVLRLDDMAANAKALQDFLK"
FT   gene            397218..397949
FT                   /locus_tag="lse_0378"
FT   CDS_pept        397218..397949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0378"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0378"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26529"
FT                   /protein_id="CBH26529.1"
FT                   /translation="MEKVRKKRKWNWAQILAIFVLITLLISMVYAVVNLISAPSGNVPE
FT                   GEQTKADYSLMLMQCVLGVVVLFLPSLISRKMKFVIPNAMYIVFIVFLYCAIYLGEVQS
FT                   FYYLIPNWDTILHTFSGAMLGGLGFSIVSLLNNNERVTLSMSPIFVALFACSFAVLLGV
FT                   FWEFYEFAADSFGMNMQKTMLEDGTMLQGHAAVADTMGDLFVDFLGAFVISIVGYFSIR
FT                   KNKKWMQNFEFKKVDEETNSK"
FT   gene            complement(398093..400252)
FT                   /locus_tag="lse_0379"
FT   CDS_pept        complement(398093..400252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0379"
FT                   /product="transglutaminase-like superfamily protein"
FT                   /function="Transglutaminase-like enzymes, putative cysteine
FT                   proteases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0379"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26530"
FT                   /protein_id="CBH26530.1"
FT                   /translation="MKKKLSLILLFILSVLLISEWIYPFAELTELSTASWIILFITLSL
FT                   ASFFTHLRYYWTIPLHIVMIYVVAGIYYAKDGIFSGQWFSSFFQITFSGFSDMVQFRPS
FT                   DISMDFIVIVFLIALWLLSYITTYSILRKQRIMSVLILTVSYLAVINTFTDYNSSWAIV
FT                   RTVLEGFLLLHLALTSRIATPNRLNGNLLKQNGIIYHAFILFLLAVFVFSSLMLPKKAP
FT                   IWPDPVPIIRDALGINTTRTVGYSEDDTELGGAVKKDNATVFKARTDNGHYWRVESKRI
FT                   YTGVGWANEKSTELQQFSSGDNFPIQLSEETTGEAKTAEISFEASSEYVPYPYGTQAIN
FT                   SAVDTFNANLTTEKITPTNTIKNYTIELKTPVYNIETMQKADFSTLPDSFVSKYTQTPS
FT                   ELPKRVATLTNKITKDADSIYDKTKAIESYLSASGEFTYSTDDAKETPNGADYVDQFLF
FT                   ETKIGYCDNFSTSMVVMLRTLGIPTRWAKGYTPGEGEKDAKGDKATYTITNNNAHSWPE
FT                   VFFPGTGWVPFEPTATFSNPENFQEPTTETANKPDTPNESSSEASKPDTTEKAPDQTDG
FT                   SSSTGETKQAEQAKTDKANNPLKIPSWIWWIPIGLIVAIISAAVIFRRRIRSYLLLRTL
FT                   QKNPIFSKTYIKLLKSLASYGYIRQSSETLRQFAARVDTELGTNNFSKLTKIHELNIYS
FT                   QTSGDRNVTTAEIKLFIQIITLLTK"
FT   gene            complement(400249..401391)
FT                   /locus_tag="lse_0380"
FT   CDS_pept        complement(400249..401391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0380"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein (some members
FT                   contain a von Willebrand factor type A (vWA) domain)"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0380"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26531"
FT                   /protein_id="CBH26531.1"
FT                   /translation="MLKKRLLLASRWIIMLIIYTGLWAYTLFQGDTASWFLTYFFSFIL
FT                   IVLFLSSIYPLKAWNVNRHFAKNTYHDGDLVDMHVTFTRKSRYPVGYLLFQQKTPLSFG
FT                   KLNARQQLVYPLFKKKFTVTLDSFVGLRGIHSFPAIDLETSDAFGLLERSYQTSAEKSL
FT                   TIYPSYFPDVLDKIREATPENERNAAYWTLKKNTNLHSLREFSSGDRISLIDWKSSAKT
FT                   EQLMTREFENSATSRLSVIFYGVSHPYFELSLRAAYSFIRKISEENGEIRVSILGDKTT
FT                   NFSPSASTNKLQDISIAFAELSPKDGVILQESLESNLHDGEKILLFTPCVDTMLMQKVT
FT                   RLTDSKQLQIITFESDQAIDTKALFLEPASLMSRWERENK"
FT   gene            complement(401396..402343)
FT                   /locus_tag="lse_0381"
FT   CDS_pept        complement(401396..402343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0381"
FT                   /product="ATPase AAA family protein"
FT                   /function="MoxR-like ATPases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0381"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26532"
FT                   /protein_id="CBH26532.1"
FT                   /translation="MSTEPSIKIEQIINEVEKVIVGKRHVVKLSLTALLAGGHVLLEDV
FT                   PGVGKTMMVRTLAKTIGVSFKRIQFTPDLLPADVTGVSIFNPETRDFEFRPGPIMGNIV
FT                   LADEINRTAPRTQAALLEGMAENSATVDGITRKLTDPFFVMATQNPIEYEGTYSLPEAQ
FT                   LDRFLLKINIGYPTVEEEMQLLTLKQYQDPLDQTKQVVTQNELLNLKKQTKHVFIDDVL
FT                   KNYIIRLVDASRKHASVALGISPRGSLAFMQAAQAFALIEGRDYVIPDDIQYLAPYIFT
FT                   HRLILKSEAYYNEETPESIIASILKNTSVPVEKR"
FT   gene            402490..404085
FT                   /locus_tag="lse_0382"
FT   CDS_pept        402490..404085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0382"
FT                   /product="purine catabolism regulatory protein, putative"
FT                   /function="Regulator of polyketide synthase expression"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0382"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26533"
FT                   /protein_id="CBH26533.1"
FT                   /translation="MSVKLGDLMKLPSLKEAKVVSGKSGLSKLVSSISVLEYTEVALLD
FT                   DDLFDNNEFYGSEIVVSAFVNICNDVEAQCRTIERLHKVGEVALILYYVGIFIPKLDKK
FT                   FVDYANELDFTIIVMPENEMSLRYSEVIYEVVEAIVKQEMTDTNFVSESLEQISNVRPA
FT                   QRNMDTTLKILSDRTHVSLVLTDNSFQVINSITWPRTRQWDFAQIIETSKQLNENELTK
FT                   WTVDERTIYTVRKPIFQDGMQAMHLFMMKEKDTLTSDIAMQISEVVQVFMNLWGKNYVE
FT                   ISTAELMKAILNDESLKMRRLGKILNVDVSSIKWMWLVKTEEIRDNEQVLAELKSFVAS
FT                   HFSVSLIDLFEKNIVVLLDNSVAQRDRTHTAQTFAEMMKQLGIKLKITVCQGMEQTSDV
FT                   QRAYSLVNENKKAANTIYGRKLIYSLQEIEFAAKCVAIVGQGELSIAEHLLPLKPIAEN
FT                   EELIETLSVFLLEGESNYNQAAELLFLHKNTIKYRIQRINELLQYPVTKIPESYNLYIA
FT                   VAVRRLLSETNNNI"
FT   gene            404219..405502
FT                   /locus_tag="lse_0383"
FT   CDS_pept        404219..405502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0383"
FT                   /product="cytosine/purines/uracil/thiamine/allantoin
FT                   permease family protein"
FT                   /function="Cytosine/uracil/thiamine/allantoin permeases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0383"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26534"
FT                   /protein_id="CBH26534.1"
FT                   /translation="MTTKKTEQQTQSWQSLAFVWTGAMICVPSLLVGGTLIASMALWQT
FT                   ILIALIGYGVIVLFMIYQGMQSSDLGIPAVSVASQVFGEQGSKKIISIILAIACLGWFG
FT                   IQANVCGAAFSQFLGIYGINLPVPISSLIWGIIMLLSAIYGIRILSILNYIAVPILLFV
FT                   CIYGLIVSLNDGGLAVVQNYKPAGSMSFMTGLAITIGSFALGAVIAGDYSQYTKSRKDV
FT                   VKAAIVGILPSGILMIAVGAILALTAGTADISVVFTKLGLPVLGIIGLILAAWTTNAVN
FT                   AFSGGIAIINVFNISEKYHKVAVAAAGGLGTLLAVIGILNHFVPIMSVLSAMVPPVAGV
FT                   MIASYWIVQKGDKSKWAPVPGVNWLGVSAWLVGAVIAGIPVILTFFPSLPQLPNQPLIG
FT                   IILSLAVYLVGAKILAGKTNNVENLEGK"
FT   gene            405503..406603
FT                   /locus_tag="lse_0384"
FT   CDS_pept        405503..406603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0384"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0384"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26535"
FT                   /protein_id="CBH26535.1"
FT                   /translation="MRYLDEQAIENIAIGAAFLGTGGGGDPYIGKMMALTAIKKYGPVK
FT                   LLSPEEIADDDYFIPAAMMGAPSVLIEKFPKGDEFVRVFEKLGRYLGKEVKGTFPMEAG
FT                   GVNSMIPIVVAAQLGLPLIDCDGMGRAFPELQMVTFHLDGISATPMAITDEKGNIGIME
FT                   TIDNKWTERIARVTTVEMGASSLVSLYPCDGAQIKQSSIKHIVTLSEEIGKVIRETSLD
FT                   ESEKLQQLLDVTKGYHLFEGKITDVVRETRAGFNFGRVRINGLNNDAESEVIVHFQNEN
FT                   LVAEKNGQPIAITPDLICMVDLETLMPVTTEALKYGKRVRVMGLPADDAWRTAKGIETV
FT                   GPRYFGYDVDFELLEELVQKEERRHV"
FT   gene            406596..408146
FT                   /locus_tag="lse_0385"
FT   CDS_pept        406596..408146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0385"
FT                   /product="hydantoinase/oxoprolinase family protein"
FT                   /function="N-methylhydantoinase A/acetone carboxylase, beta
FT                   subunit"
FT                   /EC_number="3.5.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0385"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26536"
FT                   /protein_id="CBH26536.1"
FT                   /translation="MYKIGIDVGGTNTDAVILDENQKLIHSVKMPTSEDIETGITESLH
FT                   RVLSETGIDRSKVTHAMLGTTQCTNAIVERKKLAKVGVLRLGYPATASVLPYTAWPEDM
FT                   VGYLSGKYKLTGGGYEYDGQVLSEINETEIRETLAEWKGTVESIAVVGVFSSLKNDQEL
FT                   AVQKIIEDELGVDIPVSISSTVGSVGLIERENATILNAALFKVIAATSDGFEKALIQEG
FT                   IEQAEIYLCQNDGTLMSLNYARQFPILTIACGPTNSIRGASYLAGLKDAMVLDVGGTTS
FT                   DIGVLTDGFPRESSLAVDVGGVRTNFRMPDIVSIGLGGGSIVREKDGEIAIGPDSVGYR
FT                   ISEEALVFGGKTMTTTDIAVRLGMANIGDAQLVAHIPTNFAEKAYEKIAQMTEDAIDKM
FT                   KTSSSNVNLVLVGGGSVIIPDEIAGVATVFRDKNGPVANAIGASISQISGQYEQIYIYS
FT                   QIEREVALQDAEQKAREQARLAGAVADTIEVVEVEEIPLAYHPGNATRLRVKVVGNLI"
FT   gene            408175..408270
FT                   /locus_tag="lse_0386"
FT   CDS_pept        408175..408270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0386"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26537"
FT                   /protein_id="CBH26537.1"
FT                   /translation="MEMFFSTKIRVKKYFIMEQEKLALMDFLSGR"
FT   gene            complement(408468..409448)
FT                   /locus_tag="lse_0387"
FT   CDS_pept        complement(408468..409448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0387"
FT                   /product="HD domain protein"
FT                   /function="HD superfamily phosphohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0387"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26538"
FT                   /protein_id="CBH26538.1"
FT                   /translation="MQITNSLYGTFEIESVLEELISSPSVARLGQIHQGGASYLVNPLW
FT                   NVTRLEHSIGVMLFIRRFGGSLEEQIAGLLHDVSHTTFSHVVDYALELEKEDFHEQIFE
FT                   KFVKSSTIPAILEKYGFSYEEILADISKWTILEQEAPELCADRIDFTLLDLYRHEKISL
FT                   IEVNQFLDNLVVLNGQVYLTDIAVAEWFAEQYYEEVIDYFYDPLNIYSHEILAEAIRLA
FT                   LKQNTITVTDFQLTDAELLEKLKQNSDAMAKIQLLWSNVCLEENNLDYTFHHKKKTRLI
FT                   NPSVLLDGKLIPVADISEKVQQMNLKARKKSESGFYLKVIEKKSI"
FT   gene            409570..410133
FT                   /locus_tag="lse_0388"
FT   CDS_pept        409570..410133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0388"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0388"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26539"
FT                   /protein_id="CBH26539.1"
FT                   /translation="MAESFITKKAIASGLLELCQNKRFEKISIADITNICGLNRQTFYY
FT                   HFTDKYDLLSWTYENDVFHCLADGITLENWDGHVLKMLESMKINADFYKNTVSADASIL
FT                   SLCFSKLTCSLFMDLFKKLDTNAKVRNDDRVFYAEFFSYGCSGVLITWISSGLKEEPET
FT                   IANQFFRLAKDTEFLASRMYQEEN"
FT   gene            410243..411943
FT                   /locus_tag="lse_0389"
FT   CDS_pept        410243..411943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0389"
FT                   /product="antigen, putative"
FT                   /function="Myosin-crossreactive antigen"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0389"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26540"
FT                   /protein_id="CBH26540.1"
FT                   /translation="MKNKKRTVVALTGAAIGTRIAAKKISEQKATEKERLVEEAIQARY
FT                   YGDKQVYFVGGGIASLAGAAYLIRDANFDGKNIHIIEGMHILGGSNDGAGSTDKGFVCR
FT                   GGRMLNEETYENFWDLFRSIPSLDMPNFSVTEEILNFDHLHPTHAQARLVDKDRNILDA
FT                   HSMGFNNNDRMLMTKLLATPEEKLDHLTIRDWFDEHFFETNFWYMWQTTFAFQKWSSLF
FT                   EFRRYMNRMMLEFSRIDTLEGVTRTPLNQYESLILPLKTFLDKHHVDFTINQTVEDIDF
FT                   KDAPGITATALHLSDGTVINLGPDDVVIMTNACMTDSATLGDMNTPAPKPEEKPISGEL
FT                   WYKVAQKKPNLGNPEPFFGHEEETNWQSFTVTCNGDKLLKRIERFTGNIPGSGALMTLK
FT                   DSNWLMSTVVAAQPHFKAQDANTTIFWGYGLYPDRVGDFVKKPMKECTGEEILYELMCH
FT                   LNWQDDWEEIKADIVNVIPCYMPYIDAQFEPRAMSDRPAVVPEGSKNFAMISQFVEIPQ
FT                   DMVFTEEYSVRAARIAVYTLLDIDKKICPVTPHNRNPKVLAKATQTMFR"
FT   gene            complement(411994..414135)
FT                   /locus_tag="lse_0390"
FT   CDS_pept        complement(411994..414135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0390"
FT                   /product="leucine-rich repeat, cell wall anchor family
FT                   protein"
FT                   /function="Leucine-rich repeat (LRR) protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0390"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26541"
FT                   /protein_id="CBH26541.1"
FT                   /translation="MFLKKKKIISASLVVVLMTTFTIPTFAEETDVIPESETTTVENTS
FT                   EEKTATPNSNDTTAETNSTIPEIPEAAVAPELETKSIKSTETAPEEKAATPNSKNVTTE
FT                   PTDIVDVSLFENQQWLIKFTEKATGKTIANTTYEDIAAIKTMQVNDISSLSAFIPKAIG
FT                   LYTGLESLEICYKRNLSGTIPDEIGNLTNLTYLRLMGNSLNGTIPDSIGNLTKLQTLDL
FT                   ANNAMNSTYNGYRADGLGGAVPESIGNLTELKQLNLGSYSNFTSLPSSIGNLKKLETLE
FT                   MSQSKLTSVPIEVKDLTSLKSMNFSYNQINQEIPEEWGQLTNLTNFNVECNAFYGEIPE
FT                   WTYSVPTIYLSKNHLFDVPAGRGMGTTPTFNYLNVDKIEDPTVKANQYDVTAIADELTL
FT                   PNGTTTFDVRDNLLSVYQTTKAIYFPKSTLNTESTLVSGDASGISFDGNNVTILKSGTY
FT                   EINVELKGLQDKTNMNAQATFKVTADLPNQAPVITVAEDHITINQGSSFDYHDYVSVTD
FT                   DSDTNINDALTVTGTVDVNTPGDYVLTMDATDSEGLAATSKTLYVHVNGIPVITAEDQV
FT                   ITKGDGFDPMADIIVSDEDADIESKVIASGEKMTDSLYYVTYEVTDSNGAKATKTIQVT
FT                   VLTPANVEPAKIDPSLPVPKNIDPPTNDPKTKIVAKTTPTATKKSNKLPKTGDSTSNHI
FT                   PLIVGLMALSSTALLLRRK"
FT   gene            414374..415477
FT                   /locus_tag="lse_0391"
FT   CDS_pept        414374..415477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0391"
FT                   /product="radical SAM family protein"
FT                   /function="Predicted Fe-S-cluster redox enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0391"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26542"
FT                   /protein_id="CBH26542.1"
FT                   /translation="MEKSSIYGLTWTKLTEWLEEHGQKKFRATQVWDWLYRKRVKTFEE
FT                   MSNVPKETIELLTANFVMSTLEEQVVQESTDGTTKYLFKLSDGNLIETVMMKQEYGLSV
FT                   CVTTQVGCNIGCTFCASGLLKKSRDLTAGEIVEQIMNVQHYLDGRNLEERVSHVVVMGI
FT                   GEPFDNYDNVMDFLRVINHDKGLAIGARHITVSTSGLAPRIIDFANEDFQVNLAISLHA
FT                   PNNELRTSIMRINKTYSIEKLMEAIHYYVEKTNRRITFEYIMLKGVNDHKKEALELAAL
FT                   LGEHRHLAYVNLIPYNPVDEHIDYERSTKEDVLAFYDTLKKNGINCVIRREHGTDIDAA
FT                   CGQLRSKQIKRVGIRERMKQKQAAAEE"
FT   gene            415589..416083
FT                   /locus_tag="lse_0392"
FT   CDS_pept        415589..416083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0392"
FT                   /product="transcriptional regulator effector binding domain
FT                   protein"
FT                   /function="DNA gyrase inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0392"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26543"
FT                   /protein_id="CBH26543.1"
FT                   /translation="MEVEIVERNAFSAVGKKRTFSVKNEAQKEKISQFWQEANTNGDTD
FT                   RIAELAEYATIDAMLGICTMSEEQFAKEEMDYYIAIESEQNPPEDMEKITIPASKWAIF
FT                   KSVGPMPTAIQEVWQYIFGEWLETSNYNHGPGPEIEVYTEGDTLAPDYYSEVWIPVVEK
FT                   I"
FT   gene            416240..416605
FT                   /locus_tag="lse_0393"
FT   CDS_pept        416240..416605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0393"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized enzyme involved in biosynthesis
FT                   of extracellular polysaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0393"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26544"
FT                   /protein_id="CBH26544.1"
FT                   /translation="MIIVTNTIKVEKGAAEHVIRQFTGENGDGHPTKDIAEVEGFLGFE
FT                   LWHSKPEDKDYEEVVVTSKWESDEAQRNWVKSDSFKKAHGRTKDSRAQREDRKGIVGNE
FT                   IARFEVVHVQNPVVIEK"
FT   gene            416844..422156
FT                   /locus_tag="lse_0394"
FT   CDS_pept        416844..422156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0394"
FT                   /product="leucine-rich repeat, cell wall anchor family
FT                   protein"
FT                   /function="FOG: PKD repeat"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0394"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26545"
FT                   /protein_id="CBH26545.1"
FT                   /translation="MKKKLSMVIVSALLLGYLAPFSTLAVAEETTVPEDLTTKSEITEE
FT                   KTPDIETNSDKEVKEEPVEKEAEKPTETKEVEPVTPKIETKTEKPKSKQSNLKTAVPAG
FT                   STYNSLFPDDNLAKKIAIIVTGNADATGDEVADSAGLLSITQLNLSGETGIDETDIASI
FT                   EGFQYLENVTSVDLSENNLTDITPLTDLTKIVTLNLSSNQNLEDLNGVEGLTNLQDLNV
FT                   STCKSLADISPVAALPALKEISAQGCNIQTLELENPAGDALPELETFYLQENDLQDLTA
FT                   LATLPKLKNLYIKGNSSLESLETLNGSTSIQLIDASNCTDMETVGDISGITTLEMIQLS
FT                   GCSKLKEITDLKNLPNLTNITANNCIIEDLGTLENLPKLQTLILSGNENLTDVDAINDL
FT                   PQLKTVALDGCGITNIGTLENLPKLEKLDIKGNKVTDISEITDLPRLSYLDASENQLTT
FT                   IGTLAKLPLLDWLNISENQLKDVSTINNFPSLNYINVSNNSITTFGKMTELPSLKEFYG
FT                   QFNKVTDISMIHDMPNLRKLNVSNNLINNLGTFENLPKLQNLDIHSNKITNTTVIHDFP
FT                   SLETYDASSNLISTLGTMDNLPEVTTINLSSNRIPSLEPIGDLPKLDTLLVNSNSSYLR
FT                   TVGSLDGLPALRILELNSNYINYTGKEATLSAFSDLTNLIELSMKDNYYIVDLSGLSSL
FT                   TNLRYLYLDNNRIEDVTPLSNLTELRELTLGTNKIQDISALSSLNKLANLVVKSNKIID
FT                   ISPVAEIIENGATVTATSQTWSLPSVLTYQGTFTIEDPVIWYDGTVLPPSYIASSGVYN
FT                   DEKITWNKMTSSSSSTSFSFSKVEEGLTFSGTVTQPYKASVKVTANAEQTYTIGDTVSE
FT                   EQFLLDVKAKSADGAPVTSDFETVVDLNTFGDYEVTLTSEKNGIQADSCKVIVHVLHGA
FT                   PIISADETITYDKNATVTEAEFLADIHASTDLDTEITSDFSTAVDFSKGGEYTVALNSE
FT                   NADGVKSDTVYVKVTVNKDPAPVISSKTEYTYDKFSEVTEAQFLDDIDANTDDGSIVTS
FT                   NFGTAVNLDKAGDYTVTLNSSNSDAVAATPTVVIVHVEKEVTATINADQAQQYDKHAVI
FT                   DEEQFLEDVDATIDATPTTAVITSDFESVVDLNVPGTYTVTLNAMNEDGGASTPKEVSV
FT                   VVRKLPAPEITADAEITYPKFDEVSEAEFLSDIHATISDPDVTITTNFNSIVKLDKAGD
FT                   YTVMLNAENEDGVKATPVEVVVHVEQGERPVITADTAISYDKFSSKTEAEFLSDIHATT
FT                   SDGQASTVITSNFTVATNFNTAMAYTVTLNATNEDGISAEPVLVTVTINQEKAATLKAD
FT                   SEVTYAKKQQVTEADFFKNIHLEGTEAPSTAEATSDFETAVDFSTVGDYTVTINATNED
FT                   GVASTPIEVVVHIGQTSAPVITAKTEVEYNKHEVTDERRFLYDSEAKTNEDDLEIKTDF
FT                   AEKVDIDSVGTYKVTLTATNEDGLEASPVEVNVVIHDMAAEKATVKYLDENGTEIAPSE
FT                   TLTGNLDDTFSVQAKAIDGYKCDATLSGVFTTSEQTVTFHYQTIEPGAVTIKYKDANGK
FT                   TVAEDKEITGEVGDDFEAVAQTISGYSCQATASGKVTEEPQTITFTYNKVTPSKNTGKI
FT                   TVNYLDESGKKLADSKTITGNIDDPYNVDAKSINGYQVEGDDSATGVFKKDTQTINFKY
FT                   KKNATTKNDPTQKGNGSSNTKVKNNSNVSIKETTNTKKLPATGDTETVTWIFLIGLGFL
FT                   IISSFLLFKRPKKS"
FT   gene            422308..422883
FT                   /locus_tag="lse_0395"
FT   CDS_pept        422308..422883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0395"
FT                   /product="nitroreductase family protein"
FT                   /function="Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0395"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26546"
FT                   /protein_id="CBH26546.1"
FT                   /translation="MIKDTIIERRSIKKANDAPISRETINTLLEQAAFAPFHSKVEPWN
FT                   VYVLHTLEEKERYIEKIIAFNEREQGVTFSEAEIAELKAGYAKKIITPPYLLIVTTNII
FT                   GHGKKDFESIGATSAFIQNIQLLGWEAGIGMIWRTNRFIFDDKFATDLGIPNEQKIIGT
FT                   LHLTTLAEIPEPKPRRPLNDWVKDLADL"
FT   gene            422948..423118
FT                   /gene="rpmF"
FT                   /locus_tag="lse_0396"
FT   CDS_pept        422948..423118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="lse_0396"
FT                   /product="50S ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0396"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26547"
FT                   /protein_id="CBH26547.1"
FT                   /translation="MAVPARRTSKAKKNKRRTHKGLTAPGLSRDSETGEYRMSHRISPD
FT                   GTYNGRTIIEK"
FT   gene            423305..423421
FT                   /locus_tag="lse_0397"
FT   CDS_pept        423305..423421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0397"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0397"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26548"
FT                   /protein_id="CBH26548.1"
FT                   /translation="MGNKKVKRKLGANIWWIVIVAILVIFVAYLVMGYAARI"
FT   gene            423450..423908
FT                   /locus_tag="lse_0398"
FT   CDS_pept        423450..423908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0398"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26549"
FT                   /protein_id="CBH26549.1"
FT                   /translation="MNAKEAYLHNIQKDIEWDTILFATKVDRDGAAIQTFNSHPFLKMK
FT                   KVWADNFYTIETAAWLAKAEYIISEIELPPFYMKRKNQIYIQIFNFKEWNNNIARLLLH
FT                   ADFIVKQQEHEKLENIRGILNATILLLENIASTKFKKDPPKKRSKKIS"
FT   gene            423908..425089
FT                   /locus_tag="lse_0399"
FT   CDS_pept        423908..425089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0399"
FT                   /product="glycosyl transferase domain protein"
FT                   /function="Glycosyltransferase"
FT                   /EC_number="2.4.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0399"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26550"
FT                   /protein_id="CBH26550.1"
FT                   /translation="MYCGGFKNNGITSSAINLMKNINKQKYQIIVVEDENLGFDETKNL
FT                   EKVPDDVIKIQTSESLNLFPEEEEAFFQFHDYPLEHLMKHGPTHFLTPGIKRIYQRELK
FT                   RLLGDTKVDVALDFDGYFKHWTLLMASSNAPNKIIFQHNEMMQEYSKKLNNAYKHRADL
FT                   NIVFPLYNYFDRIVSVAKPIEMVNKRDLQHIVYDESKMTYVHNSIDYPYILQSSKLEDE
FT                   AVIPVDTFNFVTMGRLSPEKNQQMMIAAFQKLQEEFPDTNLFIIGSGELEDTLKTYVTE
FT                   LSLDDKVHFLGQLDNPFATIAACDAFLLSSIHEGQPMVLLECLVLNKPILATDTPGCAG
FT                   LLKGYGLLARNDVENFVMGMKEIRTGYKPPKAFDYKAYNQEAIRMLEEILEMK"
FT   gene            425117..425998
FT                   /locus_tag="lse_0400"
FT   CDS_pept        425117..425998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0400"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /function="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0400"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26551"
FT                   /protein_id="CBH26551.1"
FT                   /translation="MKNENPLNQYYAGEFEKQLQPYPGLQSKMNPVPDTGENTYQGANK
FT                   LVGKKAFVTGGDSGIGRAAVIAYAREGADVAINYHPDEEVDAQEVKEIVEKAGRKCILL
FT                   PGDLREENFAKEVVKKAFNELGGLDILVLNAGMQQYELDIQKLSATQLRDTFEVNVFSV
FT                   VFAIQEALNYLGAGASIILTSSIQGVKPSAHLVDYAMTKSCLISITKSLAEQLGKKGIR
FT                   INAVAPGPIWTALQISGGQPQESIPEFGQDQPLQRAGQPAELASVYVLLASNEASYITG
FT                   QVYGITGGAPIN"
FT   gene            426028..426117
FT                   /locus_tag="lse_0401"
FT   CDS_pept        426028..426117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0401"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0401"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26552"
FT                   /protein_id="CBH26552.1"
FT                   /translation="MPWTKNDYPDSWKNLKKTEREKAIEIGNA"
FT   gene            426284..427012
FT                   /locus_tag="lse_0402"
FT   CDS_pept        426284..427012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0402"
FT                   /product="MutT/NUDIX hydrolase family protein"
FT                   /function="ADP-ribose pyrophosphatase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0402"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26553"
FT                   /protein_id="CBH26553.1"
FT                   /translation="MTEEFVKKEDALKNYSAKEFRTPDGYTSDMVLTTVKELSGVPTLH
FT                   ILLIKRATKNAEGRPNIEGGKWAVPGGFVEESESADQAAERELQEETGLTNIPLTAFGV
FT                   FDKPGRDPRGWIISRSFYAIVPTEALEKRVAGDDAADIGLFPMTEALELPLAFDHLEIL
FT                   KKAFNAITEEFLLTTAIRDFLPETFSAELLYQTLNGCTKPGVLPDEVEFMENIDYLPYL
FT                   EKTGELYRFNADAEAGSIYF"
FT   gene            complement(427058..427951)
FT                   /locus_tag="lse_0403"
FT   CDS_pept        complement(427058..427951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0403"
FT                   /product="transcriptional regulator, LysR family"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0403"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26554"
FT                   /protein_id="CBH26554.1"
FT                   /translation="MNLRQLYYFKKLAEKEHYTIAAAELSITQPSLSHSIAELERELGV
FT                   YLFEKQGRNIRLTKYGRFYLTYVEKSLAELEKGEKLLHELTSPSHGNIDLGFIYTMGAH
FT                   TVPELVQNFTKAENHKNTTFSFYQGATKSIIPDLKNEKFDLAICSYVENEPDIEFLPLT
FT                   KQELVIVVAENHPLAQFDSIDLKDTAEYSYIFFSDTSGLRPLIDSLFKEINIQPKIGCY
FT                   VEEDTAMVGLVSVDYGISIMPKISSLAHYNVKVLSINEPKHDRFIYLASLKNHYISPAS
FT                   KAFKDFALRYGEKYFL"
FT   gene            428148..430142
FT                   /locus_tag="lse_0404"
FT   CDS_pept        428148..430142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0404"
FT                   /product="NADH:flavin oxidoreductase, putative"
FT                   /function="NADH:flavin oxidoreductases, Old Yellow Enzyme
FT                   family"
FT                   /EC_number="1.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0404"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26555"
FT                   /protein_id="CBH26555.1"
FT                   /translation="MTDYPSIFEPLTVKRMTIKNRVIMPPMGTNLAGLNGEFLEEHMAY
FT                   YEQRAKGGTGLITIENACVDFPYGTNGTTQLRIDNDQYIPGFYKLTERLHKHGTCVSIQ
FT                   INHAGASAYPARLNGLQPVSASDIPSKTGGTIPRPLTVEEIYEIVDKYGAAARRAQQAG
FT                   FDAVEIHGGHSYLLCQFLSPLYNKRTDEFGGSAENRARIVKLILEKVRAEVGPFFPIVL
FT                   RFSADEFVDGGNHLEDILELLDYCQEEADILNVSAAINDNLYLQIDQMNLEDGWRSYLA
FT                   KAVKDKFNKPTITSGNIRSPKAAEKILSEGYADLLAMGRGLIAEPNWVNKVAAGQEEML
FT                   RKCISCNIGCADHRIAKSKPIRCTVNPDIIHEDKYKETKVTRPTNIVVIGGGTAGLEAA
FT                   CTAAEVGCNTTLIEANEQTGGLARAIANLPDKKRIADFPNYLANRAAKLTNLKVITGTK
FT                   ADTALIDTFNPDVVVNATGSKPLLPPIKGLLDVIDKEGSNVHSIFGLISNIDAFTDFSN
FT                   KKVAVIGGGAVGLDVVEYFSERGSDVTIVEMMPLLGKDLDMITRLSMMDIIEKNHVDVQ
FT                   TETALTEVAADHFKVKHDGVDAEIPFDYGFVCLGMRPERPLMEELAAYGHEKQIEIVNI
FT                   GDSAATRKILEGVREGRNILTTLEKIGSL"
FT   gene            430242..431117
FT                   /gene="aroE-1"
FT                   /locus_tag="lse_0405"
FT   CDS_pept        430242..431117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE-1"
FT                   /locus_tag="lse_0405"
FT                   /function="Shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0405"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26556"
FT                   /protein_id="CBH26556.1"
FT                   /translation="MTNKITERITGHTELIGLIATPIRHSLSPTMHNEAFAKLGLDYVY
FT                   LAFEVGDKELKDVVQGFRAMNLRGWNVSMPNKTNIHKYLDKLSPAAELVGAVNTVVNDD
FT                   GVLTGHITDGTGYMRALKEAGHDIIGKKMTICGAGGAATAICIQAALDGVKEISIFNRK
FT                   DDFYANAEKTVEKINSKTDCKAQLFDIEDEERLRKEISESVIFTNATGVGMKPFEGETL
FT                   LPSADMLRPELIVSDVVYKPTKTRLLEIAEEQGCQTLNGLGMMLWQGAKAFEIWTHKEM
FT                   PVDYIKEILF"
FT   gene            431183..431941
FT                   /gene="aroD"
FT                   /locus_tag="lse_0406"
FT   CDS_pept        431183..431941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroD"
FT                   /locus_tag="lse_0406"
FT                   /function="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0406"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26557"
FT                   /protein_id="CBH26557.1"
FT                   /translation="MNKVVVKNVIFGEGAPKICVPMVGKTVAALKEEAEMLKKIDLDVV
FT                   EWRVDFFEGVEDLAKVEIALDEIRAILPETPILFTFRSAKEGGELAVSDAFYFELNETI
FT                   AATKKVDLVDVELFNEEADVLKLIETAHKNDVKVVMSNHDFDKTPAKEEIISRLTRMEA
FT                   LGADLPKIAVMPKSAADVLTLLSATNEVFEKANQPIITMSMAGTGVISRLAGEVFGSAM
FT                   TFGAAKKASAPGQIDVNELRHVLDLLHKQF"
FT   gene            complement(432004..432906)
FT                   /locus_tag="lse_0407"
FT   CDS_pept        complement(432004..432906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0407"
FT                   /product="transcriptional regulator, LysR family"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0407"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26558"
FT                   /protein_id="CBH26558.1"
FT                   /translation="MKLSTLKYFVDVAEQGNFTKAAQKLYISQPTLSRRIQELEAEIGV
FT                   ELFIRHRHALELSSAGEQFLVEVNDILKRVNQLTHMFDKQETPDESRQLVKIGYLANFN
FT                   LSKMYELIEEFKASHPYVQFSLKPDTPMNLSDGLSNGAYDLVFNLSTYFNGSKDIEKVP
FT                   FINNHLQIALPANHKFSHMKKLNFAELKEETVILLERKQSPVIVDYVISECTKHGFNLK
FT                   ANSYVQNLDEGLSMTSVGEGLAFLYSGMNDGTLAEKYHIKIVDLENDSTDQDIAAALDK
FT                   PNENELVQELFSFIKSYFN"
FT   gene            complement(432984..434741)
FT                   /locus_tag="lse_0408"
FT   CDS_pept        complement(432984..434741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0408"
FT                   /product="hydrolase, putative"
FT                   /function="Predicted acyl esterases"
FT                   /EC_number="3.4.14.11"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0408"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26559"
FT                   /protein_id="CBH26559.1"
FT                   /translation="MTTKMTEKMLFSPSFEYVDNGIEHGVLSPFETKEIILEKGSQIAE
FT                   GFKPLDCAIKMLKDVPVQMRDGITIYTDIYLPITEEKVPVLVAWSPYGKSAGTAPRYKN
FT                   LFQMLGMGNTWNSGLTKFEAPDPAYWCAHGYAVCNPDMRGIAHSEGDTTMIGSQEAEDG
FT                   YDLIEWLATQSWSNGKTALTGTSYLAFSQWYIAAEQPPHLTCINPTEGLADGYRDLAFI
FT                   GGIPDKNFIERLQVNHVSAKHAKREDLTKEMEAFPLADAAVWKDKVADPRKITIPAFVV
FT                   ASYSNTLHTMGTFRSWRSLASKEKWLRIHDRQEWPYYYDRDNIEELRRFFDYYLLGKEN
FT                   NWKETPTVRYSLIDFQGRNQTDLPAETFPPLATKNKRYFMNGKFRTLQITPETEDFPVK
FT                   YAPENLPGRTSFQMTFDKDTDFVGYPKAKLFMEVDSYDDMDVFVWVQKLDKFGNVLSEF
FT                   VVPNHGAALQDFTQEGASALRYKGAWGRLRASMRHLDSKLTTEEIPAYSFDRVEKLAKG
FT                   EIVELDIVLSPLGLAYKTGETLRVVISSKDELGSVMPGTPGCTPDNKGVHVLHTGGDYA
FT                   SYIQLPLNN"
FT   gene            434937..435533
FT                   /locus_tag="lse_0409"
FT   CDS_pept        434937..435533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0409"
FT                   /product="GDSL lipase/acylhydrolase family protein"
FT                   /function="Lysophospholipase L1 and related esterases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0409"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26560"
FT                   /protein_id="CBH26560.1"
FT                   /translation="MKKKLLFLGDSVTDAGRDFADGYDLGQGYVKYIADSLKTEDVTVL
FT                   NRGVSANRVADLHRRIDTDAIELAPDVVTILIGINDTWFSFSRWEDTSVTAFKEVYRVI
FT                   LTRIKAETNAEIVLMEPFVLPYPEDRKAWRGDLDPKIGAVRELAAEFGATLIPLDGLMN
FT                   ALAVKHGPTYLAEDGVHPTKAGHEAIASIWLEFTK"
FT   gene            435788..436012
FT                   /locus_tag="lse_0410"
FT   CDS_pept        435788..436012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0410"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26561"
FT                   /protein_id="CBH26561.1"
FT                   /translation="MKLLLKNINELAAKQKNEGLTDFEKERQAVLRQEYLQKIRGTVQD
FT                   NLHHVTIIDPLGDDVTPKKLKEIQAELRG"
FT   gene            436171..437106
FT                   /gene="prs-1"
FT                   /locus_tag="lse_0411"
FT   CDS_pept        436171..437106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs-1"
FT                   /locus_tag="lse_0411"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /function="Phosphoribosylpyrophosphate synthetase"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0411"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26562"
FT                   /protein_id="CBH26562.1"
FT                   /translation="MAGKMKLFSVTSERPLATKIADYLDIPLCEVELQKFSDGEVKINI
FT                   EESIRGTNAYVVQSMNSNVNERLMELLIMVDALKRASVHSINIIMPYYGYARQDRKARS
FT                   REPITAKLMANLIQRAGADRLITVDLHAAQIQGFFNIPIDHLSAVPLIGDYLIEKYGDE
FT                   DVVVVAPDHSGVVRARRIADRLDAPIAILNRKPRPHEDEIMSVIGDVKGKVAIVVDDII
FT                   DTGVRATTSADVLLEKGAVEVIACATHSVMAGSATERLQNSKIKEVITSDSIDLPEDKQ
FT                   FDKLTTISIGRILGRAIEGVQENRSLHPLF"
FT   gene            437790..438374
FT                   /locus_tag="lse_0412"
FT   CDS_pept        437790..438374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0412"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0412"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26563"
FT                   /protein_id="CBH26563.1"
FT                   /translation="MKKAFIPLLFLLILLASCSAPDEKLTKDTKIFKEGVINADYQVPK
FT                   NLAELESNSEDIVKVKLLQNKEIGKGNNTISEVEIIEKYKGNFKSGATIDISEPWLLNT
FT                   GEYQAVENYIALEKGQEYILFLSGGHDADKVSSITSLGYGKFNKTLKEQKASMNDFDTV
FT                   GEVQKYDFISNTNEEVLKYQVIKKQVLEKFN"
FT   gene            438463..439140
FT                   /locus_tag="lse_0413"
FT   CDS_pept        438463..439140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0413"
FT                   /product="glutamine amidotransferase, class I"
FT                   /function="GMP synthase - Glutamine amidotransferase
FT                   domain"
FT                   /EC_number="6.3.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0413"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26564"
FT                   /protein_id="CBH26564.1"
FT                   /translation="MIIDVLQHVPHEGPGLIAKWAKENQHQLKVHSLFNEKDQVPTDSE
FT                   FLIILGGPMGVSDTAEFPWLEEERDLIKQLIEQNKPVFGVCLGAQQIATALGSTISMNS
FT                   EKEVGWFPVNRISTELSFFPERIDVFHWHQETFSLPNGVTHLFSSEACSNQGFLYGDNV
FT                   IGLQFHFEMEKSGIEAILQIDEAFITPGKFVQSAAEIRESGIPEGNKQMLEAILDYLAE
FT                   KNI"
FT   gene            complement(439159..439518)
FT                   /locus_tag="lse_0414"
FT   CDS_pept        complement(439159..439518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0414"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0414"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26565"
FT                   /protein_id="CBH26565.1"
FT                   /translation="MEKMLFIQTGFGVDVHGQNITKAAERAVRNAIFTNSMPGIRSQLP
FT                   DNSLENMVVNIKLALPCDTDKLDEEVIRAIIPYGTVTIETMPGGMLTTSGIFLEDKEDK
FT                   NDLMYIVNASVETGY"
FT   gene            complement(439525..439983)
FT                   /locus_tag="lse_0415"
FT   CDS_pept        complement(439525..439983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0415"
FT                   /product="transcriptional regulator, MarR family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0415"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26566"
FT                   /protein_id="CBH26566.1"
FT                   /translation="MNNEQSMNQQIALFYFGYKAFTETADLIIAKHSLKRLHHRILFFT
FT                   ARLPGLTINELLTFLEISKQALHQPLAELKERQLLTIEQGTRDKRQRCIFLTAAGKELE
FT                   NELGAAQRKQMAQIFAETADTDGKHFTEVMEGYAKNRPGAALIKDFKE"
FT   gene            440343..442184
FT                   /locus_tag="lse_0416"
FT   CDS_pept        440343..442184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0416"
FT                   /product="cell wall surface anchor family protein"
FT                   /function="FOG: PKD repeat"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0416"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26567"
FT                   /protein_id="CBH26567.1"
FT                   /translation="MKKFFKLILAITCLLMLTYPTLPVFAEETSSGNNVVNIPDSALKT
FT                   YLNGQLKQASDADITTEQMAQIKSVTLSGTNYTDLTGLETAVNLETLTISNTNITTLNP
FT                   IKNQTSLTYLNVSGDAITDSFFPDLNQLTNLQSISVNSKNVTHNIFGKFNKLPKLRYLY
FT                   AQNSMLITDISALASLENLDTLFLQFDGIDDFRPLNDFASFKNGKLKSLAAYGQNTGRT
FT                   NPRIALKSGKLDYNAADQTLYLPFSMMPNPLTSFDGTVAPFSKSTSASNTYVGFNDVAV
FT                   ASSRLTITDDGITVSGVTKEEFDGLTELEYNARYDFPTGSYPTPPSMSSYTVSSGTYDQ
FT                   YFDISHTLDLTADESIGYNQYTPTNEEQFLKDINAKTDDGTAVQSNFDQVVDFDTPGEY
FT                   IVTLNAENSAGLKADPVEVKVTVYAKPIITADSSISYKEKTTKTVEEFLAETHSSVTEN
FT                   ATLTSDFNDVVDLNTPGEYTVTLNAENERGQKADPVQVIVTVTTKPGVKPTPPTPEPPT
FT                   PTPEPPTPKKPTPEKPEEKKNNKKTVAKDPTKQTPTQKPKSNLTTKENNVTTTKEVTKT
FT                   NEQKLPKTGDTGLGTWPVAFTSIMLGLTAIILLKKRK"
FT   gene            442274..442705
FT                   /locus_tag="lse_0417"
FT   CDS_pept        442274..442705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0417"
FT                   /product="universal stress protein UspA family"
FT                   /function="Universal stress protein UspA and related
FT                   nucleotide-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0417"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26568"
FT                   /protein_id="CBH26568.1"
FT                   /translation="MDKYHRILVAVDGSEPAKLAFEKGLELALKLDGVLAIASIVDLRA
FT                   FSPNVSYDGSLEEKAELELKGNVNEYAEKARAAGVKQVETFVAKGNPKVLLSTDIPAEF
FT                   QADLIICGATGMNRVEKLVLGSVSSYIMAHAICDTLIAR"
FT   gene            complement(442738..443550)
FT                   /locus_tag="lse_0418"
FT   CDS_pept        complement(442738..443550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0418"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /function="Fructose-2,6-bisphosphatase"
FT                   /EC_number="5.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0418"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26569"
FT                   /protein_id="CBH26569.1"
FT                   /translation="MKKNVWKLMVMFCALLLIAGCGNDSTTSKADTKEKKDGTVTFYVV
FT                   RHGKTMLNTTDRVQGWSDAVLTPAGEEVVTAAGKGLKDVDFGAAYSSDSGRAIQTANLI
FT                   LKESDKSADTKLQTDPRFREFNFGSYEGDLNHNMWSDIAKSQGKTLEEWQSTGLSPKDF
FT                   ANSVAELDKTRVKEGENWPAEDYATIQARLKDGITEVAEKESKNGDENVLLVSHGLSIG
FT                   ALLDTIEPGYKLPATGIQNASVTKITYKDGKFSIDDVNDMSYVEKGQK"
FT   gene            445992..446714
FT                   /locus_tag="lse_0419"
FT   CDS_pept        445992..446714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0419"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein predicted to be involved
FT                   in DNA repair (RAMP superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0419"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26570"
FT                   /protein_id="CBH26570.1"
FT                   /translation="MRLKINCDFESNIIPKDYRGKIVSLFKIGIEKSSPERYGDLFGSN
FT                   KRKNYTFSIYLPKPKNNKNEIYLEEKNCIINFSTGDAETGIVFYNAFMYLRNKKVSFSS
FT                   QNNITIKNIDIIREKKIISNKVYLKTLSPVVSRDHNKVTYKNWFYNFEDEEFEPTLKRN
FT                   MLPFLIEEFGEQARFDVEKIKITPISMKKVVVYCHEIHIESSVGIFELTAEPYLQEYFL
FT                   QNGLGSMTGSGFGMLEQL"
FT   gene            446730..448418
FT                   /locus_tag="lse_0420"
FT   CDS_pept        446730..448418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0420"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0420"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26571"
FT                   /protein_id="CBH26571.1"
FT                   /translation="MQAEIEVRANDWLINSGITGFLNIVGKENVRIDGQSLYFSTDILE
FT                   GFETKYFNYFIKEYKETLAWHKIVSYKEKMEYYRAEEFASFDEKALDDLNKYTKDVVKF
FT                   YLKKPNYIKVFPLIDPEANITEWLGNLTTITISKKQKFEEVKVEILESVKSTYNQIDAI
FT                   IDFCASEKGLKYLGAKNLIYSVINKGWSGVSFLFKQTKFIDPYEDYKTTFLDPVFEYLD
FT                   TDLSKAKYNCFICNQPIKTLKLDLSFMNDVGFDTARKTSHVWDFNNDVATCPVCRLIYS
FT                   CVPAGFTYVYGEGMFVNDSFSIDKLLDVNVHMRESILHFNNEGINSNNPYRALVESITM
FT                   EKEDKRRYELADIQLVRYENEHYRFNILSKKMLHILNDSKTILKSLIRCGYKEGNLNIN
FT                   LYKEVIQHLMNNENLFTLIHKLIFYKQTNANGLYYNMGHVAGILEINTKFLKEIDVMTN
FT                   ISQKQLWFVQSCGTEFKEGYYGKKSENKIAGITYKLLNALKVNDKDGFMDTLLNSYSYL
FT                   AKPIPSVFMNVFSNDEAFKSVGYAFMLGVGGERTKKEDGGNTDEK"
FT   gene            448408..449277
FT                   /locus_tag="lse_0421"
FT   CDS_pept        448408..449277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0421"
FT                   /product="CRISPR-associated negative autoregulator,
FT                   putative"
FT                   /function="Uncharacterized protein predicted to be involved
FT                   in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0421"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26572"
FT                   /protein_id="CBH26572.1"
FT                   /translation="MKNKGLAMTIVFQAESANYGESLGNISALKKISRNNGDQYTYISR
FT                   QAIRYNLMEQIGEKVAPVKAEGGGDKKVIQFLSEASIADFPELDFFGYLKTEKGTAGQK
FT                   RSAKVRLSNAISLETFKGDLDFLTNKGQADKINENMNIAQAEIHKSYYRYTITIDLDQI
FT                   GIDGTVEIDNKEKARRVKKLMDTVAFLYRDIRGRREDLKPLFVIGGVYDVKNPVFQNVV
FT                   DVLDNKIVIKNIDDLLQYEDIRENTKVGIIDGQFANADEVKSKLNAESVPAFFNEIKGK
FT                   IDAYYEGN"
FT   gene            449255..450043
FT                   /locus_tag="lse_0422"
FT   CDS_pept        449255..450043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0422"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0422"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26573"
FT                   /protein_id="CBH26573.1"
FT                   /translation="MLIMKAIRVKLWQDLVNYKKPTSFQLKETYPLPPYSTVIGMIHTL
FT                   CGFTSYHEMKISIQGKYFSKVNDLATRYEFKNGMTYDATRHQIKVDNYGVSRGISTVEL
FT                   LVDLELLLHIIPEDPALVPVIEKAFKEPIEYPSLGRREDIATIQAVDVVEVEKRKPKEN
FT                   KSVNISKDYNAYVPISLAESKVVRFKSQESSVGRSKLLGTRYLLTEKYERVNHGTEKAP
FT                   KFFRKWRKKDVIYSSRIFVSKNDVFFLDKDDCLVFIEEEV"
FT   gene            450113..452323
FT                   /locus_tag="lse_0423"
FT   CDS_pept        450113..452323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0423"
FT                   /product="CRISPR-associated helicase Cas3, putative"
FT                   /function="Predicted helicases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0423"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26574"
FT                   /protein_id="CBH26574.1"
FT                   /translation="MQKYLAKSNPPETIQEHTDNLLKNYQTLKKLYPEINIDWYLLELV
FT                   CLLHDLGKMNRLFQKKLGNGSGVGKEIPHGYLSVAFVPYSKLEDLGYSEDEIQVVYQAI
FT                   ARHHERKKDFTEQEWETEIEKLSEQWETFFYERLADNADYSSEIDEIYFYPEARIFEGE
FT                   DTVEIETFKNYVQLKGLLNRIDFAASAGIDVELENDFLQESMEHQLANFREKNAAADWN
FT                   LLQKYMLQHQNENVVVIAETGMGKTEAGLLWLGNHKGFFTLPLRTAINAIYTRVTREIV
FT                   TDKQAQRVGLLHSETYSQYLFHEENTEMEIDEYYTRTRQMSLPVTICTLDQLFDFVFRY
FT                   AGFEHKLATLSYSKVIIDEIQMYSPDLLAYLILGLSYIDKFGGKFCVMTATLPGIVLDL
FT                   LHDNGVDFIQPEEKFVSERVRHSVEVVHTEIDSAFIEPFFAGNRILVICNTISKAKKIY
FT                   SELKAMFPNKKVRLIHSQFIKKDRSKKEEEIFEDGQKDNPESCIWVATQVVEASLDIDF
FT                   DLLFTELSDINGLFQRMGRCYRNRALEVDTNVYVFDGGEKVCSGVGQFIDKTIFMNSKK
FT                   ALEKCNGALTEMKKMEIVEQIYSTEALKESEFYDELTQALNYVKSFDSYELDKKEVRSK
FT                   FRNINSITAIPSTVWQENEEEITSYMEILAKSSKEVSKKEKMIARTNLAEFMLNIPDYL
FT                   YKKSEGEVHRINRYETVIEFKCDYSEDIGIIMQEKQKESLFF"
FT   gene            452335..452823
FT                   /locus_tag="lse_0424"
FT   CDS_pept        452335..452823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0424"
FT                   /product="conserved hypothetical protein"
FT                   /function="RecB family exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0424"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26575"
FT                   /protein_id="CBH26575.1"
FT                   /translation="MRISGTHVYYYFVCKRKLWCFSKEIRMEHLDENVQLGKLLDETSY
FT                   TRENGQVMIDETVNIDFIKDWKVLHEVKKSRAIEEAGIWQLKYYMYFLKQRGIVIEKGV
FT                   VDYPKIRQRETIFLLEEDESEIEKVLTEIENITTDMKPPKVIDKPLCKKCAYYEYCYI"
FT   gene            452827..453825
FT                   /locus_tag="lse_0425"
FT   CDS_pept        452827..453825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0425"
FT                   /product="CRISPR-associated Cas1 family protein"
FT                   /function="Uncharacterized protein predicted to be involved
FT                   in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0425"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26576"
FT                   /protein_id="CBH26576.1"
FT                   /translation="MRKIESYYLFSDGELKRKDNVIRLTAPDGRFKDLKVEMTREIFLF
FT                   GEVNMNTKGLNYIGQLGIPVHIFNYYGFYSGSYYPRETNVSGQLLIAQVENYTDEKKRL
FT                   YIASEFIEAASFNLLRNLRYYKQRGKDVTKEMDEIKFLRKSIGKMEDIQSLMGIEGNIR
FT                   KTYYEAWQKIINQEIDFEKRVKRPPDNMINTLISYVNSLVYSSCLTEIYKTQLNPVISY
FT                   LHSAGERRFSLCLDIAEIFKPLIADRIIFSLLNKNVITEDNFEKEANFCYMNKAARQKV
FT                   LQAYDLRMKETIKHRDLGRNVSYRHLIRLECYKLVKHLMNDKEYEGFKIWW"
FT   gene            453800..454108
FT                   /locus_tag="lse_0426"
FT   CDS_pept        453800..454108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0426"
FT                   /product="CRISPR-associated protein Cas2, putative"
FT                   /function="Uncharacterized protein predicted to be involved
FT                   in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0426"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26577"
FT                   /protein_id="CBH26577.1"
FT                   /translation="MKASRFGGDYMYVILIYDISVENGGAKVWRNVFKICKRYLTHVQK
FT                   SVFEGEITPALLVKLRMELDKYIRSDMDSVIVFSSRQQKWLEKEFWGLTDEKTSNFF"
FT   gene            456263..456388
FT                   /locus_tag="lse_0427"
FT   CDS_pept        456263..456388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0427"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26578"
FT                   /protein_id="CBH26578.1"
FT                   /translation="MKDGVRESDLIGALEEAQTGAVKLDATRYVNTFPEKNTPIS"
FT   gene            456427..456903
FT                   /locus_tag="lse_0428"
FT   CDS_pept        456427..456903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0428"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0428"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26579"
FT                   /protein_id="CBH26579.1"
FT                   /translation="MILEISLSAYIFTFKLWDWGRLGLDGKPRPVHIDHGKKVINWNRS
FT                   EKWVAENLVNQFEPLIETATHTKEKTGLYKTEQIYTERDWFTDYVDYDNSEKTVNMLNL
FT                   VEGDNVVVESLDDAFEAFEVRYVETFVIPAQVERFRIRNIGKSDHVAVLRARIM"
FT   gene            457126..457299
FT                   /locus_tag="lse_0429"
FT   CDS_pept        457126..457299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0429"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26580"
FT                   /protein_id="CBH26580.1"
FT                   /translation="MKTETRSYIAKEIPGTPKVNYKTTVRESFLKGPGGGVKVESVWDG
FT                   DRLLTIIVKGGK"
FT   gene            457301..457540
FT                   /locus_tag="lse_0430"
FT   CDS_pept        457301..457540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0430"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26581"
FT                   /protein_id="CBH26581.1"
FT                   /translation="MNSFKLKRYESFIELKDDLKEDTILISEALSDSNKFIKANNDLFE
FT                   AGFIYYDTGLQPQIKMLCQSQKIFLGVNEIFFLY"
FT   gene            457560..457802
FT                   /locus_tag="lse_0431"
FT   CDS_pept        457560..457802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0431"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26582"
FT                   /protein_id="CBH26582.1"
FT                   /translation="MFEVELPSLLYDVLVDLDCIYVVCVCELDIFVYQNNGTLLWNMGF
FT                   RDTVESYYLEDDESIIIECSDGERTTFQLDSGAVK"
FT   gene            complement(457871..458239)
FT                   /locus_tag="lse_0432"
FT   CDS_pept        complement(457871..458239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0432"
FT                   /product="membrane protein, putative"
FT                   /function="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0432"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26583"
FT                   /protein_id="CBH26583.1"
FT                   /translation="MTILAFILTFIVMIEHIYIMILEMFFSNTNLAAKTFGVEKELLAN
FT                   RKVQTLFANQGLYNGFLAAGLAWGLFFAGDTFAGSVQIFFLSCVVIAALFGGATSSRGI
FT                   LVKQGVPAVLALVAVLLV"
FT   gene            458385..459800
FT                   /locus_tag="lse_0433"
FT   CDS_pept        458385..459800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0433"
FT                   /product="MFS drug resistance transporter, EmrB/QacA
FT                   subfamily"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0433"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26584"
FT                   /protein_id="CBH26584.1"
FT                   /translation="MQQERAMERKIRPIPIIASFLMAGFIGLFSETALNMALSDLIQVF
FT                   DISSATVQWLTTGYLLTLGILVPISGLLLQWFTTRGLFFTAVSFSIAGTLIAAISPTFA
FT                   MLMIGRVVQAVGTALLLPLMFNTILLIFPEHKRGSAMGMIGLVIMFAPAVGPTISGLIL
FT                   ENLTWNWIFWISLPFLIIALLFGIKYMQNVSVVTKPKIDILSIILSTLGFGGVVFAFSS
FT                   AGENGWGSATVLTAIIVGGISLALFVWRQLTMEKPLMDLKVFKYPMFTLGLILVFISFM
FT                   MILSTMILLPLYLQNSLALAAFSAGLVLLPGGVLNGLMSPFTGRLFDAYGPRALVIPGF
FT                   VVAVIALFFLTRIETDTTALTIIVLHSVLMIGISMVMMPAQTNGLNQLPRKLYPDGTAI
FT                   MNTLQQVSGAIGTAVAITIMTAGQKAYMETAQGAGPEEMVASLTAGIQNAFVFGLIMAC
FT                   IGLVCSLFIRKAK"
FT   gene            459928..460932
FT                   /locus_tag="lse_0434"
FT   CDS_pept        459928..460932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0434"
FT                   /product="ROK family protein, putative"
FT                   /function="Transcriptional regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0434"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26585"
FT                   /protein_id="CBH26585.1"
FT                   /translation="MALPRDLKELNKRHIKSILRQRGAMTKAEIAETTDLSVVTVNKLI
FT                   RALEENSEIIEQDSSVVTGGRRAISYKINPNFQQVLVVSLQEKWKKITYSFSVYNLLGE
FT                   VEFVEDMSGEGLDIHELKRNIKDHVCAFPKISCIVIGVPGIEIGGRLRAMDFPLLLNVH
FT                   LRETLESEVNLPVLVETDTNAAILGYKNRPVAENNIVGLYYPERFPPGAGLFINGEILK
FT                   GKNGLAGEIKHMPLGIDWDNFDFSVDKIKEHIRKMVLLTMSFYDPETIVIYTNFYFGQK
FT                   DFMEELTQGLAEIYPYASLPEMVLSRKFTSDYRIGLFAFGVDYLENNLTDWRI"
FT   gene            complement(460971..462287)
FT                   /locus_tag="lse_0435"
FT   CDS_pept        complement(460971..462287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0435"
FT                   /product="glycoside hydrolase, family 4 protein"
FT                   /function="Alpha-galactosidases/6-phospho-beta-glucosidases,
FT                   family 4 of glycosyl hydrolases"
FT                   /EC_number="3.2.1.86"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0435"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26586"
FT                   /protein_id="CBH26586.1"
FT                   /translation="MTKGIKIATIGGGSSYTPELIEGFIKRQDELPVRELWLVDVEAGR
FT                   EKLEIVGNLAKRMVKKAGVNMEIHLTLDREEALKDADFVTTQLRVGLLDARVKDERIPN
FT                   SYGVVGQETNGPGGMFKGLRTIPVILDICKDMERLCPDAWLINFANPAGMVTEAVLRYS
FT                   NQKKVVGLCNGPIGIERNIADTLGVDVSEIYVEFVGLNHMVFAKTVYHNGKDVTKDVVF
FT                   KMTEDEAGSSLKNINATGWDKTFLRTLNMIPIDYLRYYWQTKQQLEDQARAYAEHGTRA
FT                   EVVKKVEAELFELYKQEELAEKPKQLEQRGGAYYSEAACNLINSIYNDKRDIQIVNTRN
FT                   NGAILDIDPDSAVETNCVITRQGPIPLASGRLPIAINGIIQEIKTFERLTAEAAVTGDY
FT                   DKALLAMTINPLTPSESVAREMLDELLEAHKEYLPNFFK"
FT   gene            462490..463242
FT                   /locus_tag="lse_0436"
FT   CDS_pept        462490..463242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0436"
FT                   /product="phosphosugar-binding transcriptional regulator,
FT                   RpiR family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0436"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26587"
FT                   /protein_id="CBH26587.1"
FT                   /translation="MLFLDKNLELNDTELDIYNYIVANLDKVVYMRIRDLATEAHVSTT
FT                   TILRFCRKFGCNGFSEFRVKLQLYLEEQKLAQIDMADETTYIDFLKRTAQPEFKAQIQN
FT                   AVRILRDRELVLFAGVGSSGVIAEYGAIYFSSLFTLALHIEDPLNHPFYHLSSKLSDKI
FT                   CMIAISVEGENEDIIRYIHQLKAQNCKVISITNSAKSTIARLSDANIAYYINKEMYQEA
FT                   NITSQLPALYTIENIAREIRTQIDNEKS"
FT   gene            463348..463791
FT                   /locus_tag="lse_0437"
FT   CDS_pept        463348..463791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0437"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0437"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26588"
FT                   /protein_id="CBH26588.1"
FT                   /translation="MYSNTKEKVVFTFIMCSLMILCMSSYNIFLENGINSEAFVIVLKA
FT                   FVPFVLVGFLLDFFVVGKIASRLHGLMVSQKASTFKKVIMMQLLMVTFMCVLMSTLSLI
FT                   VNQQDFSHLGMLILRNYFVALFLQIFIVSPFVRLISPRIFGLL"
FT   gene            complement(463845..465503)
FT                   /locus_tag="lse_0438"
FT   CDS_pept        complement(463845..465503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0438"
FT                   /product="STAS domain/sulfate transporter family protein"
FT                   /function="Sulfate permease and related transporters (MFS
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0438"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26589"
FT                   /protein_id="CBH26589.1"
FT                   /translation="MFKHIFLSLNGYKASYLRNDVISGVGVAALTIPVAMGYAQVAGLP
FT                   PIYGLYASFLPVIAYVIFASSPQLIFGIDATASAITGSIILGTAGLTAGSKEAIALAPV
FT                   LAFFCAIFLILFSILKLGRFAKYISAPVLSGFISGLSVSIIMGQIPKIMGLKESGDSFF
FT                   SSLGIIFGQFFQSNWLSLAMGVVTIIIVISCKKLIPKVPMSLVVLIIGTMAAYFFKLDQ
FT                   YNVDIVGKIPVGFPSLGLPDFAASSWTLAIGGGLVCAIATFAGSLLPSESFAMRNKYTI
FT                   DDNRELFAYGASNFVAAFSGSPPASASVSRTAANEQFRGKTQMVSIVAATIIALIVAFL
FT                   SGLLYYMPQPVLSGIVFAALVGIIDVDVLKGLFKISRREATVWIVAAVGTLLVGVIFGV
FT                   LLGIVLSFINVVSRSMQSPVAVLGVIEGRHGYFDLKRNPEAKPIPNIVIYRYSASLFFG
FT                   NFGKFADGLKTAIQDDTKLVIFESSAIINIDTTSTESLKDLLKWLDEKGIEYYFADIID
FT                   HLKTSFRKHDLGFIIDEGYTKKTVEDALDDFYRKK"
FT   gene            complement(465620..466360)
FT                   /locus_tag="lse_0439"
FT   CDS_pept        complement(465620..466360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0439"
FT                   /product="transcriptional regulator, MerR family"
FT                   /function="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0439"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26590"
FT                   /protein_id="CBH26590.1"
FT                   /translation="MQPKELAELTGISVRTLHHYDKIGLLTPQKDDENGYRHYSEQEVD
FT                   KLQQILFFKELDFPLKKIKQILDDPSFDKSVALSLQYRLLTEKKKQIETMLKTLDQTIK
FT                   NEKGEITMTNEEKFTGFDFSTNPYEEEAKKLWGDKAVEQANANISKMTNTEKLTIKESF
FT                   DAEFRSLAAIRTLHPASDEAQLRMDHFFHYLNDNHGNIYSLEAFRGLGEMYVADERFTK
FT                   NIDQFGDGLALFLKEAMKIYAEKN"
FT   gene            466601..468076
FT                   /locus_tag="lse_0440"
FT   CDS_pept        466601..468076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0440"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0440"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26591"
FT                   /protein_id="CBH26591.1"
FT                   /translation="MNRKIKSISLWLWHHLTPQVFAVICVLVITLLALFIPPYIGMADN
FT                   GDFFRIFSSNGLFVNNANYDNLQFGHFVKEFGIYQYFNENPVAIYSSQSIFIQIALALN
FT                   KVFWSDTVFDIRFLGGLQLALLLPAIYLLVAGLTAKMKGWPGYLVAALTVFIFADTAYT
FT                   AYFNSFFSEGLILIMMLYIAAGFILLFQHKYNDYAMLGMIFVASLILITAKQQNAPIAV
FT                   VIAVCGIIVFFIRRDQAFRISAMAAFLVIFMSGVVMYAFIPGEFVTINQYQTMTRGVLL
FT                   DSENPEKSLQEMGINEQFALLKGTNFYQKYKMIDLDNELMQKDFYPNYNFVSVLSYYLE
FT                   NPKQLGKMLDLSARNSFSIRPFEMGNFEKVTGYQFKEKTHFFSAYSDAKAKLAPEKFSF
FT                   LILWALIFLISYAVNAFKAFRVKDFRGMLLFDLIVLLIGSGFAVILVTIVGDGEADLTK
FT                   HNFLFNVCFDLTILIGATSILQAYLKGRGEKHA"
FT   gene            468069..469568
FT                   /locus_tag="lse_0441"
FT   CDS_pept        468069..469568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0441"
FT                   /product="putative secreted protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0441"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26592"
FT                   /protein_id="CBH26592.1"
FT                   /translation="MRKKIIMAFLLGLVIFFINEQDITAKADDGVTVFYDSLAKNTENE
FT                   GNIDSLLRILNSMGERVMMYSWNENPDLSETSKIIVLQNKQNDLPDKWVQKLKDSKAKI
FT                   AYIGGNPPAFLADKLQLKTEAVANAALTIQTNDGLTGKPQLVVNTNLITSYKGTSFGEI
FT                   NTTENVKSPYGVQSENYAYAPIFQANNASEFALVDVLRALFGTKKEANQYALITDVNPF
FT                   VDFNMLKKTADTFYEKGIPFVVSAGPVFYNSNFMAAKNYAEILRYVQAKNGTILMNVPA
FT                   VTYGASPAGELESIIQKSVHFFADNDVAALGVTAELYWNFDKVYGTEGFAPFNSGILLP
FT                   NEKIIHTTKKNNGNAFEKSPFSVTSDFYGTMSGQMNFPLDIAITYPFFNSEKELKAAVN
FT                   QLADENISDFRLQTNEVKTIQDTIESNAGSLYINDQAITLDSDLKYLKTKKMETQKQAG
FT                   SLEGFFSYQNTFFTIVIVLSLGIIGILFIFGYRLYMKKYMK"
FT   gene            469579..470829
FT                   /locus_tag="lse_0442"
FT   CDS_pept        469579..470829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0442"
FT                   /product="glycosyl transferase, family 2 protein"
FT                   /function="Glycosyltransferases, probably involved in cell
FT                   wall biogenesis"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0442"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26593"
FT                   /protein_id="CBH26593.1"
FT                   /translation="MVIADYLALFAVICIWGLLLVNIILIVAGYVYYLKNEARKIPEIP
FT                   KDVPFISVMVPAHNEGKVIVKTVESLLAFDYPKDRYEIIVINDNSSDNSAELLKAIQAK
FT                   NPTRQLKIINTDNVTGGKGKSNALNIGFAESRGEYIAIYDADNTPERQALRILVGEITN
FT                   DAKLGAVIGKFRTRNRNASWLTRFINIETLSFQWMAQAGRWALFKLCTIPGTNFIVRRS
FT                   LLEAIGGWDVKAVAEDTEISFRIYMMGYRIKFQSKAVTWEQEPQTLPVWFKQRSRWAKG
FT                   NIYVILKNVPLLFKREGRRVRFDILYFLSIYFLLLTSLIVSDILLVLYALGFVHTTLAG
FT                   LSGALWLLAILLFVAGTFITLTTEKGEISFSNLIFIMLMYVTYCQLWMVVAAYGFFIFL
FT                   KDTVLKKETKWYKTERF"
FT   gene            470845..472890
FT                   /locus_tag="lse_0443"
FT   CDS_pept        470845..472890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0443"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0443"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26594"
FT                   /protein_id="CBH26594.1"
FT                   /translation="MKKLTVMGLLVFAVLFLYRPDVFAADKTYQTVFGTDKTAQGKFTT
FT                   TKQNFTIENYWDVSSAKAKLVYTITQLNEKEISTMTLKINDVAFYSFRPDKTDKGTRQI
FT                   EVEIPKDKLKKGVNVLSVESFVYTDLPDGRCTIDDTPANWLQFDKTSAVNVTYSDKAFK
FT                   QTIADFGERFTGIDTVKSQQGAVAVLENAGDTELGAALEGLSGFSSANTLEDKNIPFGK
FT                   YEEANTRNGKNYIALFSSYDHLPAAIKSQIKADKKLETQALFQVVTAGNTNTLVVTSKS
FT                   NDALKKAGKLIANQNYLSQLGTNSKWLTTDEKIDTPANNVDKNTKLTTSGDKIKGIGHV
FT                   TQDYFISMPANRSASTGTEVSLDFRYAQNLDFEHSLVTILVNGKPIGSQKLSAKKANGD
FT                   KVTFQIPSDLNVKGDFSVTVAFDLVLTNNYCGFISDSEIPWAYITPESTINLNTTEETD
FT                   LLFEQYPYPFVADGDFNNAMVVVPDKLTTEDTDSLANIFNLLGRFHDGNRGSLTAVHAK
FT                   NWDKAKKDANVIAVGTMNNNPVIKNANEDLYFQYDKTGSYFLSNEKISIEKNYGKGLGS
FT                   VQLIKSEGMQILAVTGPGTTQTELGSELIASKENLAEIYGDGAIVDNDNTIHSYRFKKA
FT                   ADTQDESFGTKISNNKEVTVFGAFALLTVVLLGVAVLLILRKYRRK"
FT   gene            472904..473758
FT                   /locus_tag="lse_0444"
FT   CDS_pept        472904..473758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0444"
FT                   /product="membrane protein, putative"
FT                   /function="FOG: GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0444"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26595"
FT                   /protein_id="CBH26595.1"
FT                   /translation="MKKITNNLYADIGFLFFILLCFITIGFMINTPDEYLRNIIFLNIT
FT                   FLLVIITYFTNLTLGLILNILYIFIYATYIIYEIVANQMAYGVDSYYWLIITPLFTVAG
FT                   AMFTRNTSKLQAENTKIKEQNLYLGTIDQETLLKNIVSFQNDERIFSSISRRYDLPLSL
FT                   MVIKVRHWRELKRFQSEDEMRLALQDISAILESCIRTSDVLYLLDKDDATWGLLLLTDE
FT                   PGGKLVADRIKSRIAEANTEEFAAKYRVKLELRIGTSQFDSEKVKTPLDFIELATKELE
FT                   YDV"
FT   gene            473817..474641
FT                   /locus_tag="lse_0445"
FT   CDS_pept        473817..474641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0445"
FT                   /product="conserved hypothetical protein"
FT                   /function="SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0445"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26596"
FT                   /protein_id="CBH26596.1"
FT                   /translation="MNLEEIVDCMLRTNQEIQQTQTEHRIKLVDFWEIKAGDRVLEVGC
FT                   GQGDTTAVLANAVGPNGFVQAIDIAPETYGAPFTIGDATNHIKNSVLGDRIDFKLATDI
FT                   LQGDISFSDKSFDVAILSHASWYFGSKDELTRMLVLLSKWAKRVCYAEWNPQITDVKQS
FT                   AHLLAVLTQASYEAFKTNTQSNIRTFISPFDLKEIIAEHNWKIGAEASIYSEKMQDSRW
FT                   EIEYTKDFITKELEADLGVPAKFKTFLQSQSQLIELENSLPMASYCTSWRTE"
FT   gene            474719..474988
FT                   /locus_tag="lse_0446"
FT   CDS_pept        474719..474988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0446"
FT                   /product="ACT domain protein"
FT                   /function="ACT domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0446"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26597"
FT                   /protein_id="CBH26597.1"
FT                   /translation="MRAVLTVIGKDNVGIIAGVSNKLAELNINIVDVSQTIMDGYFTMM
FT                   MMCDISQINKEFDEIKSELAGKGENLQVKIHIQREEIFNAMHKL"
FT   gene            475007..476362
FT                   /locus_tag="lse_0447"
FT   CDS_pept        475007..476362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0447"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0447"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26598"
FT                   /protein_id="CBH26598.1"
FT                   /translation="METNQILETIRMIEEEKLDIRTITMGISLLDCMDGDGEVARKKIY
FT                   QKIVTKARHLVSVGEAIESEFGIPIINKRISVTPIAIIAGSSADKDYVEFAKTLDAAAK
FT                   EVGVNFIGGYSALVQKGYTKGDEILIRSIPRALAETERVCSSVNVGSTRTGINMDAVRQ
FT                   MGEVIKETADLTADTQGLGCAKLVVFANAVEDNPFMAGAFHGVGEADCVINVGVSGPGV
FT                   VKRAIEKVKGEPFDIVAETVKQTAFKITRMGQLVGQVASEKLGVPFGIVDLSLAPTPAI
FT                   GDSVAHILEEMGLEMVGTHGTTAALALLNDAVKKGGVMACGHVGGLSGAFIPVSEDAGM
FT                   IEAVQQGALNLEKLEAMTAICSVGLDMIAVPGDTTAETLAAMIADEAAIGVINNKTTAV
FT                   RVIPASGTKVGDMVEFGGLLGTAPVMPVNGKSSADFIARGGRIPAPIHSFKN"
FT   gene            complement(476400..477368)
FT                   /locus_tag="lse_0448"
FT   CDS_pept        complement(476400..477368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0448"
FT                   /product="transcriptional regulator, LacI family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0448"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26599"
FT                   /protein_id="CBH26599.1"
FT                   /translation="MANIQEIAKLAGVSSATVSRVINKRDYVSEETRKRVQTIIDQLDY
FT                   VPNLNAVSLKRGTTKLIGMVIPSFTDSLNVFLKSFTMIAQEHGYNVTLFMTRIDQDKEL
FT                   EALEMLRQKKIDALVLVIRSNDWKTIEHYTKYGPIVTWQRVESEKIPSVFMNQYDGYTL
FT                   ALEHLYEKGYRKFVNVYGNTTGLNTQSRMLAFKDFCERYDLDPHEFRQFYGLGSRQDGE
FT                   KIAHWWEETAHKPDAFLTPNDYFAAGLLTEARRSGHRIPEDFAICGFDNMEIAHLLDMT
FT                   TIHYPVNLQAENAFMLIMNKLFGSDLPLIDLDFHLVERKTT"
FT   gene            477541..478863
FT                   /locus_tag="lse_0449"
FT   CDS_pept        477541..478863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0449"
FT                   /product="glycoside hydrolase, family 4 protein"
FT                   /function="Alpha-galactosidases/6-phospho-beta-glucosidases,
FT                   family 4 of glycosyl hydrolases"
FT                   /EC_number="3.2.1.86"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0449"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26600"
FT                   /protein_id="CBH26600.1"
FT                   /translation="MKKGVKIVTIGGGSSYTPELVEGFIKRYHELPIRELWLVDIEAGR
FT                   EKLEIVGNMAKRMVKAANIDCEVHLTLDRREALKDADFVTTQFRVGLLEARIKDERIPL
FT                   SHGIIGQETNGAGGMFKAFRTIPVILGIVEDMRELCPDAWLINFTNPAGMVTEAVLRYG
FT                   KWDKVIGLCNVPIGAIKSASDVLGKPEEDLFFKFAGINHLHWHRIFDKDGTELTETVID
FT                   GLYGPNANPGKVVENIKNMRFLYEQVKHLKMLPCPYHRYYYMTDAMLEEELASFKNEGT
FT                   RGEVVKKLEDSLFELYKDPNLDHKPEELSKRGGAHYSDAACEIINSIYNNKGTLMVVST
FT                   RNNGAIDDVPYDSAVEITSVIRAHGAEPVNFGKFPPAQRGLLQVMKSMEELTIEAAVTG
FT                   DYATALQAFTSNPLVPSGDLAKTILDEMLEAHKEYLPQFAK"
FT   gene            479022..480212
FT                   /locus_tag="lse_0450"
FT   CDS_pept        479022..480212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0450"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0450"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26601"
FT                   /protein_id="CBH26601.1"
FT                   /translation="MSQMLAFVIVVLILFIGDVVATRTKAWVPSVFVCAILFLFGYWTF
FT                   FPSNIVEIAGIPPIVATLLMYLLITNMGTLLSVRELMNQWKTIVIAISGILGILALLFT
FT                   IGTLFFDFKTVVVVAPPLVGGVVSSLIMSEAAKAAGLVSLSVLAILIYVMQGFAGYPLT
FT                   SIMLKKEGSRMLTKYRSGEWVPANEVAQVEGHDTHETPRLFQKIPDKYNTNYFKFLRLG
FT                   LVGLLAYGCSVLIDPIVTISPYVLCLLFGVIATSIGFLERQPLQKANGFGFAIMALMLF
FT                   IFDGLKNATPEMLLDLLWPMFGTIVIGIIGMYIFSFIVGKFLGVSKELAFAVSLTALYG
FT                   FPADYIITNEVINSLTTDQKEREALTSHMLPPMLVAGFVTVTIVSVVLAGIFVGFL"
FT   gene            480237..481481
FT                   /locus_tag="lse_0451"
FT   CDS_pept        480237..481481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0451"
FT                   /product="amidase, hydantoinase/carbamoylase family
FT                   protein"
FT                   /function="Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0451"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26602"
FT                   /protein_id="CBH26602.1"
FT                   /translation="MKTNLERIKQHLEKLNTYTATPGAGTTRLSYSKEDLGARNYLKAE
FT                   MAKVGLTVSEDAIGNIYGRLEGVNPDLPAVMVGSHFDSVPNGGAFDGPAGVITGLEVAT
FT                   VFHEQNYKPYYPLEIIAMIEEEGSRFGAGLLASRAITGKVTKEMLHEMKDSDGITAAEA
FT                   MAKLGFNADKVNKAVRTKKSIKAFIELHIEQGPILENANEDVALVDTIVGLTEIKVTVS
FT                   GQAGHAGTTPMNERKDALTTAVQILADLPDLAIQEGNGTVLTVGKLNVFPNGANVIPNK
FT                   VVFTVDIRAKEEQHVQNTLNKVKAIIKQAEKNGISCEIEDMLYEKPTQLSKEIHHALTE
FT                   SARKLNFKHRTMVSGAGHDAMIFAGLTEVGLVFVPSHNGISHAPEEWTDYDKLQKGIEV
FT                   VLDTVKKWTEEDTNE"
FT   gene            481474..482655
FT                   /locus_tag="lse_0452"
FT   CDS_pept        481474..482655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0452"
FT                   /product="peptidase M20D, amidohydrolase family protein"
FT                   /function="Metal-dependentamidase/aminoacylase/carboxypeptidase"
FT                   /EC_number="3.5.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0452"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26603"
FT                   /protein_id="CBH26603.1"
FT                   /translation="MNDKIKQLILKEEDEMIAFRRDLHQHPELQWQEFRTTDQVATELD
FT                   KLGIPYRRTEPTGLIADLVGGKPGKTVALRGDMDALPVQELNESLAYKSTEDGKMHACG
FT                   HDSHTSMLLTAAKALKEIQAELSGTVRFIFQPSEENAEGAKEMVAQGAMEGVDHVFGIH
FT                   IWSQTPSGKVSCVVGSSFASADIIQIDFKGQGGHGAMPHDTIDAAVIASSFVMNLQAIV
FT                   SRETDPLDPVVVTIGKMEVGTRFNVIAENAHLEGTVRCFNNTTRAKVAKSIERYAKQTA
FT                   AIYGGTAEMIYTEGTQPVINDEKSALLVQQTIVESFREDALYFEKPTTGGEDFSYFMDE
FT                   APGSFALVGCGNPDKDTEWAHHHGRFNIDESVMKNGAELYARFAYNYLNQQEF"
FT   gene            complement(482703..483719)
FT                   /locus_tag="lse_0453"
FT   CDS_pept        complement(482703..483719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0453"
FT                   /product="tagatose 1,6-diphosphate aldolase, putative"
FT                   /function="Tagatose-1,6-bisphosphate aldolase"
FT                   /EC_number="4.1.2.40"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0453"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26604"
FT                   /protein_id="CBH26604.1"
FT                   /translation="MVQITKGKFDGLQRLSNDKGVIAALAIDQRGSLKKMIQQAKGTED
FT                   KKDVEDFKQLVSEELTPYASAILLDLEYGTPAIKARHEGSGLLTSYEKTGYDATTPGKL
FT                   PDLIEDLSALRIKENGGDAVKILVYYDPDEPAEINEIKYAFLERIGAECRAVDIPFFLE
FT                   PITYDAKVTDSGSLEYAKLKPAKVKASIKEFAKPRYGVDVLKLEVPVNFKYVEGFAEGE
FT                   AAYTQDEAARHFEECSDLSPLPFIYLSAGVTSEMFHKTIQFANQHNVQYSGVLCGRATW
FT                   ADGIEVYGKQGDDALREWLRTQGKENITSLDKLLDEGAVPWWTKYGSFEDVHVVEKQ"
FT   gene            483953..485104
FT                   /locus_tag="lse_0454"
FT   CDS_pept        483953..485104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0454"
FT                   /product="penicillin-binding protein, putative"
FT                   /function="Beta-lactamase class C and other penicillin
FT                   binding proteins"
FT                   /EC_number="3.5.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0454"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26605"
FT                   /protein_id="CBH26605.1"
FT                   /translation="MNRRERHKTKRRKNLIIVLCAVFILFVTTSWIIAEFKGKEQQAVA
FT                   KPVQKKTTTKPTKSKPVKEEPTKTVVKNQEIDNYLQEIGFSGSVLVVRDGKTILQKGYL
FT                   DANRETKKPNTPDTLYYIGSSQKAIIATAILQLEEQGKINTEDPISKYLPNFPNGNNIY
FT                   IKNFLNHTSGIVGHTETGGKITPKELIEDIENQGIKSQPGTWNYLDSNYTVLAYLVETL
FT                   SGESLQSYLGKHIFKPSGMEHTGFNQKKVDGGKNESIGYYLQKDGTYKTPSLIDLSQLY
FT                   GCGDICMTSKDLYLFNKALMSKKLISEVSLQKMFTPGSTSGYGMGFYVDPGSYNSHGVL
FT                   SGWNVSNSMSHTGRTYVILFSNIQNNIASFGKVNNHIYELLNK"
FT   gene            complement(485141..486061)
FT                   /locus_tag="lse_0455"
FT   CDS_pept        complement(485141..486061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0455"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /function="ABC-type Fe3+-hydroxamate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0455"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26606"
FT                   /protein_id="CBH26606.1"
FT                   /translation="MYQKHKWAAIFMTLLLAVVLTACGSSSDKDSSKEKEDATKTVTDT
FT                   LDRKIEVPTTPKRIVALQNVSEMEILGVKPVGTLDYYITTYPEATKGTESVGNDKPNIE
FT                   KIASLKPDLIVISDYQKDLLENLEKVAPVYITHFGDTPDKQLSNMANLLNKKAEKEKWD
FT                   KDYTAASKEAKATLKDAGVENEKAAVIQFYGKEIYIHDAKVFDGLFSGAGFTPTDEAKA
FT                   NHETKAISSEAIPSYAKDADRLFILMPTDGNDDSINEMLKGVWKDIPAVQKNQVYKVDN
FT                   TKWSDYSASAQLYQIEDTVKQITGK"
FT   gene            complement(486258..486893)
FT                   /locus_tag="lse_0456"
FT   CDS_pept        complement(486258..486893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0456"
FT                   /product="CBS domain protein"
FT                   /function="Hemolysins and related proteins containing CBS
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0456"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26607"
FT                   /protein_id="CBH26607.1"
FT                   /translation="MLIKNLCIPKINLTTVPGDATLQEAINLLEESGYRCVPVLDEKGE
FT                   KFLGNIYKMHIYKHAANGGSLSDPVMSLIKNESKHICVNASFFEVFFTIKELPYIAVLN
FT                   EQGHFYGILTHGKLLGLLQDGWNVKTTSYVLTIATGEVQGALTKITKIIDRYSSIASLI
FT                   TLDNQSEDFIRRVLVSLPTGVTEDKKNEIVAHLERKGLRVVETEKIQK"
FT   gene            487105..488286
FT                   /locus_tag="lse_0457"
FT   CDS_pept        487105..488286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0457"
FT                   /product="alcohol dehydrogenase, iron-containing"
FT                   /function="Uncharacterized oxidoreductases, Fe-dependent
FT                   alcohol dehydrogenase family"
FT                   /EC_number="1.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0457"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26608"
FT                   /protein_id="CBH26608.1"
FT                   /translation="MAQEMMNFDYYNPTHIIFGKNRLEELNQVIPADKKVLLLYGGGSV
FT                   KKFGTLDKVKAVLKTREIGEFGGIEANPTYETLIKAIKLVKEENYDFLLAVGGGSVIDG
FT                   TKFVAAGALFDGDPINIFGSGIGENRPITEALPFGTVLTLPATGSEMNSGGVVTFVEKK
FT                   AKLGFGSPFTYPVFSLLDPELTYTLPTRQLANGIMDAYVHVMEQYMTYPVGALLQDRYA
FT                   ESLLQTLIEIGPDVIDENNHDYNTRATFMWSATNALNGTLSRGVPQDWASHGLGHEITA
FT                   LYGIDHARTLAIVLPSLLNVRRNEKREKLVQYAERVWGVTTGTEDAKIDAAIAKTREFF
FT                   ESLGAGTKFSDYGLGEEVVDQLVNQLERHGLTSISERGDQTLEVSRQIYTNAL"
FT   gene            488345..489832
FT                   /locus_tag="lse_0458"
FT   CDS_pept        488345..489832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0458"
FT                   /product="proton-dependent oligopeptide transporter"
FT                   /function="Dipeptide/tripeptide permease"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0458"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26609"
FT                   /protein_id="CBH26609.1"
FT                   /translation="MSTENTAKEKTFFGHPRGLATLFNTEFWERFSYYGMRAILIYYMY
FT                   DTVANGGLGFSQATATAIMSIYGSLVFMSGVIGGWFADRVLGPRRTIFYGGVLIMVGHV
FT                   VLALPNGGATALFISMIFIILGTGLLKPNVSNVVGDLYPAEDNRRDAGFSIFYMGINLG
FT                   AFIAPFIVSAVSDKAGSFHAGFSVAAVGMAVALIVYVLTGKSYLKEAGKKIPNPLQKSE
FT                   AKSLTFKILGIILAIGLLIAILTMITGSLTINTIILAVTVMGVGVPLAYFIMMMTSKKT
FT                   EPDEKSRLTAYIPLFLIAVLFWMIEEQGSSTLAIFAAERTDLSIGSYTLNPANFQSLNP
FT                   VFVIILSPIFAWIWTRLGDRQPSTPRKFALGLFFAGLSFVIMMLPGILHGNTTTLVSPL
FT                   WLVLSFFICIFGEMFISPVGLSATTKLAPKAFASQTMSLWFLSDAMGQAFNAQATQFFS
FT                   ADTEVAYFGITGFVAIAFAIGLFILAPFLKKYMKGVH"
FT   gene            490030..490737
FT                   /locus_tag="lse_0459"
FT   CDS_pept        490030..490737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0459"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /function="Phosphoglycerate mutase 1"
FT                   /EC_number="5.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0459"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26610"
FT                   /protein_id="CBH26610.1"
FT                   /translation="MDSSSRVVIYLTRHGKTILNTLDRVQGWADSPLTEEGALVAHDLG
FT                   RGLKGTHFVAAYASDRGRAIETARIVMKESDNQHLKLAKLAEIREFGFGKFEGEYNQTV
FT                   LKMVANEHGFDSIESYYDKTTENDSNIVIDTVHRLDETGMTENSTIFEERLTAGLDEIL
FT                   ADVTKLGGGDVLVVAHGMVIHRIIEMIDPSQNLRIIENASVTKVIFEDGAYSIEEPGNM
FT                   FYVETGKQAQGGV"
FT   gene            490738..491433
FT                   /locus_tag="lse_0460"
FT   CDS_pept        490738..491433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0460"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /function="Fructose-2,6-bisphosphatase"
FT                   /EC_number="5.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0460"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26611"
FT                   /protein_id="CBH26611.1"
FT                   /translation="MAAGKLHVYLVRHGKTMFNTSRRVQGWSDTPLTNEGIEVAQFLGR
FT                   GLRDISFDSVYTSDRGRTIETAGIVLQESNQTHLEINELRDFREFGFGKFEGELEDIMF
FT                   GSVMKHLGFQTLDEAFESFGEDGYRIVSETVEKLDETGMAESWNEMEYRLKNALQTVSA
FT                   ENTTADSNVLVISHGMAINAIVSFFDSKLVDPELANASVTKLGFENGEWTVEAVNDLSY
FT                   VEAGKSVLV"
FT   gene            491692..491976
FT                   /locus_tag="lse_0461"
FT   CDS_pept        491692..491976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0461"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0461"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26612"
FT                   /protein_id="CBH26612.1"
FT                   /translation="MSEINVKETIFQQHANTLESANDGEYFPLKNGNMPYSRANSINQL
FT                   RSALSDLVGVVQNFQEVTKKDADRLEKMGKAYTKQDKSAAKKIGQLEVR"
FT   gene            491977..492345
FT                   /locus_tag="lse_0462"
FT   CDS_pept        491977..492345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0462"
FT                   /product="conserved hypothetical protein"
FT                   /function="Type I site-specific restriction-modification
FT                   system, R (restriction) subunit and related helicases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0462"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26613"
FT                   /protein_id="CBH26613.1"
FT                   /translation="MDTIHSQIEQQLQQVKKAKITIETTIDQTRRKQNEQDWLEEDNHH
FT                   LEQEKLALLDFLRSGWQGEEASGFHRYLEDQQHEESQTWKKDLQAKRTDLETELQENKA
FT                   QLHALETKQATLKKEWRA"
FT   gene            492342..493853
FT                   /locus_tag="lse_0463"
FT   CDS_pept        492342..493853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0463"
FT                   /product="conserved domain protein"
FT                   /function="ATPases with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0463"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26614"
FT                   /protein_id="CBH26614.1"
FT                   /translation="MSRIDIAELNDFLHGLRASNAEAKGMIRKIKEAAMDYTQDNSLKG
FT                   AAVSTSKSYFSSTYTSITQSILEALDESEERLAQYIREFGSQVDSSPSCKIDAQVLQEV
FT                   MDKVSQLQRKEESLQEQLTAPNTRPDMQEVYAVKTKSAHTQLLKAIEKEQILEKYIAFE
FT                   QSHGQFFSALDELIRATGQAVKELLDKVTFNDQTGTYSIPKSTTASLQRMKKALDTART
FT                   ENDKDPYPESFEDYTLLAYTYVNDQGETVTMWLLEKDGKRANNKELQAFLEEHGNELSP
FT                   VLYTELSGEELERKVNDAWKDGVNYLNGQKVSGPSAGILKSSAYVASMKDAMDDAGLTE
FT                   MSLSLGFGIAAARNAPILKKKAKSSSKAKVNSPETKQTVSGEKWNNYFKEKYGAEKVRW
FT                   KNPVKSINEVIDMPSLLKRAHPEDIAEIAKQAGWTVQPLKKGSKKGLSYSESGGYSMNA
FT                   PAGSGDSLYIQYHPGGGHHGANAYYKVSSPKNGTIRIDLEGRVLE"
FT   gene            493853..494200
FT                   /locus_tag="lse_0464"
FT   CDS_pept        493853..494200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0464"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0464"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26615"
FT                   /protein_id="CBH26615.1"
FT                   /translation="MARDVEDLMLLHKRVIENLEEFSMSAEQQIEKLKRFDVADELASD
FT                   FSDIALEYAKILFDQDWLTEEQLKLFLEIDKKLDKMSMNKDLWSNEAVKSNNEWEECRT
FT                   RGKELLATFGY"
FT   gene            494489..494773
FT                   /locus_tag="lse_0465"
FT   CDS_pept        494489..494773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0465"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26616"
FT                   /protein_id="CBH26616.1"
FT                   /translation="MLCFSHPCMLKINEGYDEVLYGFNPINIFKLNEKEYSIEEEESDR
FT                   FKLKGELIDSADSIIQIGNFKINISDGDIAGDIYNGDFVELTVSRIDTV"
FT   gene            complement(495286..496326)
FT                   /locus_tag="lse_0466"
FT   CDS_pept        complement(495286..496326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0466"
FT                   /product="conserved hypothetical protein"
FT                   /function="3-carboxymuconate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0466"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26617"
FT                   /protein_id="CBH26617.1"
FT                   /translation="MSNNEATAYIGTYTKVESQGIYRLVIDKTTGEIKENTLAGKMDNP
FT                   TYLKISDDEKFVYSVAKDGDKGGVAAFAIEADGSLSLINQDLATGNPPCYVDASHDGSV
FT                   VVSANYHLGTIVSYPTEKGALKPSVSTIQHVGKSVHERQEKPHAHYAGFTPDQKYVLTC
FT                   DLGTDKVTTYSATAGKLEQVTELDVTPGSGPRNLVFHPNNTFVYIMTELTSEVIFAEYD
FT                   KSTGELKVIQTIASLPADFDKENKGSAIHISPDGRFLYVSNRGQDAIVSFAVAEDGKLT
FT                   LATTTPVEGVGPRDFDLNYTGELLVATNENSNNMTVFGINKETGALTLLQKDVKVPEPV
FT                   CIKFVK"
FT   gene            496714..497619
FT                   /locus_tag="lse_0467"
FT   CDS_pept        496714..497619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0467"
FT                   /product="magnesium transporter, CorA family"
FT                   /function="Mg2+ and Co2+ transporters"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0467"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26618"
FT                   /protein_id="CBH26618.1"
FT                   /translation="MPFQTYFGDKKYNWVNIDMDKSEKLDDVYQRYGIDDEVIAYSLDR
FT                   NERAHFEYDQKTDTFVLVFNVPDQRKIDNHHETIPMVFMIKGRQLITLTNKNNQYITQK
FT                   MQKHLEDNTEMTIHQFLFSSLYIIMDSFFPYVEEMNIDRKIINDKLKIKTTKKNLLSLS
FT                   DLETGIVYFVSASKQNAALLEQMKAHMVYRGLNEVEKEQFEDALIEARQLVEMTDLSSQ
FT                   ILQQLSGTYNNILNNNLNDTMKILTALSILLTVPTIITGFFGMNMPLPLEHNAFGWMVT
FT                   IFISIILWFGLSYVLRRLMK"
FT   gene            complement(497662..499038)
FT                   /gene="gdhA"
FT                   /locus_tag="lse_0468"
FT   CDS_pept        complement(497662..499038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdhA"
FT                   /locus_tag="lse_0468"
FT                   /product="NADP-specific glutamate dehydrogenase"
FT                   /function="Glutamate dehydrogenase/leucine dehydrogenase"
FT                   /EC_number="1.4.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0468"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26619"
FT                   /protein_id="CBH26619.1"
FT                   /translation="MAQTPTIQNDTKAAEEYAARVFETIKQRNPGETEFHQAVEEFLNS
FT                   VIPALAKEPKYEANGILEQLTEPERLISFRVSWVDDSGTVQVNRGYRVQFNSAIGPYKG
FT                   GLRFHPSVTGSIVKFLGFEQIFKNSLTGLPIGGGKGGSDFNPKGKSDAEVMRFCQSFMT
FT                   ELQKHIGPDTDVPAGDIGVGGREIGYLFGQYKRLRGAYDAGTLTGKGLTYGGSLARTEA
FT                   TGYGLVYFTVQMLEAAGETIRGKKIVVSGSGNVAIYAIEKAHELGAKVVACSDSSGFVY
FT                   DKDGINVATVKQLKEVERLRISEYVAFHPNAEYYAGGDVWSIPCDIALPCATQNEINAD
FT                   QARALVKNGVIAVAEGANMPSTLKAVDIYHENKVLFGPAKAANAGGVAVSALEMAQNST
FT                   RMSWSFQTVDEHLQNIMKDIYKNSSNAASEYGASGNLVIGSNIAGFLKVADTMIAQGII
FT                   "
FT   gene            complement(499568..499879)
FT                   /gene="hisE"
FT                   /locus_tag="lse_0469"
FT   CDS_pept        complement(499568..499879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisE"
FT                   /locus_tag="lse_0469"
FT                   /function="Phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /EC_number="3.6.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0469"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26620"
FT                   /protein_id="CBH26620.1"
FT                   /translation="MLGKLYEEISLRKETPKEGSYTNYLFDKGLDKILKKVGEETTEVV
FT                   IAAKNNDQELISEVSDLTYHLLVLLVEKNIPLSAIQAELDGRAGKLSTTRDRKEIDKL"
FT   gene            complement(499880..500197)
FT                   /gene="hisI"
FT                   /locus_tag="lse_0470"
FT   CDS_pept        complement(499880..500197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisI"
FT                   /locus_tag="lse_0470"
FT                   /function="Phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0470"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26621"
FT                   /protein_id="CBH26621.1"
FT                   /translation="MNHVDFSKGLVPTIILDDQNGEVLMLAYMNEASYQKTLETGFTWF
FT                   YSRSRNELWNKGATSGHTQKVQQIWTDCDNDTLLIRVIQTGPACHTGKRSCFFNLIKEE
FT                   E"
FT   gene            complement(500194..500949)
FT                   /gene="hisF"
FT                   /locus_tag="lse_0471"
FT   CDS_pept        complement(500194..500949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="lse_0471"
FT                   /product="imidazoleglycerol-phosphate synthase, cyclase
FT                   subunit"
FT                   /function="Phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribonucleotide (ProFAR) isomerase"
FT                   /EC_number="4.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0471"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26622"
FT                   /protein_id="CBH26622.1"
FT                   /translation="MLTKRIIPCLDVTAGRVVKGVNFVSLTDVGDPIEIAKAYNEAGAD
FT                   ELVFLDITATVELRETMIDVVERTAEQVFIPLTVGGGINSISDMKNLLQAGADKISLNS
FT                   AAIKRPELIQEGAAKFGNQCIVVAIDAKWNGENWSVYTQGGRNDTGLDAIEWAKKAVRL
FT                   GAGEILLTSMDGDGTKNGYDIPLTKAISEAVSVPVIASGGCGNANHMAEVFEKTNATAA
FT                   LAASIFHYGELSIKNVKTTLLEKGVNIRP"
FT   gene            complement(500939..501661)
FT                   /gene="hisA"
FT                   /locus_tag="lse_0472"
FT   CDS_pept        complement(500939..501661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="lse_0472"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /function="Phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribonucleotide (ProFAR) isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0472"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26623"
FT                   /protein_id="CBH26623.1"
FT                   /translation="MQIFPAIDLKNGQCVRLFQGDFTKKTIVNPDPVAQATTFARDGAS
FT                   YLHIVDLDGALEGRPVNLEVIKEMKKASAIPVQVGGGIRSMAQVDYYLQSGIDRVIIGS
FT                   AALTDPDFLQTAVQKYGPKIIAGIDAKNGYVATSGWLDVSQVNYLDLAKKMEQMQVETI
FT                   IYTDISRDGTLTGPNLTQMEALKNHVAVNLIASGGVSSRKDLENLAKLNLYGAIAGKAL
FT                   YNKNISMADIIEVEQLAY"
FT   gene            complement(501634..502266)
FT                   /gene="hisH"
FT                   /locus_tag="lse_0473"
FT   CDS_pept        complement(501634..502266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="lse_0473"
FT                   /product="imidazoleglycerol-phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /function="Glutamine amidotransferase"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0473"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26624"
FT                   /protein_id="CBH26624.1"
FT                   /translation="MIVIVDYDTGNTKSIRKALDFIGLPNKISSNKKDIKAADGIILPG
FT                   VGAFPEAMQELIQRGLDTTLKEVATTGKPILGVCLGMQLLLDSSNEHSLTKGLGLIPGQ
FT                   VEKLPDEPKFAVPHMGWNQLNIHQTTPLTTNLEGEYVYYVHSYYANCPEKYIIATSSYS
FT                   VEIPSMINNGNIYGAQFHPEKSGEIGLRILTGFKEVIETCKSSQQSI"
FT   gene            complement(502267..502851)
FT                   /gene="hisB"
FT                   /locus_tag="lse_0474"
FT   CDS_pept        complement(502267..502851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="lse_0474"
FT                   /function="Imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0474"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26625"
FT                   /protein_id="CBH26625.1"
FT                   /translation="MRTATKTRTTAETDIELALNLDAQEEATISTGVGFLDHMLTLFAK
FT                   HSRITLHVKADGDTYVDAHHTVEDIGITLGLCLKESLGDKAGINRYGSAYVPMDESLGF
FT                   AALDLSGRSYLVFDAELTNPKLGDFDTELVEEFFQAVAFNAEMNLHLRVLYGKNTHHKI
FT                   EALFKAFGRALREAITTNPEIKGVNSTKGVL"
FT   gene            complement(502852..504135)
FT                   /gene="hisD"
FT                   /locus_tag="lse_0475"
FT   CDS_pept        complement(502852..504135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisD"
FT                   /locus_tag="lse_0475"
FT                   /function="Histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0475"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26626"
FT                   /protein_id="CBH26626.1"
FT                   /translation="MKYLTGTTEAILSELKSIKSTTDTATIETQVKAIIQQVKTDGDKA
FT                   VLHFTEQFDKVSLSELRVSDDEITTALNQVDAPFLEVLQQAKANIESFHLKQKQNAFLD
FT                   NEKTGVIRGQLIRPLATVGVYVPGGTAAYPSSVLMNVLPAKIAGVERIVMITPPGENGI
FT                   NSHVLAAAQIAGVDEIYQVGGAQGIAALAYGTESIPKVDKIVGPGNIYVATAKREVFGL
FT                   VDIDMIAGPSEIVVLADDSANPSFIAADLLSQAEHDTLSRAILITTSEKIAKETETQIY
FT                   AQLEKLPRKAIAAESIRSEGKIILAQNQADMFEIMNEIAPEHLEVQLESPMNYLHEIKN
FT                   AGSIFLGSYASEPLGDYFAGPNHVLPTSGTAKFFSPLGVEDFTKRSSFISYTKEALAKE
FT                   KDAIILLAKKEGLDAHAKAIQIRFEEEK"
FT   gene            complement(504132..504773)
FT                   /gene="hisG"
FT                   /locus_tag="lse_0476"
FT   CDS_pept        complement(504132..504773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /locus_tag="lse_0476"
FT                   /function="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0476"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26627"
FT                   /protein_id="CBH26627.1"
FT                   /translation="MKVLKIALTKGRLEKDAIRLLEKAGIDCSSMEDKKRKLIFHSPTQ
FT                   PISFILVKAVDVMTYVKHGVADIGIVGKDILLEASKSHYEMLDLEIGKCQFCLASTPAF
FT                   DISSYRRKIIATKYPNIASKYFREKGEDVEIIKIEGSVEIAPVLGLADAIIDIVETGST
FT                   LKENGLQIYDKMYPISARMIVNKASLKQNKTQIFELIDQLEKVIKEERNK"
FT   gene            complement(504770..505951)
FT                   /locus_tag="lse_0477"
FT   CDS_pept        complement(504770..505951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0477"
FT                   /product="histidyl-tRNA synthetase, putative"
FT                   /function="Histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0477"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26628"
FT                   /protein_id="CBH26628.1"
FT                   /translation="MNLNRNLPTGTRDKLFREAQTAYKIEQQVNQYFGKRGFKRIETPI
FT                   IEFADVFSSENQADTKMYRFFDEKGRLTVLRPDMTLPIGRVVSTTGVTLPLKLSYSGKI
FT                   FRANEDFGGEQNEQTQAGIEIIGYPSIKAEIECILSGIGVLNALEIPNFQIELGHAAIY
FT                   RRVVHLLNLSETAEIDFRLLIQNKSLTGIQQFVENNPSTLDAFILALPRLFGPANTILP
FT                   QAKKLTKDKGILTALTEIETIVAAVSYTADINVDLGLVQDFHYYTGIIFRGYADLAADN
FT                   FLSGGRYDHLLEQFTTSSSPAVGLALNLDSLTNLQNRAGIIQKQAATTLLIHYDLAALP
FT                   EAEQLMKRTPNSELSFFEEPSNAISFAKKWKIPRVVHVSTGGTKTIFAKEAGE"
FT   gene            506093..506920
FT                   /locus_tag="lse_0478"
FT   CDS_pept        506093..506920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0478"
FT                   /product="histidinol phosphatase, putative"
FT                   /function="Predicted metal-dependent phosphoesterases (PHP
FT                   family)"
FT                   /EC_number="3.1.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0478"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26629"
FT                   /protein_id="CBH26629.1"
FT                   /translation="MKRDGHTHTEFCPHGTREDVEEMILKAIKLGFDEYSIVEHAPLPN
FT                   EFIQKAAGDREAVETASMALSDIHYYLKKMMHLKKKYASDLLIHIGFEVDYLLGFEDFT
FT                   RDFLDEYGPQTDDGVLSLHFLAGQDGQRSIDFSAADYDEGIVQFYGGFEQAQLAYLEGI
FT                   KQSIEANLGKFKPTRIGHISLCQKFWQYFGPEKNVFSDEVTAQFQQILTLVKKRDYELD
FT                   FNTAGLFKPLCGETYPPKEIASLANELQIPFVYGSDSHGVKDVGRGYDVYCQK"
FT   gene            complement(506905..507201)
FT                   /locus_tag="lse_0479"
FT   CDS_pept        complement(506905..507201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0479"
FT                   /product="methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase"
FT                   /function="Predicted methylated DNA-protein cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0479"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26630"
FT                   /protein_id="CBH26630.1"
FT                   /translation="MIPADFEDRVYEVVRQIPRGKVTTYGQIAYKIGFPKNSRLVGATL
FT                   KHSKRDKITPCHRVVNAAGRLVPNWEEQRELLLSEGVRFKANGHVDLKIYFWQ"
FT   gene            507281..508312
FT                   /locus_tag="lse_0480"
FT   CDS_pept        507281..508312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0480"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26631"
FT                   /protein_id="CBH26631.1"
FT                   /translation="MPDFSYAKITKLVVHFAGNKAREEGTEVSANVLADIGSEMNQTLA
FT                   SIFLEPFNKDEYYQFTHETDLDFNEVRTFAANMFAYEEEFLDESKKILEHLYSETTHPN
FT                   IKSGDVWIFYIEGCVVDGDFTNGIGIFKVENKEVFLKNDFNGREFQIGYDKGITGTDLD
FT                   KGCLIFDLEQDSGNKVLILDRLNRGDSVYWKDKFLGIEKITDEKFYTEGFVEVCTDYIK
FT                   QREESLLDKSNFVKATTEYLAGEETLNIAEFARTTIEKPEEITEFNTMVDTFERENNVR
FT                   FPETFQLDEEKRGKLSKKIRKTIKLGKNISVVVKDLEQLEETDFVQGYDEERGKNYMIV
FT                   YYD"
FT   gene            complement(508357..509652)
FT                   /locus_tag="lse_0481"
FT   CDS_pept        complement(508357..509652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0481"
FT                   /product="xanthine/uracil permease family protein"
FT                   /function="Permeases"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0481"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26632"
FT                   /protein_id="CBH26632.1"
FT                   /translation="MDKFFKLRENKTTVRTEILAGLTTFLSMAYVLFVNPSMLATTGMD
FT                   LKAVFVATILASVVGSLAMGLIGNYPIGLAPGMGLNAFFAYTVCAQWGIPWQTALAGVL
FT                   VSGLVFICLTLSGIREKIVNAIPSELKFAVGAGIGFFIAFLGLKNAGIIVPNDSTIVAL
FT                   GDLHSGPVLLAVFGIVITVCYMTLGWKGAIFFGMATTAIAGMIFGLIDVPNHIVSSVPS
FT                   IAPTFGQAVIHLPDIFTPQMLIVILTFFFIDFFDTAGTLVAVATQAGFVKDDKIPRAGR
FT                   ALFSDSLATVSGAIFGTSTTTSYVESTAGVAVGGRTGLTAIVIAICFSLSLFFSPLLGV
FT                   ITSAVTTPALVIVGILMIGNVAHIDWTKFEIAVPAFFVVLMMVLTFSIATGIAIGFIFY
FT                   PITMALKGRYKEVHPIMYVMMVLFILYFIFVV"
FT   gene            509966..511360
FT                   /locus_tag="lse_0482"
FT   CDS_pept        509966..511360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0482"
FT                   /product="glycosyl hydrolase, family 1 protein"
FT                   /function="Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase"
FT                   /EC_number="3.2.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0482"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26633"
FT                   /protein_id="CBH26633.1"
FT                   /translation="MTYKFPENFWWGSAASGPQTEGAANVDGRKPSIWDHWYDIEPGRF
FT                   FNDVGPTNTSNFYYQYKEDIALMKQTGHNSFRTSIQWSRLIPDGIGEVNPKAVDFYNRV
FT                   IDEMIANNVEPFMNLYHFDMPMSMQEKGGFESREVVDAYATFAKTCFELFGDRVKHWFT
FT                   FNEPIVPVEAGYLYDMHFPNVVDFKRATQVAYHTTLAHALAVKEFHALAIPKGQIGIIL
FT                   NLTPSYPRSQNPADVKAAHIADLIFNRSFLDPVTKGEFPADLVEIIREHDALPTYTEED
FT                   LAIIKNNIIDILGVNYYQPRRVKAKEYAAHPDAPFMPEHLFDNYEMPYRKMNPYRGWEI
FT                   FERAIYDIAINLRDNYDNIPFFISENGMGVEGESRYRNADGMIEDTYRIDFIKSHLKWL
FT                   HKAIEEGANCNGYHLWTFMDCWSWANAYKNRYGLVEVDLDNNFKRTIKASGHWYKELAE
FT                   NNGFED"
FT   gene            511404..512132
FT                   /locus_tag="lse_0483"
FT   CDS_pept        511404..512132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0483"
FT                   /product="transcriptional regulator, GntR family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0483"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26634"
FT                   /protein_id="CBH26634.1"
FT                   /translation="MAQNQTKYSFIAEEIRKRIMNHAYPLNQPIPDEITLAKEFDCSRM
FT                   TMKKALEVLVLEGLLYRKRGHGTFIIKSALDADRLQIHNQEVNGFTKLLNGKKVISKVI
FT                   EFKVIFPSEEIAERLHIEMETPIYDILRVRLVKDEPYVLEHTYMPVGVIPGINQQILEG
FT                   SIYSYIQDELHLKIASSYKQIRADKATLLDQQYLDCASDDPVVEVEQTVYLNNGLAFEF
FT                   SKSRHRYDKFVFTTVNIARR"
FT   gene            512244..513407
FT                   /gene="xylR"
FT                   /locus_tag="lse_0484"
FT   CDS_pept        512244..513407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylR"
FT                   /locus_tag="lse_0484"
FT                   /product="transcriptional repressor of the xylose operon,
FT                   putative"
FT                   /function="Transcriptional regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0484"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26635"
FT                   /protein_id="CBH26635.1"
FT                   /translation="MTQKTDQDVMRENNKKLVLKTLFNAGQTSRSSIASTIRLQKSTVS
FT                   SIVRELHEAGLIEELGIGESTNSGGRRPNLIQLNYRYGYVLAFDMGARHLRYSVNYLNG
FT                   EVIQKESLRLIGKSIKDVFQMMEKVISGLPNFATKKGLLGIAVSTHAPVYNNEIRYSPF
FT                   LELDSFSLLSALQEVVDVPIRFENEANLTAISIRDFWNHSDEEPLTNLVALNIHNGIGA
FT                   GTIIKEQLYHGLQGLAGEIGRSVIWKDKKVYRLEELYSEKAIIEKIAQHEKKSDLTVDE
FT                   FIGLIRSGNQFVLEVVDEWITAIAQITYNLVQYSAPEAVFLSSRSLAQFPELLERISSE
FT                   YKELDPLGETRLEFTEHDIYDSSLLGGVALISRQVLGLESQNLVFKK"
FT   gene            513564..514877
FT                   /gene="xylA"
FT                   /locus_tag="lse_0485"
FT   CDS_pept        513564..514877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylA"
FT                   /locus_tag="lse_0485"
FT                   /function="Xylose isomerase"
FT                   /EC_number="5.3.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0485"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26636"
FT                   /protein_id="CBH26636.1"
FT                   /translation="MSYFPQVEKIQYEGKNTKNRLAFRHYNAEEVVLGKPMKEHLRFGV
FT                   AYWHTMTQDGSDPFGMAINERTWIAGTEMETAKNRVEAFFEILEKLGAEYFCFHDIDVA
FT                   PAGNSIEEFMNNLDEITDLIKEKMDQTGIKLLWNTANMFSHPRFNNGAGSTNDPEVFAY
FT                   AAAQVKKGLDISKKLNGANYVFWGGREGYETLLNTDMKFEQDNIARLFKMVIAYAGKIG
FT                   HKPQFLIEPKPKEPSKHQYDFDAATTMAFIQNYGLEGDFKLNLEANHATLAGHTFEHEL
FT                   RVAREFNALGSIDANQGDMLLGWDTDEFPTNVVDVTLTMYEILQNGGIAPGGINFDAKV
FT                   RRSSFAMEDLLLAHIAGMDTFARGLKAAAKIIEDKFIENILNERYGKWSSTDIGKSILD
FT                   GKEDLESLTKYAYQHGDNIKLESSHIEHVKSVLNDYVF"
FT   gene            514896..516398
FT                   /gene="xylB"
FT                   /locus_tag="lse_0486"
FT   CDS_pept        514896..516398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylB"
FT                   /locus_tag="lse_0486"
FT                   /product="xylulokinase"
FT                   /function="Glycerol kinase"
FT                   /EC_number="2.7.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0486"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26637"
FT                   /protein_id="CBH26637.1"
FT                   /translation="MGYVLGIDLGTSSLKGLIMNKAGQLVAEASAEYRIDSPAPGFSEQ
FT                   HPEYWVIAFEEVITKLSFDVADFSAELEAISFSGQMHSLVTLGENNEVVYPAILWNDVR
FT                   TTKQCAEIMEQLGDQLKEITKNIVLEGFTLPKILWLQQNKPEIWAKVRKIMLPKDYLAF
FT                   VLTGNMACEYSDAAGTSLFDIEKHEWSTAICDKFEIDKDILPSVVASLEQVGVVNEVYA
FT                   NRFGLKQDVKVFAGGADNACAALGAGIVNEDYALVSLGTSGVFSSFEPEIINYQGKLHF
FT                   FNHVIPDVYYSMGVTLAAGNSLNWFKNTFGKGLGFDELLADVHTVAPGSEGLLFTPYIV
FT                   GERTPHIDSKIRGSFIGIDTRHELKHFARAVLEGITFSLKDAQVLMETAKNKKFKQIIS
FT                   VGGGARNTDWMQMQADIFDAEIIRLEVEQGPGVGACMIAAVGNAWFTDFESCRDTFVQY
FT                   QKETFKPKQDNVANYEKLYEVYREVYPATKNICATLTGFGEI"
FT   gene            complement(516442..516900)
FT                   /locus_tag="lse_0487"
FT   CDS_pept        complement(516442..516900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0487"
FT                   /product="membrane protein, putative"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0487"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26638"
FT                   /protein_id="CBH26638.1"
FT                   /translation="MDLVWTIIIQLVLSYVATVTFAIITNVPKRALNACGITGTFGWMA
FT                   YWTLMQMDSGTGASSLAGAFVVAVLSHFFAKYKKMPITIFNVPGIVPLVPGGLAYQAVR
FT                   NFVLGDYTEAIGFSVQVTVVAGAIAAGLMLSEVFNHSIRTFRERKERI"
FT   gene            complement(516917..517669)
FT                   /locus_tag="lse_0488"
FT   CDS_pept        complement(516917..517669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0488"
FT                   /product="membrane protein, putative"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0488"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26639"
FT                   /protein_id="CBH26639.1"
FT                   /translation="MKTDTTDYLLETCLMAGKIMMESGAEMYRVEDTMNRIANIASNKK
FT                   GISFVTPTGIFMSLEGERNVQLQQIPTRTINLEKVSMVNELSRDFAEKRINLKDLHTKL
FT                   TNLDKDVRHFPLWLQILAASFVSGSLMIIFGGSWVDFIPTCLIGAIGFIVFYYTQIFVK
FT                   VKFLAEFLASFTVGLLAVFTISIGLGINLDKMIIGGVMPLVPGVPITNAVRDLIAGHLL
FT                   SGMARGTEALLTSCAIGIGIAVIFRFFL"
FT   gene            517838..518044
FT                   /locus_tag="lse_0489"
FT   CDS_pept        517838..518044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0489"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0489"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26640"
FT                   /protein_id="CBH26640.1"
FT                   /translation="MANIEYEIMEEVGVLSENTRGWRKELNRVSWNGRPAKYDIRDWAE
FT                   NHEKMGKGITLTDEEAEALKKLL"
FT   gene            518058..518741
FT                   /locus_tag="lse_0490"
FT   CDS_pept        518058..518741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0490"
FT                   /product="phospholipase/carboxylesterase family protein"
FT                   /function="Predicted esterase"
FT                   /EC_number="3.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0490"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26641"
FT                   /protein_id="CBH26641.1"
FT                   /translation="MRMYAYDIYEPIGRKEGETFPVIFGIHGFGGDELDMAGRLELLMD
FT                   RFVVVSLRGDVEYGPSFGFYHMVLEGDPNMHEIDFTSLRVAEFIDDICKNYHSIDKSQI
FT                   FVAGFDQGAILTTAIMQSYGGQYKGAALLSGRVPTFLENRPSNLMLKNKQIFIGHGLED
FT                   AVFQVKEADKIAAFFEKMGCNVETHRYFIGHNINEAEQDDLNDWFESFLPNQPVKNKAE
FT                   KQRPQ"
FT   gene            complement(518757..519941)
FT                   /locus_tag="lse_0491"
FT   CDS_pept        complement(518757..519941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0491"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0491"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26642"
FT                   /protein_id="CBH26642.1"
FT                   /translation="MKNSIKVKIFPKFTKGYKEGYPLILKERMEKWPKELEEGDILELI
FT                   DASGKFIARGYHGKQNKGDGWLFTWDKKEQLDEPFLTELITTAKDKRQFLFADDTTTAF
FT                   RIFNGEGDGFGGFTADYYDGFLVIQWYSIGVYSFQKMILDIFMSLPEIKGIYEKRRFQE
FT                   DTKDDFVAGQKATFPLIIKENGINYATYLDDGWMTGIFLDQRDVRRRISEDYAISKNVL
FT                   NTFSYTGAFSVAALFGGASKTTSVDVAGRSLAKTKEQLEVNGLDPATQSIIVEDVFHYF
FT                   KYALRKQLTFDLIVVDPPSFARTKKVTFRAAKDYPALLREIIDITAIGGTIVASTNYAG
FT                   FGMKAFKKMIAEAFESSDRTYKITETHSLPADFTVNKNFPEGNYLKVLFLTLDV"
FT   gene            complement(520028..521599)
FT                   /gene="iap"
FT                   /locus_tag="lse_0492"
FT   CDS_pept        complement(520028..521599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iap"
FT                   /locus_tag="lse_0492"
FT                   /product="protein p60 precursor (invasion-associated
FT                   protein)"
FT                   /function="FOG: LysM repeat"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0492"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26643"
FT                   /protein_id="CBH26643.1"
FT                   /translation="MNMKKATIAATAGIAVTAFAAPTIASASTVVVEAGDTLWGIAQDN
FT                   GTTVDALKKANKLTTDKIVPGQKLQVTEVASEKTEKSVSATWLNVRSGAGVDNSIVTSL
FT                   KGGTKVTVESTEANGWNKITYGEGKTGYVNGKYLGNAVTSAPSATPEVKQEETTQAAPA
FT                   QQTKTEVKQATPAATTEKDAVETKTTAPAVDTNATTHTVKSGDTIWALSVKYGASVQDL
FT                   MSWNNLSSSSIYVGQNIAVKQSAAKNTAPKAEAKTEAPAAEKQTAAPVVKESTNTSTTT
FT                   TVKKETTTEKQTSTTKAPAQAAKPAPAPAPTVNTNASSYTVKSGDTLGKIASTFGTTVS
FT                   KIKALNGLTSDNLQVGDVLKVKGTVPATNTNTATAPTTNTNNNTSSSNTSTPSKNNNTN
FT                   QSSSNSSSASAIIAEAQKHLGKAYSWGGNGPTTFDCSGFTSYVFAQSGITLPRTSGAQY
FT                   ASTTKVSESEAQPGDLVFFDYGSGIAHVGIYVGNGQMINAQDNGVKYDNIHGSGWGQYL
FT                   VGFGRV"
FT   gene            522018..524345
FT                   /gene="secA2"
FT                   /locus_tag="lse_0493"
FT   CDS_pept        522018..524345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA2"
FT                   /locus_tag="lse_0493"
FT                   /product="preprotein translocase secA subunit"
FT                   /function="Preprotein translocase subunit SecA (ATPase, RNA
FT                   helicase)"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0493"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26644"
FT                   /protein_id="CBH26644.1"
FT                   /translation="MKQNFDDRKIVKQYREIARQIVKKEGLYKNMDQNELCEQTNYWRE
FT                   KFKTKPMTDRDKINIFALAREAASRIIGLDAVVVQLIGALVLGDGKVAEMKTGEGKTLM
FT                   SLFVMFIEVMRGNRVHLVTANEYLARRDREEIGQVLEYLGVSVALNESGLDKAQKKAIY
FT                   TADVIYGTASEFGFDYLRDNMVRQKEDKVQSGLDFVLIDEADSILIDEARTPLLISDRK
FT                   EEDLSLYQTANKLVKTMMKDDYEMEEHKRFVWLNDAGIEKAQKFWGVESLYSAEAQSEL
FT                   RITMLLMRAHFLMHKDKDYVVLDDEVLIIDPHTGRALPGRRFNDGLHQAIEAKEEVEVN
FT                   EESRTLATITIQNYFRMYKKISGMTGTAKTEEEEFRQIYNMDVVVIPTNLRINREDVPD
FT                   DIFYTKKEKGRAIVYEVSWRYEKGQPTLIGTSSIKSNEWISGLLDAAGIPHQVLNAKNH
FT                   AQEAEIIAKAGKRGMVTLATNMAGRGTDIKLDLDVHKLGGLAVIGTERHESRRIDLQLM
FT                   GRSGRRGDPGFSKFMISLEDDLLEQFESKSWEKLSVKLKRKAPRDGKPVNSSKIHAVVV
FT                   NAQKRLEGANYDIRKDLLSYDEVIDLQRKMVYKERDKLLERNKLGVSSEKILREVAEYA
FT                   FIHTEVDPEKMDKYYARQKEFLGGTKFPISFDEVSLMEPTEVVEKIVAWHKQERDKFPL
FT                   ETITAIEKEVYLNLMDQMWVMHLDAMVQLREGIHLRAYGQQDPLVMYQKEGAQLFEKFQ
FT                   ADYHFYFAHALLELDPDGLVQG"
FT   gene            524461..525630
FT                   /locus_tag="lse_0494"
FT   CDS_pept        524461..525630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0494"
FT                   /product="membrane protein, putative"
FT                   /function="Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0494"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26645"
FT                   /protein_id="CBH26645.1"
FT                   /translation="MKGSLTKFKQLFIDNKFVLGLLIFLLVALDIYVLTKISFIFDPLM
FT                   VILKTVAAPIVLAGISYYLFNPVIDWLEKKKWKRGWAIALLYVVIIGLIILLFSFVIPA
FT                   VKDQIISLFKTFPGYWDQITQKFNEFSQSSLFDQLKDKLSTNMSDIMKTLSEKGTSVLN
FT                   SAITSVGSIVGTVTEVVLAIVTTPLVLFYLLKDGKKLPDFLLKMLPVNGRAHTRQVLGE
FT                   ANHQISSYIRGQIIVSLCIGILLFIGYLIIGLPYALTLAIIAACTSIVPYLGPAIAITP
FT                   AIIIAIVTSPWLLVKLVIVWCVVQLLEGKFISPQVMGKTLKVHPITILFVILIAGNLFG
FT                   VLGVIFAVPGYAVLKVIVTHVFIWFKRVSGLYGEQPESEYVDTPEEPKL"
FT   gene            525906..526619
FT                   /locus_tag="lse_0495"
FT   CDS_pept        525906..526619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0495"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0495"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26646"
FT                   /protein_id="CBH26646.1"
FT                   /translation="MIIKKPIIVGIICVGSLTLMAPTAFAVTSEGDSKASVNFKAGTGI
FT                   VNPVDPTDPTQPLDPLDPSNPTEPGTGNTGSLTLDYVSSVSFGEQEVSSSEQTYSATSR
FT                   KPFIQVSDRRGTGKGWSVTATASSFQDEDDASSLAGATLSFKNGESASASTTTSSPTAS
FT                   QNVNLPTDGTSIVKVVSAKETEGKGTWINRWFGATPDDTDSLNDNVKLTIPGGSATLGS
FT                   HEATISWTLSDAPGV"
FT   gene            526710..527732
FT                   /locus_tag="lse_0496"
FT   CDS_pept        526710..527732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0496"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0496"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26647"
FT                   /protein_id="CBH26647.1"
FT                   /translation="MKKSFLSLFLLIPLLVTIFPMLDVKAAEGDVGYSVQAKIPNNQVD
FT                   KKQTYFDLRMKPKQKQTVEIEVKNSSNEEIQVEANITYATTNRTGMIDYTQNDLTKTDK
FT                   SLLHPLPEIAKIPDDQRVLKIPVNGTKVVQVNIEMPEETIDGVVLGAVKFTKKVTDETK
FT                   KTDGVSLKNEYSYIVGMQLSENDNKVNPNINLKSIKPALVNYRTAIVTKLQNDQPVIIK
FT                   DLSVDAKVYKQGSNKVLHQTKKADMTMAPNSSFDFDIDWENKPLEAGDYRLKMTATNGV
FT                   ETWKWDEKFTIEDKDQDLNKEAVNIEQSNPWLYVGIAAGILLIFLIIIFIARKRRKNNN
FT                   "
FT   gene            527750..530215
FT                   /locus_tag="lse_0497"
FT   CDS_pept        527750..530215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0497"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0497"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26648"
FT                   /protein_id="CBH26648.1"
FT                   /translation="MSLKKIITILALTALFFGLGVVADVNADGATLAANEAVVTTFDEL
FT                   KKAITEDNGIDTVYLGADIPLSSGIKIPDVKKTFTLSGKDPVTNEIHTLTETMASSGAQ
FT                   SSVITVDTNNGAKETTLKDINVIGKNYYGTISVLAAAKNVVQNYENINYQGPQLIYNLN
FT                   GTAVFSGDNNIRIASVVSGSATPNEVGEVKGVNVSGKLKIDHASSNANSVFWFGSGTSE
FT                   VNTFTVEENADVTILSNGTGMFYRTGSKPIDINVNKNAKVDITSNDNIFRDTAGGAVNV
FT                   AEGADVTITKTAGANPLLWVAGDITVSPDARFILKKTGGTGNIIYFANATAKLDVRNPR
FT                   SFLIATAPNSAMFYWPYTNTFNFEAQMVNYWNTAGTVDRTDAPAQSFSLPDGDNVIGSL
FT                   TYGGTTTKIVSSNANMTAANFNQNTARMIVMGRLEGTINPVNDSDDTILGTATANAFIT
FT                   VSYKENGIDKKLSGQADETGNYQLTIPAGFIKPYTDLTTTVSQDQKTITLEQITVTDVT
FT                   PPSGNPVPQILNIGDPFPNVADLVTDIYDHSDNTSGAGITKTLQTTPDTNVFGPQQAIV
FT                   RLEDKAGNYIDIVVPVFIKDDDTLMQDEKALRATDFSINLSEISSLNETELSEMIIKES
FT                   AAKAFNVLTGADLSDEIEVASTNIEKTSGTYKATLQLDDLTKEITIQVTGELRFNQVPE
FT                   TISFEATELANQKNIAKRNTDFDMSVLDSRGEGNSFRITAAIQAPLTSTTNSAHTLPEG
FT                   LIFINDAGEKAILTDEPINVFEAETTDEMNVPVEWSADKGILVEADAAETYTGENYETT
FT                   IEWTLTDAP"
FT   gene            530326..531741
FT                   /gene="phrB"
FT                   /locus_tag="lse_0498"
FT   CDS_pept        530326..531741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phrB"
FT                   /locus_tag="lse_0498"
FT                   /function="Deoxyribodipyrimidine photolyase"
FT                   /EC_number="4.1.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0498"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26649"
FT                   /protein_id="CBH26649.1"
FT                   /translation="MTSVMWFRRDLRLNDNKALYQACRDKDDLILLFQVNPEQFINGSP
FT                   SHQAFFSSVAYFKQKVDETAHLQIMFGEPMGLLEKLKEKIPAWDKVYFNRDETGYGAKR
FT                   DEAALQFFAKEEIEVFAYHDAYLHHADDVKKSATDFYKVFTPYYKKWREEIKERPLPIS
FT                   INPEKVNNTILFPEDEKQFVEMTRELPPLDATKLGELAAQSHLNHFVKENLADYNEARD
FT                   FPDLDKTSHLSRFLRTGEVSIRTVWQAVQEAEHTNGRATFEKELCWRDFYNMIYVSFPN
FT                   QKNEAIQANYRFIEWENNRTNFQKWQQGATGFPLVDAAMRQLKETGWMHNRLRMITASF
FT                   LTKDLLIDWRWGEKYFQQMLIDYDPASNIGGWQWAASTGTDAVPYFRIFNPTTQSEKFD
FT                   PSGNFIRKYVQELAGLPDKFIHQPEKMTNQEQEKFHLIIGEDYPFPIVDHKERRKLAIA
FT                   RYEFSKDYASENI"
FT   gene            531880..532290
FT                   /locus_tag="lse_0499"
FT   CDS_pept        531880..532290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0499"
FT                   /product="membrane protein, putative"
FT                   /function="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0499"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26650"
FT                   /protein_id="CBH26650.1"
FT                   /translation="MTQFMKLFFTSAVVFLIFDLFWLLVVSKKMYEHFIGDLMGDVRIF
FT                   PAVIFYVIYVIGVTFFVLIPGTEKGSIGYVILAGALFGLICYATYDLTNLATLKDWPVA
FT                   MTVIDLVWGTAVTTVTSVIVYFINMNFFGGGS"
FT   gene            532293..534068
FT                   /locus_tag="lse_0500"
FT   CDS_pept        532293..534068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0500"
FT                   /product="DAK2 domain protein"
FT                   /function="Predicted kinase related to dihydroxyacetone
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0500"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26651"
FT                   /protein_id="CBH26651.1"
FT                   /translation="MTEVGNMRLLQGMLNGAREVISKKDELNRINVFPVADGDTGSNLA
FT                   SLMQAIIDNVAQKDYSTKELLDEVASAALIGARGNSGMIFAQYLNAVAESYHHLESTVE
FT                   ELVQAFQKAVNKAYEALLDPKEGTILSVMSAWSEALAENYTKEKSLHHSLLNAQEVAEK
FT                   ALANTQFQMPILKKNRLVDSGAKGFYYFIVGLTNAYCEKVAVISEMVEDDQEPIEHVET
FT                   SKPLYRYCSEFIIKSPTATKQTIQTVLATKGDSLVIVGNEGQIKLHIHTNEPKEVLNLL
FT                   AKYGTMTYQKVDDMRLQYDVTKKPRAKTAIVTDSIADLPEEFLLTHQIHVLPMNILAED
FT                   ESFLDKLTVGPTMIKEKMMQQVKMSTAQPTIRSVDALLSFLENKYEQVLIITVSAQLSG
FT                   TYQLIKQRIKQKNLASDWIHVIDSRLNSVAEGLLVKQAVELVEAGRTFEEITRQIEQTA
FT                   KRSFIYVAVADLSPMVESGRIPRFLGKIAQKLSLFPIVSLDENGEGKLIGVSFSQNQSM
FT                   KKIIKKVTKLHHENQLEELAVTHVSSADKANDWGNQLQKLTGQLSYIVDSSSAIAISAG
FT                   IGSVAVAGIKKEETI"
FT   gene            534065..534838
FT                   /locus_tag="lse_0501"
FT   CDS_pept        534065..534838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0501"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0501"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26652"
FT                   /protein_id="CBH26652.1"
FT                   /translation="MMYWLVAGVLFVYFVIWFIISKVKQKYSLVDIAWGGGFVVVAWTG
FT                   FLATLSMTIQNITILILVTLWGVRLFWHLARRNWNKPEDYRYVNMRKRWGTKLVNLKAF
FT                   LNVFVLQGVLLFIIALPITHTFANETADFHWWQVVGIVLWVIGFIFEVGGDSQLENFKK
FT                   NPANKGKLLTTGFWAVTRHPNYFGEALSWWGVFLVAFTGLTASWLIISPVVITLLLLFV
FT                   SGVPLLEKKYQDREDFKQYANKTSKFFPIIGKKGL"
FT   gene            534961..535503
FT                   /locus_tag="lse_0502"
FT   CDS_pept        534961..535503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0502"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0502"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26653"
FT                   /protein_id="CBH26653.1"
FT                   /translation="MKKEKTVLIMNFDEESISYQAFSEMKRLHQERKIIGYQMAVVKHE
FT                   PGNKLEAQDFLDFTGADKNMKDSLIGMLIGILGGPFGILIGWMIGAIVGTTKDAGEVKN
FT                   ALTIFERTLKTIPEGSTGVILIATEQELGNVNDVAIDELHGRVQRMDEAIVAQEIKEAQ
FT                   ATEGKAKDSAKKHWFSK"
FT   gene            535736..536536
FT                   /locus_tag="lse_0503"
FT   CDS_pept        535736..536536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0503"
FT                   /product="formate/nitrite transporter family protein,
FT                   putative"
FT                   /function="Formate/nitrite family of transporters"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0503"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26654"
FT                   /protein_id="CBH26654.1"
FT                   /translation="MDVESSPLMQKIDYSTRKKIDLVNNSILRYIVRAMLACLFLTLGT
FT                   AVAVMIGDKVDHFAPGLGKIVYAFMFSWSLVMIIYMNAELGTSNMMYMTTGVYQKIIKP
FT                   GKALQILFLCIICNLLGGILAGYLVSLTAAFQNLPADHFLFTAVTGKLEKAPLEIFVEG
FT                   IFANIVVNTAVLCTLRMKDDAGKVIAMIFIIFIFAFLGFEHVIANFSSFSLAFFASGGT
FT                   LAAMTVGNVSVNLVLALLGNFVGGGLVIGLGYAWLNRTKSIYKD"
FT   gene            complement(536575..537681)
FT                   /gene="metX"
FT                   /locus_tag="lse_0504"
FT   CDS_pept        complement(536575..537681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="lse_0504"
FT                   /product="homoserine O-acetyltransferase"
FT                   /function="Homoserine acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0504"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26655"
FT                   /protein_id="CBH26655.1"
FT                   /translation="MTLQQKELFQKSPLLLENGETLSPVLVGYETYGTLSESRDNCILL
FT                   EHALTGTAHAAKHFEADALGWWDDYIGPGKTIDTDKYFLVCTNVFGGCSGTTGPSSTNP
FT                   KTGESFRLQFPGFSMKDIIKVQRELLEQLGVARIVSVIGGSMGGMQATQWAIDYEDITD
FT                   SIVNIASPLAAGPDAIGYNLIMRMAILNDPDFNGGNYIGQPEGGLATARMVGMMTYRTS
FT                   ELFSKRFERFTVAESSPAAFSKEHFQIESYLQYQGDTFVERFDANSYLYLTKAIDLFDV
FT                   TAPAKDDLPAFSKIKIPYLLIGITTDQLFRIHDLRRGYELLKQWSVPVTYHEVTSEYGH
FT                   DAFLVEKELPKFEPLIQTFLNNLPVKNA"
FT   gene            complement(537698..538975)
FT                   /locus_tag="lse_0505"
FT   CDS_pept        complement(537698..538975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0505"
FT                   /product="O-acetylhomoserine/O-acetylserine sulfhydrylase
FT                   family protein"
FT                   /function="O-acetylhomoserine sulfhydrylase"
FT                   /EC_number="2.5.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0505"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26656"
FT                   /protein_id="CBH26656.1"
FT                   /translation="MSNEYKFETIQVHGGHTPDGDTHARAVPIYQTTSYTFDSPEHAAA
FT                   LFGLQETGNIYTRIMNPTTAVLEERLTLLEGGIGAVATASGMSAITYSILNIAGSGDHI
FT                   VAAATLYGGTHTLFSHTFKTFGIDVTFVDPNEPENFEKAIKENTKAVFVETIGNPDINI
FT                   VDIEKVANIAHASDIPLIIDNTFATAYLNRPFDFGADIVVYSATKFIGGHGVAIGGAVI
FT                   DSGKFNWANGKFPKLVVPDDSYNGLSYTNDVGAAAYITKLRVSLLRDTGAALSPFNAFL
FT                   LILGLETLSLRLEQHVKNAKLVANFLNDHPKVVWVNYPGLKENKYFDLAQKYLPKGPGA
FT                   IFTFGVKGGYEAGKKVIESVELFSHLANVGDAKSLIIHPASTTHQQLNAEQQLTAGVKP
FT                   ESIRLSIGIENADDIIQDLTQALEQI"
FT   gene            539422..539949
FT                   /locus_tag="lse_0506"
FT   CDS_pept        539422..539949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0506"
FT                   /product="membrane protein, putative"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0506"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26657"
FT                   /protein_id="CBH26657.1"
FT                   /translation="MKTFTRILVLLAGIAMIVLGIWFLFHPGISLLTSTLMFGFLLLIS
FT                   GIFHTVSYFSDKKLQKVSGWVLADGILSILLGFLLLFNEFAGTETIVLLFGMWVLFAGI
FT                   MRTIGAFTAKQNNVQGWGWILTIGIIGIVVGFIALFNPVVSAIGIVLIVGIFFIVQGIS
FT                   AIATFFFIGKTN"
FT   gene            complement(540070..540771)
FT                   /locus_tag="lse_0507"
FT   CDS_pept        complement(540070..540771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0507"
FT                   /product="regulatory cyclic nucleotide-binding protein"
FT                   /function="cAMP-binding proteins - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0507"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26658"
FT                   /protein_id="CBH26658.1"
FT                   /translation="MSLLNEENSFYNTDLLDLLKDSNEAVLPYKRIRFRRNQKILTEGE
FT                   ETTYFYVIGDGVVSMSKNTCKEDSIITFLGKNDAIGPLTMLGGAKSPVNYTTISEVSVY
FT                   QFERKYVLGKFLSSPDVFWQMNTLMQSMVQPILEREAYVNLPSNEKVLAGLIACGERFG
FT                   RIESDGSCLIPYYFTQKILGNYLNLARAYVATNLRKLEEEGIITLSPKPWRINDFSIQK
FT                   QKLNTTYKTYL"
FT   gene            complement(540847..541395)
FT                   /locus_tag="lse_0508"
FT   CDS_pept        complement(540847..541395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0508"
FT                   /product="BioY family protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0508"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26659"
FT                   /protein_id="CBH26659.1"
FT                   /translation="MRDQKLKFLVVDSLFAVIIAILAQVAIPLGPIPLTGQTFAIGLAA
FT                   TILGARHGTISVLVYIVLGAVGIPVFQGMTAGIGIIFGPTGGFIIGFIFNALLTGWLLE
FT                   KTKFTVPFAIIANILGAIVTLIFGVLWLKVSTGLDWPAAFLTGMVPFIIPGIIKAVFAA
FT                   ILGILIRDRLLKAKLLKAS"
FT   gene            541588..541920
FT                   /locus_tag="lse_0509"
FT   CDS_pept        541588..541920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0509"
FT                   /product="transcriptional regulator, PadR family"
FT                   /function="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0509"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26660"
FT                   /protein_id="CBH26660.1"
FT                   /translation="MEVNPQFKKGVLELCCLFLIQKKDCYGYELANQVSKYIEVAEGAI
FT                   YPVLRRLVKEEYCSTYLVESNEGPSRKYYQLTVKGEIYLNELISEWNNFTDSVSKLLTE
FT                   EEAENE"
FT   gene            541913..542503
FT                   /locus_tag="lse_0510"
FT   CDS_pept        541913..542503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0510"
FT                   /product="putative membrane protein"
FT                   /function="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0510"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26661"
FT                   /protein_id="CBH26661.1"
FT                   /translation="MNKQDFLNELNQRLELLDPRERRELLSDYQEHFRNGLAEGKSEEQ
FT                   IVFDLGTPEEIATDILSERDIKEEPVENDYYYVPRKNYNGDRSKGKQILIGVGLFFLDV
FT                   CLIIPILISLWAISISVWVTVGACLVSPILLGVGLIFGMGYEMYQLFVSIGLVGFGLML
FT                   LLVASLLFQFVKKATIGIIQWHKYAVKGGGENA"
FT   gene            542496..543596
FT                   /locus_tag="lse_0511"
FT   CDS_pept        542496..543596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0511"
FT                   /product="putative secreted protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0511"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26662"
FT                   /protein_id="CBH26662.1"
FT                   /translation="MPKRHLRSKLFFAGLVLFIIGAIGVGFTMKSGEMIEKGEPLTKTW
FT                   DLADSDINKIAFSSSRDTLIEWKKSTSGKNYVELSGNYSENDKADIEKLKATSSDGTSF
FT                   DLTVPEENVWFNFGKIYAYGQQKLTVYLTEDTKVDNLKLNSHSGDMTVSNFKVKNFVST
FT                   TSSGELKVNKIEADNVNASSNSGDIELTDIKADTTLENSSGETTITNLTGDLQVEGNSG
FT                   DVTVSGVKAKNTKIAVDSGEIELANSDIAELVTLTSSSGDISTLDTKGKMHVESSSGSV
FT                   DLERLTSNLNAKTNSGDIDASFINDAKDIKVYTDSGEIDLKVPADFKAVYEVNTNSGSV
FT                   KKPTSETNTKNQVTADSSSGDITIEK"
FT   gene            543701..544201
FT                   /locus_tag="lse_0512"
FT   CDS_pept        543701..544201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0512"
FT                   /product="acetyltransferase, GNAT family"
FT                   /function="Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0512"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26663"
FT                   /protein_id="CBH26663.1"
FT                   /translation="MDFQIRKATNLDAEAIQHVAITSWHHTYQDLIPNDVQDGFLEKFY
FT                   NVETLHNRISATPFAVLEQDNKVLGFANFIELEKGKSELAAFYLLPEVTKRGLGTELLE
FT                   VGMTLFHVPLPMFVNVEKGNETAIHFYVAKGFVKVEEFTEDFYGYPLETIRMNLNHHAF
FT                   EEE"
FT   gene            complement(544249..544635)
FT                   /locus_tag="lse_0513"
FT   CDS_pept        complement(544249..544635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0513"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0513"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26664"
FT                   /protein_id="CBH26664.1"
FT                   /translation="MRFILAYLSIFILGIFSALLIETILFENVTPQLIFSAILFAAPVI
FT                   LIASTLGEIFYGFSKKATYFTFTVWGFAYGVVVTVIILSIIQVSGMAISVGISVLGGVI
FT                   MAILAIIFFFLRGGNRASGKAATK"
FT   gene            complement(544687..545031)
FT                   /locus_tag="lse_0514"
FT   CDS_pept        complement(544687..545031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0514"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0514"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26665"
FT                   /protein_id="CBH26665.1"
FT                   /translation="MLDKKTISALSYFSIFFGPVITPSIIWLSNKDKETTHHAKWALLT
FT                   QTTFVIGMGIIILLYNYVPFSTNSADTVHFLSLATVFFIVVLNVTIILFNLIRGISCIV
FT                   KHLEDNWARC"
FT   gene            complement(545180..546520)
FT                   /locus_tag="lse_0515"
FT   CDS_pept        complement(545180..546520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0515"
FT                   /product="MatE family drug/sodium antiporter protein"
FT                   /function="Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0515"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26666"
FT                   /protein_id="CBH26666.1"
FT                   /translation="MSSVQKVASLSLFTLAWPIFLEQFLRLMISYIDVFMLGHYSDDAV
FT                   AATGVANQILVISIIIYGFISVGVQIIVAQMIGAKKHKEIENVITNGLVVAFLIGIVMS
FT                   IIFIFMSKNFLTWMGIDPHLVEVGAPFLEIIGGSSVVIAIHASILPILRAHGYVRQSIL
FT                   VPVTISIINVVGNYLFLYGPLAYLDYGVAGVGISTAVANFVGMVLAILMLRKYIGYTFH
FT                   FKKLEQVSKKLLYSILRLGLPSAGENLSYAGSQLVVTAIIAILGTEALTTKVYASTVSQ
FT                   FVALFAIALGQASQIIIGRAVGAKEIDKAYKQGLRSWKIGLVVAIVVSVSIYLFAEPIM
FT                   GLFTTNTEIIAMTKELFLLSIFLELGRATNIIIISSLNSTGDVRFPFICGLIVMWIVSL
FT                   PFSYVLGISAGLGLVGVWLAYIIDEGVRAVLMYRRWRSKVWSLKSII"
FT   gene            546667..547149
FT                   /locus_tag="lse_0516"
FT   CDS_pept        546667..547149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0516"
FT                   /product="transcriptional regulator, MarR family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0516"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26667"
FT                   /protein_id="CBH26667.1"
FT                   /translation="MIERSGEMSSKNQDLGHSVIKAFMNFKHAELKSFQIPGYSKSETR
FT                   FIFILSRGLKSQGPKIRVSDLGHMLRISKPSVTQMIQSLEGKGLIKRVQNPDDKRSMYV
FT                   ELTDLGADVSKKMLDEFQVSFEDMQEFLGEEDMTKLITLLEKLTDYLNTKSENKEA"
FT   gene            547157..548881
FT                   /locus_tag="lse_0517"
FT   CDS_pept        547157..548881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0517"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /function="ABC-type multidrug transport system ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0517"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26668"
FT                   /protein_id="CBH26668.1"
FT                   /translation="MIKLMKRLKPYWLSITVVLVLTFGQVIGQLYLPTLMSNIIDKGVV
FT                   EGDTDYIWSTGMQMLLISFASVILSVIVVFLASRISMGFGKDLRDKIFTKVEDFSLQEF
FT                   DKVGTSSLITRTTNDVVQIQNVLYMMMRLMVMAPIMLLGGIIMAVGRDAKLSLIFVVVL
FT                   PLLLILVVVLGSKAMPMFKSLQKKMDKLNRVIREGLTGIRVVRSFNRNEDELEKFEEAN
FT                   ADYATTAIKVNRLLSLMSPLMMLLMNLTSIAIVWIGSIFIGNGDMEVGDLMAFIQYAMQ
FT                   IMMSFMMLSAVFIMIPRAGASAERINEVLDMEAEILNPANPKTSTPPAKLSFENVTFRY
FT                   EGAEKPVIENINFEAKAGETVAIIGSTGAGKSTLINMIPRFYDVESGVVKINGIDVREM
FT                   DQSSLRQKIGLVPQKAVLFTGTIASNMRYGKEDATDEEIWEALRTAQAENFVSKQTNGL
FT                   DSRVEQGGNNFSGGQKQRLSIARSLIRKPEIYIFDDSFSALDFKTDAKLREALKKETTE
FT                   AVTLIVAQRITSVVNSDQIIVLNEGKVAGIGTHEELKENNQIYQEIMRSQLSEEEIA"
FT   gene            548878..550701
FT                   /locus_tag="lse_0518"
FT   CDS_pept        548878..550701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0518"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /function="ABC-type multidrug transport system ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0518"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26669"
FT                   /protein_id="CBH26669.1"
FT                   /translation="MSAATPGPGGGMRMQTNAKPKNFKQTLFRLLGYMKPRSVAIIVVF
FT                   IFAILSTIFNIFSPKELGKATTEIFKGVMTSEGIDNDKIFNILMLVLVLYLGSSLFSFI
FT                   QQYVMSSVAQRTVYDMRKDLKAKMARLPLKYYDTRSNGDILSRSVNDMDNIANTLQQSL
FT                   TQAITAIVQMIGVLIMMLTISWQITLIVLVTVPISIILVAIIAGRSQRYFGAQQRNLGI
FT                   LNDTVEETYGGQTIIKAFGQEKKTLVKFDEVNEDYYKAAKKAQFISGIMMPVMQFVGNL
FT                   GYVGVCVAGGIFVTNGTLQVGDIQSFTQYVQLFTQPISSVANIANIIQSTIASAERVFE
FT                   MMDEEEEKDEIPANINQVAGEENSIVFDHVKFGYTPDKPLMTDLNIHVEEGQMVAIVGP
FT                   TGAGKTTIINLLMRFYDVDGGSIRMKGIDTRDMTKDAVREKFGMVLQDTWLFNGTIADN
FT                   IAYGREGATKEEVIGAAKAAYADDFIRRLPNGYDTVLNEEGSNISQGQKQLLTIARAIL
FT                   SDPSILILDEATSSVDTRTELNIQLAMGNLMEGRTSFVIAHRLSTIRDADLILVMNHGS
FT                   VIEQGTHADLLEAKGFYADLYNSQFTGAQAV"
FT   gene            550819..551118
FT                   /locus_tag="lse_0519"
FT   CDS_pept        550819..551118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0519"
FT                   /product="rhodanese-like domain protein"
FT                   /function="Rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0519"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26670"
FT                   /protein_id="CBH26670.1"
FT                   /translation="MYQSITANDLEQELKVNPRNILDVRDAADFAEGHIPNAINIPIND
FT                   LPEKYNKLDSEHAYTIICYAGGRSERASQFLAAEGFDVTNVMGGMGAWHGEVSK"
FT   gene            complement(551165..552946)
FT                   /locus_tag="lse_0520"
FT   CDS_pept        complement(551165..552946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0520"
FT                   /product="peptidoglycan bound protein (LPXTG motif)"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0520"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26671"
FT                   /protein_id="CBH26671.1"
FT                   /translation="MKRIGIKVSLCILLVFPFALQGPFVVSAEGNISVQAADDTVNIPD
FT                   PAFKSYLNGLIGQPSTSDITEAQMDTITAITINGGSVSDITGIDYAHNLTSVRIANTQV
FT                   TDFSLLASLPKLTNISLAGSSITSSSIPNLNNLQNLTSLSISPASLDNSVLTKINKIPN
FT                   LTFLELDSNYSLTDIMPLQSLPNLVTLFVQFCGIHDYRGIENFPKLNNLSAYGQNVGRT
FT                   VLINSNIKSSALNYNETAQTIFVPFTLMTDRTVNFNGDLIPFSTSTSSSNTYFTLNEQQ
FT                   INGSRLSIDNTGVTVTGITKDFFDSLTKMEFNSVYNNPAGSYAAPPNITNYTISGGTYD
FT                   HYFDIDHSLTITNDAAISYTEGNTITEAQFLTDIHAETDDGTPVTSDFDSVVDFNTPGV
FT                   YTVTLNAENYAGLKATPKTVTVTILAKPVITADKNITYTTGDSKTAEQFLKDISASTND
FT                   GSTVTSDFESVVDLNKAGTYEVTLRAVSADGIEADPVKVLVTIENGSEPPIPPNPPTPP
FT                   GPDPTPSPNPSPNPSTNPTPNGGNGAMSSKNTTTYQNASKKIILPATGDSNQATIVLIG
FT                   AILAGIAVFSMRKRKHD"
FT   gene            complement(553107..553733)
FT                   /locus_tag="lse_0521"
FT   CDS_pept        complement(553107..553733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0521"
FT                   /function="Acyl carrier protein phosphodiesterase"
FT                   /EC_number="3.1.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0521"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26672"
FT                   /protein_id="CBH26672.1"
FT                   /translation="MTNVLFIKANGLPAERSVSVALYEIFLTEYKKSHPEDNVTELDLF
FT                   EADLPYYDVTMMSGLHKEAAGETLSGEEKRLADIANSYLDQFLAADKIVMAFPLWNFSI
FT                   PAQFLTYLFYLNQAGKTFKYTANGPVGLVGDKKIALLNARGGIYSDGPMQSFEMSVNYV
FT                   KNVLSHFGISEPEMVIVEGHNAKPDLAKDIISAGAKEAVELAKIF"
FT   gene            553921..554355
FT                   /locus_tag="lse_0522"
FT   CDS_pept        553921..554355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0522"
FT                   /product="transcriptional regulator, MarR family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0522"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26673"
FT                   /protein_id="CBH26673.1"
FT                   /translation="MKPCTERSELLYRMHLLSKEISHVFEQQTNKSFTKVEILFHIKQT
FT                   PGQSQNKLKENLYIDSASITRHLKRMEEQGLITREKKDENKRYTYLFLTPTGKAELASL
FT                   LAEKEKFQNEALADFSEEEVALWLKSVTKMMNNIEKMEEK"
FT   gene            554358..555299
FT                   /locus_tag="lse_0523"
FT   CDS_pept        554358..555299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0523"
FT                   /product="alcohol dehydrogenase, zinc-containing"
FT                   /function="NADPH:quinone reductase and related Zn-dependent
FT                   oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0523"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26674"
FT                   /protein_id="CBH26674.1"
FT                   /translation="MKAVVIENYGGKEQLKEKEVAMPKPEKNQVIVKESATSINPIDWK
FT                   LREGYLKQMMDWEFPIILGWDVAGVISEVGEGVTDWKVGDKIFARPETTRFGTYAEYTA
FT                   VDDHLLAKIPDGISFEEAASVPLAGLTAWQALFDHAKLQKGEKVLIHAGAGGVGTFAIQ
FT                   LAKHAGAEVITTASAKNHELLKSLGADQVIDYKEVNFKDVLSDIDVVFDTMGGQIETDS
FT                   YDVLKEGTGRLVSIVGISNEDKAKEKNVTATGIWLEPNGEQLNELAKLLENKTVKPIIG
FT                   ETFPFSEKGVFDAHTLSETHHAVGKIVISFNK"
FT   gene            complement(555408..555650)
FT                   /locus_tag="lse_0524"
FT   CDS_pept        complement(555408..555650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0524"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0524"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26675"
FT                   /protein_id="CBH26675.1"
FT                   /translation="MHPIEQFLANNRTTITEIEANTRLRKGSLQKLIDKDVRTSDISLR
FT                   VLTQIAYTLNTGADIVAKQLSDLEVTNDLTFLTED"
FT   gene            555758..557515
FT                   /locus_tag="lse_0525"
FT   CDS_pept        555758..557515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0525"
FT                   /product="membrane-anchored glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /function="Membrane domain of membrane-anchored
FT                   glycerophosphoryl diester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0525"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26676"
FT                   /protein_id="CBH26676.1"
FT                   /translation="MNDIKNSLKVIYQYRMDYLKVTLLLTIAQAFVIPPFIYYFFFFIL
FT                   RIAGVPGVTDSNLGELFSSPIAVIMLIVLVLLILLFVYYELGFFILMAIYQLRGEAYTV
FT                   LKILQRLNSKAKYFISFQAIYFLVYFFLLLPIAGLSLPLTITENLYLPHFITDELMKST
FT                   TGMWLYFIAISIIFYISARLVFALPYFIEDKSLKINGAIKKSWKFPQKRLFMMLLKWVL
FT                   IIVVTGFAISMAASIIMLPLFLVEKFSAGVAMLVAGLTLTLLQLVGFFFAGIFQGIISQ
FT                   LLVKNAFTIKTRTESWQANHSQFLHKKRLIISGIVVFIFVSGFNVYAVNSTLYEPNTKV
FT                   IAHRGDTVNAVENTVEAVESAAHAGADYCEIDIQETKDKKFVVFHDLTLRRLAGSSKRV
FT                   ADMTLNELQQTEVHSGAYSSKIVSLEEIIATAKKNEIDLLIEVKLHGAESEDMVNNLIA
FT                   LLKKEHVTNKYLVQSLDQPIMGKIEKADPTLKTGIIIALNIGNLPKTSADFIVLEDFSI
FT                   NKRLLTQAKQNEKMVFVWTVNKEKLMQMYLRKNIDGIITNYPAKAIQLRDTFNENDSFI
FT                   SRVKNRLMF"
FT   gene            complement(557560..558066)
FT                   /locus_tag="lse_0526"
FT   CDS_pept        complement(557560..558066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0526"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0526"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26677"
FT                   /protein_id="CBH26677.1"
FT                   /translation="MKKWKTALLLMGVLTFSVALTACGGAEDTSSETKTETAKAETKEK
FT                   KKTDPNKLGDYQVEILSSEVEKDYEGKDAIAIKTKFTNNSKENISFMVAIDQQAFQNGT
FT                   QLETTVSSGDGLSLGDTDKDVQPGSSLEVTSIYSLQDTQNKVDVEAKELISFSDNTVKK
FT                   SFELK"
FT   gene            complement(558146..559261)
FT                   /locus_tag="lse_0527"
FT   CDS_pept        complement(558146..559261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0527"
FT                   /product="protein kinase, putative"
FT                   /function="Serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0527"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26678"
FT                   /protein_id="CBH26678.1"
FT                   /translation="MGEMTLAFIEEQYKELDKLNDKENPAVLTRNISTGELFVRKALPI
FT                   GFAPVIQQLQKLSSNYLPKIEIMIPSGKYLIVYEEYINGKNLADLVKKYPTFDPSEVTR
FT                   LMLMLANALTELHANAIIHRDIKPSNIMISNDGILKLIDFDASRVYEIGKNQDTVNLGT
FT                   IGYAAPEQYGFSQTDVRSDIYSIGVLMLELLLGKNTLPNQENITSLEKIAVRAASFDPD
FT                   KRYQTIEEFRTAVKNDSLGPTFVSELSDFASFDIPMEEPPEVFLPWYRHIPGFRTGRTW
FT                   KMIVAVLGYIFLLVGLFSEPVEGVKMTHTENFFSNFFLIVPAFVIFTNLCGVWKKLPLL
FT                   KSTSFIIRAVGIPIYIFICILFSAIFNTLIS"
FT   gene            559369..559824
FT                   /locus_tag="lse_0528"
FT   CDS_pept        559369..559824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0528"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0528"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26679"
FT                   /protein_id="CBH26679.1"
FT                   /translation="MDGEKETSKLLHELKKATSLRQVLDENEGEFKSNEMVSYLKELLA
FT                   EKNLTKASVIRSARLHETYGYQIFSGVRRPSRDRTIALSFGFKLSGLEASRLLKYTEYP
FT                   PLYAKNRRDAIIIFALDHGYSLDQTNDSLYDLEEALIETYKEEKPLV"
FT   gene            559881..560288
FT                   /locus_tag="lse_0529"
FT   CDS_pept        559881..560288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0529"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0529"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26680"
FT                   /protein_id="CBH26680.1"
FT                   /translation="MFNEQAILQVATSEKNAGDFPKVIEGFKAIGVVKYQFLVKEGIYA
FT                   FWDADGKRMEAQLNGVSKPIASEISKEKIKSAVKQAQAGLIDFEMFIELAGLAGSALWE
FT                   ADLERMTVTYMASDLSELLMEPIPPIASERQ"
FT   gene            560366..561106
FT                   /locus_tag="lse_0530"
FT   CDS_pept        560366..561106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0530"
FT                   /product="membrane protein, putative"
FT                   /function="Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0530"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26681"
FT                   /protein_id="CBH26681.1"
FT                   /translation="MDIITYFLIALSTSVIGSFLGIGGGVILLPILLLMGISQGTAAFS
FT                   SALTVFTMAIFTCSIYYKRKQGNVGLALKIAITSIPTTFIGAIVNQMLPEAVYRFLYGA
FT                   LIVVLILLMVWKNKRNNEQPHFLSKYRIMPYVFGVIIGFLAGLFGIGGGPIVIPILLLI
FT                   FMLNQKTASATSSYVTLLTSFASIGSYAIIGGSDFSIGIYMIPGAILGAIIGTRLNKLL
FT                   DEKWIAILFNILLVALFALNLIKI"
FT   gene            561191..561469
FT                   /locus_tag="lse_0531"
FT   CDS_pept        561191..561469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0531"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0531"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26682"
FT                   /protein_id="CBH26682.1"
FT                   /translation="MKKSWHDFAAFLLTILTVTWVILTWGLHISDIVPGGEKGLLYKLI
FT                   PLFLSIISTVSVFFVTEKLVKWILLSFNILLLILIFFIYHIGEMGMF"
FT   gene            561485..561751
FT                   /locus_tag="lse_0532"
FT   CDS_pept        561485..561751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0532"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0532"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26683"
FT                   /protein_id="CBH26683.1"
FT                   /translation="MEQPTEAVIYQILSSTEDVNATMDHLMYELMSFPGARLFTKNELL
FT                   YAVYWLETNDFIFRSTKNRTTRYFRTAKGNKKLTESEQIKLKE"
FT   gene            complement(561794..562237)
FT                   /locus_tag="lse_0533"
FT   CDS_pept        complement(561794..562237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0533"
FT                   /product="acetyltransferase, GNAT family"
FT                   /function="Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0533"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26684"
FT                   /protein_id="CBH26684.1"
FT                   /translation="MTSSDLEDFLSFAIEDYANDKIEAGTWNEDEALTKSKESFSKLLY
FT                   DGITTPNEHLYSIFTSEKIGYLWFHTDETATQKSAFIYDFIIFEEFRGQGFGTKSLAAL
FT                   DILAKEMQINKIELHVFAHNQTAIGLYNKVGFESTDITMAKYL"
FT   gene            complement(562272..562976)
FT                   /locus_tag="lse_0534"
FT   CDS_pept        complement(562272..562976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0534"
FT                   /product="lipase/acylhydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0534"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26685"
FT                   /protein_id="CBH26685.1"
FT                   /translation="MKKTIQSVGIWGDSIMKGVLFNPEKNRYTLLKNNCIKRASEKLGI
FT                   TFQNHSTMGRTITKGHEILTKDLAKDASNDIAIIEFGGNDCDFNWAEVSENPETPHIPG
FT                   TPIDIFETQLREMIARLKNLDIQPILMTLPPLHAKRYFDFITRSGLNKENILTFLGGDV
FT                   QMIYRWQERYSNTISKIAGETGSHLIDIRDSFLAEFHYEELLCIDGIHPNEAGHIKMSR
FT                   KFVQYASLHKSQ"
FT   gene            complement(563071..564750)
FT                   /locus_tag="lse_0535"
FT   CDS_pept        complement(563071..564750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0535"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0535"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26686"
FT                   /protein_id="CBH26686.1"
FT                   /translation="MWKKHKWLFVAILLLVIYVAPLFILGGDSHVRIHDNLDSNVTWYK
FT                   MVLDSGDYTAKVGTANIDQIMDGSVPRDTFDSEFVGIDWLYILFSTPVAFAISQLITRV
FT                   FAFLGLFLWARDYLIKDKRYLVPLYFVSLAFALTPYWPSGMLSTLGMPLALWAFLNIRN
FT                   HKRRIWNVLILTLLPFYSSLILGFCFFLVMVGCIWLYDLCKKKQFNGRFLLSILYMVLI
FT                   YLIVNYRFIYAMFLHPEPDSRSEFGSHHLSALSSIRLSLKNFVTGHTHDQALAGYIILP
FT                   TLLLVLVLIIIRKEWAKEKLFLWMFGFTLFLSFWYGFWWFDGWNVIKDHVEIMQTFNFS
FT                   RFHFLQPFLFYGLFALAIVYLLKKGNGWKKLAYIAITLQLVVVFVNNSEIYYRYGDGTP
FT                   SINEFYATEQFEEIKDYIGKPQSSYRVGSIGLHPSVSQENGFYTVDGYVNSYPLAYKRE
FT                   FRKIIAGELDKSPVLEDYYDNWGNRCYLFSAELGKNYDFGKESKKHIKKLDFNSKAFQA
FT                   VGGEYILSAVPIDNAAEQGLTFEKAFNNKESYWEIYLYKVTS"
FT   gene            565414..566058
FT                   /locus_tag="lse_0536"
FT   CDS_pept        565414..566058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0536"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0536"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26687"
FT                   /protein_id="CBH26687.1"
FT                   /translation="MKYIEFYDYVKRDAILYTYLLSNFSHVFKKINAWESIEVDRDHIL
FT                   VMKNGTLIEESTGKKKGIARCFFQQSFVFPTRHTLELKALETTEFCLIPADAVFGKLEQ
FT                   EQILSVFFLQIAEKNEQDLKRQELLITEASKNKIIATLNFLLENNLSNKTLPVFSDWLH
FT                   INILAKLANCSVPTTSSIVNELHDKGILDIKSSPWKLTSRDMRIEHFEKEA"
FT   gene            566134..572031
FT                   /locus_tag="lse_0537"
FT   CDS_pept        566134..572031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0537"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0537"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26688"
FT                   /protein_id="CBH26688.1"
FT                   /translation="MKKNILVISIVSILAISAIASAFFLMRDDAYAIETAGYTYSPDGK
FT                   TVPFSADAEYNDTWINNEKTISDGKEMKPINLARTLFLKDDRIQFLGKSVAVKSETDLI
FT                   ELPSKTSVTEDKGAYIAKSDDKTISQLPKGTVVKLAEGRYIILDNAYLKNDKGLNKKLP
FT                   KNVIVSIDENKKVQLMGDKTLEEIASDDAYIEMENNHYHFELTKEMLVSQTDNEKNIDV
FT                   RSIKVEIDDDADARKLTPTKEETDKTATDETEKAQDKKNDATADTKSNENNNQEQASGD
FT                   NEDATDTDANDASGGSDSGTSGGKSGSNGNDTDSNTNNNGSGEDKNNSGSNQDDVDKAN
FT                   EIIKKINETESNNTFQVPIVDVDLTVKGQTASADLTLTDSSKRLKSLEAVLYDSNNKVV
FT                   KKEKLESNKAKQNFTFSNLKYGESYQVVVQGSYKSASDKTQQTIFFRQTVEAKPVVLKP
FT                   EVTERGEDYLKAKITATELYGTIDQLVLKIKENNSNVTTSKTVNVNAAALTKNGQIEVT
FT                   FDSLSSSKEYIIEMEKLVVDGKDVTDESWYFISSTLKAKPTIDGLNLSYSTDKGEFVVS
FT                   PVNLVDKDSAITSIRYVAYSEDDYKANGNKAKEYAYSVVDASQKNTAVKVGRTVDMSDG
FT                   NYVFVAYISGNNGQSDFTFATPASNSVIVGKKLKPSVEFSLKEAEQDALAINYEIFDAD
FT                   NTLLYDNLTHPTLKLYKSNAQGMYSGDPVATADLTSKADITNLLEFDGLESETYYIVVM
FT                   TGSYNLDDGAGIMVDQLIGQSSVFQTTEVSKVNATFTLDSVETDKAQINVKLSDAAYKL
FT                   NEANLNIYESKTNKLVKTISLQDDFDDLMSLNGKSYSFEDLSINKEYLVEIEDGYDSGM
FT                   NHVPVTGQFVFKTRKEAPVTDKVLLDYQADQMKVGGVAGIDETDASMVDRYNATSSIIY
FT                   SIYKSDDLDTPLVEQEVSTAADFGKYTYFDLTNKLLGRGYEYVIKADIVWNDNYEDHHI
FT                   NISSETIQIKKEKPTVEYEILSRTTSEVKMNVYVKDGENAIVPGTLNVASSSGGTEALQ
FT                   NGKNTVTLPLSTTGATTLTTTGEYVISSGSSAISDTFMTKQLTALNTTAPQVGAGMAMD
FT                   ATGRALVIAPQPDSIARSTVMRTSYDLKDAASSSSDYAVAKTGSSQFDEQSLELPFGNI
FT                   WFGNTYQLTLDMKMNYMENQMDNQNLTGNYYMSIGNGASFVSSTNGNITTTNSINNADV
FT                   FAVTKGDTDSEGNISGVTFKSIWTDKYLAYRNGVLISNSETADSFKLVRQEDGSYVPEL
FT                   NGRYVDFSIGLVNEEAAGSKIDLYSTQEKSEQVSSGLSTKELAVPDITAENIGVYDKRV
FT                   KIDVIGEDKDNTTVKKNNKNELYLNVYEEDGTTLAGSVRVDGLPTRDVSITDLSPDTTY
FT                   IVKVEGKYDLLDGTGEKDKVYYSETIKTEKSLPSMTSTKYSWDPSYGARTISGVVDFMD
FT                   ESNVLTNIEYRMYDSATISSDLTDLVALEQELGSKTPVATFNDLTKTPQFSLYNNSGGQ
FT                   NYVSGKTYVIAAYMNTSLEKAPSFLCDAKAIAITPPSTVSAPITLENVSTREATLKFSY
FT                   NDPQSFLVGGPNKQFQYVLKNTATSEEVKKGNFTGGNTASWINEFTDLEPGTGYTLTIS
FT                   SSYDNLNGGGSRPWNNSFNFTTDDEYVTSNSLTIQLDSATKNVKLQAKEVKPGSATIQN
FT                   IKMEFYELMDYGGNNEHTELLETKNIPLPSAYPATVSQGFSVAGKKQNQSFLGKMIITY
FT                   KTPTNEIKTYEKTSNFITLQANVSSVQNSFKSVNATKDSLDVELAVTDEQAKLKGNYTY
FT                   ELKDEAGKVMDTEKVTAKDATDPVSLSMEPTSNYTLTVFDQDKKPIAVYQGDNEANNVK
FT                   ANISEDSFTLMSNNTADAKTELTITVEPKELSAWQTVQSWFGKDFAEIQKVQKEDLDTG
FT                   VKINGNYHDSKVTVKETKSGKAFGLIELEASK"
FT   gene            572028..574406
FT                   /locus_tag="lse_0538"
FT   CDS_pept        572028..574406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0538"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0538"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26689"
FT                   /protein_id="CBH26689.1"
FT                   /translation="MKPTWKIGIIVAVVPLIIISVVLWGSFKDARYDLVSLPDNGVVLN
FT                   NELETLQFQKGNTLYRSWNDDQLIAKNDKDDTRNEIMESTILYLDKEALMFTKSVPVID
FT                   TDGVSSKLKERQVYEPKNATYQYKNSEVAENSVVKLANRQYFLNADATLYLGDEKIKEV
FT                   SKPLLLIDKTGSVTIYENKKKSRYLGHMTLKVNDEIVLDASNETYTIGKRKIDLASFGG
FT                   TDNEKSVVKEEKEKEEEKTATNTEEKDNESADGNSKSAETASSDLNATKKYGDTLKAGN
FT                   GSSGNNEGDETTDSNIDTNDNSGSNSSGSSTGNSKGNSNGSGSGDDLNKIDDYDEVLKK
FT                   LDEMNKKLERNIPVLRIGYIAPGVTSAKVSYTYADPNNTLIGVTEISAVDEKTGKKVNT
FT                   QYVSAVDTESTLTGLSPNGKYHLEFTYQYDLGTDKGIQEVKMQSESFSTQSVSAVYQMQ
FT                   SVTSTTMKINVALDAQIDGVKRTRIKVTEVDGDSFYMDASTNLVNGSGELLTVTGLKPS
FT                   TAYQFQIVIEMKNGETIELNNSEKYYTMQATVLKSLQAKQTSDKVLQVQYDWSSADYTL
FT                   NNAKVELTDEADNAEVSYQVVNQEKGNIRIVPVTTDESVNLEAKLILETTNNETKESKV
FT                   FEYPVKKEIPYDKDAKFTISLTPFQTEEKSDPEVTTESEPETADETKQAVVAEEATQNT
FT                   NAGMTTKIEDALAPQNATYDMAFSMNRAAGESYQLDFERSTDGTEDSWTVWNQQQVTAD
FT                   STGLVSSTQTISKLAKESFKYRVAVYDKDGALQLYVYQQ"
FT   gene            574464..574706
FT                   /locus_tag="lse_0539"
FT   CDS_pept        574464..574706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0539"
FT                   /product="ATP synthase F0, C subunit family protein"
FT                   /function="F0F1-type ATP synthase subunit
FT                   c/Archaeal/vacuolar-type H+-ATPase subunit K"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0539"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26690"
FT                   /protein_id="CBH26690.1"
FT                   /translation="MDLVVACSVIGAALAVGLATLGAAIGQGIAVSRATEIIGKNPNAK
FT                   KEVMGGLFLGLLMIVALMLFALAIAVILLWVNPFI"
FT   gene            574718..575749
FT                   /locus_tag="lse_0540"
FT   CDS_pept        574718..575749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0540"
FT                   /product="ATP synthase F1, delta subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0540"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26691"
FT                   /protein_id="CBH26691.1"
FT                   /translation="MEKIIETIILYGIFAVGFLYLLHFTLKKLENILTSFFYELSQDQS
FT                   LEKESLLRRLKRQKVATSREEQKNRQLASEAEQKEVIFLEEIDQLVAENRKYEQELHLW
FT                   QIEQPKQIIEVPSVITTPHAPHKSLSSYIDEILQQVFIESEEDEAGLFTESIREFDALM
FT                   RTEKIRCALPYKVILQLFEMYSSEQLHIFTESFNKFNERAGRLAVKQVYQSSYLSPEQK
FT                   LKVMREDGTLNELDAEFVQFLFYMLTHFSYRQSRTLYRNYQGVYNIHFYTGLILVTVAS
FT                   EESASHFKKLWEPGHENYNIEYQVKKELIGGVVLQYGTKSIDMSYQELIKRSTEKIEAE
FT                   VKI"
FT   gene            575746..577242
FT                   /gene="atpA-2"
FT                   /locus_tag="lse_0541"
FT   CDS_pept        575746..577242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA-2"
FT                   /locus_tag="lse_0541"
FT                   /product="ATP synthase F1 alpha chain"
FT                   /function="F0F1-type ATP synthase alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0541"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26692"
FT                   /protein_id="CBH26692.1"
FT                   /translation="MKTIHFDMKKYETPVDLEYLKEHGRVEKISDGVIFSSGLENAALH
FT                   QSVLVDQKHRGIILELSEEFVGIGLIDETNDILEGMTVSVVNHFMEVALFDNMAGRIID
FT                   TTGKMLYDENGEQATTSYPLFCVTPAIMTIDSVTRPLNTGLAAIDSITPIGRGQRQLIL
FT                   GNRQTGKTQIAVDTIINQHDQNVHCIYVAIGLKAAYIAEVIETLKRHGAMGYSTVVATP
FT                   ASDSLTAQYLTPYAGMAVAESLRDQGKDVLIIFDDLTKHADAYRAISLLFNRPPGREAY
FT                   PGDSFYIHSSLLERAVQMNQEHGGGSITALPMIETLSDDVTAYIPTNVISITDGQLFLK
FT                   SDLFNRGQKPAVDVGVSVSRIGGDAQHPIIRKLSRNLTLILSQYEELKELLDFGNALDD
FT                   GSMRMVTDGRILTELFKQNILNPLSVAELAVLLYAFQNGFLTKIPPAKIQTFKGLLLDK
FT                   AHTNESFNLFSNQISEIHELDETHTKMLEEIIMEAGRPFS"
FT   gene            577239..578108
FT                   /locus_tag="lse_0542"
FT   CDS_pept        577239..578108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0542"
FT                   /product="ATP synthase F1, gamma subunit, putative"
FT                   /function="F0F1-type ATP synthase gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0542"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26693"
FT                   /protein_id="CBH26693.1"
FT                   /translation="MSSTNQAQKTIKALNSTRKIVHVTELATLGKLPQLREKSEAAVSY
FT                   YETILKSLRWVRETMHNGKNQTATEKNVTAIAVTSERGLCGAYNSDVFSKINQLIESLG
FT                   DQVTINWVVIGEQGHRYLTKLGQNITAYLQVSLENIDLETTTAITADFIDQINSQQMDA
FT                   LYVVFTKYFNAVHSEAMYEKIYPDIPEEEGLKPIEVDYVLDYEEDDEQVEQLLLENYLC
FT                   GLLYSMFRYSVASEYCMRRIAMKQAKDNIQKQLDEAIFDARKKSLQQKTSELLDIISGA
FT                   QTIRKEEE"
FT   gene            578109..579479
FT                   /gene="atpD-2"
FT                   /locus_tag="lse_0543"
FT   CDS_pept        578109..579479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD-2"
FT                   /locus_tag="lse_0543"
FT                   /product="ATP synthase F1 beta subunit"
FT                   /function="F0F1-type ATP synthase beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0543"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26694"
FT                   /protein_id="CBH26694.1"
FT                   /translation="MKKHTGTIISISGFVLKIEFNESDLPEIGYALEYETHQGNYLAEV
FT                   VQHTGINTVSAIAIGEVSGLARGTIVNNLGRPIEVPVGEKVLGRMLNVYGKAIDGKPEP
FT                   DTEVKWPIFRNQPKLSELDTNKEILYTGIKVIDLICPILKGGKTGLFGGAGVGKSVLMQ
FT                   ELINNISMLGGNAVFTGVGERVREGIGLYKELEESGVLPQTTVVLGQMNESPGVRMRVA
FT                   LTGLTIAEYLRDEEKKDVLLFIDNVFRFIQAGSEVSSLQGKIPITGGYQSTLSKEVGNF
FT                   QDRIASTKDGSITSIQCVFLPADDIDDPSAVATFSHLDSTIVLERSIAALGIFPAVNPL
FT                   QSSSRALNPNFVGERHYNLAVQVKFILQRYMELQEIINVLGIAELSDEDKSLVNRARKI
FT                   RNFLSQPFYVSEKFTGSEGIFVEIEDLLVSIERILNGDYDERSERDFLFIGSYKDLK"
FT   gene            579492..579824
FT                   /locus_tag="lse_0544"
FT   CDS_pept        579492..579824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0544"
FT                   /product="ATP synthase F1, epsilon subunit, putative"
FT                   /function="F0F1-type ATP synthase epsilon subunit
FT                   (mitochondrial delta subunit)"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0544"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26695"
FT                   /protein_id="CBH26695.1"
FT                   /translation="MKLKIVSPMGNFFEGEVEGFVIDTREGQQTVLEEHIDFLSFFDYS
FT                   EIIILDNNASEPIFVALGYLHLVQNEANIMAQFASKDSEQAERIFERLNKRKQSESRGS
FT                   NGERIF"
FT   gene            579805..580365
FT                   /locus_tag="lse_0545"
FT   CDS_pept        579805..580365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0545"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0545"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26696"
FT                   /protein_id="CBH26696.1"
FT                   /translation="MASGFFDTLLLICSLMLTFFLVLLVILAVIRHYLAKDGVALERIK
FT                   RYQRWHDYYQLDAEVTAFLIVISASLLVCLLAVQIPAIPFPFTTLIFWSSWLFILLALW
FT                   KKIRAPQKITKEIMQIGGVLLITAIYFIGYFAITALHDLFLNVAELSFITQVGVRIYLI
FT                   AFSLLVAGFGLFLWQRIYVKLLK"
FT   gene            580438..586473
FT                   /locus_tag="lse_0546"
FT   CDS_pept        580438..586473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0546"
FT                   /product="cell wall surface anchor (LPXTG motif) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0546"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26697"
FT                   /protein_id="CBH26697.1"
FT                   /translation="MKKSSGVHRFLILILVLLLTTGQLNLASFNVFAEENGNDDLSYEV
FT                   EKELTTDKTKANLKLKVTPKNEQLKILTIETPDGKETEGQEAAYTADKNGTVDFKINYQ
FT                   NMEDSEETKTFVASYEVSEIVSKAETSKEPEPTEQKKPTEQKTTTNKENLKSEQTNVTL
FT                   SIPEYNQTAWANGDIKTVTATVEFADNATSGKKVNFTLPDGMRFVSLPVPNNYKPTNGT
FT                   DSSIMNYLGTGDPLGNAITSITVPKNETNYNQATFGTVSYELDSGTEKASFNFSVRVDA
FT                   AKYYGATDLQSPIKTEVFANGEGTSLASVEQDIHAEGKKVVGYAGQDHVKTMFRNWYVN
FT                   HSLTEVFASSDTVDSYNYTKPYSVVNGLNHTDERGSSAYLAKNLTVTLYYPEGMEYVGV
FT                   VDNSRALIANNSDINITPYPSEHKVVINYKQMNLNGVGRSIFSVKYKIPKETPAGTYSA
FT                   AKVPHAVITTYDDKVFEADALTSNAGDLTTKAAIDTCKVVDTSVNKMRLTPRNHYINPD
FT                   NETWAGSIQIDNQKTAGMKTNQVYQIEFDPNWEAYSVNLPFDSNVSGNKITNVQYKTNL
FT                   NSNYRSYSGDLPAHVNGMVRLEASKAGLQEGEYFTEVKANVGDFSPGFVSVSPSGAWGP
FT                   NYTASYGIVKPGITSVQFKASVWDAADEANTKSSGTSTYSVSNTVTDSANGRATFYNKK
FT                   GAKIKVASAGETITTNASLVLFDYPYGTRTVINNPEVYLRELDGTTINPSTIKLTDQAG
FT                   KEVDFTVKQETANNGEKVYVLKTTGVTVGAYVDYPYKTQYLNVSYDTTFDLTLDTGINM
FT                   DIQNVLAWGGSNVSSAIGSNSFSDAGLDVNRNGKDNETLLSANSSTLNVPKQDTVTVET
FT                   FLNVAGEGTKAAYNEGDDSTVSYFTPGTDADYTVQITNTSNSEARTFELYIPIPKTGQN
FT                   FGSKFQSEAFKWDMKLNGAIDISAEQQSQFEIGYATAATADNYESADIYSETVSDYENV
FT                   NMVRIKVKNQINAGETQKFKVPLKVDETFDTANEDNKISTRDIYNPYYHVITNTFSGSL
FT                   SGTKVGAELVIGEVSGTLFNDKDANGLFEKSKGDVALGNETIELYKWNNATSAYEPVTK
FT                   NGENITTKTDANGTYTFDYNSDVGYGNYAVKFPDKNGYQYTLKNVGKNTAIDSDVPYSG
FT                   TDKGWAKNIDPTLPVSQTINAGYYAYTPEQDLKVNLNEKRVQTGRSLAITLPKVASTNG
FT                   QAGEDTIEPNFFQNIRASTEDYKWTTADTGVATVQTQNDGSAAVVGVSTNNQTIAATDL
FT                   TIAIQDIFGTKQSSTAPVYVTAADGTIVQQDGFTMGATDFSLEYKDAVALTSTEALSLG
FT                   KTAAFEEVKNGVNSSAQDRLSSVQVNQTQLAAIKNGSNQGGTYPLTYTLTKDGKTVEVR
FT                   IQVTVAQDLTTVNAHNSTLYVGDTWTAANNFDSAIDKEGESVPFADVTVSGTVNTSLAG
FT                   TYPVTYTYNGVSKTIQIIVKDNLTAVNAHDSTIYTGETWNAADNFDSALDKDGNPVDFA
FT                   DVTVTGSVNTNQAGPANITYTYDGISTTIVVTVKENKSGINAHDSSIYVGDNWTAADNF
FT                   DSAFDKDGNPVAFQDVKVTEKPTVNTNKAGVYQVTYSYGKATTTITLTVKEIQTDVNAH
FT                   DSILYIEDSWNAADNFDSARDKDGNTVPFSAIQVTGTVDTKQPGTYPVTYSYDGVSTLI
FT                   NVTVKAPQTSVKAHDSVIYTGDSWNAKDNFDSAKDKDGKAVDFQKVTVDESPTVDPSKL
FT                   GIYQVTYSYDGVSTTINVTVEPRQTSIKVHDSNIYAGDDWSAKDNFDNATDKKGDSVSF
FT                   ADMKVTGQVDTYASGTYEISYSYDGVKVIAHITVLENKAQITVQDRTIQKGDTWSAEDN
FT                   FISATNRDGEAISFEKVQVSGTVNTNKAGDYQVTYTIDPNEGTTDAGKKQLSVTATIQV
FT                   DDPSKPSKPSKPSKPSKPKSPSELQVKSNTQQTATYEDAKPLPKTGDQSITWIVWAGMG
FT                   LLILSVILWVINRRRHSYK"
FT   gene            586613..587317
FT                   /locus_tag="lse_0547"
FT   CDS_pept        586613..587317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0547"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /function="Predicted hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0547"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26698"
FT                   /protein_id="CBH26698.1"
FT                   /translation="MINLIFDIDDTVYDQLKPFEDAFNTIFGKENPLEMEALYIKSRFY
FT                   SDEVYHRVVKGEMPKAEMHIYRITQALNDFDYQITKKQAEEFQRAYETNQRKITLLPGI
FT                   KEILAWGKSQNATMGIITNGPAAHQQHKIDDLQINSWIPVGNTFISGKVGFEKPDKKLF
FT                   TLVEQQLDITGAETYYIGDSFENDVVGAKQAGWKMIWLNRRKHKAPIDTPYHPDFCVEN
FT                   ESELLAILQKLT"
FT   gene            587430..587846
FT                   /locus_tag="lse_0548"
FT   CDS_pept        587430..587846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0548"
FT                   /product="Rrf2 family transcriptional regulator protein"
FT                   /function="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0548"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26699"
FT                   /protein_id="CBH26699.1"
FT                   /translation="MKYSKATNYALHTMVYLANLSAEKSVGVKELASKQNVSPTYLSKV
FT                   LTMLVKADFVESITGVNGGYKLAKPASNISFLDVIQAIEGKTAFFHCDPKNHAETKPHC
FT                   LIGEVMGNAEQQMEDYLSKQTIGSIVVEIEKHHH"
FT   gene            587861..588457
FT                   /locus_tag="lse_0549"
FT   CDS_pept        587861..588457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0549"
FT                   /product="methyltransferase, UbiE/COQ5 family"
FT                   /function="SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0549"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26700"
FT                   /protein_id="CBH26700.1"
FT                   /translation="MKHHHNHHGEAGFKRKVDYLDRPERKELLSPEEFIQAMPINKTDT
FT                   ILDLGAGTGFLTIPAAKLVDNTVFALDLDSKMLELIQKKALDADLTNVEVLEASMEEIP
FT                   LEAGSISIALASLVLHEASSLMDVLSEVNRVVKVGGYFACLEFDTKGTDLKGPPMEIQI
FT                   SAEKLERELGKVGFEVVKNWELAEGMYVSIAQKKA"
FT   gene            588470..589102
FT                   /locus_tag="lse_0550"
FT   CDS_pept        588470..589102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0550"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26701"
FT                   /protein_id="CBH26701.1"
FT                   /translation="MNLDLMVSVSSINFHPKIEQKEADLLISHINGKNELPLALILLKR
FT                   SKLIHDERSKFVSIITACEIGVKEFYSKKIPELGLLLDEMTSPPVVKLLGSLFKKYFEE
FT                   TFPKELRSKLEKMIEIRNSIVHRSAIKPTHTELLSCYVVVLKTLNFLNKKSDNGFYNEY
FT                   YDEEVSFEPIESTGQLQINGSDKLNKAVEEGKIIYGFDINSEYIIND"
FT   gene            589256..589540
FT                   /locus_tag="lse_0551"
FT   CDS_pept        589256..589540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0551"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0551"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26702"
FT                   /protein_id="CBH26702.1"
FT                   /translation="MSEINVKETIFQQHANTLESANDGEYFPLKNWNMPYSRANSINQL
FT                   RSALSDLVGVVENFQEVTKKDADRLEKMGKAYTKQDKSAAKKIGQLEVR"
FT   gene            589541..589909
FT                   /locus_tag="lse_0552"
FT   CDS_pept        589541..589909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0552"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0552"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26703"
FT                   /protein_id="CBH26703.1"
FT                   /translation="MDATHSQIEQQLQQIKKAKITMETTIDQTRRKQNEQDWLEEDNHH
FT                   LEQEKLALLDFLRSGWQGEEASGFHRYLEDQQHEESQTWKKDLQAKRTHVDTELQENKA
FT                   QLHALETKQATLKKEWRA"
FT   gene            589906..591429
FT                   /locus_tag="lse_0553"
FT   CDS_pept        589906..591429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0553"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0553"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26704"
FT                   /protein_id="CBH26704.1"
FT                   /translation="MSRIDMAELNDFLHGLRASNAEAKGMIRKIKEAAMDYTQNHSLKG
FT                   AAVSTSKAYFSSTYTSITQSILEALDESEERLAQYIREFGDQVDSSPSCKIDAQVLQEV
FT                   MDKVSQLQRKEETLQEQLTAPNTRPDMQEVYAVKTKSAHTQLLKAIEKENILEKYIAFE
FT                   QSHGQFFSALDELIRATGQAVQELLDKVTFNDQTGTYSIPKSTTASLQRMKKALDTART
FT                   ENDKDPYPESFEDYTLLAYTYVNDRGETVTMWLLEKDGKRANNKELQAFLEEHGNDLNP
FT                   VLYTELSGEELERKVNDAWKDGVNYLNGQKVSGPSAGILKSFAYVASMKDAMDDAGLTE
FT                   MSLSLGFGIAAARNKAIISKKTREPETNRVDTNQRERILKNIEESKKAREASNFKDYLK
FT                   REKIVLEKIKKRNSKKTVESNLGNEIDITPLANHKTVESNPGPYGEPNSSVDILDKKGN
FT                   IKTRRYYDNNGRAIRDVDMTNHGNAKKHPEYPHEHFWSYDSDGNNPSRD"
FT   gene            591447..591674
FT                   /locus_tag="lse_0554"
FT   CDS_pept        591447..591674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0554"
FT                   /product="conserved hypothetical protein"
FT                   /function="Myosin heavy chain"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0554"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26705"
FT                   /protein_id="CBH26705.1"
FT                   /translation="MDYKTMADSLAYGEEYNFYYEDEEYWISKNSDGNYLTKVSDGYTQ
FT                   EFKNSNELLEKAEINGKSIMEIWEDIKNQF"
FT   gene            complement(592232..592321)
FT                   /locus_tag="lse_t011"
FT   tRNA            complement(592232..592321)
FT                   /locus_tag="lse_t011"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:592283..592285,aa:Ser)"
FT   gene            592407..592940
FT                   /locus_tag="lse_0555"
FT   CDS_pept        592407..592940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0555"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0555"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26706"
FT                   /protein_id="CBH26706.1"
FT                   /translation="MERKLLEEINLLENRKLIINLNLVAILIVFVLTVLGVVFSGGFEI
FT                   SNGFTGIFWLLLGYFLSLVIHEAVHGIFFKAFCPSGKVKFGFKSGMAYATSPGSFYTKT
FT                   QFFIISIAPFVVLTGLFIFLRSLGVNEAVVYLIFALHTSGCVGDFYYCILLINKPTGIL
FT                   VEDTEKGINFYSEG"
FT   gene            593004..593921
FT                   /locus_tag="lse_0556"
FT   CDS_pept        593004..593921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0556"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /function="Predicted oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0556"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26707"
FT                   /protein_id="CBH26707.1"
FT                   /translation="MKRITIGNSALTASEISLGCMRMADLSKADANKVINTALENGIDF
FT                   FDHADIYGGGKSEEVFADGIDMNPAIREKMILQSKCGIRQGFFDFSKEHIISSVEGSLK
FT                   RLKTDYLDTLLLHRPDTLFEPEEVAAAFTELEKSGKVRHFGVSNQNPGQIELLKKYVDQ
FT                   DLIANQLQFSIMHTGMIDTGFNVNMTIDPSLDRDGGILEYSRLNNMTIQAWSPFQYGFF
FT                   EGVFLDNDKFPELNKVIDKIAADKAVTNSAIAVAWIQRHPANFQTVVGTMNPGRLADIA
FT                   KASDVSLSREEWYEIYRAAGNQLP"
FT   gene            594186..596066
FT                   /gene="cadA"
FT                   /locus_tag="lse_0557"
FT   CDS_pept        594186..596066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cadA"
FT                   /locus_tag="lse_0557"
FT                   /product="cadmium-translocating P-type ATPase"
FT                   /function="Cation transport ATPase"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0557"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26708"
FT                   /protein_id="CBH26708.1"
FT                   /translation="MRHWMERNWQFVTTGISGILIVIGWIFGSEVGEVWTAVIFLSAFI
FT                   IGGFEQAKEGIQATIKTKKLNVELLMILAATGASIIGYWFEGAILIFIFSVSGALETYT
FT                   TNKSKREITKLMAFQPESASRILPNGDIEEVAAKDLRMDDIVIVRPGESVPIDGVIVRG
FT                   STTLNEAAINGESVPAMKTVGADVFGGTVNVSSAITVKVTQTFENTIFSKIIRLVETAQ
FT                   NEPSKTARFIERFEDFYVKAVLLFVLVMMFLPHFALGWSWNETFYRAMVLLTVASPCAL
FT                   VASVTPATLAAISNGARHGILFKGGVHLENLRGIKAIAFDKTGTLTNGTPRLTDRLFKA
FT                   NSDEKRIINVVVAMERQSLHPLASALTKELESEVTDKLMEIDVTDVPGWGVKANYDGEI
FT                   WQIGKAGFVGEDAAKQFSGEAFEKLASEGKTIVYVAAAGEVIAMFALKDTCRPEAIQAI
FT                   TALKAKGIKTIMVTGDNEQTGAAIQTELGMDYVVAGCLPEKKVDVIKDLSATYGNVAMI
FT                   GDGINDAPALAHAAVGIAMGEGTDIAMETADVVLMKNDLEKIAYAYTLSERLHWISWQN
FT                   ICFAIAVIITLIIANVFQLINLPFGVVGHEGSTILVILNGLRLLKTNRKL"
FT   gene            596162..596890
FT                   /locus_tag="lse_0558"
FT   CDS_pept        596162..596890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0558"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0558"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26709"
FT                   /protein_id="CBH26709.1"
FT                   /translation="MKKINWTQWVALFVFASMGVSVVFTIFEIFTAPIKQPATGPHVTL
FT                   RGDYIFLLFEILLGIIILLLPSIISRRFKFEIPGLVYILFIIFLYGSIYLGTVQQFYSN
FT                   VPHWDKILHTFSGAMLGAIGFSFVSLLNANSKVVMNLKPGFIAVFAFCFAVTMGAFWEV
FT                   YEYTFDGIMNLNMQRYNLSNGTPLTGRAALQDTMTDIIVDIIGALFIVIIGYLALKKGR
FT                   PWMERFEFKRKNWKKEPKKK"
FT   gene            597033..597683
FT                   /locus_tag="lse_0559"
FT   CDS_pept        597033..597683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0559"
FT                   /function="Transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0559"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26710"
FT                   /protein_id="CBH26710.1"
FT                   /translation="MFLDSGNLDEIKKALQFPFFEGVTTNPTILLKENQPRKTHIAQIS
FT                   AKLVFVQAAGLTEAEIWDDVLRIQAIQPADGTTIGLKIPAHEAGIKVMTKVRAKFPDAI
FT                   ILATAIFSSEQGYIASLAGADYLAPYYNRMEVSGLDAAKTIEELRYVLDLQGLQAVKIM
FT                   GASFKNSRQIMQALASGADTVTIGYDLFLQMMNKPLALESIEKFNEHNDALPK"
FT   gene            complement(597725..599566)
FT                   /locus_tag="lse_0560"
FT   CDS_pept        complement(597725..599566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0560"
FT                   /product="sulfatase family protein"
FT                   /function="Phosphoglycerol transferase and related proteins
FT                   alkaline phosphatase superfamily"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0560"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26711"
FT                   /protein_id="CBH26711.1"
FT                   /translation="MLERGIQLILFYFLLIVGKFTFAYFQIFKTPNFLALGMDLLFIVL
FT                   ILGLIHLFAPVRSHVYWYAGMSLFVGVLMLICVLYARFYNEIPTYHSFSLIGEVGVVKT
FT                   SATSLLNGTDWLYIIDIILLPFILYWNIKKGHDFPSFRLTSRVYGISSLSILLVLSGFT
FT                   YFMMQQNIISDSKRAKRMGIFTFNVSAAITGSDHVKAADITAQNVRDIKGVDRNENPDY
FT                   FGTAKGKNLIIVQLESFQRNLTNVKINGQSITPTLDSLEDETMYSNKFFQTVSKSNTAD
FT                   AEWSVYTSTFPSGYYTNTQTYGDRVIPSMPRLLGKNDYATETFHTNDASFYNRDEFYPA
FT                   VGFDKFYDRKFFGDEDVIGFSPSDEVLYNKAFPILEEQYKKDQKFYAQLISVSSHMPFD
FT                   IPKDKQEINLPSDLKDTELGNYFEAVHYADKQLGIFIQKLKDSGIWDDSVVVFYGDHHI
FT                   IKTDQLPEEQKKYVNRSTELKADPADDYRIPFFLHYPGMENPGEIKNVGGEVDIMPTVM
FT                   NLLGIDTGEQIMFGEDILNTSNNYVPERYTMPEGSYFTDSYMYQPDESFETGAATNYNG
FT                   TDKALSSDVKKKFDASRKLLQYSDSYVNNLPLRDEDK"
FT   gene            599780..601171
FT                   /locus_tag="lse_0561"
FT   CDS_pept        599780..601171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0561"
FT                   /product="amino acid permease family protein"
FT                   /function="Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0561"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26712"
FT                   /protein_id="CBH26712.1"
FT                   /translation="MNSLFRKKPLNDLLHNKSGSTHLKQTLGAFDLTLLGVGAIVGTGI
FT                   FILPGTVAAKSAGPAIIFSFVIAAIVCAIAAMCYSEFASSVPVAGSAYTYGYVVFGELI
FT                   GWLLGWALILEYGLAVASVASGWSSYLNALLSGFHITIPKAVSGPFNPELGTFINLPAI
FT                   FIVLIIAFLLTLGIKESTRVNTIMVALKVGVILLFLVVGVFYVKPDNWQPFMPYGISGV
FT                   MNGAALVFFAYLGFDAVSSAAEEVKNPQRTMPIGIIGSLLICTVLYVAVSAVLTGMVPY
FT                   TDLNVTDPVAYALQVIHQDWVAGIVSLGAVIGMITVILVMSYGATRLIFAMGRDGLLPK
FT                   VLAEISEKHHTPVKNTWIFAVVVAIISGLVPLDKLAELVNIGTLLAFMMVSIGIIFLRK
FT                   NKSIQQSGFKVPFYPVLPIISFLLCAFLISRLSVHTWISCGIWFVIGLIVYFVYGRKHS
FT                   ELSDK"
FT   gene            601260..602099
FT                   /locus_tag="lse_0562"
FT   CDS_pept        601260..602099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0562"
FT                   /product="glyoxalase family protein"
FT                   /function="Predicted ring-cleavage extradiol dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0562"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26713"
FT                   /protein_id="CBH26713.1"
FT                   /translation="MEKINEMMRLGEVVLNVGHLEEMAGFYQEVIGLTLLEKNERVVRL
FT                   GVSGSNEALLVLQKIDNAVVPEVPRIGLFHTAFLLPTRENLADVLVHLIKSGYPIDGAG
FT                   DHAYSEALYLHDIEGNGIEIYADRAKTDWMRDAEGNLPMVTEEVDVDGLLKIATGEAFT
FT                   EMPVGTKIGHVHLQVSDVDKAEQFYRRALGLNLTTAIPSARFFAAGDYHHHIGTNMWAG
FT                   RNLQNRQEQEVGLAWFTIITPDKEAISKQLEEQGYQVNRFEKTISVVDSNGIMIHFK"
FT   gene            complement(602183..602467)
FT                   /locus_tag="lse_0563"
FT   CDS_pept        complement(602183..602467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0563"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0563"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26714"
FT                   /protein_id="CBH26714.1"
FT                   /translation="MEFMSMIVTGLILAAIMFGLSFVVSKLSGLSWFWIAFCANSGFFL
FT                   TFLAVQSAFPENAALALSYLNLGIGIFLILQTIFGSSNWLLKKTMQRRH"
FT   gene            602565..603515
FT                   /locus_tag="lse_0564"
FT   CDS_pept        602565..603515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0564"
FT                   /product="magnesium transporter, CorA family"
FT                   /function="Mg2+ and Co2+ transporters"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0564"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26715"
FT                   /protein_id="CBH26715.1"
FT                   /translation="MIEFFKTTNEKMEQLSSLEEGCWVKVTAPTEEEIERLSKEMDVPK
FT                   PYILDALDSEERSRIELKRAEEDVRHSLVIVDCPYESEDELGYAMYETLPIGIVLTRSH
FT                   LVTISLQDLPILEDVRSMKLEVYDTTNHKQFLLKLLYAVSYYYLKYLNQIIKQTNNLEI
FT                   QIKQSMKNEQLYAFMAVQKSLVFFATALQSNKAILDKMEDVEHFMQQEENHDLLRDVII
FT                   ENKQAIAMTDTYTQIISGMSDVFSSVISNNLNIVMKFLTSFTIILSLPTIVASVYGMNI
FT                   KLPFMHNDHAFALILLFTLLITTGVTVIFWRRKYF"
FT   gene            603541..604182
FT                   /locus_tag="lse_0565"
FT   CDS_pept        603541..604182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0565"
FT                   /product="transcriptional regulator, GntR family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0565"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26716"
FT                   /protein_id="CBH26716.1"
FT                   /translation="MEKQTYEKLAYYTIKEKILSGKLRVGEHISEAGIAKELSISRTPV
FT                   RKAIAVLVSEELIEYELNRGAIVIESSMSAGRFIELLEMGEILIIQTIDKCKNKNLTYK
FT                   PEKGNEILKEMRQIQKEEEVDLYLTLLSKWLLQFISQLGNIYAEDTVRKMKRDFFNKAQ
FT                   KDIKMIPVLLEDETLECIDQLTSHMVAKEHDEAKEVTKRLVNLYIIRTFR"
FT   gene            604214..606904
FT                   /gene="pip"
FT                   /locus_tag="lse_0566"
FT   CDS_pept        604214..606904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pip"
FT                   /locus_tag="lse_0566"
FT                   /product="phage infection protein"
FT                   /function="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0566"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26717"
FT                   /protein_id="CBH26717.1"
FT                   /translation="MRKVYEIFILDWRRLFKAPLALLLVIALIILPSLYAWFNIEALWD
FT                   PYSNTSGIKVAVSIDDEGAEVDVPGTKPQQINVGNQLKETLKKNDKLGWTFVSQKEAEK
FT                   GVKSGKYYAAIHIPKDFSEDMVSVVNDNVKKPTIDYYVNEKINAIAPKMTESGATTIVN
FT                   QISSEFVETVSKSVLEEFNKAGIDLENELPTIRRLKTKVFQVQDALPEIKKMGAEAVKI
FT                   EGKLPELKAKANQVVELNKKIPELNNATENVLLVEQQLPKIDQLGQDILVLQKKIPEIK
FT                   QIASSVKEVDENFGTIKKTVNDAVDESGKALDVIDGAMGAIPTVQKIAQNGSGYVDKVT
FT                   DFADEINRSFDTLAPAIKQNLTLMKQMADNIYQVTEAIKNGSISSDQAIAELKKMEQDI
FT                   DSLQQMITQQTETLESLNETLPNKPFTDLIANLKTINSELSAQKTTITKIRTQLENGEQ
FT                   PAEELLNTLNAQAKTVSDKLQQILANYDTEIVPKIKAGLNQIQGDLKDSQKLLQNLQAK
FT                   IPEITQVLKDSRKTLQTGQTYLKEFQARLPEIQKTLDDATQVIDTKLDTIIVGINEAAD
FT                   FYQNDYPNVKANIKKAADFIRNDLPGLEKEINQASNLIQEKMPEFEKAVTIAANLSREE
FT                   LPEFEKAINNAANKITDFDKNYDLQSIIKMLRNDADKDSSFIANPVSLKETSYYPIPNY
FT                   GSASSPFYTALCLWVGALLLISLLRVDVEVPAGIFNHYHRYFGRLLTFLSIGLMQAVIV
FT                   TLGNIFLLGVSIAEPLLHVLFSMFISVVFMTIVYTLVSLFNNVGKGIAIILLVLQISGA
FT                   GGNFPIQVSPPFFQAIYPFLPFTYAVSLIRESVGGLYMPTVWLDISVLAGFAILFIAIG
FT                   VLLKKPLDKVIPKLSEKAKRSKLIH"
FT   gene            606949..607599
FT                   /locus_tag="lse_0567"
FT   CDS_pept        606949..607599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0567"
FT                   /product="transcriptional regulator, GntR family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0567"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26718"
FT                   /protein_id="CBH26718.1"
FT                   /translation="MVANRYKTLEKMVYDQLLIKIKKGELSPNQHLAEEKLAAEFGVSR
FT                   SPFRKAIATLAAQGVVTYHENSGAVLNDVIIDSARYVQLIETISILVDAAIVKVGHFGL
FT                   AMDVEKLHARLQEMERYSYLTDVENYLDAHHRFILYLISFAENPYQVTIAKQIFFQIIS
FT                   FSDEIHIFKSVEIREWTNKKSSQIYELLVKEDTEEARKTIKSMFAELTIQAYR"
FT   gene            complement(607618..608157)
FT                   /locus_tag="lse_0568"
FT   CDS_pept        complement(607618..608157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0568"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0568"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26719"
FT                   /protein_id="CBH26719.1"
FT                   /translation="MNQNKITAGGLEFLVRFALPIDHLKINELMSNTARWLKDSGSSQW
FT                   GDILQGFDVHQIEQRIERGEVALFETVKGLLAGAMIIRKTPSEWDSDLWEELASENAYY
FT                   LHRIMVSREFGGISLSKEMINWSEKLAIHEKIPFVRLDCIKTNDKLNQMYCRYGFQLIG
FT                   EKNGFNLYQKSFHLSE"
FT   gene            complement(608144..609031)
FT                   /locus_tag="lse_0569"
FT   CDS_pept        complement(608144..609031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0569"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0569"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26720"
FT                   /protein_id="CBH26720.1"
FT                   /translation="MMTISQVKQTAKESLRGNWGIAIGIFVLAWLIETVASGVLSWIPF
FT                   IGWIALFLLTGPLYVGVSWVYLAISRREQPEVAYMFSGFKEFGRTFLAYLLISIFIFLW
FT                   SLLLIVPGIIKTYSYSQTFFILRDNPNISALDAITESRHMMNGHKGRLFGLSLTFLLWY
FT                   LIPIAVGIVGSVIVFGGMASVSYTTDPTELISALAAGATFGGLVLMLVAGLISLGISLY
FT                   VYPYLLTSVAVFYDDLYAASEGIYVEETVIVEEEVDPFAQTEEDPFANDTHPEGFGPET
FT                   TKEPETPKDENEPK"
FT   gene            609216..609425
FT                   /locus_tag="lse_0570"
FT   CDS_pept        609216..609425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0570"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26721"
FT                   /protein_id="CBH26721.1"
FT                   /translation="MAHENLRELEDRLIGLRQEYQEVLSETRDFEDPQLQNGPINASEV
FT                   RLSALRHEISEVEKKIKKVEGDTK"
FT   gene            609499..610206
FT                   /locus_tag="lse_0571"
FT   CDS_pept        609499..610206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0571"
FT                   /product="serine/threonine protein phosphatase family
FT                   protein"
FT                   /function="Diadenosine tetraphosphatase and related
FT                   serine/threonine protein phosphatases"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0571"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26722"
FT                   /protein_id="CBH26722.1"
FT                   /translation="MKPIFAVGDVHGEITLLDELLENWDKERERLLFVGDLIDRGENPA
FT                   AVLRRVKELADNSDAIVLKGNHEKMLLDWLESPSEKMHYYLSQGGMETIQSLIADSLDK
FT                   KTTPEGLAERIKQESAELIEFIRNLPLYYEEGKYVFVHAGVDFTKGDWHETEERDFYWI
FT                   REPFLFGENKTGKVFIFGHTPVQNLHKNGSSGIWVSSDKTRLDIDGGAVFGGELHGVVV
FT                   EEKVIAKSFTVKK"
FT   gene            complement(610251..610814)
FT                   /locus_tag="lse_0572"
FT   CDS_pept        complement(610251..610814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0572"
FT                   /product="membrane protein, putative"
FT                   /function="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0572"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26723"
FT                   /protein_id="CBH26723.1"
FT                   /translation="MEQNKEKLTKPTSEKNYFWPIMIISFVAVVVILLLFFSPIGYQGA
FT                   VHFDITIFPRMNAIFNSFTFVFLVIALWAIIKKKNINMHRGFILAAFTSTLFFLVSYLT
FT                   FHYLSAETSTFGGTGIIRPIYFFILITHSFLAAIVVPLALFALVWGWTMQIEKHKKIVR
FT                   WTMPIWLYVSLTGVLVYLFMAPYY"
FT   gene            610932..611348
FT                   /locus_tag="lse_0573"
FT   CDS_pept        610932..611348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0573"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0573"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26724"
FT                   /protein_id="CBH26724.1"
FT                   /translation="MSIIARELTKAEEAEIIRLKEEGEIMLQTDGTPEERVQKIVDYLK
FT                   NTSSDPDSAEEQGYLLGSLYGEAVREKYGWKWLFVSENDLEGYAITSKKHGYTFMVHDY
FT                   FMQVIVGNKADNSKMLFELMPDMTGNRNDFRIIG"
FT   gene            complement(611433..611789)
FT                   /locus_tag="lse_0574"
FT   CDS_pept        complement(611433..611789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0574"
FT                   /product="hypothetical protein"
FT                   /function="Conserved protein/domain typically associated
FT                   with flavoprotein oxygenases DIM6/NTAB family"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0574"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26725"
FT                   /protein_id="CBH26725.1"
FT                   /translation="MQVGSEATFNVADATIWENIERIAKTTGNFNLPDFKKQAGYEYCT
FT                   DKFSLGGFTKMAGKEVPSVRIQECPIQIETSITELSIRSDFAIIECEIKGIFVDEKILY
FT                   DDSHIDVNNSFPGI"
FT   gene            611879..612358
FT                   /locus_tag="lse_0575"
FT   CDS_pept        611879..612358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0575"
FT                   /product="ThiJ/PfpI family protein"
FT                   /function="Putative intracellular protease/amidase"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0575"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26726"
FT                   /protein_id="CBH26726.1"
FT                   /translation="MGGMKVVPDCLIDDMVVDETNMLILPGADTWNDAKHTAILKMARE
FT                   FLSHGAKVGAICGATVALANLGILDERPHTSNGAGFLAMFSPNYRGQDFYVDQLSVLDN
FT                   NLITASSAGSLLWSKQIIEQLDVFQSDTLEFWYDYFNTGDSNYFFQLMETLPSVE"
FT   gene            complement(612500..613315)
FT                   /gene="thiD"
FT                   /locus_tag="lse_0576"
FT   CDS_pept        complement(612500..613315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="lse_0576"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /function="Hydroxymethylpyrimidine/phosphomethylpyrimidin
FT                   ekinase"
FT                   /EC_number="2.7.4.7"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0576"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26727"
FT                   /protein_id="CBH26727.1"
FT                   /translation="MTIKKTLTIAGSDSSGGAGLQADLKTFEEYGTYGFSAITTIVTMD
FT                   PDNNWAHGVTPIDAGLVREQLKTILSGGPVDAMKTGMLGSIDIIKATREAIDKYDLKNV
FT                   VIDPVMVCKGEDELIQPENAEAIRDLLLPKATITTPNLFEAGQLSGLGKLTTLDDMKAA
FT                   AKKIIELGAKYVVIKGGKALESDKAIDLLYDGKDFTVYEVEKISPSHNHGAGCTFAAAI
FT                   TAGLAKGLTVEEAVAKAKDFVTAAIKGGFALNEFIGPVWHGAYNKAENR"
FT   gene            complement(613340..614206)
FT                   /locus_tag="lse_0577"
FT   CDS_pept        complement(613340..614206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0577"
FT                   /product="Cof-like hydrolase"
FT                   /function="Predicted hydrolases of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0577"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26728"
FT                   /protein_id="CBH26728.1"
FT                   /translation="MIKVIASDMDGTLLNSNIEIAQENVEAIEKARAKGIHFVLCTGRM
FT                   YDDAMGLINKVNLYAPAICMNGAEIRDEHGKIVLQHPIDRDLARDTYNTLSELGMYTEF
FT                   FTDMGPITTDKARGKEFMIEMHKRIHPDAPVSEITEKVEERFESKDVHEIPDVERILAN
FT                   KELTILKFISFSYNKEILAKAKAKLEKENELSVTSSFSDNIEITHREAQKGISLQYYVE
FT                   KLGITLDETFAIGDNMNDISMLKMAGYSVAMGNAEEEVKDLAEHVTSTNDEHGVAAAIY
FT                   KMLETND"
FT   gene            614380..614943
FT                   /locus_tag="lse_0578"
FT   CDS_pept        614380..614943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0578"
FT                   /product="maltose transacetylase (maltose
FT                   O-acetyltransferaseacetyltransferase), putative"
FT                   /function="Acetyltransferase (isoleucine patch
FT                   superfamily)"
FT                   /EC_number="2.3.1.79"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0578"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26729"
FT                   /protein_id="CBH26729.1"
FT                   /translation="MKTELEKMIAGEMYDPSDRELVHGRSRARKFCREINDTMDAESRQ
FT                   SVLKRLFGGTKENVYVEPDFRVDYGSNIYVGENFYANFDCVILDVCEVHIGENCMMAPG
FT                   VHIYTATHPLDPVERNSGQELGKPVVIGDNVWIGGRAIINPGVTLGNNVVVASGAVVTK
FT                   SFPDNVVLAGNPARVIKTIEVKDK"
FT   gene            614940..615203
FT                   /locus_tag="lse_0579"
FT   CDS_pept        614940..615203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0579"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0579"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26730"
FT                   /protein_id="CBH26730.1"
FT                   /translation="MIISDAKIFEQMESELAKARAATTKASQDKHLHGLMLLVQLAKTG
FT                   DETGLEVEPSTIPKSEPAQIVNMDGKKIELEDGANGDSLLDF"
FT   gene            615213..615590
FT                   /locus_tag="lse_0580"
FT   CDS_pept        615213..615590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0580"
FT                   /product="membrane protein, putative"
FT                   /function="Uncharacterized small membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0580"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26731"
FT                   /protein_id="CBH26731.1"
FT                   /translation="MKKTIITGAIFAGLAVLLGAFGAHALKEILGSYASTWETGVQYQM
FT                   FHAVGILIVGLLMEKQTSRLYTWAAILFSVGIVFFSGSLYVLSISKVAVLGAITPIGGV
FT                   CFVVGWFLLIMGVSRRSTRFY"
FT   gene            615717..616652
FT                   /locus_tag="lse_0581"
FT   CDS_pept        615717..616652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0581"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /function="ABC-type multidrug transport system ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0581"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26732"
FT                   /protein_id="CBH26732.1"
FT                   /translation="MTYALEITGLRKIYSTGVEALRGVDLTVEEGDFYALLGPNGAGKS
FT                   TTIGIITSLVNKTSGKVKVFGYDLDTDIVRAKQQIGLVPQEFNFNPFETVQQIVVNQAG
FT                   YYGVSRKEAFKRSEKYLKQSNLWEKRHERARMLSGGMKRRLMIARALMHEPRLLILDEP
FT                   TAGVDIELRREMWTFLRELNESGTTIILTTHYLEEAEMLCRNIGIIQSGELIENTSMKS
FT                   LLSKLQFETFIFDLEPYDQAFEISGYQYIFEDKQTLSVEVERNQGVNHIFEQLSAQGIK
FT                   VLSMRNKSNRLEELFLKITEEKHQVGEKHV"
FT   gene            616645..617415
FT                   /locus_tag="lse_0582"
FT   CDS_pept        616645..617415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0582"
FT                   /product="ABC transporter, permease protein"
FT                   /function="ABC-type multidrug transport system permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0582"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26733"
FT                   /protein_id="CBH26733.1"
FT                   /translation="MFNLYFTALKSLAAKETNRYMRIWVQTLVPPVITTSLYFIIFGKM
FT                   IGSRIGDMGGFSYMEYIVPGLIMMSVITSSYANVSSSFFSQKFQKNIEEILVAPVPTHI
FT                   IIWGFLIGGIGRSILVGSLVTIISLFFVPLHVYSWSIGIITFLMTAIVFSLAGLLNGIF
FT                   AKSYDDVSIVPTFVLQPLTYLGGVFYAISMLPPIWQAVSKVNPIVYMISGFRYGFLGVT
FT                   DVPIMVSMLILVLFIVVLYAICWYLISKGRGLRS"
FT   gene            617920..618342
FT                   /locus_tag="lse_0583"
FT   CDS_pept        617920..618342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0583"
FT                   /product="putative membrane protein"
FT                   /function="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0583"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26734"
FT                   /protein_id="CBH26734.1"
FT                   /translation="MGFLEAYKSFWKNYVNFSGRASRSAYWYATLWNVIIVLVLYVLAF
FT                   IFGLSLVMEKVMAGYGIVGLGSAVFILFVLWLFMLAILLPTISLTVRRLHDSGKSGFFA
FT                   FLNLIPFVGGIIILVFMCLESDGPNQYGDGDSEFDI"
FT   gene            complement(618383..618592)
FT                   /locus_tag="lse_0584"
FT   CDS_pept        complement(618383..618592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0584"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0584"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26735"
FT                   /protein_id="CBH26735.1"
FT                   /translation="MYIEIYTVNGESIRLDDDAKINNISIHELSKADLKNLFSEKCIEL
FT                   TKYDLTYFINTNQVNWFLVSEGIH"
FT   gene            complement(618612..619532)
FT                   /gene="mogR"
FT                   /locus_tag="lse_0585"
FT   CDS_pept        complement(618612..619532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mogR"
FT                   /locus_tag="lse_0585"
FT                   /product="transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0585"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26736"
FT                   /protein_id="CBH26736.1"
FT                   /translation="MPKSEIRKLLQEIKKQVDNPGNSSINEIKKMASESGIDEDTAEEI
FT                   FHLLTDFYQAVEDHGGIEKYMHSNISWLKIELELLSACYQIAILEDMKVLDISEMLSLN
FT                   DLRIFPKTPSQLQNTYYKLKKELIQVEDIPKNKPGRKRKTQQNSKKEKTNIFGKVVPSE
FT                   YKQPTSIKEQINYDKSREKNLVDLLSGVKSNVQLLSEHQGEENNVYDLLKSIYSLSSLA
FT                   VQKEELDRKYQDLQTKYQELEQENIYLKQQNETMNESFHALVLQVADFAYANDLDQIQA
FT                   LPLFSQQLVVTLNQLGIFKENYKQM"
FT   gene            619904..620215
FT                   /locus_tag="lse_0586"
FT   CDS_pept        619904..620215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0586"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0586"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26737"
FT                   /protein_id="CBH26737.1"
FT                   /translation="MEYFLSLLKIIVLLAVLAGISYFLVKKNKQAARTRKSENDLIKLE
FT                   DTLLISHQLRAVLLEVDGEKVLAIISNNDIRTVSLKGNNQDESLFRELLLKEETKENA"
FT   gene            620208..620975
FT                   /gene="fliP"
FT                   /locus_tag="lse_0587"
FT   CDS_pept        620208..620975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /locus_tag="lse_0587"
FT                   /product="flagellar biosynthesis protein FliP"
FT                   /function="Flagellar biosynthesis pathway component FliP"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0587"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26738"
FT                   /protein_id="CBH26738.1"
FT                   /translation="MRKIASKRVFQVSFVVIFVFSLIFFWPGTSVHAESWLDSLGVNGT
FT                   DGVNSSVALFVLVTILSLSASIVLMFTHFTYCIIVLGLTRQGLGATNLPPNQVLVGLAL
FT                   FLSLFMMQPLITAWYDDVYKPSQTEEWSASKVWDETKPLLTKYVAENTYKHDINMMLKA
FT                   EGEKPVTKKEDAPLMALMPAFILTQITQGFLTGMFIYLAFIFIDLIVSTLLMYLGMMMV
FT                   PPMTISLPFKILVFIFIGGYGLITNMIFQTIHF"
FT   gene            620988..621260
FT                   /gene="fliQ"
FT                   /locus_tag="lse_0588"
FT   CDS_pept        620988..621260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /locus_tag="lse_0588"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /function="Flagellar biosynthesis pathway component FliQ"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0588"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26739"
FT                   /protein_id="CBH26739.1"
FT                   /translation="MNLTPITQIFQDFFYSGLALILPVSLICIVVVIVVAILMAMMQIQ
FT                   DQSLTFLPKIIAFVVALFILGPWMFEHMTDLFVGIFSKLPLMIRV"
FT   gene            621263..622024
FT                   /gene="fliR"
FT                   /locus_tag="lse_0589"
FT   CDS_pept        621263..622024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliR"
FT                   /locus_tag="lse_0589"
FT                   /product="flagellar biosynthetic protein FliR"
FT                   /function="Flagellar biosynthesis pathway component FliR"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0589"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26740"
FT                   /protein_id="CBH26740.1"
FT                   /translation="MEFEFFLAVVIVFCRIASFLFFFPLLKGRHIPNSVKVIFGMAISI
FT                   PVATVVDVSGITTLPDLLLRVTSEVVFGLALAKLVEIIAVIPKMAGFMIDYDLGFSQVN
FT                   LIDPSYGTQNSITAAILDTFFVVIFLSLQGLDYLIFYLMKSFEFTASVSILFEKGFIDL
FT                   FLGTLGFALASAVSIALPIMGSIFIVNIILAFISKSAPQINIFMNAFIIKITFGIFILA
FT                   CAVPILSTVFKNLTDEMIQQYVSFFDYLLKK"
FT   gene            622039..623085
FT                   /gene="flhB"
FT                   /locus_tag="lse_0590"
FT   CDS_pept        622039..623085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="lse_0590"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /function="Flagellar biosynthesis pathway component FlhB"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0590"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26741"
FT                   /protein_id="CBH26741.1"
FT                   /translation="MAKDNKTEKATPRRIKKARNEGNVAKSKELNNAFSLLIVAGLLYF
FT                   FGGMFIKNTIQAFVALLKQPPNLASIESYSLFYIMEFGKVLLPVMIMVVIFGLMNYGVQ
FT                   VGILFSAKAVKPQFKRLNPANYFKRVFSVKGLVEVVKALLLITLLSYVAYIGFRDHLQT
FT                   LISYTGQNWLYSLKQIFSLFKNEFLALFLVIAVIGLLDFFYQRYDYKKGLRMSKQEIKD
FT                   EMKDSEGRPEVKQRQRSIARGLLQGSITKKMADATFVVNNPTHISVVMRYDKAKDHAPK
FT                   LLAKGEDELALFIRQVAETDGVPMITNRQLARSIYYTTNPDEYIQEDLYKDVIEVMKEL
FT                   MDADKIQF"
FT   gene            623132..625207
FT                   /gene="flhA"
FT                   /locus_tag="lse_0591"
FT   CDS_pept        623132..625207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhA"
FT                   /locus_tag="lse_0591"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /function="Flagellar biosynthesis pathway component FlhA"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0591"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26742"
FT                   /protein_id="CBH26742.1"
FT                   /translation="MGSLGAIKKYFAILIAVSFVIALIVPLPPFVLDLVLVTILAFSVL
FT                   VYMRATSIKDWNELKSFPSLLLLMGIFRVSINISTTRAILTTGDPGQVIKQFGNFVIGS
FT                   NFVVGIVIFIILIVFQFIVANGSSRTAEVAARFTLDALPGKQMAIDADLNQRLITEPEA
FT                   KEKRAYLNMETEFYGAMDGAGKFVKGDVLFTVLLAVVNIVFGLIVGMVQGGLSFGEAAV
FT                   KYTELTIGDGIVSQIGSLLMAMSAGVIVTRVFDGSDDNVAVGIFKELMQNSVVVYTLAG
FT                   MFILMGVFSPLPAIPFVGIGVVLGIIGYRTQFNIKKKEQLEIAKEMELIQSENNSAEAE
FT                   HNQAFGAAREKFPVVVELGLNIAALVKQKMNGETAKDKVVLMRKSILQDLGIGVPGINF
FT                   KDNTSFQPRGKYEIKVKGVAVASGVLKAGHLLALKTPGVMIDLDAEPTKDPIFGEDGYW
FT                   ILPGELEDAQMKNYQVLEPLSILITHLDVVLRKNLHELLMRQQIKDLIDSLADENQILI
FT                   DEIKKKEIDYSLIQGVLRQLLKEGISVRDLPTIVEGIIDGQTIYPNDLDGITAFVRERI
FT                   SKVICEQAKNQDGKIYALLLQDSIEMDTEIVNTPYYGYALNWALDKELPIIQKVRDTVN
FT                   KAQLTGREPVILTRRKDFRFGFVRVLERYQLDVPVLSISELSPETEVEQIALIEPT"
FT   gene            625229..626452
FT                   /gene="flhF"
FT                   /locus_tag="lse_0592"
FT   CDS_pept        625229..626452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhF"
FT                   /locus_tag="lse_0592"
FT                   /product="flagellar biosynthesis protein FlhF, putative"
FT                   /function="Flagellar GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0592"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26743"
FT                   /protein_id="CBH26743.1"
FT                   /translation="MGKHLVEKMEIFKANSKREIHKKIRLVTNEPYRITDERVTKTGIF
FT                   KKQYEVTAVIMSEVAIADGRMDFQETFAKSVVKNRPKTDDLLKKEKLLEMLASGAELAT
FT                   STPLLEERKTQEEELSAMRQELAALNRELAVKMREEREQNSDFVKFLKSRGISDTYVAD
FT                   FMQAGRKQFKQVESAHLDDITDWFVPYLSGKLALEDMFDLSNHRIISLIGQTGVGKTTT
FT                   LVKLGWQLLKQNRTVGFITTDTFRSGAVEQFQGYADKLDVELIVATSPAELEEAVQYMT
FT                   YVSGVDHILIDTVGRNYLAEESVNEIAAYTNVVHPDLTCFTFSSGMKSADVMSILPKLA
FT                   EIPIDGFIITKMDETTRIGDLYTVMQETNLPVLYMTDGQNITENIFRPKSRWLAERFVG
FT                   ADRRQVLE"
FT   gene            626449..627228
FT                   /locus_tag="lse_0593"
FT   CDS_pept        626449..627228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0593"
FT                   /product="flagellar basal-body rod protein, putative"
FT                   /function="Flagella basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0593"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26744"
FT                   /protein_id="CBH26744.1"
FT                   /translation="MKGLYIGAAGMMNYMQHIQVHSNNVANAQTPGFKFDQLTSEVISK
FT                   NKVNYQNNPVAKQVGTIDYGVRPAATHINLTAGSSYITNRDRDFFMQDANPEQGSNFFI
FT                   TAKNGEISLSRGGQFHSDQFGFLRTADGANLLSATGEAVQVGVKTSIRAEANGALYNAE
FT                   TNAYLGRLGTRFVSADQVDNLAKDGEGRLHVNGTNTMNLPAGQGIIQNGVLETSNVDLG
FT                   VEMVQLMDNQRMVQASKNIVNMFDKVYDKESSGLIRQ"
FT   gene            627256..628044
FT                   /gene="cheR"
FT                   /locus_tag="lse_0594"
FT   CDS_pept        627256..628044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheR"
FT                   /locus_tag="lse_0594"
FT                   /product="chemotaxis protein methyltransferase CheR"
FT                   /function="Methylase of chemotaxis methyl-accepting
FT                   proteins"
FT                   /EC_number="2.1.1.80"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0594"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26745"
FT                   /protein_id="CBH26745.1"
FT                   /translation="MIPDLEKDYLYFTRVVKRDLGLDLTLYKETQMKRRILSFIVKKKY
FT                   VTFGEFFKHLKKDTLLLDEFISLITINVSSFFRNRNRWDALEKSVIPQLLENSRGKLRV
FT                   WSAACSSGEEPYSLAMMLERSVGARNYDILATDLEPAILKRAVIGEYQSRQMEELNEQE
FT                   RQNAFIQNDDTYQISPKYRRSIRFRRHDLLTDYYEKGFDLIVCRNVLIYFTAEGKHQAY
FT                   QKFADSLRRGGVLFIGGSEQILNPAEYGLATLNNFFYIKT"
FT   gene            628068..628403
FT                   /locus_tag="lse_0595"
FT   CDS_pept        628068..628403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0595"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0595"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26746"
FT                   /protein_id="CBH26746.1"
FT                   /translation="MGRMENIKNLAFFEDKPGLAEQILALEKQEQIFLPNEFEIRQTVA
FT                   YQIGEKEVILGRLESFYFLALKGVEESVYRSQAFASEADAKAFFVHLPEMENELVAFWL
FT                   NEVELVR"
FT   gene            628430..629281
FT                   /gene="motA"
FT                   /locus_tag="lse_0596"
FT   CDS_pept        628430..629281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="lse_0596"
FT                   /product="chemotaxis protein MotA"
FT                   /function="Flagellar motor component"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0596"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26747"
FT                   /protein_id="CBH26747.1"
FT                   /translation="MEITTIVGLVLAVIVIAGSFMIQNISLAMLFSAEALIVIILGTIT
FT                   AVMMAHPWSDVKVVPKLFKILFTKERGPDKVDVLIQYKEYADEIRRSGVLALEDSVDEI
FT                   EDPFMKRGMRLVVDGQSSPEFLRDVLEEEVSSMEERHAAYAKIFASAGAYAPTLGVLGA
FT                   AMGLIHAMGEMSNPDKLSEAIAAAFICTIFGIFTGYVLWTPFANKLKVKSQKEVHLRYM
FT                   MIEGVVALQERNAPRVVEERLLSFLSPKEKDVLRNGKGKKTREVEEFERGQASQETAGG
FT                   TR"
FT   gene            629241..630068
FT                   /gene="motB"
FT                   /locus_tag="lse_0597"
FT   CDS_pept        629241..630068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="lse_0597"
FT                   /product="chemotaxis protein MotB"
FT                   /function="Flagellar motor protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0597"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26748"
FT                   /protein_id="CBH26748.1"
FT                   /translation="MAKRRKKPQEEHVDETWLIPYSDLLTLLLALFIVLFASSSVDAKK
FT                   FEQMGNAFKKIVEEGAAGNQAYVSKGEGPDDPNVNAVLKAMDEQDKKKQANEEEKAKKA
FT                   AAALLKKQNEEKIEAFKKQIDSYIQAEKLGTKMTTKYSDEGLLITIRDDILFQSGSAEL
FT                   SAGKREIAKEIGDLFAQGKGTMEGIVSGHTDNVPISTSTYSSNWELSVARAVNFMEAII
FT                   QENNEVNPGEFSARGYGEFKPVAKNDVATNREKNRRVEIMVRPINPDKLDEDK"
FT   gene            630079..630579
FT                   /locus_tag="lse_0598"
FT   CDS_pept        630079..630579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0598"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0598"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26749"
FT                   /protein_id="CBH26749.1"
FT                   /translation="MQLFLSGSHTLTDYDKQEIESYLEKFVPVNHIHLLCYKSIENEVL
FT                   QFFLKKEQLAPRLSIYTFAPKECLPEPFLSAIDYLERLGSSYQSFGYFNTIIAKPTYEK
FT                   FLAQIISKMDLVCCFYNGDKPTDVIPVDVAKTCDVQSMIYDLPKTKKHLLHRTSSDKIK
FT                   LVN"
FT   gene            630602..632515
FT                   /locus_tag="lse_0599"
FT   CDS_pept        630602..632515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0599"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /function="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0599"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26750"
FT                   /protein_id="CBH26750.1"
FT                   /translation="MRPLISICMIVKNEAHILRQSLASFRKFTEEIIILDTGSTDETKK
FT                   IAKEFTDFVYDFEWTGNFSDARNFAATKATGKWIMAIDADECLEEESYLKLKKQLKLQT
FT                   ESIYMAQIISFTGEKGRVTTTNHMPRIYKNDGTICFRGVIHEQLEAVDKHSIEAGIADV
FT                   KIYHYGYMSEIVEKQGKSNRNLRLLEKEVKNNKDSGFVHFNIGQEMNRLGKKEEALKEF
FT                   SEAFRLRDDNQYIWAKLSAYHIADLLEQEKRYEESLAIIEEARIIWPNVPEFPLKKANI
FT                   LYLSHQLEDAKEIYQNLLETTTIDYQPIVLYEATNFIPHKMLGHIYLEEKDYTRAMTYF
FT                   SKAYAENSSDYGVMFQMIMLLSKFHEPKEIFAFMERHQFISSTETGLRLLSMTTQQGYA
FT                   ELSELIVQSLTDVYPPVAEATEVKIRTIRNVFPVISETAIIFGIKEELIDAADLCLWHY
FT                   ENPQLPIEQVMKNSDVGDIYNFIFENGPRISKKRYLFVLERAIALGKGEFADYLLALRT
FT                   GYHDSINSHIADLFFQYDFADIALDFYNIVDADEVTKQGYINLINYLVDAGVEEEALSI
FT                   AERGIDNFSTDFRFYLWAIKIDAENRADRISEAMDEFPNNRYLAKLLDEVTVFQDAMTN
FT                   NR"
FT   gene            632528..633436
FT                   /gene="cheV"
FT                   /locus_tag="lse_0600"
FT   CDS_pept        632528..633436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheV"
FT                   /locus_tag="lse_0600"
FT                   /product="chemotaxis protein CheV"
FT                   /function="Chemotaxis signal transduction protein"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0600"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26751"
FT                   /protein_id="CBH26751.1"
FT                   /translation="MTEEKGILLQSGTNELEIVTFTVGENLFCINVLKVKEIIHPLEVT
FT                   PVPDSNPAIEGVSQVRGEIMPVVNLARVMKLPEIEPENTKFIITELNQMKIVFRVDEVH
FT                   RIQRISWEQIEEPEKLSIGLEELAVGIVKLEGNLVLLLDYEKIIYEISGNADFAVTGED
FT                   RITRKVNREEKTIFIAEDSQMLRQLLEDTLHEAGYTNLQFFANGKEAQEHIFKLLKEQK
FT                   QQTFDNVNLLITDIEMPQMDGHHLTKVIKEDEIGRDLPVVIFSSLITEDLEHKGAGVGA
FT                   DAQVSKPNIHQLINILDELVL"
FT   gene            633672..634535
FT                   /gene="flaA"
FT                   /locus_tag="lse_0601"
FT   CDS_pept        633672..634535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaA"
FT                   /locus_tag="lse_0601"
FT                   /product="flagellin"
FT                   /function="Flagellin and related hook-associated proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0601"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26752"
FT                   /protein_id="CBH26752.1"
FT                   /translation="MKVNTNIISLKTQEYLRKNNEGMTQAQERLASGKRINSSLDDAAG
FT                   LAVVTRMNVKSTGLDAASKNSSMGIDLLQTADSALSSMSSILQRMRQLAVQSSNGSFSD
FT                   EDRKQYTAEFGSLIKELDHVADTTNYNNIKLLDQTATGAATQVSIQASDKANDLINIDL
FT                   FNAKGLSAGTITLGSGSTVAGYSALSVADADSSQEATEAIDELINNISNGRALLGAGMS
FT                   RLSYNVSNVNNQSIATKASASSIEDADMAAEMSEMTKYKILTQTSISMLSQANQTPQML
FT                   TQLINS"
FT   gene            634814..635173
FT                   /gene="cheY"
FT                   /locus_tag="lse_0602"
FT   CDS_pept        634814..635173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY"
FT                   /locus_tag="lse_0602"
FT                   /product="chemotaxis response regulator"
FT                   /function="FOG: CheY-like receiver"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0602"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26753"
FT                   /protein_id="CBH26753.1"
FT                   /translation="MLKLLIVDDAMFMRTMIKNIVKDSDFEVVAEAENGLEAVKKYDEV
FT                   KPDIVTLDITMPEMDGLEALAQIMAKDPSAKVIMCSAMGQQGMVVDAIKKGAKDFIVKP
FT                   FQADRVLEALEKAAR"
FT   gene            635193..637043
FT                   /gene="cheA"
FT                   /locus_tag="lse_0603"
FT   CDS_pept        635193..637043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheA"
FT                   /locus_tag="lse_0603"
FT                   /product="chemotaxis two-component sensor histidine kinase"
FT                   /function="Chemotaxis protein histidine kinase and related
FT                   kinases"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0603"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26754"
FT                   /protein_id="CBH26754.1"
FT                   /translation="MTTNMLDLFIEEASEHLQALNDNLLQLEKDPTNGGLVSEIFRSAH
FT                   TFKGMSATMGFQQVADLTHAMENVLDEVRNNRLVVTEHLVDIIFTCTSHLETMVSDIQH
FT                   GGQGAADITKTVADLEALLSPEQEESTEATYQISIKIEDAAILKAVRAVMCLERLAEIG
FT                   IISDTTPDREAIELEEFEQTFEVVLESSQTKEEIEAVLLDISEIEKVTVKEEVEETQIV
FT                   EPIKKTAKQTTKRLENKTIRVQLEKIEKLMNVFEESVIERARIDEIAEKTNNKELMEHL
FT                   GRFSSISKEIQNGLLNMRMVPVDSVFNRFPKMVRTLAKELGKKIDLVIEGADTEVDKIV
FT                   IDEIGDPLVHLIRNSVDHGAETVEVRRKNGKNETATINLKAFHSGNNVVIEIADDGAGI
FT                   NKRKVLEKAIAKNVVTRAESTKMTDTEIFDLLFDSGFSTADQVSDLSGRGVGLDVVRNT
FT                   ILKIGGKISVESSENAGSTFRIEIPLTLSIIQSMLVATAEYRYAVPLANVAEAITIDRA
FT                   DIQHVHGKDLINYRETIIEVLDLGECFHETPLKDTEELLLLVVKNAKRTFGLVIKDIIG
FT                   QREIVLKTLGSFFSESQIAFSGATILGDGRVVLILNLETF"
FT   gene            637056..637355
FT                   /locus_tag="lse_0604"
FT   CDS_pept        637056..637355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0604"
FT                   /product="flagellar motor switch domain protein"
FT                   /function="Flagellar motor switch/type III secretory
FT                   pathway protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0604"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26755"
FT                   /protein_id="CBH26755.1"
FT                   /translation="MEQIFQVELPEWEPNETTQEGREKGTIRQVENIGVNLIVRLGKRE
FT                   MPVGDIAELSIGDVLEVEKKPGHKVEIFLDEKKVGIGEAILMDENFGIVISEID"
FT   gene            637374..637784
FT                   /locus_tag="lse_0605"
FT   CDS_pept        637374..637784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0605"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0605"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26756"
FT                   /protein_id="CBH26756.1"
FT                   /translation="MKQEAYNAVKMKVDQEKTAILKELQLLLAKREQVASKLAHEQEVY
FT                   YSRTKKERLQVCVLAGSMQLDAFSPSRIKQMEREISQISQYIQSNEQILEQLEEKGKQA
FT                   KKMYDETRKKWQQLENKKEEQTLRDLKMVLLK"
FT   gene            637800..638834
FT                   /locus_tag="lse_0606"
FT   CDS_pept        637800..638834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0606"
FT                   /product="flagellar hook-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0606"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26757"
FT                   /protein_id="CBH26757.1"
FT                   /translation="MLIPDNLLQPLIGKKEIEPKELLAEELVDLPFISLLMEKNPAPLL
FT                   KGDSKNESEVQLPIKEIVTPLVSAKLLEKDEAPKLTAEPLELKEVKDTLIAIAKQAIKP
FT                   QVETFPQEAKEPVKNPTQQQPMTVPLIVPVQTPPTKETPKLAENVLNNQPILTKLPQEK
FT                   EAIQLFKATIKEPTTVKEEIVIKKPAETTNIWHESTKQAAPTAKLESPVTLKQLDKTIT
FT                   DQIEQLQKFQVKQNKAFFAIQPESLGKVEVLLKKMPDKIFVHIEYQEQSAKQKLEQMAQ
FT                   DLHNRFRDRGVEVAVTMTEKQAPKDSGQGSEGRQQGEAKKEKERENPHREQHKPKVFDL
FT                   EEET"
FT   gene            638836..639258
FT                   /gene="flgD"
FT                   /locus_tag="lse_0607"
FT   CDS_pept        638836..639258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /locus_tag="lse_0607"
FT                   /product="flagellar hook assembly protein FlgD"
FT                   /function="Flagellar hook capping protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0607"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26758"
FT                   /protein_id="CBH26758.1"
FT                   /translation="MDGISSLSGATQDTNNAVTSSVSKTLGKDDFMKLFLTSLQYQDPS
FT                   SPLDTNEMMSQMAQLSLMEQVANMTTAVDKLSEQAQNSALQSAVNFIGKDIKGVSLNGE
FT                   VISGQVESVQQTTNGVMLKLKEQDSLVPLTYVTEIN"
FT   gene            639277..640512
FT                   /gene="flgE"
FT                   /locus_tag="lse_0608"
FT   CDS_pept        639277..640512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgE"
FT                   /locus_tag="lse_0608"
FT                   /product="flagellar hook protein FlgE, putative"
FT                   /function="Flagellar hook protein FlgE"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0608"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26759"
FT                   /protein_id="CBH26759.1"
FT                   /translation="MNQTMYTAISGMNAFQQALSVTSNNIANANTTGYKKQSVVFNDLL
FT                   YQNTMGSVAGGLYAGTNPMSFGSGAKIGAILTDYTAGSPTSTGRNKDAALQGRGFFIAG
FT                   DNAGGNIVYTRDGSFAVSDNNYLTTQQGKYVMGYATDKNGNVLSGNLQPIQIPLNSAIP
FT                   GEATKTGSLSGNIPLDWGEKDTINSELSVYDNAGGKHKLQVNMKAGTPDANGNVSYDYE
FT                   IQMDGKELTPPVTGTLNYNAQGELTNAAALRNIQINTTVNGKQIDMDLNLSGLTNYGTN
FT                   QVFSPTSDGKGAATVKDYAITDSGYIAVSYSDGTVIPVAQLAVATFSNEDGLVKMGNGE
FT                   YVPGLSSGDAVYGVAGQNGAGGISGSSLEGSNVDLSREFVNLMTYQSGFQGNTKVIRVA
FT                   DDVMKQIVNLIQ"
FT   gene            640526..640762
FT                   /gene="fliN"
FT                   /locus_tag="lse_0609"
FT   CDS_pept        640526..640762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /locus_tag="lse_0609"
FT                   /product="flagellar motor switch protein fliN, putative"
FT                   /function="Flagellar motor switch/type III secretory
FT                   pathway protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0609"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26760"
FT                   /protein_id="CBH26760.1"
FT                   /translation="MKINHNIPLRIDFELGRTKQPIASLLDVKKGTVFRLEDSVANVVK
FT                   ITISGKCIGYGEILTKDGKMFVKITKLGEGSSS"
FT   gene            640784..641776
FT                   /gene="fliM"
FT                   /locus_tag="lse_0610"
FT   CDS_pept        640784..641776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /locus_tag="lse_0610"
FT                   /product="flagellar motor switch protein FliM"
FT                   /function="Flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0610"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26761"
FT                   /protein_id="CBH26761.1"
FT                   /translation="MSDKLSQEQIDALLSQMSEGKVVDESTEIGDFGRFHPYDFHKPEK
FT                   FGAEHLESLKTVASAFTKKSMEFVSQRIRIPIHTEATLADQVSFASGYIETMPNDSYIF
FT                   CIIDLGDPELGQIIIELDLAYVIYIHECLSGGNPKRKLSERRLLSVFEELTLKSILEKF
FT                   CEALKESFKSVHPIAPEIVSVETNPALIRVTSPNDMMALVNVDIKSEFWISTMRIGVPF
FT                   FSVEEIMNKLENVVEYTFDKRRNFDAEVEQELHQVEKEARIRVGEIKTTWKELNKLEVG
FT                   DVLLTETHIRDTLKGYVTEKWKFECYMGKSGNQKAVKFMRHTGRTEQER"
FT   gene            641779..643287
FT                   /locus_tag="lse_0611"
FT   CDS_pept        641779..643287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0611"
FT                   /product="flagellar motor switch domain protein"
FT                   /function="Chemotaxis protein CheC inhibitor of MCP
FT                   methylation"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0611"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26762"
FT                   /protein_id="CBH26762.1"
FT                   /translation="MEQLLDKNITQMELDVIGEIANISFGSASTVLSDLLHQQVTISTP
FT                   KVEIVDIYNTKDIDIPHVVLEVNFHKGIEMRNLFVLQSEVAAAIADLMMMGDGNIDPNE
FT                   ELSELHLSAVQEAMNQMMGHSATAMSNMFGEMIDITTPDIKVIALKEQLEDSEDQTMIK
FT                   VGFDLIIGDLITSNLMQLIPVNKGKELAKRLLGDTEPEKEEINLTAEELDVFLEVCNIG
FT                   IGSASTVLSKLLNRKVSLKIPTARVIDSKEFEFNERPCLVTSVEFVEGLRSSNTFIISK
FT                   NAALIMADLMMMGDGKVQEDAELTELEVSAVQELMNQMMGFSATAMSEMLGTKIDISPP
FT                   TMEFCNFGDTMIQKNIAEGKTVEVIFPLEVEGLLKTPMYQIFNPAAAKEMAQLMLAIQA
FT                   QEVANKADMQEIEPEMPLPIEEKETLSEMEAILEDIPVKLEVVFGTAKVKLETFISWCE
FT                   KDVIILKESMNEPLALMLNGVIIGKGILVRVDDHFGIQMTELVR"
FT   gene            643293..644702
FT                   /locus_tag="lse_0612"
FT   CDS_pept        643293..644702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0612"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0612"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26763"
FT                   /protein_id="CBH26763.1"
FT                   /translation="MRKLGVLIILFWMAFSYQADATEIIPPMISLENEQTEYTAGEEIH
FT                   FRLENAEDLKIVLINEQGQKRFLKEPVYTVTDSDLDGSYRAELYQKEKLEPVLVAEDLF
FT                   QVKQLDEITPDDTPPSFSAIDISHDTDILPTIVLHVSIEASDDESGVKAATLIIQGDSN
FT                   KAEVQLTQNIWTEKWEGELALTDFQLGEKITFAVRLMDFADNEITVDTLKELQLYQPKA
FT                   PTISYNGMDILAEQKKIVQVGDEIELTLDKYATEFPTFESESGKVIPLIWQKNPTGWQG
FT                   SLTLTQDLVGEIIQIPAFGPKLLIRTNSKPFHSIELIKNTILTGIINEDFATISQLYID
FT                   VNGSRYAVIRDGVRFTSEEITTTGNITLYWTDWDGQIYSEVLVQKIKPILPPIHKEIIT
FT                   SKPVIPKENHPIFTTPAPKPENPVKKLENTSNKQAKKENKSTNNSSSIPFWVPSLIIIG
FT                   IIIFSGNKAMK"
FT   gene            644726..645886
FT                   /locus_tag="lse_0613"
FT   CDS_pept        644726..645886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0613"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0613"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26764"
FT                   /protein_id="CBH26764.1"
FT                   /translation="MKIDGIQESAENRNQLDREIIKQNPLAKEVTKAQMTTEVATGKTP
FT                   PVSFSFQELSNLQLSGTATNLELYMKLMMNNAKKANDLIFYVMRAGIKNPTDSTKWQTV
FT                   RREISSQLSTILMKQHNFEAYFSENPANQKLFLANQKIMNEISFLLKMLPTLTFETTGK
FT                   YDFLRTMQIASGNMEKGIQMMREFQGHIEHATKLDPIVEAKQETNWMIKVLREFGNMFH
FT                   ARHLMPYELQAENINIWKFGSEYLKMMNQLLPQIGAFPNGNIQIFHQQATKPLTELFQE
FT                   LQRLADGQMTQGSIAVILDRMQGQLTRLSQLFQKMEVEAGFTEAERILGSVDAEFASDM
FT                   TKMMLLAQQEMSFLDLLVKDFRSVSKQPVFFMIVAIFIILLFFILF"
FT   gene            645993..646457
FT                   /locus_tag="lse_0614"
FT   CDS_pept        645993..646457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0614"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0614"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26765"
FT                   /protein_id="CBH26765.1"
FT                   /translation="MNNVSISQISQSKQTNLVRGMQELNQTQQLYFEQMKANGKKQSPS
FT                   LTEIKELITEVTDKKTLVEMDMTVDNVLSYKKAVQSFLNFYVNNVMDYDNVESRHPKYG
FT                   FSQKMTILKQVEKQTSELDDVMNLIDTKTGHLDMLNRIGEITGMILDVVL"
FT   gene            646467..646895
FT                   /locus_tag="lse_0615"
FT   CDS_pept        646467..646895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0615"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0615"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26766"
FT                   /protein_id="CBH26766.1"
FT                   /translation="MQEEIQKQLEKLIECNEKANQEAILLGKLIQAENWLEAEEHQLGL
FT                   QRELAILQKEYEALKVAIGENNTLQQWQRTLTPAENALINERKGLLLEKEAALRVSVQE
FT                   NQIKTEMQLAFSEHMVDVITGHHAETQAENNMMINETF"
FT   gene            646914..648437
FT                   /locus_tag="lse_0616"
FT   CDS_pept        646914..648437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0616"
FT                   /product="flagellar hook-associated protein 1-related
FT                   protein"
FT                   /function="Flagellar hook-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0616"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26767"
FT                   /protein_id="CBH26767.1"
FT                   /translation="MRLSDFNTSLSGMSAAQIANMVAQQNISNMNTPGYIRQAVDQQAL
FT                   YSDGGLLGGNKQTGYGVKVTDIKRLTNVALTTQYNNQIAKQSASLYESGALNQALNLFG
FT                   TPGKNTPSDNLDNFFTAWGALAKNPDQATNTTALLSSMTIFTDQLNQLHSGLKELETTI
FT                   TADTEAAVKDLNTLIKKLGSINKAIGNAGSNPPNDLLNQRDQILTTMSGYAGISVSAHP
FT                   NNPDVYDVTIGGRLVVQGDETTEITSTRTASGFEFFVSGQTLNMPEGSISASVRVNQNE
FT                   IKSYQAKIETFSNDLAKALDDIQVKNVNKTMDDLQKIGDELQANPNDEKLLSNREELLR
FT                   QLEKFPGVTRSGDTIDIGGTSHSIDSLGTSTYVNDVSDFSIPIFVQNAGKWMINPTITN
FT                   NAENKQFLGVIAADIASLKTDKNIEGTTFPNFMDGLITEVATDASKSSATSTADTQALS
FT                   SLSESKSSLEGVNIDEEMTNIMQYQSYYVANTKAMNTVNDMMKALLAML"
FT   gene            648449..649324
FT                   /gene="flgL"
FT                   /locus_tag="lse_0617"
FT   CDS_pept        648449..649324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgL"
FT                   /locus_tag="lse_0617"
FT                   /product="flagellar hook-associated protein FlgL, putative"
FT                   /function="Flagellin and related hook-associated proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0617"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26768"
FT                   /protein_id="CBH26768.1"
FT                   /translation="MRISTNQQANTIINQLNNVSGNLAKYQLQVSSGKKYESMSQNPGA
FT                   TAQILSYNHVLSQLNREKTDVTEAKSLLNTAETSLSSMTTSMNRVNALVLQAINGTSDK
FT                   NNMSQSAEEIKGLLGVLLSVANAEDDGRYVFSGSSTSVKPFTTDKTTGEIIYNGTTENK
FT                   NFRVTDTLEVEVFHDGSAMTDVFNNIQKIVDAMKTGDKDALSGLQEINSQNIEIITNSM
FT                   TNIGGQKNGVAAYDNVLSSKITDFSERKSNVEEVNMPEAVSNLNKTSIAYQAALQSSVM
FT                   VQKLSILNYM"
FT   gene            649336..650625
FT                   /gene="fliD"
FT                   /locus_tag="lse_0618"
FT   CDS_pept        649336..650625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliD"
FT                   /locus_tag="lse_0618"
FT                   /product="flagellar hook-associated protein 2"
FT                   /function="Flagellar capping protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0618"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26769"
FT                   /protein_id="CBH26769.1"
FT                   /translation="MGSSIASSLMDPTQYYSQFISLQKASLEKAKTPYQNQISSYQSRI
FT                   DLYASLKNALSDSLKTMSSFTTYESKTKLATSSNETSFTVSSTSSSVNGSYSIEVENLA
FT                   TADTYNKAVPDIEAKIGVSGTIKINGKEIKVDADSSMKNVMNTINSAGAKVNLYTLGEN
FT                   MVVTSATTGVENSIKFEGDSAVLEALGLVQNSPDHLAAEDAKLRINGATVTSATNKVTN
FT                   YIPGVTINLKKETTGTEKLTIQDQSDENAAKMITSFVNTYNALTSTMKTYTGKGTILQA
FT                   SLADLEANRALNNVFQHKKDGNTLFDFGISVDKEGVLKVDETAMKKIVAEDPTAVERFF
FT                   FGIGGLGDELYQSLNKTFGSTGFITDETTSMSNEINKLNLKLTDITSRNDTLLTNITDQ
FT                   YNKWLEMMQAMQSDAMTLDALIDGMNSSNK"
FT   gene            650645..651031
FT                   /gene="fliS"
FT                   /locus_tag="lse_0619"
FT   CDS_pept        650645..651031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliS"
FT                   /locus_tag="lse_0619"
FT                   /product="flagellar protein FliS"
FT                   /function="Flagellin-specific chaperone FliS"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0619"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26770"
FT                   /protein_id="CBH26770.1"
FT                   /translation="MQAWKRYTQNELNTSNPIKNTIYIYERCIIEFKKLEKALEALHFS
FT                   EADLILDKMEKIFEELKLQLNPEAGQELYDNIFGLYEWISEQIRQMQLLKQPVNIDTII
FT                   HVITQLKEGYEGVMKHESSKDTFG"
FT   gene            651003..651284
FT                   /locus_tag="lse_0620"
FT   CDS_pept        651003..651284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0620"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26771"
FT                   /protein_id="CBH26771.1"
FT                   /translation="MNQAKTHLAELKAMFHTTGQLTVSLQEYQTKLKELLKSAEILPND
FT                   QKKAFYQETKAVINKGILFTETQLERTENAFTENKSRQAANRNYAKFF"
FT   gene            651305..651706
FT                   /gene="flgB"
FT                   /locus_tag="lse_0621"
FT   CDS_pept        651305..651706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="lse_0621"
FT                   /product="flagellar basal-body rod protein FlgB"
FT                   /function="Flagellar basal body protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0621"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26772"
FT                   /protein_id="CBH26772.1"
FT                   /translation="MENYTTHIGNYLNYLQTANQVVSNNIANANTSNFKASETSFEESL
FT                   GSSLRPSGQNNETTTGSLTKTNSKHLTGTEIDQTNAKVTTKGGSINEDGNNVNVTSEMI
FT                   SLTKNNQMYALAISALNYNSSINTAARGK"
FT   gene            651718..652128
FT                   /gene="flgC"
FT                   /locus_tag="lse_0622"
FT   CDS_pept        651718..652128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="lse_0622"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /function="Flagellar basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0622"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26773"
FT                   /protein_id="CBH26773.1"
FT                   /translation="MFEGINTSGSALNAAKQWMEVSSNNIANADSSAAPGETPFLRKRV
FT                   VMSEISPFETALTGTKGVKVSEISSDTGSVKRVYDPTHPNANEAGYVNYANVDMTAEMT
FT                   NLMVGQKMYAANTSALQANEKMMEKDLEIGKV"
FT   gene            652145..652441
FT                   /locus_tag="lse_0623"
FT   CDS_pept        652145..652441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0623"
FT                   /product="flagellar hook-basal body complex protein FliE,
FT                   putative"
FT                   /function="Flagellar hook-basal body protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0623"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26774"
FT                   /protein_id="CBH26774.1"
FT                   /translation="MAMESINTASVMPKVTLAETAKTDNAAGAGNTFTQMLDSMSDVQS
FT                   NAQNSVSNLLTTGEGNASDVLIQMKKAESEMKTAAVIRDNVIESYKQLLNMQV"
FT   gene            652509..654152
FT                   /gene="fliF"
FT                   /locus_tag="lse_0624"
FT   CDS_pept        652509..654152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="lse_0624"
FT                   /product="flagellar M-ring protein"
FT                   /function="Flagellar biosynthesis/type III secretory
FT                   pathway lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0624"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26775"
FT                   /protein_id="CBH26775.1"
FT                   /translation="MAKIKTMYSKLKNWHKGAIFVGLFVVVTVFLLYLNTPKTEITLYK
FT                   NLSETSQQQVTDQLAKMGVDYTVDKSGNILVDEKVETLVRDKFADLGIPYTGQDGNDIL
FT                   LNSSLGASEEDKKMQEKVGTKVNLEKEIVQSYGTTVDSASVQLTLPESSSIFEEASQKG
FT                   SAAVTLKTKNNQTLTSEQVLGIQRTVSAAVPNVASEDVAIIDTKNGVISEADTTKEEGS
FT                   SAYKNEVDIQNAIGKNVKTDIEGTLSSIFALDNFRVNTSVTVNFDEIKQNTERYPNDGK
FT                   VRSNQKDTSTDTSKGSTNTTESGTAANADVPNYTEENGGDTNTYTSEKSSETTNYELDS
FT                   TIQEIKKHPALAKTNVVVWVDQQALNNNGVDMAEFTKAVGVSAGLTPNMATPEGAEEGA
FT                   TPTFEGTFQNGDVTIMPIQFLDNQAPVEKDTGKTPEPASKAWIWWLAGGLLFAIIAAGI
FT                   IGYIIFLKRKEQLEEALEPEEVDYIPAEEAIVVPEDHPDFNFQTDAFHLSEPELKARKE
FT                   SLKNKLGEMAKEDPGRAAAVIQKWLNERQE"
FT   gene            654156..655268
FT                   /gene="fliG"
FT                   /locus_tag="lse_0625"
FT   CDS_pept        654156..655268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /locus_tag="lse_0625"
FT                   /product="flagellar motor switch protein FliG"
FT                   /function="Flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0625"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26776"
FT                   /protein_id="CBH26776.1"
FT                   /translation="MAETLKETLEDTMSEQETVTEEETTTDETTTLASESGISRREKAA
FT                   LIIWSLEEEIATEVVDLLPDASKQRLAREMAKMKEMDGGAVEEATKEFLGELELLSGGI
FT                   AKLDREHLQRLFPDMTTEELNQLIYGVEAESRIGETALDILREIDDVDSLFTIISDESP
FT                   QTIAMIASYMKPEEASKLLALLPEEKMINTVIGIASLEQFDSEVMQNVSNLLRIKLDTM
FT                   TNSSLNKTDGIKNVANILNNVTRGLERTIFEYLDVQQAELSERIKEKMFMFEDIILLDN
FT                   MTLQQVLAEIQDNNKIARALKNEKEELKEKILSCVSKNRRDMITEELEVLGPIRLSDVE
FT                   QAQQDIANVVKNLEKDGKIVIQRGEQDVLI"
FT   gene            655255..655947
FT                   /locus_tag="lse_0626"
FT   CDS_pept        655255..655947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0626"
FT                   /product="flagellar assembly protein FliH, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0626"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26777"
FT                   /protein_id="CBH26777.1"
FT                   /translation="MSLSNPRIPKTDVTLSDVKMELIYLDDIAETAEAESPYAKELEQL
FT                   ENHQKELEKHKSTIEIEQQKIANEKALLAAERAEIAELKKQAAAEIEQQKIAFEQEKEQ
FT                   IYLTITDFLWDESIDLAERIVHQAIDTRQIEVLPMLTEVIQKLPVAFDKLNVTTHPETL
FT                   QALKEENTGTKYDWLLENIHWNFDMRLDYGEFTVEEEKEYFDYRITEIFQTLHKQNDER
FT                   KILGGDNS"
FT   gene            655944..657245
FT                   /gene="fliI"
FT                   /locus_tag="lse_0627"
FT   CDS_pept        655944..657245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="lse_0627"
FT                   /product="flagellum-specific ATP synthase FliI"
FT                   /function="Flagellar biosynthesis/type III secretory
FT                   pathway ATPase"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0627"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26778"
FT                   /protein_id="CBH26778.1"
FT                   /translation="MNWSPKNQAWQELKNTVPYIQKGKIHTVQEQMYISKGPQVKIGDT
FT                   VMVGENKVLCEVISIEKENNMLLPFNQSDKVAYGDWVYVTDTKITIPADEFLLGKVLNA
FT                   SGEILNEEAGTAKFKQKMPLEAPPIHAFNRAEITETLETGIKAIDGMLTIGIGQKIGIF
FT                   AGSGVGKSTLLGMIARNAKADINIIGLVGERGREVKDFLRKDLGEEGLRKSVIVAATSD
FT                   ESHLMQLRAAKLATSIAEHFRDQGKTVLLMMDSVTRFADARRSVDIAVKELPIGGKTLL
FT                   MESYMKKLLERSGKTKLGSITGIYTVLVDGDDMNGPVPDLARGILDGHIVLTRELATKN
FT                   HYPAIDVLGSVSRVMEEIVPENQWENASKIREWMSIYQENELYFKLGTIEQTNDNASIF
FT                   TSKEKSYFIHQFLKQLRDENVSLEETNQLMETLV"
FT   gene            657261..657935
FT                   /locus_tag="lse_0628"
FT   CDS_pept        657261..657935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0628"
FT                   /product="transglycosylase, SLT family"
FT                   /function="Soluble lytic murein transglycosylase and
FT                   related regulatory proteins (some contain LysM/invasin
FT                   domains)"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0628"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26779"
FT                   /protein_id="CBH26779.1"
FT                   /translation="MNPVEHVISTRQAEFERAFEAAKQSSTTFETKLNERLNATTEQKT
FT                   TSIQTVTDAELNRAREVYEALINQADNTSTTIPNTTAETTATETKPTTESTNWNNYQIK
FT                   PISAENEGKYSELIKTAAAKYDVPEALIKRVIQVESNFNPSVVSSAGATGLMQLMYGSN
FT                   RTDPATNIDLGTKQLAGYIKKYDGDLKLALAAYNAGPGNVSKYGGVPPFKETQNYLTKI
FT                   IE"
FT   gene            657949..658593
FT                   /locus_tag="lse_0629"
FT   CDS_pept        657949..658593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0629"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0629"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26780"
FT                   /protein_id="CBH26780.1"
FT                   /translation="MGNWQQKWESWRDMTTAMQLEIKIEAAEKVTSYIKNAQFEEAINV
FT                   IRQTEALLNELDFETKMSRVEEQLQAFTSDQEAAKSFEASQLQNLEKPSVNVTFDLSDV
FT                   KAEAMNQFTKRDFKLVDSSETHMQFLRGNRNFYLDIFNPEKDAETHYNNLDEKCQYKNI
FT                   GFICQNEATTQTATELTNAWLETLDAPKKKFLTINIANLEAMKQNQEVLFQ"
FT   gene            658952..661297
FT                   /locus_tag="lse_0630"
FT   CDS_pept        658952..661297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0630"
FT                   /product="cation transport ATPase, E1-E2 family"
FT                   /function="Cation transport ATPase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0630"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26781"
FT                   /protein_id="CBH26781.1"
FT                   /translation="METNTHIPQGLSSEEVAERVRNGQVNHALKPLTRSITGIIRDNTF
FT                   TLFNIINVVIASFIIFVGSYKNLLFLGVALCNTAMGIFQEIRAKRNIDKLTILTQAKVK
FT                   VMRNGQVCELEQGEIVLGDIIVLNREDQICADGVIYQTDGLEVDESQLTGESEPVIKNT
FT                   TDSVMSGSFIVSGQAYVEVSAVGEQSFVSKISMEVKQEKRPDSELIRSIKKIIKVLTFI
FT                   IIPLGLALFFSKYLQGLPLRESVLGTSAAMIGMIPEGLVLLTSIALAVGVINLAKQKVL
FT                   VKSMPCIETLARVDVLCLDKTGTITDGKLDVTDIILKNPKVTATQISASVGAIVGSLAD
FT                   NNATSIALRKHFVENPEWQTTARFPFSSARKWSGCSFAEKGTFLIGAPEFIFKDLSVAN
FT                   KQELDGYANQGFRVLAVAHADEQIESPVLPEKSELLAYILIADNIREEAPSTFAFFANE
FT                   GVSIKVISGDNPVTVSNVAVRAGIANGDKYIDMNTVGEDADMVSLIETYTVFGRVTPHQ
FT                   KRALIKAYQKQGHTVAMTGDGVNDVLALKEADCSIAMAEGSDAARSVSDFVLLSNNFDS
FT                   MIDVLREGRRVVNNIERVAALYLIKTMYSTVLALTFIFVPGAYPFQPIQLSPISSLTVG
FT                   IPSFFLALKPNYDRIKGQFLHKVLQTSVPAATCVIAYIMLILAFGNMLGLTFAETSTMN
FT                   VMLTGATCFVALISVGHPFGPKTKLLVGTMMAAFVCLFLFAGQFFSLVPIFDLEMMLIY
FT                   VPLLISCGPLYWFIRHIITRFSWAGAHD"
FT   gene            661436..661762
FT                   /locus_tag="lse_0631"
FT   CDS_pept        661436..661762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0631"
FT                   /product="transcriptional regulator, PadR family"
FT                   /function="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0631"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26782"
FT                   /protein_id="CBH26782.1"
FT                   /translation="MRGLTELLKGSLEGMILERISRGETYGYEITKYLNDLGFDEIVEG
FT                   TVYTILLRIEKKGLVEVEKKKSDLGPARKFYTLSESGKEELALFWKRWEFIQAKMIQVK
FT                   GGQV"
FT   gene            661762..662085
FT                   /locus_tag="lse_0632"
FT   CDS_pept        661762..662085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0632"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0632"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26783"
FT                   /protein_id="CBH26783.1"
FT                   /translation="MFKWYKKYREEKRDYKLYKKRIAALPEDYQTAMKAIETYLWSFAK
FT                   GAGMFYVLKNVLEMFENAAADNLELKAVVGDDLAEFADNLLLEYPEETWLDKERKKLRK
FT                   SMK"
FT   gene            662101..663009
FT                   /locus_tag="lse_0633"
FT   CDS_pept        662101..663009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0633"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /function="ABC-type sugar transport systems ATPase
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0633"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26784"
FT                   /protein_id="CBH26784.1"
FT                   /translation="MAIIDIQQVKKNFKKQEVLKQVTIQVETGKIYALLGANGAGKSTL
FT                   LKIITGLLSSDGGEVTIKNLSVQKNTKAVQRLFSYNAQQASVDEVLTGYENLLLIGKLR
FT                   HEKRPKEVALSLLEQFGILDSKDKPVSAYSGGMKRRLDLAMSLVGDAEILFLDEPTTGL
FT                   DPSSRFELWEVIQKLKNKGKTIFLTTQYLEEADKLADTIGFLKNGEIIATGTPKEMKRL
FT                   AGENSLMLTFAPTDIEKAKEVLRAFNPKQLSDVILSVELVEEIKTTLDILKELSLNQLE
FT                   PQDFETIRPTLDDVFIALTKG"
FT   gene            663016..663783
FT                   /locus_tag="lse_0634"
FT   CDS_pept        663016..663783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0634"
FT                   /product="ABC transporter, permease protein"
FT                   /function="ABC-type multidrug transport system permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0634"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26785"
FT                   /protein_id="CBH26785.1"
FT                   /translation="MMIKEYFEDIFALAGRIIKHNIRSLDTMITVVAMPIMLMLGMVYI
FT                   FGGSVKIEGLSQQDYIDYIVPGILLMTIATGSAYTALRINLDKTAGMFERFKSMPIAKS
FT                   AVIGGHVVASVIFMLISCLAVLIVAWLIGFRTDANFGEWSLIVLLLVLFAFMLTWLSVP
FT                   FGLMAGSVEGAGAFSYIILMLLFVSSAFVPVAGMAKVVRIFAENQPMTPIIQSLRDLFT
FT                   SAPLSNDIWLALGWMFAILIVSYIGGMFVYKKI"
FT   gene            complement(663823..667908)
FT                   /locus_tag="lse_0635"
FT   CDS_pept        complement(663823..667908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0635"
FT                   /product="internalin-like protein, cell wall surface anchor
FT                   (LPXTG motif) family protein"
FT                   /function="Leucine-rich repeat (LRR) protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0635"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26786"
FT                   /protein_id="CBH26786.1"
FT                   /translation="MKKFYSSVVIACLIFTAIIPIPANVQATANAMKKNAVNHSSEETS
FT                   DVSASQPISKETTETDRLNVERSDSNSGSTKAKEVAVEADDTYLDIFPDEAFAEVIALE
FT                   ITGSNDTSQTVTQAQLDSLTSLNAPSKNITDVTGIQQLTKLKSINLSKNNLTSIAPITN
FT                   LTALTTLDVSANLLEEISITSAQNIPNLTALSVLNNPTIKKLSIEDQAKLTSISISVDN
FT                   DQAAQLAELTLSNLPALTSAPYAGSVNFSNYSDYLSKVKLTGLPQISSVTLNDTQINDV
FT                   TIEDLAKLTKLNLSDNKLTDMAQMKLQDLPLLNDLDVADNQWNSFILDAENATEFPNLA
FT                   SLHLNGNPTMTNISLEDQPKLKTVSISVNTGQTAQLAELTLSNLPALTSAPYAGFVNFS
FT                   NYSDYLSKVKLTGLPQISSVTLNDTQINDVTIEDLAKLTKLNLSDNKLTDMAQMKLQNL
FT                   PLLNDLDVIDNQWNSFILDAENAVEFPNLASLHLNDNPTMTKISLEDQPKLKLLSIDVS
FT                   GGQTTQLEELTLSNLPALTNAPYAGSVNFSNYSDYLSKVKLTGLPQISSVTLNDTQIND
FT                   VTIEDLAKLTKLNLSDNKLTDMAQMKLQNLPLLNDLDVIDNQWNSFILDAENAAEFPNL
FT                   ASLHLNDNPTMTKISLEDQPKLKLLSIDVSGGQTTQLEELTLSNLPALTNAPYAGSVNF
FT                   SNYSDYLSKAKITGLPQISNVNLSNNQLTNVLVENMDNLKTLTLYNNKLTELDQLSDLP
FT                   VLNSLDVSNNSIGVLPTSLETEAPVLQSLTGTNQTISLPNKIVSDRLSVENKISNDGVI
FT                   SPPTAISNSGVYENGNVIWEYNNIKDLTSVSYNFSEPVNYPAVSGTFSGKVTQPFKISL
FT                   PPVITADESITYPKFSTITEAAFLIDVHATTNDGSPVTSDFLTAVDFSTAGNYTVTLNS
FT                   VNEDGVTADPVTVIVHVEKAPAPIITADSEISYMKNSTVSSSEFLSDIHATTNDGSPVT
FT                   SDFLTAVDFSTAGNYTVTLNSVNEDGVTADPVTVIVHVEKAPAPIITADSEISYMKNST
FT                   VSSSKFLSDIHATTNDGSPVTSDFFTVVDLSTPGDYTVTLQAINEDGVPAVPVSVTVHV
FT                   EQTPAPIITADTSITYPLFSEVTEAEFLSAIHAKTSDGSPITSDFTTVVDFSTAGDYTV
FT                   TLNSINADGITADPVTVIVHVKKATAKPIITADKEITYPINSVISQEKFYADIHATTND
FT                   GSSITSDFLTVVDFNTPGDYTVTLQAINKDGLAANPVKVIVHITPSKPTPPVPPDNNGN
FT                   SSNSSNSSNSNNGNGSGNSNINNSDNTDNKKSAQQTNIILPRTGDTNNHLIFIGFNLLL
FT                   LAFCVLSSTRKRKKIRRQ"
FT   gene            complement(668276..668923)
FT                   /locus_tag="lse_0636"
FT   CDS_pept        complement(668276..668923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0636"
FT                   /product="fibronectin-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0636"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26787"
FT                   /protein_id="CBH26787.1"
FT                   /translation="MKEFIEPYQYNFIKNQLNNISRAYRSANDTSTLKALKSLTEEKIN
FT                   QIFSQAELEAHQDLFIQMHAITTTKEAEPFLEELKAFVIPFVSPSDAKLKKVFAKTKKL
FT                   KIPAWSKLNLRDYTFYGWNDIAQQRKYIITYDDGNLVGVEGTISADIQKGVCSICHSHS
FT                   KVSLFMAKTKSSGDGIYTTNGNYICYDSDVCNEQIKARETLDEFIAVVRKRK"
FT   gene            669194..670924
FT                   /locus_tag="lse_0637"
FT   CDS_pept        669194..670924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0637"
FT                   /product="pyruvate oxidase"
FT                   /function="Thiamine pyrophosphate-requiring enzymes
FT                   [acetolactate synthase pyruvate dehydrogenase (cytochrome)
FT                   glyoxylate carboligase phosphonopyruvate decarboxylase]"
FT                   /EC_number="1.2.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0637"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26788"
FT                   /protein_id="CBH26788.1"
FT                   /translation="MSKVKASETLVQTLKNWGIDHVYGLPGDSIDTVVDALRKDQEEIE
FT                   FIHVRHEEVATLAAAAYSKLTGKIGVALSIGGPGAIHMLNGMYDAKMDHVPMLVLAGQV
FT                   TTDMLNTGFFQEVNLPAIFEDVAVYNKQIDNPETLAEIVDEAIRTAYKEKGVAVLTIPN
FT                   DIPAQEIKASLESRPVKFEQENPKLPETNIQEAVKLIDKAKKPVILAGLGTKHAGGELL
FT                   AFAEKAKIPIIHSLPAKTIIPDDHPNALGNLGKIGTKPAYEAMQETDLLLMFGNDYPYT
FT                   NYLPKKADCIQIDIDPAKISKRYPATVGLVGDAAEILTSLTTKITPVEERKFLQACQEN
FT                   MQEWWKWLEEDTSKTTDPIAPEVVMANIQKIAEKDAIFSIDVGTATVWSTRYLHLTPQN
FT                   DFLVSAWLGTMGCGLPGAIAAKKAFPDRQAIAIVGDGGFSMVMQDFVTAVGQKMPMIVV
FT                   VLNNQELSFIKYEQQSAGELNYAIDLPDINYAKFAESCGGIGFRVEKMADLENAFESAK
FT                   LATKPVIIDVSVDSSAAPLPGKIIMDEALGYTKFEIGSIIEDHRFAKMPPLKTILRRFL
FT                   "
FT   gene            671086..672885
FT                   /locus_tag="lse_0638"
FT   CDS_pept        671086..672885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0638"
FT                   /product="methyl-accepting chemotaxis protein, putative"
FT                   /function="Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0638"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26789"
FT                   /protein_id="CBH26789.1"
FT                   /translation="MNLIKNRKLKTKLSINIVITTIMLIGLGATSFLGFRHVADLSDNM
FT                   VDNNVAPMREIATIQTNMAQINIDILTMFDTINGKATLIKDIDSLYAANDEALHAFKKA
FT                   NLTAEDKKQLAYFEEKLADMKSAASSVISDTSSALDDAELLGAQNRYYQNVKTKFDDAT
FT                   KQLNVLNDMNYEEVEKSSQAISDFGVKISLIFTAVIVAMLISLFIFNAYITKVILKGIR
FT                   HLQTAVHKVSSGDLSYRSTYNGRDELGDITNDLNEMSENLRLMIEDVKKASTDVKSSSD
FT                   NVIISSEIISAMTTEMDIEMKMMGEQIQTQIGSMKESTEAMDQMTGGVQNVAEYALKVS
FT                   DLTKDSAEKTNDGIAVINNLVSQMDRISGVMRSSTDVVSQLVNRVGEVEKALDTVTNIA
FT                   DQTNLLALNAAIESARAGEHGRGFAVVAEEVRKLAEQSRLAVVDINTVLKKIQTESKTT
FT                   IEVMNNGLSESEAGQKIISETEETFSDLLNRVNDISLQMQNVSQETEEMAAGIEEVNTS
FT                   ISDVTEISNQIGEKSTAALEFAEVNKMKVDELVVISEEMQKISGSLEGYVANFNTEVSE
FT                   EEIEVAKETEPKDSGEPVLAENV"
FT   gene            672898..673629
FT                   /locus_tag="lse_0639"
FT   CDS_pept        672898..673629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0639"
FT                   /product="putative secreted protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0639"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26790"
FT                   /protein_id="CBH26790.1"
FT                   /translation="MRIWIKSLLVITACIFSFTLLNTKYNFYSPSVKLESAKVVYKIDQ
FT                   APFDVRLDVPLLNQMDAPALFNGCEVTSLAMLLQFSGKNVTKNQLAHELPTTPIEQNSQ
FT                   YGNPDKAFVGSISGANSPGLGVNHAPIAKLATKYIDKAHVHDITGSELKDIITVLSTGA
FT                   PVWIITTTDYQAPKNWQTVTTKEGKKKITYSMHSVVITGYDKENFYINDPYGHKNRAVK
FT                   KSILEEGWTAMGKQAIYLSHP"
FT   gene            complement(673986..674198)
FT                   /locus_tag="lse_0640"
FT   CDS_pept        complement(673986..674198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0640"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26791"
FT                   /protein_id="CBH26791.1"
FT                   /translation="MVFSKKMISSIIVIISLGYAYFQFEAVRAVQNTASATLLPTTGDK
FT                   ISIWPIVVGVFLVLVAIVLFLKKKI"
FT   gene            674646..676451
FT                   /gene="glmS"
FT                   /locus_tag="lse_0641"
FT   CDS_pept        674646..676451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="lse_0641"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase (isomerizing)"
FT                   /function="Glucosamine 6-phosphate synthetase contains
FT                   amidotransferase and phosphosugar isomerase domains"
FT                   /EC_number="2.6.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0641"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26792"
FT                   /protein_id="CBH26792.1"
FT                   /translation="MCGIVGYIGENNAKNILLEGLEKLEYRGYDSAGIALQNNEVVTVV
FT                   KEKGRIADLASLVPTDAFGTTGIGHTRWATHGKPNHENAHPHQSKTARFTIVHNGVIEN
FT                   YTLLKEEYLKDHTFISDTDTEVIVQLIELFAENLSTKEAFKKALSLLHGSYAICLIDQA
FT                   DSETLYAAKNKSPLLIGKGNGFNVIASDAMAVLKQTDQFVEIMDKELVILTKDAFRLET
FT                   LEGEEVVRESYTAELDASDIEKGTYPHYMLKEIDEQPAVTRKIIQAYQNEAGEINVNQT
FT                   IIDEILASDRIHIIACGTSYHAGLVGKNLIEKMAEIPVEVHVSSEFGYNLPLMSKKPLF
FT                   IFITQSGETADSRQCLVKVKELGYRTLTLTNVPGSTLDREADHSMYLYAGPEIAVASTK
FT                   AYTAQISVLAVLAVSLGRAIGNEEAKKINLAAELGIVANAMEAMVSSKEVIEHIAGEFL
FT                   ATSRNAFFLGRNIDYFVAMEAALKLKEISYIQAEGFASGELKHGTIALIEDGTPVLALI
FT                   TQESINWNIRGNVNEVLARGANTCIFAMENVAQPGDRFLIPQVHPLLTPLASVIPCQLL
FT                   AYYAALHRDCDVDKPRNLAKSVTVE"
FT   gene            676564..677301
FT                   /locus_tag="lse_0642"
FT   CDS_pept        676564..677301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0642"
FT                   /product="riboflavin kinase/FMN adenylyltransferase,
FT                   putative"
FT                   /function="FAD synthase"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0642"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26793"
FT                   /protein_id="CBH26793.1"
FT                   /translation="MEVSHVTLEPNKDSRPAVLTIGKFDGVHIGHQKILNTALSLKKSD
FT                   EILTAISFSPHPLWALKQIEIYREMLTPRMEKERWLAHFGVDYLIETAFTPRYAETTPE
FT                   QFVTNHLSNLNLSHIVVGSEFNFGKGRDSDVELLRDLCAPYNIGVTSVPVIETNQTKIS
FT                   STNIRAFIRRGHFQEAEELLGHPWYISGMVENGEMIDLDDYVLPATGEYQTDTGLIKIT
FT                   NRRTIKVDLPNGLHQIHINNKLS"
FT   gene            677386..677865
FT                   /locus_tag="lse_0643"
FT   CDS_pept        677386..677865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0643"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0643"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26794"
FT                   /protein_id="CBH26794.1"
FT                   /translation="MKIPTTLKHKPVIVVENYEEVDGKNAYDSDAKGLSLGLAQWNDRG
FT                   KVDISAKVWRHTGDKWSRQSEELPLHRVLDLAILIARTKVHFKDAYRLPDFYDKENPTL
FT                   DRIGMQGDAMTISVCEENEYINEDIALFEQALKNDDELLSERLRTLSKLLQEAGY"
FT   gene            677880..678218
FT                   /locus_tag="lse_0644"
FT   CDS_pept        677880..678218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0644"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0644"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26795"
FT                   /protein_id="CBH26795.1"
FT                   /translation="MNKNNRKELIRAYKEKAPDAGVYRFISRESGKFLIDNTMDLKGIA
FT                   NKLAFGVKIGAGNMLPPEMAKEAKQYGIETIDFEILEKVDIKPEMTKEDIKEENDVLLS
FT                   LWLEREDI"
FT   gene            678359..678757
FT                   /locus_tag="lse_0645"
FT   CDS_pept        678359..678757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0645"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0645"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26796"
FT                   /protein_id="CBH26796.1"
FT                   /translation="MNPRKTEFVLTLIAGITGVIAGFTGIMGGGLMTAALSSSELTSEA
FT                   GIYGSDVDAIVSASGIMVVVASFALIIGVVLFVFAFLIKKNAKVFGILTLILGVVGFFL
FT                   VGLLWIVPGILAIIAGIMCLARKVPDFY"
FT   gene            678973..681372
FT                   /locus_tag="lse_0646"
FT   CDS_pept        678973..681372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0646"
FT                   /product="cell wall surface anchor (LPXTG motif) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0646"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26797"
FT                   /protein_id="CBH26797.1"
FT                   /translation="MWKKVGLVILSFSLCLPTVIASAEEPTKTQMIVNAENFPEGKTYA
FT                   EFFPDQNLAIRVAALNGKQTTDIVTKTDLDSITELDVTSAGISSISGLEYMENLTGIDF
FT                   TYCSVTDLTPLTNLTKLTYVDFDGNNNIVNLEPLAGLTNLETLNLGAFDGNSVVDISPL
FT                   ANLTNLKALDLEGNNIVDVSPLSGLTNLESLDIYNNEISDISALSSLTKLNSLFIGANT
FT                   ISDLTPLTSMQNLTILESRGNGLVNKDLEIINSLSSLKTLRMQDNDITDLSFFNTCSST
FT                   SLNMVDFGGNHISDIRPIMTYRNGHRNLSTYDVTSQVITLPTIETKENAITIENKIFDI
FT                   NGSLLAPKSIDNKGTYTAPNVTWGNLTANPSKVSYTFNNGGRFSGTVNQPINYLAPELT
FT                   FDSEITYTVNTLKDEATFLSDVSAETDDNAEIDSNFESKVRMNTVGDYSVSIWSSNTHT
FT                   DSQGTITVHVVAAPTLPTITADPEITYDEGTVKNEAEFLNDVSATTEEDATITSDFDQA
FT                   VNLDVPGDYEVTLTSTNAVGYVTTKVIVHVVAVPALPTITANPEVTYDEETVKTEAEFL
FT                   NDVSATTEEDATITSDFDQAVNLDVPGDYEVTLTSTNAVGYVTTKVIVHVVAVPALPTI
FT                   TADKEITYETGTEKSEAQFFSDVSAKTEEDAVITSDFDQVVNLDVPGDYEVTLTSTNAA
FT                   GLTSMKVIVHVVENTTPVDPKTPDDPKTPANPKKPVDPLEPVNPVDTKNPTYSINSEGS
FT                   KTTNKKATTQGSEKTLPKTGDSSSYWVLLGLLCVGIAGFTLNKKRI"
FT   gene            complement(681437..681610)
FT                   /locus_tag="lse_0647"
FT   CDS_pept        complement(681437..681610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0647"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0647"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26798"
FT                   /protein_id="CBH26798.1"
FT                   /translation="MKQQSGLFLLEVANATSELNQKIMDTLFTRPKTGSITALSDKGTF
FT                   KLIIKTPAIHDK"
FT   gene            682045..683886
FT                   /locus_tag="lse_0648"
FT   CDS_pept        682045..683886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0648"
FT                   /product="cell wall surface anchor (LPXTG motf) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0648"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26799"
FT                   /protein_id="CBH26799.1"
FT                   /translation="MKKSFIFLLILATCFSFHLNTSMAFDGENTISTNEKIDVVTEADL
FT                   GGQGWLINEVNRQLSPKKVGTDLTFEDLAKITRIILPNKNLTGEVPPEIKNLVSLQDLL
FT                   LYSNKLTGTIPAELGELKKLKTLRLDYNQLTGTVPEGLGNISFIQLQMNKLVGQLPLSL
FT                   YENRTGSNEVNVSGNQVTIDGTTNVPSVYSAYTFVYPYPYSEYSGKIKALHPYIYNLDN
FT                   SMNFTPFLKGSATFIDLQAANMFDSALFAGHHVTITDEGNLKVLYDGELTEDVSIPLSG
FT                   WNSGSHRLSVVLDKAFNNPQNKVEILLNLLAVQGEDVTVEYVNENGESIHASQLISGNV
FT                   GDEYDATIEEYKLAIDKYTLDESKLPANAVGTFSNEAKTVTYVYNKIDGAPITVKYLDE
FT                   NGTEIAEADTLTGKIDAPYETTPKEISGWVVDENKLPTNKTGDFTADSQNVTYTYKTNQ
FT                   TKITAHDSTIYVDDAWNAKDNFDTAYDKYGNEVPFDKVSAEGTVNTSKPGVYSVKYIYD
FT                   GAETVIKVTVKAKDVPVEPTNLIDPTNPVEPAHSPAVTPSQSSNSAVKLISVPSERGEW
FT                   KLPTTGDDRFDSILYIGAGIAVIFAAISLLRKRKIHL"
FT   gene            684036..684599
FT                   /gene="flaR"
FT                   /locus_tag="lse_0649"
FT   CDS_pept        684036..684599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaR"
FT                   /locus_tag="lse_0649"
FT                   /product="DNA topology modulation protein FlaR"
FT                   /function="Adenylate kinase and related kinases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0649"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26800"
FT                   /protein_id="CBH26800.1"
FT                   /translation="MNEWNNLQKVLKNKQRILVIGPNGAGKSTFAIMLGESLAINVFHL
FT                   DKIFWKRNWEHLSEQEFEQDLDGILNSEEPYIIDGDYFSSLKKRVDQADLVIWLKIPAF
FT                   ICIKNIVKRRFKYMFKKRPDMAEGCNEKLSLSFLNYALKYNERSGKPTEILLKDINENN
FT                   LFIINSNKSFKKYCHLLAESKLLK"
FT   gene            684621..685853
FT                   /locus_tag="lse_0650"
FT   CDS_pept        684621..685853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0650"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0650"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26801"
FT                   /protein_id="CBH26801.1"
FT                   /translation="MKKSKKWLKVFLIIFGAIVIVFAGLTILNKTFHTSYKNMDKTDQA
FT                   FFKQLNTLYSKTKNEPLWQGDDLAKNPVVFVRKGDHLNFSDNTVNLIRGNVYAVGVKGL
FT                   EDKWYAEKINLPDSYDMPDVYRLAVTTPGIWSTWIPLGNFSSFNTNEKTGKMEQTDMQV
FT                   GDSSHVYYFKYGKSNIENPAKASQAAMPFFAHESFHYFGQKDWNGSDGNIDVESKDAEW
FT                   YSLLGLQYSVLDTIMEKVEAKDTAGISKALSDYVIVSDARRKLDSKDYQDEKKHETIEG
FT                   TADYVGIKASTITGGKLQILSGAQDEDHRRFSILFEVIANDPNFVSEIKWNRYDSGALL
FT                   SAALDQVDTANWQTEFNEKANNGTYTLDDRIHELKFSGKGNSLDKIKQNYDFNNIEALS
FT                   GKIVNGLKSES"
FT   gene            685952..686827
FT                   /locus_tag="lse_0651"
FT   CDS_pept        685952..686827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0651"
FT                   /product="lipase/acylhydrolase, putative"
FT                   /function="Lysophospholipase L1 and related esterases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0651"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26802"
FT                   /protein_id="CBH26802.1"
FT                   /translation="MLYLLLNKPQEKAGDLSVKKSKAVQFLLFFSVLALILSIIGVASI
FT                   WLGQKNHQAKETNKQMTQSETKVDKKQDTFKITALGDSLTYGVGDTEGGGYVRVVENFY
FT                   KKTTKNVENVNLAISGARSDQLLKQLDQKEVQNQIKSADVILMTIGGNDLFRGGEALED
FT                   FKSDAITQAETSYKNNLQQIYQTIRKLNPSAPVFHIGLYNPFMTLENATEMSNVVAKWN
FT                   MESQNLTQQEKDIVYIPTFDLFQQNGEAYLATDKFHPNHAGYQFIGNRVTEVIQTGGDG
FT                   SDDGASTSSN"
FT   gene            686799..687704
FT                   /locus_tag="lse_0652"
FT   CDS_pept        686799..687704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0652"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /function="ABC-type multidrug transport system ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0652"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26803"
FT                   /protein_id="CBH26803.1"
FT                   /translation="MTGPALQVTDLHKKIRKREIIKGISFEVMPGEVFGFLGPNGAGKT
FT                   TTIRMIVGLIKPTSGTILIGGEDIQKNFTEAMRSLGSIVENPEFYGFLTGQENLAYFAR
FT                   MDPSIKKERILEVTALVGLEKRINDRVSTYSLGMRQRLGIAQALLSNPKLLILDEPTNG
FT                   LDPSGIHEMRDFIRALARNEGISVLVSSHLLSEIELLCDRVAIMTEGTIIKTDQVAHLL
FT                   SSREQLRWRVTPFEQAKTFLESVTEVEVDGAYLVTSMNDNSAEWNEQLVAQGIKVHEID
FT                   KRKPSLEDLFLELTGGQSID"
FT   gene            687697..688677
FT                   /locus_tag="lse_0653"
FT   CDS_pept        687697..688677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0653"
FT                   /product="membrane protein, putative"
FT                   /function="ABC-type transport system involved in
FT                   multi-copper enzyme maturation permease component"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0653"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26804"
FT                   /protein_id="CBH26804.1"
FT                   /translation="MINLVYNEQLKLWRKKRLIVILALVAIIVAIFTYAQFRQYQEDEK
FT                   QAGTSDWHVQTQQEIVDLENRLGTGRLPEEYQKYFKVLVGQLQYYLDNDINPNAPGAPT
FT                   FLKTFVENGISLLFPLFIMVIAADLISAETSAGTMKFLLTRPVKRWRILTSKYISMLLS
FT                   ISAIMILSAVIAYLISGIVFGYGGWDAPVLTGFDVKNGAISTTNVYQLPVWQLLLMEFG
FT                   LAWFVSVVVGVLTMFVSVLVRSTAAVMGIMLASLITGTILTNLVSSWPSAKYLFMVNLQ
FT                   LTNYLNGSSPPVEGMTLNFSMLVLTAWMLVAFVLSYFIFTKRDVY"
FT   gene            688804..689691
FT                   /locus_tag="lse_0654"
FT   CDS_pept        688804..689691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0654"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase familiy protein"
FT                   /function="Lactoylglutathione lyase and related lyases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0654"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26805"
FT                   /protein_id="CBH26805.1"
FT                   /translation="MIQGIHHVSALTKSFNENHHFYSDILGLRLVKNTVNQANIKMRHL
FT                   FYGDYAGTPGTLLTFFEIPKIGTSYNERAYFGSITLGIPKNTTNFWEKRLNDFAISFQK
FT                   TDKTLSFHDPDRMGIILTEISETITHPTIHTEIPADKQIVRILGADYHVPSTDKTSQFF
FT                   TEYFGLESQNGVLVDKNGLSFAKIYPSRSDNKSRTGRGTIDHIAYTVESKKDVDKLHEM
FT                   ALQNKLPIEEFVDREYFKSLYIKEPSGLRIEFASKEPGFTIDEPLETLGEKLALPSFLE
FT                   GKRTEIETYFGGEK"
FT   gene            689691..690650
FT                   /locus_tag="lse_0655"
FT   CDS_pept        689691..690650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0655"
FT                   /product="glyoxylase family protein"
FT                   /function="Lactoylglutathione lyase and related lyases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0655"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26806"
FT                   /protein_id="CBH26806.1"
FT                   /translation="MIKDLKGIHHVTAMTSSAEKNYAFFTEVLGMRLVKKTVNQDDIHT
FT                   YHLFFADDKGSAGTDMTFFDFPNLPKGRHGTDSISRVAFRVPSDAALEYWLDRFNQLEV
FT                   PHGEIKTLFGKKYLTFQDFDDQQLQLISDENNEGVAPGTPWKNGPVPEKYAIYGLGPVF
FT                   LTVGSLSNMEAILMSIFGFKKVTEENGLHLYEVGEGGNGAQIIVEERTDIPVALQGYGG
FT                   VHHVAFRVEDHDELQKWIDRMNTIEIPNSGYVNRFYFESLYVPVSAGILFEFATDGPGF
FT                   ASDEPYETLGEKLALPPFLEPKRAEIEKMVRPIDTKRS"
FT   gene            690657..691265
FT                   /locus_tag="lse_0656"
FT   CDS_pept        690657..691265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0656"
FT                   /product="phospholipase/carboxylesterase domain protein"
FT                   /function="Predicted esterase"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0656"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26807"
FT                   /protein_id="CBH26807.1"
FT                   /translation="MEHLFIPGKNKDLAPLLLLHGTGGDEKSLVEVAEFINSDAPILSL
FT                   RGEIKEGGANRFFKRFHDGSLNLADLEIKTKELINTTRELAEKYELDFEKIIAVGYSNG
FT                   ANIAANALLQAEDSFHKAILFHAMPAGNEQPVFSIDHRSVFLSAGLNDPLITAKASEKL
FT                   VEILEHRGAKVETVWTAAGHSLTMEELEAAKKWYQNNQK"
FT   gene            691274..691894
FT                   /locus_tag="lse_0657"
FT   CDS_pept        691274..691894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0657"
FT                   /product="conserved hypothetical protein"
FT                   /function="Conserved protein/domain typically associated
FT                   with flavoprotein oxygenases DIM6/NTAB family"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0657"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26808"
FT                   /protein_id="CBH26808.1"
FT                   /translation="MTIFRSAELTQKENYKFLTGSIIPRPIAFVTTLAEDGVTVNAAPF
FT                   SFFNIVSSEPAIISIAVQRVGGKQKDTARNAAFTKELNIHIVSEEMVEEVNKTAASLAP
FT                   DESEVAHTSLHLETILGMKTPKISEANIVLTAKLDQLIPITNDAGEIVADLILARILTY
FT                   ELDDAVFNKEKGYILPEALTPVARLAGNDYAKLGEIFQVVRPN"
FT   gene            692221..693477
FT                   /locus_tag="lse_0658"
FT   CDS_pept        692221..693477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0658"
FT                   /product="GTP-binding protein"
FT                   /function="GTPases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0658"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26809"
FT                   /protein_id="CBH26809.1"
FT                   /translation="MEKKVLIVGISQKQKDFDYSMEELANLAAANNMEVVGELRQNIDK
FT                   ENRATYVGKGKVDEVKGLAEMQEASLVIFNDELSPSQIRNLEEALELDVMDRTGLILAI
FT                   FANRAKTKEAQLQVEIAKLQYELPRIFGQGEDMDQQSGKGGLSNRGSGEKKIETDRRTI
FT                   KHQIRHLQKELAMLVDDREVRRRKRKKNEIPVVSLVGYTNAGKSTTMNGLVRAYSETAD
FT                   KQVFEKDMLFATLETSVREIVLPDNKQFLLTDTVGFVSKLPHQLVKAFRSTLEEARDAD
FT                   LLIHVVDYSDPHYKTMMQTTEETLKAVGVEDVPVIYAYNKADLLEDEIYPTQTDNTIIF
FT                   SAREQPSLEFLTEVIKKELFSGYAKSEFLIPFEDGQVVAYLNNHAKVLETEYLENGTKI
FT                   IAEVSPADLQKLKNYQVEK"
FT   gene            693554..694426
FT                   /locus_tag="lse_0659"
FT   CDS_pept        693554..694426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0659"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /function="Predicted phosphohydrolases"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0659"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26810"
FT                   /protein_id="CBH26810.1"
FT                   /translation="MKKTGLGILGAVAAFTGYAYWSTKHLTITNYEITSAKIPEEWDGA
FT                   SFIQLSDLHSASFGLYNNPLLSMVNELSPDAIFLTGDMIDGDESPVVAMALVRKLAKEF
FT                   PTFYVSGNHEGRSAFYEDFKADMEAHHVTVLENERYFLKKDDAAIMVAGIKDPRFSKEE
FT                   WLEADLPKHEWETEALKVSLGEATNNLAADYFTILLAHRPEFWPLYQAYPVDLVLSGHA
FT                   HGGQFRFPLTEGLFAPGQGFFPKLTAGIHRAGGKELIVSRGLGNVTKLPRLFNDPEVVR
FT                   ITLKSKGDA"
FT   gene            694431..695420
FT                   /locus_tag="lse_0660"
FT   CDS_pept        694431..695420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0660"
FT                   /product="lipoyltransferase and lipoate-protein ligase
FT                   family protein"
FT                   /function="Lipoate-protein ligase A"
FT                   /EC_number="6.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0660"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26811"
FT                   /protein_id="CBH26811.1"
FT                   /translation="MIYLDNQDVLDQAYNFAMEEYALRFLDENETYFMFYRMKPTIIVG
FT                   KNQNTLEEINHSFVEQHDIDVLRRLSGGGAVYNDEGNISFSMITKDDGNSFQNFARFTE
FT                   PVIRALQKLGVNAKLSGRNDIEVDGKKISGNAQFSTKGRLYSHGTLLFDVDLEMLEAAL
FT                   KVDPEKYLSKGVKSVRSRVTTIREHLAQDMDIQSFKQILLESIFETSDIPRYEFTAEDK
FT                   LGIEKLRVERYRNWDWTYGKSPKASIKHKKRFPAGTIEFQLDINKNQITAAMIYGDFFG
FT                   TEDVAELANKMVGCRFDRASIREVFQKIDTKNYFGNIETEAILEMLFE"
FT   gene            695608..697473
FT                   /locus_tag="lse_0661"
FT   CDS_pept        695608..697473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0661"
FT                   /product="internalin-like protein membrane anchor,
FT                   putative"
FT                   /function="Leucine-rich repeat (LRR) protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0661"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26812"
FT                   /protein_id="CBH26812.1"
FT                   /translation="MKKHYSLKCFLLVISTVFVISIWMSHEMIVKAESITKPMPINKIF
FT                   PDEEFAKVVRDGLGKAAVTDVVSQTELNTLSEINIVAVESIEGIQYLNNLNTIEAYLCP
FT                   ISDLNKLTNLSNLKYLALQSCDLSDLSFVSDLVNLEELSVQENKISDISPLSSLLNLTS
FT                   VSLYGQEITSIPVFYQENLVIPNTVKNGDATLIPPSEISNSGTYLSPNITWDLPAFIDS
FT                   VDYSFDQKVTFGNIRATFSGTVEQPLKLGYKAIFDVDGTQTNELVEENDVIPEPADPIK
FT                   EGHTFIGWYDAETGGTKWDFSTGKMPPNDKILYAQFNINSYTATLDVDGTTTSQTIVYQ
FT                   ENLTEPIAPTKEEHTFLGWYDAKTDGAKWEFNTDRMPAKDMTLYAQFNVNKYLVTLDID
FT                   GETTNQLIGYQTLLPEPTAPTKEGYTFTGWYDAQIDGIKWDFSTETMPANDVTLYAQFS
FT                   INNYAVTFDVDGKTTNQSIVYQGYMAQPVDPSKEGYTFTGWYNAKKGGTKWDFSTGTMP
FT                   PKDMVLYAQFSENKNTAGGNKTPGQVTNPNNKPNNKPNNKPNNKPNNKPNYNKPILVQG
FT                   QGDASAKILPKTGDKATVPLMFIGILCIGFSIHAFRQTYNGSSPE"
FT   gene            697692..698990
FT                   /locus_tag="lse_0662"
FT   CDS_pept        697692..698990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0662"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0662"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26813"
FT                   /protein_id="CBH26813.1"
FT                   /translation="MVIANRAFIQTSAAKIKQELNNPKLVEMYERCMANTLDTTIKIRE
FT                   SGLTFILTGDIPAMWLRDSVCQVRPFLLFAAENEEIESMLIGLSKEQAKLVAIDPYANA
FT                   FNETANGAGHQADITEMHPQVWERKYEIDSLCYPIQLAYYIWKITGRTEQFDQAFLQML
FT                   QSIFSLWQVEQHHETESSYRFERMDCVPSDTLKRDGRGTETTYTGMLWSGFRPSDDACE
FT                   YGYLIPSNMFAVVVLAYAKEIIEAFFPDEKETYEQAATLRSDIQAGLEKFGTYNHPKFG
FT                   EIYAFEVDGFGNQLLMDDANVPSLLSLPIIGYSDKEEKIYQNTRNFILSKDNPYYFEGE
FT                   MAKGIGSPHTPKGYIWPIGLAIQGLTTNDQVEKNTILEMLLRTDAGTGLMHESFHPDNP
FT                   EDFTREWFSWANMMFCELVLDTVGFQMASALTK"
FT   gene            699007..699897
FT                   /locus_tag="lse_0663"
FT   CDS_pept        699007..699897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0663"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /function="ABC-type sugar transport systems permease
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0663"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26814"
FT                   /protein_id="CBH26814.1"
FT                   /translation="MARIRNKSVQVHQQRMAYLFIALPVLLLAVFMILPIGMALVVSFT
FT                   DYDIINAPNWIGFDNYVKMFNDPYFFISLKNTILYTALFVPLGLVASLGAAVLINMNKK
FT                   GAGLFRTFFYVPVLCSTVATATIWYWLLNPQYGLINQVLGWFGINGPAWLYDSNWAMFA
FT                   IVMMSVWMTFGTNMMIFIAGLQGIPANLYEASKIEGASRWKTFRYVTWPSLSRTTFLVT
FT                   TMLIINAFQVFDQAYVLTKGGPGNSTITLVYYIYNEGFGGLKMGYASAISFVLFLIILV
FT                   FSIINMRVNKEDRTA"
FT   gene            699909..700784
FT                   /locus_tag="lse_0664"
FT   CDS_pept        699909..700784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0664"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /function="ABC-type sugar transport system permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0664"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26815"
FT                   /protein_id="CBH26815.1"
FT                   /translation="MNTIKFKKMSKSILWYIAVLLISLITVFPLIWTLSTSFKPVSEIL
FT                   SNSMNLIPKMFTWDNYKDVFSTTPFARYLFNSLILAVGGVLTNLFFGSLAGYAFAKLPF
FT                   KGKKGLFMTFLGSMMIPAVVTMIPSFLVLKNFPLMGGNDITGHGGMGFINTYWAILIPG
FT                   AAGAFSIFFMKQFFETLPDELSEAARIDGCSEFKIFWKIYMPLAKTALATLGIMTFQAG
FT                   WNQFMWPLIVLNSQKMMTVQVGLASFQYNESANYGALMAGTIISTVPVLFVFIFAQKYF
FT                   VEGIAHNGGK"
FT   gene            700807..702063
FT                   /locus_tag="lse_0665"
FT   CDS_pept        700807..702063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0665"
FT                   /product="bacterial extracellular solute-binding protein,
FT                   family 1"
FT                   /function="ABC-type sugar transport system periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0665"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26816"
FT                   /protein_id="CBH26816.1"
FT                   /translation="MKKVFLAVLSTVLLLSLAACGGGSDTSSKEKGGKEEIVMWGSWSG
FT                   DQIKQLDKQIATYNASQDKYKVKYVMQENVEEKLLTGIAGGELPDIIMWDRYQTALYAP
FT                   KGVLEPLDELVKKDNVELGDFYEESVKEMTYDEKLYGLPLLNDNRVLFYNKKLLKEAGV
FT                   EPPTTWDELATAAEKTSKWDGNKMTQAGMSMQDVGLFNLYLMQAGGELVTADNKKTAFN
FT                   SEQGLEVLNYWDKMQNDLKVYQRGFDDGTDAFAAGKEAMTFNGPWALADYNKVEDLDYG
FT                   VVEPPAGPDGEKGAIMGGFGLVMPKQAEHKDGAWDFMKWWTTKPENGVEFAKISGWLPA
FT                   NKIAAEDPYFTEDPNYSVFVNTMKYAKIRPTVAGYADVEGLAMKPQFEKFMNGNISAEK
FT                   ALSQAEKEGNQILKEERDN"
FT   gene            702067..703095
FT                   /locus_tag="lse_0666"
FT   CDS_pept        702067..703095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0666"
FT                   /product="glycoside hydrolase, family 76"
FT                   /function="Predicted glycosyl hydrolase"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0666"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26817"
FT                   /protein_id="CBH26817.1"
FT                   /translation="MKWSEYATLAQKSLEKFYQADTEEQFLNNFYPINNIEEDNKVFNY
FT                   WWLAHLVEVRLDAYLRTKQQADLDVAEWTYAHNKNRNGGTLVHDFYDDMLWNALAAFRL
FT                   YKVTGKSVYLDDAKLVWQDLVDTGWNDTMGGGFAWRRPQMYYKNTPVNAPFIILACWLY
FT                   NELQEQKYLDWAIKTYEWQTKILVRADGFVEDGINRLEDGAIDREWKFTYNQGVYIGAS
FT                   LELYRITKDIKYLEMANKTAEVSLQELTENGIFKEEGSGGDEGLFKGIFYRYFTDLIEE
FT                   TNNQSFRDFVTSSCQVLVDHAMVDGYLLMGMNWKEKPSSQIPYSAELSGMIALEMAAKL
FT                   EK"
FT   gene            complement(703209..704057)
FT                   /locus_tag="lse_0667"
FT   CDS_pept        complement(703209..704057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0667"
FT                   /product="secreted protein, putative (LPXTG motif)"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0667"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26818"
FT                   /protein_id="CBH26818.1"
FT                   /translation="MQIKKYMMILVIFFSILVLSPLTSMATGENPEESNVVYTDEDEDP
FT                   DLSWDYRSGTGWDDWLNSDWDTNCSSWTNRQYNELEPVEEVEIEHSEKNEDTVDSSPTN
FT                   NSWLDDNNLTTDHNTNIETNAKLVFKPNNNSDVVPDTKPSSNSNVSSDTKSSTNSNVSS
FT                   DTKSSTNSNVSSDTKSISKLNNTPDTKTSSKPTTKLPIKSAKVDNSDINAKDSFVTSKQ
FT                   VYEKPNSIHINLKLGATKNNNNYKISSLHPTTGDSEMPVLPIFGGVLFAGSILYLTKRK
FT                   Y"
FT   gene            complement(704412..705524)
FT                   /locus_tag="lse_0668"
FT   CDS_pept        complement(704412..705524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0668"
FT                   /product="transcriptional regulator, GntR family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0668"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26819"
FT                   /protein_id="CBH26819.1"
FT                   /translation="MKKLLYQKVYDQLKLAIQEGELPVGAKLPAEKELMAQFNVSSITL
FT                   KKALELLKKDGYISRRPRVGTFVINASPSSEQVETRMFDKPLFGCIMTNFDDTFGTILL
FT                   SGMLEHSNSKAHIIVKKSLGDTEREEEILQEFIEMNVAGILILPASSKFISPTLLELAS
FT                   QKFPLVVIDRTLEGLPISSISSDNTEAGRIITEKLFELGHKHIGIITSTSPVSTLDSRV
FT                   NGFIRGHASFHTAFHSDYVFREIESVMPNSTVSIQTDIDKIALFLQTHPEITALVATEY
FT                   NIALLIKQACLKLKKRIPEDLSVVCFDHPDNFFDASAFRFTHIKQAQYKIGVKAVDMLL
FT                   KQINQPDAIKKETLPPLLVKGDSVKARKKN"
FT   gene            705685..706437
FT                   /locus_tag="lse_0669"
FT   CDS_pept        705685..706437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0669"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0669"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26820"
FT                   /protein_id="CBH26820.1"
FT                   /translation="MAIKKLNDFYFKKLGNWNLIHSFMKGFWRTFFLLVLLLIIGDIVV
FT                   VGLMDSQYFIPAILLSLLCIPLFYYILIYTRAKKFIRVRYQLRNFTELTMMRRYLLLAY
FT                   LEKSGFGTRDDLEKLLRFIHSEMAEEKQNNKPLSSLVGVFFAAFLAILGGSFLFLVDNV
FT                   VERLIAAVLIIVLAIILYVIGTFFVRVVRSKSEMNSRKEHQLTKEIIAIQTAMLVSENT
FT                   SYHPFLAMEKKVSESDFLKEIIASRSFL"
FT   gene            706459..707109
FT                   /locus_tag="lse_0670"
FT   CDS_pept        706459..707109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0670"
FT                   /product="transcriptional regulator, GntR family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0670"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26821"
FT                   /protein_id="CBH26821.1"
FT                   /translation="MTTKRKETRESVCYREIKKKIRNGELKPGDRLIENTLSQQLEISR
FT                   TPIRKAIGMLAADGYIEYNDFRGAIVKDSIINKERYFEMTEILGLFLKQAIHKIRTKKI
FT                   TFNKLEMINKLAEIKNQENQEHSSVYFDYEKWFAQNLLTYLRNKYYLKISEDFFNNIKE
FT                   FGDEEVINIAQNASVKTIDNIQNFIDAMDVHDYDKCLNLIDELIDAHVLVAYR"
FT   gene            complement(707154..708143)
FT                   /locus_tag="lse_0671"
FT   CDS_pept        complement(707154..708143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0671"
FT                   /product="alcohol dehydrogenase, zinc-dependent"
FT                   /function="NADPH:quinone reductase and related Zn-dependent
FT                   oxidoreductases"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0671"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26822"
FT                   /protein_id="CBH26822.1"
FT                   /translation="MKSFQALFIEKEEQDTSLHFRDTTIDELPENDVTIEVHYSGINYK
FT                   DGLAVLPDGKIVSEYPFIPGIDASGVVVETKSDRFQVGDEVIVTSYDFGVSYFGGYSEF
FT                   IRVPAEWVVPLSAGLSLKEAMILGTAGFTAALSVDALEFSGVTPTDGKIAVSGATGGVG
FT                   SLSSAILSKRNYQVVASSNKADAAEFLQKFGVSEVVSREAFQPEKIRALDKQLFAGAID
FT                   CVGGKPLAYLLTAVQYGGAVTTCGMSAGGKLDTTVFPFILRGIQLFGIDSVLCPMPKRE
FT                   RIWNRLATDYKLANLDELATEIPFSELPTALHQVMNGGVTGRYLVKIK"
FT   gene            708319..709248
FT                   /locus_tag="lse_0672"
FT   CDS_pept        708319..709248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0672"
FT                   /product="conserved hypothetical protein"
FT                   /function="Sphingosine kinase and enzymes related to
FT                   eukaryotic diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0672"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26823"
FT                   /protein_id="CBH26823.1"
FT                   /translation="MGKALLIVNPSSGKEKGKVYQGKTEEVLKKRYEEVEVRLTEKAGD
FT                   ATEFASWASEQGFEAVIAMGGDGTLNETINGLAIHENRPDFGFIPLGTVNDLARSVGIP
FT                   LKPEKAIQSLEHAVAVPMDIGRIGDQYFMNVLAIGMIAQAVDQVSVEQKTKFGSVAYFL
FT                   EGLKAFNRNELLNFKLEYDDEVWEGEAALVVAGLTKSVGGIESWAPDAKIDDGYLHIVI
FT                   LTKLGLLDAANMIPQLIRGNLKNSGGVVYIKTKKLKIDASGDELSINVDGDPGPGVPAE
FT                   IEVLGSHLNILAPKESSKKRFGPFVLNR"
FT   gene            709288..709620
FT                   /locus_tag="lse_0673"
FT   CDS_pept        709288..709620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0673"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0673"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26824"
FT                   /protein_id="CBH26824.1"
FT                   /translation="MEEELEVIHKGLANAKNGFKAVPGKLYLTKTYIVHKPNDYFDEEI
FT                   NIPLDSVRKIRGVRTKILGKALIPNILEIDMISGEKYQFVVNKQKKWLEAVAKVLESRG
FT                   ESQKLA"
FT   gene            complement(709660..710523)
FT                   /locus_tag="lse_0674"
FT   CDS_pept        complement(709660..710523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0674"
FT                   /product="ROK family protein"
FT                   /function="Transcriptional regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0674"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26825"
FT                   /protein_id="CBH26825.1"
FT                   /translation="MTILAFDMGGTAVKYGVLTNQGELLEKGKFATPDNLDELIRLLVE
FT                   VKTTYDYSFQGVAFSCPGAVNNETGIIGGASAIPYIHHFPFRQLLEEKLALPVTMENDA
FT                   NCAALAEVWLGAAKDKQDIIFMILGTGVGGSVIRDGKVHHGANLHGGEFGYMLMDQEGH
FT                   TLSDLGTVVNAGKRIGERLVPVEEVDGVRAFELRDEGNLIATEELKTMFYYLARSIFNL
FT                   QYALDPELVVIGGAVSERAGFIEELNSYVDEVKASVPIAKIRPTVVGCEFGNDANLIGA
FT                   TAFHLA"
FT   gene            710680..711063
FT                   /locus_tag="lse_0675"
FT   CDS_pept        710680..711063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0675"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0675"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26826"
FT                   /protein_id="CBH26826.1"
FT                   /translation="MEIKVQGKLTDGRIAFSSEYGECVGIWADEDPEPSRVYTVEITIP
FT                   EMISAELLHESEEKHCVLEIDEEGLVHVVGKLEDYEEDGFAVLRLEESIICFDTKFSEE
FT                   IEMLHGRFVEFVVSEIKLSNVGI"
FT   gene            complement(711273..711416)
FT                   /locus_tag="lse_0676"
FT   CDS_pept        complement(711273..711416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0676"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0676"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26827"
FT                   /protein_id="CBH26827.1"
FT                   /translation="MIRIATWIQSKKSLKNTPTYIEIREYEQPIQAKRKIENDEKKKKL
FT                   IG"
FT   gene            complement(712144..713088)
FT                   /locus_tag="lse_0677"
FT   CDS_pept        complement(712144..713088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0677"
FT                   /product="DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0677"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26828"
FT                   /protein_id="CBH26828.1"
FT                   /translation="MYKNRLKELMLERNISNHMLARETTISRQAITKIKNNPFHDISIN
FT                   VLTELLEYFDISFDDFGTIYTREQCLQTLLPDKGFNHKNLDLLESLFSENLCISCKYQP
FT                   YSSEQCLNIWSKGYYKKFSFSGNMRINTSLYGLTFEITDFDLYRISKNFTFDTFYEFYE
FT                   NFIIQLENYALNLGFTQIVININSYTDKDLDTRLEPRIVNSKDLKFLVSNYKYSNRENE
FT                   LIKMAIIKHLGYIEYCYNDVLQKRKFEKERINTYLDSLRHLTFFEKEKKRISMFSEKNL
FT                   HSNHNTKKFIKQINSEFIPKEKLEKDVKRQWGW"
FT   gene            713456..717097
FT                   /locus_tag="lse_0678"
FT   CDS_pept        713456..717097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0678"
FT                   /product="hypothetical protein"
FT                   /function="FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0678"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26829"
FT                   /protein_id="CBH26829.1"
FT                   /translation="MSRLNRIQNEIKQLEGGRFQKLCDIYLYRKRSWENIVSLGSMEGT
FT                   DKTTKGIPDTYFFDNQSNRYILVMYGTRADSTAKLEVDIKEAIEKTKIDKKDIQEIICC
FT                   HTSSNLTVSKDKELRSLAGPIELKLIGIDTLSHDLLQFKYQNLVKDFLGIAESTEQVWN
FT                   IEQFISIHDKSKTNAPLNTSFIDETDTVEELTEDLNGHQILLLSGISGTGKTRLAIEVC
FT                   KKLPSDSNVICVKSNSMPVYQDIKDALDNNRVNYLFLDDANMITNFDAIVNLLRLEEYE
FT                   QKLKIIITVRDYALSGIINQLKSFKIKTQKVSLMSDEQIELLINSINKVSSSNLRKIIK
FT                   LSHNNPRIAVVASIMAKEQNYEFIDNGKGILGSYYYQIIKENALSQSEKVSLFILSFRH
FT                   KLNLTDTDTLQELLTFFKLDFDNFLVSLNQLHDKELCDIFQDKAAKVSDQSLSDFVIID
FT                   FIANNKVFKVRDFFLSLFPENAKDIVEMLVLVNNFNSSNDWVDYLTAEIKYVYNEVIAD
FT                   IDKERFLTQYGALIPIEALTYTNEKIQSTSCSEYQISQKEFEEKKRSNQIEDPIIEILC
FT                   SLSNSERFNDAGMLLMEYLKKRQDKVYEVFSAIKSNFDIEEDGNSYLEKRFCVFEIFSK
FT                   QKNINELTALLIVNVAENFLKFSGEKFISNGRSVVISRYTLVDGEYLIELHTKIFYMLF
FT                   EVYNLEYVEVNNHIDKLLFNYPVYEVKNGFLETVSSDLKCIENLFFKDLNKLDIRQEAI
FT                   VFKLNSEKNKLNLNSQLFFEYKPSSRQKIYKIFSSNMLDYKAEEFDYEKAQKLRIKNLS
FT                   ESFNGYFNNLPWIFNILSEYQSDELLNKYELEESILLLYSQLEIADKVQMLTALLSSEF
FT                   SLSNYHFDYYMEKLSFEEGKNILNCVKKEVDERWYLSNLFTCNKINNDMIKELVLFLKN
FT                   LKNYEKVNSFNILSFESYIKQDATILDILMSKYRGGEISKRFFIPSYVPEEKADKIVDI
FT                   VGYKELERIYLDSFDDENVDDSGAIFKSLLKKGDANFIYLFLTKLNTERLKLNSVKRDI
FT                   QLKYIWKSQVAEEGIKKYLDFLIQENRVIYVGVDPYLEEIFKANTERTSEFIKAEIFDT
FT                   GDENRLVNLYNLSLEIFDDEVLLHLFKLLKDKDINANFLEKLNLTMRTHSWSGSLVPLL
FT                   DKEISFLNQLLEIFEGIKYISHALVISTRIDSLKKQKEKELLSDYLE"
FT   gene            complement(717480..717947)
FT                   /locus_tag="lse_0679"
FT   CDS_pept        complement(717480..717947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0679"
FT                   /product="putative membrane protein"
FT                   /function="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0679"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26830"
FT                   /protein_id="CBH26830.1"
FT                   /translation="MVWDATNIFLFVANILTLLYILYNDAVIPLWKGKSVLTVKLRSRG
FT                   RWDGYLFVGIIALLFVSNAFFREGPFSTSVLLAIMGVLFIYICFFRSSRAVFKETGIFY
FT                   ALLFFPYDKIERMNLSEDGILVIETNRQRLMLFAKSEKDLEKMLAVFATYS"
FT   gene            complement(718068..718946)
FT                   /locus_tag="lse_0680"
FT   CDS_pept        complement(718068..718946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0680"
FT                   /product="PTS system, mannose/fructose/sorbose family, IID
FT                   component"
FT                   /function="Phosphotransferase system
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IID"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0680"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26831"
FT                   /protein_id="CBH26831.1"
FT                   /translation="MSEQIIVNEKKITKRDLMGVFVRSNLFQGSWNFERMQSLGFCFSV
FT                   IPVIKRLYPEKGPEREQAIKRHLEFFNTHPYMAAPILGVTTAMEEQKANGADIDDGAIN
FT                   GIKVGLMGPLAGVGDPIFWGTVRPVLAALGAGFATDGSIIGPILFFVLFNAIRLGFRYW
FT                   GVFYGYTKGTDVVSDMSGGLLQKLTEGASILGLFVMGALVNKWTTIYVPLVAYTTTDSK
FT                   TGKEVPTTVQSILDQLMPGLLALLLTFACMWILKKKVNALWLILGLFVVGILGYWSGIL
FT                   GLPPAGYSPLG"
FT   gene            complement(718965..719777)
FT                   /locus_tag="lse_0681"
FT   CDS_pept        complement(718965..719777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0681"
FT                   /product="PTS system, mannose/fructose/sorbose family, IIC
FT                   component"
FT                   /function="Phosphotransferase system
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIC"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0681"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26832"
FT                   /protein_id="CBH26832.1"
FT                   /translation="MTAIQLILVFLVSCISGMGSILDEWQTHRPLIACTLIGLVLGDIT
FT                   TGIIIGGTLEMIALGWMNIGAAVAPDAALASIISTILVITGGQDISVGISLAIPLAALG
FT                   QVLTILVRTITVAFQHMADKAGKEGNLRSLDWIHVSALLLQAMRIAIPAMIVAVTVGTD
FT                   AVENLLNAIPDVIVNGLNVAGGFIVVVGYAMVINMMSAKYLMPFFFLGFVVAAFTAFNL
FT                   VALGVLGLVAAIIYIQLNPKYQLKAAIEQYGGGGGGRQADDLDDDLDD"
FT   gene            complement(719939..720424)
FT                   /locus_tag="lse_0682"
FT   CDS_pept        complement(719939..720424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0682"
FT                   /product="PTS system mannose/fructose/sorbose family IIB
FT                   component"
FT                   /function="Phosphotransferase system
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIB"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0682"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26833"
FT                   /protein_id="CBH26833.1"
FT                   /translation="MEIRLARIDDRLIHGQVATVWTKETQVERIIVISDDVAKDEVRKT
FT                   LLTQVAPPGVKASVVDVQKGIRVYNNPKYATTPVMLLFTNPTDVLTLVEAGVNITTVNI
FT                   GGMAFREGKHMITNAVSVDETDEAAFRKLDEKGIELEIRKVASDSKVKLIPLLDKDK"
FT   gene            complement(720424..720858)
FT                   /locus_tag="lse_0683"
FT   CDS_pept        complement(720424..720858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0683"
FT                   /product="PTS system mannose/fructose IIA component"
FT                   /function="Phosphotransferase system
FT                   mannose/fructose-specific component IIA"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0683"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26834"
FT                   /protein_id="CBH26834.1"
FT                   /translation="MPVGIVIGTHGESARELLKSAEMIIGKQDNVEFITFVPGENTDTL
FT                   ITKFKEKLEKMDTSEGVIFMVDLFGGSPYNASSQIALPEENMDVVTGVNIPMLLEVLSM
FT                   RTASNQKDLVETALKAGIGGVRSLKNSLPKMETQVGEDDL"
FT   gene            complement(721187..724003)
FT                   /gene="levR"
FT                   /locus_tag="lse_0684"
FT   CDS_pept        complement(721187..724003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="levR"
FT                   /locus_tag="lse_0684"
FT                   /product="transcriptional regulator (NifA/NtrC family)"
FT                   /function="Transcriptional regulators containing an
FT                   AAA-type ATPase domain and a DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0684"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26835"
FT                   /protein_id="CBH26835.1"
FT                   /translation="MKRIDRIYEFILENPSTMTIREQLEKNEGFTATTISETLEILRNN
FT                   VSMELNELHRQGKIIKIVGRPVLYFPKKAVEEEIGRILADNELEFESCAALLKLLKPKI
FT                   AERSPFDDLIGANDSLKTPVEQAKAAVLYPPNGLHTMILGQTGVGKTLFANLMYRFSQH
FT                   AKRLPSDAPFIIFNCADYYNNPQLLMSHIFGHVKGAFTGAENDKGGLVEKADGGILFLD
FT                   EIHRLPPEGQEMIFYLMDSGTYNKLGETDRTRKSNVLIIGATTENPESSLLKTFMRRIP
FT                   IIITLPSLEERTAFERVELLKYLLSSEAHRVNKPIRIEDEAAKALLGNTTYGNIGQLKS
FT                   NIQLVCAQGFLNSFDKDDEILIDFKTLPINIKDGFFHFSNRRKELQAIAEYLEPYTTIF
FT                   PELNNTLITSDEYEPNFNLYKIIEDKASILMDQGVLDDDIKKFIKMDIDIHLNSFYNKF
FT                   KNTIHNRENILKIVNEEILNFAEGVEQRIEHQLGKKLNERFLLAFSLHLTSFIKRIESN
FT                   KPLKYTNIENVVNDQPEAYELSREIKDDIEASFHIRVPNMEVMYLTLLISSLLKDQENA
FT                   RVAVLVATHGNNTASSMVSVAKKLLGEGLVEGIDMPLDQSPKIVLDKLTERAREMDMGR
FT                   GLLLLVDMGSLTSFAPVISERTGIPVRSIDMVSTATVIEAVRKSNILDMELDSIYDSLK
FT                   DFRGYGGYTSEDDTLDSTQKPHAIVTICATGEGTAEKLQLFIENILDTITTDAIKVIPI
FT                   GLHEMDTKLEELQEENDILMAVGIQDPKIQIPFIPLERLFGDDGEEQLVSLVKQRNIMV
FT                   KTGETGRIAKEIIEESLNEFLTYLNPKKTIEILSSFANVLEKKLGYELDNTFKINLLIH
FT                   VGCALERMVLNDGLTYHDDKNMIDTSVFKALEETNKEVIYKMNLKLTNDELCYLYDILN
FT                   EIQPEVTI"
FT   gene            724198..724833
FT                   /locus_tag="lse_0685"
FT   CDS_pept        724198..724833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0685"
FT                   /product="acyl-carrier protein phosphodiesterase, putative"
FT                   /function="Acyl carrier protein phosphodiesterase"
FT                   /EC_number="3.1.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0685"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26836"
FT                   /protein_id="CBH26836.1"
FT                   /translation="MSKVLFIKASPLPNEVSRSSQVAETFMEEYKAKNPSDTVEELVLY
FT                   NTEVPLLDLELMTAGRELQAGKAFTDLAPEVQQRLNAYNTLTDQFLAADKYVFVFPLWN
FT                   LGIPPLLKAYVDTFVIAGKSFRYTEHGPEALLKDKKAILIHGSGGIYSAGQTSSFTHGE
FT                   PYLRTILQFIGIEVVPTIFVEGIDHNPSKEAEIVAAAKAVARESAAGF"
FT   gene            725026..726402
FT                   /locus_tag="lse_0686"
FT   CDS_pept        725026..726402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0686"
FT                   /product="amino acid permease family protein"
FT                   /function="Gamma-aminobutyrate permease and related
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0686"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26837"
FT                   /protein_id="CBH26837.1"
FT                   /translation="MEEQKEELQRGLKNRHIQLIAIGGAIGTGLFLGAGKSIHLAGPSI
FT                   MLVYLIIGAILFFVMRALGELLIHNPTTGSFTEFAEQYIGPWAGFITGWTYWFCWIVTG
FT                   IAEITAVGMYVKFWVPDLPQWIPALGCVLILLLFNLATVKAFGEIEFWFAIIKVVVIIA
FT                   LIVIGFVLVFIGYKHGTSTASFSNLVDYGGFFPNGLAGFLLAFQMATFSFVGIELVGVT
FT                   AGEADDPERTLPKAINNIPIRILIFYIGALLVLMSIYPWSNIDPNTSPFVSVFTMIGIP
FT                   AAAGIINFVVLTAAMSSCNSGIFSTSRMLYTLSAEGKAPKKMHHLSSNGVPATALITST
FT                   ACLLIGVFLNYVLPEQVFILVTSIATICFIWVWGVILVAHLRFRKKHPEIAAKSKFKMP
FT                   LSPLMNWVSLIFFVGLLIILGFAADTRIALFVTPVWFLILAIAYQIVKASNKKSEIRHI
FT                   "
FT   gene            726667..731097
FT                   /locus_tag="lse_0687"
FT   CDS_pept        726667..731097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0687"
FT                   /product="BadF/BadG/BcrA/BcrD ATPase family"
FT                   /function="Activator of 2-hydroxyglutaryl-CoA dehydratase
FT                   (HSP70-class ATPase domain)"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0687"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26838"
FT                   /protein_id="CBH26838.1"
FT                   /translation="MIHAGLDVGSTTAKAVALNDQGDILFQTYRRHYSDIKKVTLEIMQ
FT                   DMQKKCGMTEMTFKITGSSGLAISKFLNVPFVQEVIACTEAVEQVIPETDVVIELGGED
FT                   AKIIYFSGGIEQRMNNACAGGTGAFIDQIATLLQTDPTGLNELAQNANTIYPIASRCGV
FT                   FAKTDVQPLLNEGARKEDIAASIFQSVVTQTISGLACGRPIRGKVAFLGGPLTFLDQLR
FT                   YRFTETLKMKDSDIIAPQNAEYFIALGTAFTGLNDVPTKVEDMINRLSNMDMTTMATDT
FT                   VILPALFESETDLADFRARHNKMKAKRAKLEDYEGDAYLGIDAGSTTTKLILMSQTNEI
FT                   LYSFYASNNGNPLQSVIDATSDLYEILPEKVRVAQSGITGYGESLIKAALKIDVGEIET
FT                   VAHYRAAREFSPDVDFILDIGGQDMKCMKIKKGALDSLMLNEACSAGCGSFLETFAQTL
FT                   NLSIEEFAARALEAKAPVDLGSRCTVFMNSKVKQVQKEGVSMEDLSAGLAYSVVKNALQ
FT                   KVIKLRSPKDIGEKVIVQGGTFYNESVLRAFELLTGREVIRPDIAGMMGAFGAALIARE
FT                   HYETGEVTEMLVLEKLREFNAETSQSRCNLCSNTCQLTVTRFGDDRMFVSGNRCERGER
FT                   VEKSRNVLPNLYAYKLQRTFDYKSLKKSEATRGTIGIPRALNVFENYPLWHTILTNLGF
FT                   RVVLSSKSSKNLYDKGIETIASEAVCFPAKLTHGHIMDLIKKKADRIFYPSVVYEKPEF
FT                   GEATNNFNCPVVAGYPEVIRVNVDALEEKNIPMISPFLTLDNEKALITQMSLAFPEVPV
FT                   EDMETAVKAGLAEAELCRKDIQEEGEAALTYIKKNKIKGIVLAGHPYHIDPEVNHGIPE
FT                   LITMNGMAVLTEDSISHLGEIDHKLRVENQWKYHARLYRAASFTAKSEDLEFVQLTSFG
FT                   CGLDAITTDMCQEIIEGHNKVYTLLKIDEINNLGAARIRVRSLKAAMEEREKNNVKPTV
FT                   MKKPKERVLFTKEMKKTYTILAPQLAPTHFEMLEAAFKVGGYNLEILPAVTPRAVDEGL
FT                   RYVNNDACYPAILTIGQMMDALKNGDYDLDNLAVLMTQTGGGCRATNYISMLKKALGEA
FT                   GIDHIPVISLNANGLEKQPGFKLTPKILVRLLAGISLGDALDRMVYRTRPYEVEKGSAN
FT                   KLFRKYLDAGRELMENYSISAYKKFANDMVQAFDKLPITNEVKPRVGVVGEILVKFHPG
FT                   ANNNIVDVIEEEGGEAVVPDLTDFILYCCYDDHFAANTFGRSKVKSFAKQSVAIPLINQ
FT                   FRKPVTDALKKSERFEAPASIESIAEKASQLLSLGNKMGEGWFLTGEMFELLDSNVPNI
FT                   ACLQPFACLPNHITGRGMIKGLKKMYPEANIMSIDYDAGSSSVNQLNRIKLMLSIARKQ
FT                   LETTDVVTEKEKNTRFNPREKILGKAKQVRESAPVEMIGNKVKQAREADPVGAIAQKVK
FT                   HVASSSNEHVQTDND"
FT   gene            complement(731145..731621)
FT                   /locus_tag="lse_0688"
FT   CDS_pept        complement(731145..731621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0688"
FT                   /product="EbsC family tRNA deacetylase, putative"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0688"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26839"
FT                   /protein_id="CBH26839.1"
FT                   /translation="MNKKTNACRMLDQQKIPYQLREYAWSEDSLDARHVALETGDDPAH
FT                   IFKTIVLTGDKTGNIVACIPANKSIDLKEIAKISGNKKCELIPVNTLEKLTGYVRGGCS
FT                   PIGMKKLFPTFIDRSAEELETILISAGKRGIQIVIAPTDLKQIIRGTFASISEK"
FT   gene            731742..732395
FT                   /locus_tag="lse_0689"
FT   CDS_pept        731742..732395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0689"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0689"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26840"
FT                   /protein_id="CBH26840.1"
FT                   /translation="MKKGLFGMVMLLSLMLVLSACGTSRVEPKEAGEITVNSIVYNKDT
FT                   DKIKDVYGEDGSDFEKEFEKSFKESFITTFTASFSSDVNIDKEVDTFYNALRKQVNEKT
FT                   SYTTKVTNDDKESPEIQFAVKGLNMKGVQTELTEELTKAVTADPSIAMDDEKMAKKTME
FT                   IYTKAVQNADAVSESKNITLKLTVNSKDDSLWKMENDMAFMQELTTAFFLGGMQ"
FT   gene            complement(732527..733228)
FT                   /locus_tag="lse_0690"
FT   CDS_pept        complement(732527..733228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0690"
FT                   /product="membrane protein, putative"
FT                   /function="Uncharacterized membrane protein possible Na+
FT                   channel or pump"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0690"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26841"
FT                   /protein_id="CBH26841.1"
FT                   /translation="MVLLGSLVNGLGILIGSIIGMKLHNIPERIKDTVMKGMGLSVIVL
FT                   GIQMAFKTSNSLIVILSICFGAVIGELINIDYHLNQLGHWIERKVGANGKSNIAKGFVT
FT                   STLTFVIGAMGIIGALDSGIRGNHDVLFTKSVMDGFIALLLSTTLGWGVMLSAIPVFLF
FT                   EGIIALFATQIDKFVPADLMTLIIGEITATGGIMILAIGLNLLGLTKIRVANLVPGILI
FT                   AALIVAGLYYF"
FT   gene            complement(733336..733977)
FT                   /locus_tag="lse_0691"
FT   CDS_pept        complement(733336..733977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0691"
FT                   /product="conserved hypothetical protein"
FT                   /function="Putative NADH-flavin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0691"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26842"
FT                   /protein_id="CBH26842.1"
FT                   /translation="MKIGIIGATGRAGSKILEEAKDRGHEVTAIVRNAGKITQTHKDIN
FT                   ILQKDIFDLTLSDVSDLNVVVDAYGVSPEEADKHVTSLNHLMRILNGTVSPRLLVVGGA
FT                   ASLQIDDDGNTLLESKGLKEAPYFPTAEAQAKQLTNLKENESHFSWTYVSPPAMFEPGE
FT                   RTGSYQSGKNHLLFNSEGNSFISMEDFAIAIVDEIEKPNHLNERFTVAGN"
FT   gene            complement(734067..734993)
FT                   /gene="rarD"
FT                   /locus_tag="lse_0692"
FT   CDS_pept        complement(734067..734993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rarD"
FT                   /locus_tag="lse_0692"
FT                   /product="RarD protein"
FT                   /function="Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0692"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26843"
FT                   /protein_id="CBH26843.1"
FT                   /translation="MENKQNGQLGGIMAGALAYVFWGVLPIYWKLVTNVPPMEILAYRI
FT                   LWSFIFMLFLIVCLRKASMVFEETKAILLKPKTLIAIIVAAFLVTGNWFLFIYTVNSGH
FT                   VTEASLGYYINPLVNVLLATVILKERLSRGEIIAVISATIGVLILTWHLGSVPWAAIGM
FT                   AVTFSLYGLIKKLVPVSVWTGLTLETMIITPFALIYVLFFATNGLMQYPSNTNIILVGA
FT                   GVVTAIPLLLFATAAKKISYTMVGFLQYIGPTLMLAIGVLLFKESFDHIQLFAFAFIWL
FT                   ALIIFTISHVYSAAKIKQLAAAAKQQS"
FT   gene            complement(735100..735630)
FT                   /locus_tag="lse_0693"
FT   CDS_pept        complement(735100..735630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0693"
FT                   /product="YceI like family protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0693"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26844"
FT                   /protein_id="CBH26844.1"
FT                   /translation="MTVEKWNVDPAHSSIEFQVKHMMVSKVKGAFSNFTADIEMDPEDL
FT                   TSAKLSFSVEAASVDTRQAQRDGHLKSEDFFNVEKYPNVTFTATKITPDGDDEYVVTGD
FT                   LTIRDVTKPLTLQVSYEGTGKDPNTGNMVAGFEAKGKFNRKDFGLNYNAALETGGVLIG
FT                   DEVKLNIQIEASK"
FT   gene            735890..736351
FT                   /locus_tag="lse_0694"
FT   CDS_pept        735890..736351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0694"
FT                   /product="transcriptional regulator, MarR family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0694"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26845"
FT                   /protein_id="CBH26845.1"
FT                   /translation="MTGVNTDTENISELLKTYWSIQRISAGYADQNAASLGLTIQQLAM
FT                   INVIYGTPGISVAELTKRLIITGSSAAANIDGLISLGLVVKLNKTIPNDSMDLTLKLSK
FT                   KGEDLSKRSTANAFMYKAMMKVFENLSEEEVEELIRLNKKVETLLKKCK"
FT   gene            complement(736401..737861)
FT                   /gene="lysP"
FT                   /locus_tag="lse_0695"
FT   CDS_pept        complement(736401..737861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysP"
FT                   /locus_tag="lse_0695"
FT                   /product="lysine-specific permease"
FT                   /function="Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0695"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26846"
FT                   /protein_id="CBH26846.1"
FT                   /translation="MEKETHGEIRRDLKTRHLSMIAIGGSIGTGLFLASGNAIHTAGPG
FT                   GALVAYIAIGIMVYFLMTSLGEMATYMPVSGSFSTYATRFVDPAFGFALGWNYWFNWAI
FT                   TLAVDISTAAIIVQFWLPDTPAWLWSAIFLILIFGLNALSVKAYGESEYWFSIIKVATV
FT                   IVFLIVGVLTIVGILGGEVIGFSNFTAGDAPFKGGFFAILGTFLIAGFSFQGTEMVGIA
FT                   AGESATPEKSVPKAIKQVFWRILLFYIFAIFIIGMIIPYTSPNLLSADATDVAISPFTL
FT                   VFEKAGLAFAASVMNAVILTSVLSAGNSGLYASTRMLWAMARDKKAPRFLGNVNKRGIP
FT                   MAALIVTTIVGAMTFITTLTENGTVIYTWLLSASGLTGFIAWVGIAISHYRFRKAFVKQ
FT                   GHDLNELKYRAKFFPFGPILALILCILVIIGQDYAAFLNPEFSNPAWWQKIGISYIGLP
FT                   IFLIFWLSFKFVNKTKVIPLEDCKFDKK"
FT   gene            complement(738227..738988)
FT                   /locus_tag="lse_0696"
FT   CDS_pept        complement(738227..738988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0696"
FT                   /product="blue-light photoreceptor, putative"
FT                   /function="FOG: PAS/PAC domain"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0696"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26847"
FT                   /protein_id="CBH26847.1"
FT                   /translation="MAVYPKFDIILEALNLSSVGVIITDAEEKNNPIIFVNTGFENITG
FT                   YPKEDALGSNCHFLQGEDTDQEEVKKVRDAVNNKTTTTALLKNYRKDGSSFMNELTIEP
FT                   IYDDNDHLYFVGIQKDITTEHNYQLELEKSLREIEKLSTPIVPIKDNICVLPLIGSLTN
FT                   DRFQSMSEYVSEYMDNGKEEYLIMDLSGLADFNEDAIMNLVKFNGFMKLTGVELIVTGI
FT                   SPKFAMTLIRYEENLASLTTYSTIKEALQYY"
FT   gene            739140..739496
FT                   /locus_tag="lse_0697"
FT   CDS_pept        739140..739496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0697"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0697"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26848"
FT                   /protein_id="CBH26848.1"
FT                   /translation="MFITFTDSAKKRLEALRSDLPGQLHLYYDTEGCSCENSGIFTLRL
FT                   VEEKTKEDNVIESTIGPILIKQWTEIFLEDQLTIDYDDIEKTMILKSDGQYYNRNLLLV
FT                   TNEDEVISCPMSSI"
FT   gene            739650..740288
FT                   /locus_tag="lse_0698"
FT   CDS_pept        739650..740288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0698"
FT                   /product="RelA/SpoT domain protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0698"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26849"
FT                   /protein_id="CBH26849.1"
FT                   /translation="MQQPTVGELENWRNVMLLHRFALEEVNTKLKILNEEFQFIHDYNP
FT                   MEHLKSRVKSLESIGAKLEKKNLDITPENALKHVHDIAGIRITCSFVSDIFRIHEMLAG
FT                   QNDITILRVKDYVTNPKPNGYRSLHLLCEVPIFLTNRSEKMTVEIQIRTVAMDFWASLE
FT                   HKIYYKYQQEAPEELVKELQDAARIITHLDEKMKNLNDQIDQYKKEKEK"
FT   gene            740418..742475
FT                   /locus_tag="lse_0699"
FT   CDS_pept        740418..742475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0699"
FT                   /product="Na+/H+ antiporter"
FT                   /function="NhaP-type Na+/H+ and K+/H+ antiporters"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0699"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26850"
FT                   /protein_id="CBH26850.1"
FT                   /translation="MEIFLYVLALLVAIFISNLLNRFVPFVSVPLIQIGLGVMIALIPI
FT                   TFDLKLNPELFLVMFIAPLLFNDGRRTDKAALWGMRMPILVLALGLVFATVVVIGYFVN
FT                   WMIPTIPLAAAFALAAALAPTDAVAVSSLSGRINLPKRIMNLLEGEALINDASGLVAFQ
FT                   FAIAAMVTGVFSLLDASISFFVIAIGGVLVGLVLSWLKFKFLKWVRGLGMEDVTFHMLI
FT                   QILTPFLIYLAAEELHVSGILAVVAAGIMHSMERKKIDPQSVKLNIVSQSTWSVIIFVL
FT                   NGLVFLLLGTQLPSIIEVVWNDSGISNLQVIAYILSITAALILLRFVWVYLSWNIGAKK
FT                   REKHNKKTTRPKLRPVLLTSLSGVRGAVTLASALAIPFFLDDGTLFPQRALIIFLASGV
FT                   ILCTLIIATFILPLLAKNEEVTTEDERAEKATRIRILRNVIRELKEQTLPETKAATDEV
FT                   IEDYRRRIYDLQHDNNTNRGMDEREREKRLEIIEWQRANTQKMADNGELVATDSYRYQH
FT                   YLNMLEQAIKQRFRTKIKTAWLFVQRFIMLIIHPKKWRKIRHKMKKGISKDNVRFQAIR
FT                   KLREENEILVIQKLKDQLTEENADLIGPLITEHTMFLERVRNDQTLSRGKRAKSEQKKR
FT                   EVQIVAFQTERDIIQHLFETGGISRDLARELRQNLNMIETYLYDDFLATD"
FT   gene            742744..744612
FT                   /locus_tag="lse_0700"
FT   CDS_pept        742744..744612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0700"
FT                   /product="cell wall surface anchor family protein (LPXTG
FT                   motif)"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0700"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26851"
FT                   /protein_id="CBH26851.1"
FT                   /translation="MLKRVAVFILLLSLIVGVFPVNTPSAEETDGQLLAVLPTNETYET
FT                   IFPDDTLAKTVALAATGSEDTGQIVTQTDLNKVTSLNITETTDLVTNLEGVQYLTSMTN
FT                   LKAPNQDITDLSPIEQLIALTNVNFNGNANLEDISALYPLERLRYILLSDTSVKDLKPL
FT                   YNYSRRSLVEIDLENLDLYNEDIDTVLNQIHARESDDMLHLHLNGNHIIDFSSIHQFGR
FT                   GVQTATGQTYSLPSVKVGQELTLNNQIIFYADYLYPPSAISNNGEYVEPTYSWNGSDLA
FT                   DYPEQVSYSWNVDQGNTQFSGTVTQPLTYIRIQADEAISYPKKTVKTEEEFLNEVHAST
FT                   TDGSVITSDFADVVDFATPGVYEVTLNSEDANGLVAFPVKVQVTVEAKMGVPVITADNE
FT                   ISYPKDTVKTEADFLQEVHAKASDGSTVTSNFDSVVDLNVPGDYRVELNAANEDNAATP
FT                   IYVIVHVFSDQQEEGTVTAHYLDENGKSLAKDVRLVGEVGSAYETKAEKITGYTLKETP
FT                   TNANGEFTSDAQTVNYIYALNKKDDGDKTPDNPSNPNTPNNPNNPSAPDKKDIAVIVNG
FT                   GNNSTNEVAKEKSIVLPKTGDSNHSAPLLILGSLLLGIGILIKPKK"
FT   gene            744830..745372
FT                   /locus_tag="lse_0701"
FT   CDS_pept        744830..745372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0701"
FT                   /product="transcriptional regulator, Cro/CI family"
FT                   /function="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0701"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26852"
FT                   /protein_id="CBH26852.1"
FT                   /translation="MEIGKRIKNLRLSKNLTQEELGERTDLTKGYISQLERDLSSPSIE
FT                   TLFAILEVLGSTPKDFFDEEEHNQKVIYGELEHTFFEDEEKGYRIKWLVPESNEKEMEP
FT                   VLLEIEAKSCFKSFEPSLSETFGYCLKGEVTVMLGRNEYVAKTGEAIYFHAADEHQIIN
FT                   QSSEKAILILVATDSYL"
FT   gene            745387..746481
FT                   /gene="potA"
FT                   /locus_tag="lse_0702"
FT   CDS_pept        745387..746481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potA"
FT                   /locus_tag="lse_0702"
FT                   /product="spermidine/putrescine ABC transporter,
FT                   ATP-binding protein"
FT                   /function="ABC-type spermidine/putrescine transport systems
FT                   ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0702"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26853"
FT                   /protein_id="CBH26853.1"
FT                   /translation="MAETIIRFENVTKQFDNDPPVLDNVSFEIEKGKFYTLLGPSGCGK
FT                   TTILRLIAGFLEASEGQIYLGEKVINQIPANKRPVNTVFQDYALFPHLNVYENVAFGLR
FT                   IKKLKKEAIEEKVKEALRFVNLKGYEKREISEMSGGQKQRVAIARAIVNEPEVILLDEP
FT                   LSALDLKLRTEMQYELRDLQKRLGITFIFVTHDQEEALAMSDEIFVLNKGEIQQSGTPI
FT                   DIYDEPINKFVADFIGESNIVTGKMIQDFEVEFVERRFECVDQGFRPNETVEVVIRPED
FT                   LEITSAEKGKLQVTVDWMLFRGVHYEVGCIDTDGNEWLVHTTRKVRVDDKIGLAFDPEA
FT                   IHVMRLGETEEEFDKRLDSYDEVQ"
FT   gene            746481..747290
FT                   /gene="potB"
FT                   /locus_tag="lse_0703"
FT   CDS_pept        746481..747290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potB"
FT                   /locus_tag="lse_0703"
FT                   /product="spermidine/putrescine ABC transporter, permease
FT                   protein"
FT                   /function="ABC-type spermidine/putrescine transport system
FT                   permease component I"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0703"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26854"
FT                   /protein_id="CBH26854.1"
FT                   /translation="MNRRTRTVYLVPYVLWILLFVVAPILLIVYYSFFDVDGNLTVDNY
FT                   IHFFTPVYLKMTASSFWYAFLITVFTLLISYPTAYLLTKLKHKQLWLLLIILPTWINLL
FT                   LKAYAFIGIFGTYGAANQFLELMGIGSKQILFTDFSFLFVSTYIFIPFMILPIFNAIEE
FT                   INPTLIQASRDLGASSLTTFRRVIFPLTADGVKSGCQAVFIPALSLFMITRLIAGNRVI
FT                   TLGTAIEEHFLVTQDWGMGSTIGVFLIIAMILIMFLTGSKKKRGVRK"
FT   gene            747287..748093
FT                   /gene="potC"
FT                   /locus_tag="lse_0704"
FT   CDS_pept        747287..748093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potC"
FT                   /locus_tag="lse_0704"
FT                   /product="spermidine/putrescine ABC transporter, permease
FT                   protein"
FT                   /function="ABC-type spermidine/putrescine transport system
FT                   permease component II"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0704"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26855"
FT                   /protein_id="CBH26855.1"
FT                   /translation="MKKSKWGTIYLVLVFVILYAPIFYLIFYSFNKGGTMHNFSGFTLG
FT                   YYKEVFQDTRLLIIVLNTFVIALLSSVIATVIGVCGALAIKFMPKPFAKNSLLSLNNVL
FT                   IVSPDVIIGASFLIFFTILGVKLGFISVLVSHIAFSIPIVVLMILPKLQEMSPTLMDAA
FT                   RDLGASQWQVLSKVILPYIMPGVLAGFFMALTYSLDDFAVTFFVTGNGFSTLAVEIYSR
FT                   ARQGISLSINALSTLIFLFTIVLVIGYYFISKRNTTKTIRTGATKE"
FT   gene            748090..749163
FT                   /gene="potD"
FT                   /locus_tag="lse_0705"
FT   CDS_pept        748090..749163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potD"
FT                   /locus_tag="lse_0705"
FT                   /product="spermidine/putrescine ABC transporter, binding
FT                   protein"
FT                   /function="Spermidine/putrescine-binding periplasmic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0705"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26856"
FT                   /protein_id="CBH26856.1"
FT                   /translation="MKQLLKIFVPVVVVALLMMLLATSMNRSEGYAGSNTLTIYNWGDY
FT                   IDPSLITKFEKETGIKVIYQTFDSNEAMMTKIEQGGTTFDIAVPSDYAISKMKEEDLLI
FT                   PLDHSKLPNEKYLDPRFMDLSFDDNNKYSMPYFWGTLGIIYNKVMFPDKNFDTWDALFD
FT                   PDLKNQILLIDGAREVMGLGLNSLGYSLNDTNKAHLMEARDKLETMTPNVKAIVGDEIK
FT                   LLMADNEAGVAVTFSGEAAEMLSENEDLEYVIPKDGSNLWFDNMVIPKTAKNVDGAHKF
FT                   INFMLKPENAAINAEYVGYATPNEKAVKLLPKEISSDERFYPNMDELTNLEVYDNLGKR
FT                   MLSYYNELFLEFKMYRK"
FT   gene            749293..749994
FT                   /gene="cah"
FT                   /locus_tag="lse_0706"
FT   CDS_pept        749293..749994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cah"
FT                   /locus_tag="lse_0706"
FT                   /function="Carbonic anhydrase"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0706"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26857"
FT                   /protein_id="CBH26857.1"
FT                   /translation="MTVEKVKWGYDEKTGPDMWGHICSDFEIANTGKAQSPVNIEQSDV
FT                   EKIKPSTMRIYYKETDYTIKRIEQSVHVFPHDKEQGLRFNGEYYPLVSFHAHIPAEHLL
FT                   DGYIYPIEWHFVHEKADGTTLVMSAWMEIDNTTNVELKDLPKHFPEVFVDFETEREITL
FT                   DANEFLPEERVFYTYQGSRTTPPTVEGVTWIVLKNAKSLKQEDFTELDKAIGNTSRPIQ
FT                   DLNGREITFYN"
FT   gene            750063..750605
FT                   /locus_tag="lse_0707"
FT   CDS_pept        750063..750605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0707"
FT                   /product="HD domain protein"
FT                   /function="Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0707"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26858"
FT                   /protein_id="CBH26858.1"
FT                   /translation="MYEKARKMMIEAHKGQVRKITGEPYFSHPLNVARILRRACFSEDV
FT                   VIAGLLHDAVEDTSMTDQDIRQIFGDVVADLVASHTENKTLSWEERKAHTIEQVRTGTL
FT                   EEKALIVADKLDNLSSVKYALSSEGKSVWSYFNRGYDQQRWYNEGIKNNMEYGLNPAEI
FT                   PAFFEEYSRLVKWIFKR"
FT   gene            750741..751613
FT                   /locus_tag="lse_0708"
FT   CDS_pept        750741..751613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0708"
FT                   /product="fructokinase"
FT                   /function="Transcriptional regulator/sugar kinase"
FT                   /EC_number="2.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0708"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26859"
FT                   /protein_id="CBH26859.1"
FT                   /translation="MVYGAIEAGGTKFVVAIGKESGEIIKRESYPTTEPAETMKAVIQF
FT                   FKQYQDELKAIGIGSFGPIDIRKSSPTYGYITQTPKLAWRNYDIVGAMKKEFNVPIGFT
FT                   TDVNAAALGEVSLGAAAGLSSCIYLTIGTGIGGGAVVSGKILEGFSHPEMGHIMVRRHK
FT                   LDRFTGSCPSHSDCLEGLAAGGAIEKRWGKKGVELADDEEVWNLEAHYIAQALMNYTLI
FT                   LSPERIVLGGGVMKQRQLFPLIRQKLKALVNNYVQLPDLEEYIVPPKLEDNAGITGCVL
FT                   LAVDALKSK"
FT   gene            751721..752398
FT                   /locus_tag="lse_0709"
FT   CDS_pept        751721..752398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0709"
FT                   /product="DNA-binding two-component response regulator"
FT                   /function="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0709"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26860"
FT                   /protein_id="CBH26860.1"
FT                   /translation="MKQILVVDDDKHIRQLVGHYLRREGFAVLEAMDGEAAEQIVTSQQ
FT                   VHLAVIDLMMPKMDGFELCQKIRTSYPEIPVIMLTAKDALIDKSRGFEVGTDDYVTKPF
FT                   EPEELVFRIRALLRRSTQASEVKIKIGQLTIDQKSYGIKIGNRELMIPVKEFELLYQLA
FT                   SYPGRIFTREELIERIWKRDYDGSDRTIDVHIKRLRDHFDEEKAGIRITTVRGVGYKLE
FT                   EIR"
FT   gene            752395..753774
FT                   /locus_tag="lse_0710"
FT   CDS_pept        752395..753774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0710"
FT                   /product="sensor histidine kinase"
FT                   /function="Signal transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0710"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26861"
FT                   /protein_id="CBH26861.1"
FT                   /translation="MKSLYSRIVITMLVVILASSLLGFFLANIYYQLKLKPFNDEKTTK
FT                   IAQEVQQFYQSNASLSLDEYLQSVGELGYELYLTDGGADSSYYGGEFRKKALPEKTVDR
FT                   VLRGETYHGIDEFNTGIFITGFFDNDIQNTIGVPVKVDGETEALFIRQDPEQQFGELRI
FT                   FFAMILVFTSIISILLVLISGRYIVNPIVKLTNATKQIRKGNYDVALEVKRKDEIGQLA
FT                   DSFAKMTGELEKSEAARQEFVANVSHELQSPLTSMQGFATLLASDTLTEKERAEYLAVL
FT                   SEETTRLSSLTKQLLTLASLDQEAELRKKDQVQLEVQWRQLLQTTEWSWRAKEITINLE
FT                   LDKVNCTGDAELLYQVWSNLLTNAIKFTPTSGTINIRLYQDASHAFVEVEDSGIGISEA
FT                   DIDKIFQRFYKANHSRTREEGSSGLGLSICKKIIHLHHGEIFVESKSEKGTKFTIKLPK
FT                   N"
FT   gene            753853..754941
FT                   /locus_tag="lse_0711"
FT   CDS_pept        753853..754941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0711"
FT                   /product="ABC transporter, permease protein"
FT                   /function="ABC-type antimicrobial peptide transport system
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0711"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26862"
FT                   /protein_id="CBH26862.1"
FT                   /translation="MFLALRELKHAKLRYFLIVLIMVLIAWLVLFVTGLASGLANDNGA
FT                   AISSNKATYYVLQKDSDNRLTRSNLTAAETEDVAKQVEKSKSTNLGVQMGTITKPKQDK
FT                   KTDITYFGIDKASFLQPDISEGAKPQTNKEVIADISLKESGYKLGSKVEDSATGEQFTI
FT                   TAFTKNNTFSHSPVIFVGWDAWKLIHQTNQAAQGEYNAVALDVSQNKAESLSLGSLELS
FT                   SSKEVLQGIPGYSEEQGSLLMMIAFLFVIAAFVLAAFFYVITIQKINQFGILKAVGART
FT                   AYLGRSIISQVVFLSVVSLLIGNGLTFGLAAILPASMPFTLSPLLAIGCSVLFLVVAVA
FT                   GSMLSLYRVAKVDALEAIGRAN"
FT   gene            754941..755609
FT                   /locus_tag="lse_0712"
FT   CDS_pept        754941..755609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0712"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /function="ABC-type antimicrobial peptide transport system
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0712"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26863"
FT                   /protein_id="CBH26863.1"
FT                   /translation="MTLIMKNISKSYQDGEQQIEVLKNVSLEVAQGEFVAILGPSGAGK
FT                   STFLSIAGALLSPTTGEILIGGKGLSNLSNKELTKVRLDKVGFIFQGANLIPYLNVRDQ
FT                   LLLIAELAGQKGSKAKEKAATLLKELGLEARQNNYPESLSGGEKQRVAIARSLMNDPDI
FT                   ILADEPTASLDADRGHKVVQMIADEVKKKNKAAIMVTHDERVLDLVDRVIRIEDGYLKE
FT                   "
FT   gene            755792..756490
FT                   /locus_tag="lse_0713"
FT   CDS_pept        755792..756490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0713"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0713"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26864"
FT                   /protein_id="CBH26864.1"
FT                   /translation="MIKERKIVLITSLFFIALTFLALLFQREIIWNMVSGHFDASVSNI
FT                   INLLAGNDLVTFFLHQIIAALKSTIFLIIIELLFIMVIPVFIIIVMFRAKKKEGWTKSS
FT                   IAITSGYSLLLVSLLSFMVLFSVQSLHTYQNIHENVVTAKKTILAHNSQKIEDSLANII
FT                   DNPQKSVQKIKEVSKQLDDHTGIFTLLSEWLNKVKGYENLLTFGVVIGFLLILIAHISE
FT                   LYLLWKKPQN"
FT   gene            756633..757562
FT                   /locus_tag="lse_0714"
FT   CDS_pept        756633..757562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0714"
FT                   /product="2-nitropropane dioxygenase family protein"
FT                   /function="Dioxygenases related to 2-nitropropane
FT                   dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0714"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26865"
FT                   /protein_id="CBH26865.1"
FT                   /translation="MSITNLLNIKYPIIQGAMAQIAKAPLVAAVSNAGGLGIIASGGMS
FT                   ADMLREEIQKTKALTDKPFGVNLMLMMTNIAELTEVIIEEKIAIVTTGAGTPKTFMPIW
FT                   KEAGIIVIPVVPSVMIAKRMEKMGADAVVAEGTEAGGHVGETTTMALLPQIADAVNIPV
FT                   IGAGGIADGRGIAAALALGAQGVQIGTRFLATDECPVHPDFKAAVIKASDRDTMVTGRK
FT                   SGAPVRSIKNKMIKEYIRLEEENADRDTLEELTLGSLRKAVQEGDTDNGSVMAGQIAGL
FT                   ITEIKPCKDVIEEMMAETKQVIAKLQLN"
FT   gene            complement(757608..758015)
FT                   /locus_tag="lse_0715"
FT   CDS_pept        complement(757608..758015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0715"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0715"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26866"
FT                   /protein_id="CBH26866.1"
FT                   /translation="MPFAVPYLVFNGEGQEALTFYADVFEAEITSVQRFKEMKNFDGDA
FT                   VFGERLMHSRLAKGGEEFIYITDAPYDGFTIGNRVTILINFESEDDIKRAYEALIIGGK
FT                   IEMELQVAFWGSTYAQVTDKFGVFWQLNFGS"
FT   gene            758245..760875
FT                   /locus_tag="lse_0716"
FT   CDS_pept        758245..760875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0716"
FT                   /product="cation transport ATPase, E1-E2 family"
FT                   /function="Cation transport ATPase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0716"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26867"
FT                   /protein_id="CBH26867.1"
FT                   /translation="MLWVKESIEQLLSKLHTNLETGLTKEQVKQKHAEFGTNEFEEGKK
FT                   ESLLQKIGHHLLEITTIVLLFAAAISAYLAITTGYGWAKVVVILAIVVLNMILGIYQEN
FT                   SAEKALAALQSMNAHLTTVLRDGVRMQVDATELVPGDIIEVVAGDMIPADARIISSSSL
FT                   QVEESALTGESVPVEKDAAAEVSEKAPIGDRLNMLYSGCLVTNGRATAVVVEIGMETEM
FT                   GKIAGLLNSTSKLMTPLQLRLKELAKRLSIVALLAGILIFIIDVYIYGETIIETLMIAI
FT                   SLAVAAVPETLPVIVTLTLAYGVQNMVRKNTIIRRIPAVETIGNTSVICSDKTGTLTQN
FT                   KMIIQQIWASEHTPMKATAEFGTEEVKVLEMLSLSSNATIDVTDGKETIIGDPTESAII
FT                   RLLEEKGTTKKALEEKYPRVFELPFDSDRKLMTTIHQVEEGFLSITKGAFDRIPVAFSE
FT                   ELLKEAERVHDSFAEDALRVLVVAYKRYSEMPTDLSSEALETDLTFAGMVGMIDPPRPE
FT                   SKSAVLAAKKAGIKTVMITGDHIVTASAIAREIGILTDMDKAITGAELQEMSDADLEKN
FT                   IRDYAVYARVSPEDKIRIVKAWQKNGEIVTMTGDGVNDAPALKAADVGAAMGITGTDVS
FT                   KNAADMVITDDNFATIVDAVKEGRTAYENIRKTIYFLLSTNFSQIFIMLIAIILGWGAP
FT                   VVAVQLLLINVVSDGIPGFFLSREKADDSIMERKPIPKNAGIFANGLGKKMATQAVVFT
FT                   VVTLAGFYIGQFVTINHSVGASYEVGMTMAFIILAWSSVAHIFNVRSDKSIFTIGFLSN
FT                   RGLFFSAICSMLIILGLAIIPPLANMFFLVEMSLTHWILAFVLSMLPLVFVEIQKLIQR
FT                   KKANA"
FT   gene            760890..761744
FT                   /locus_tag="lse_0717"
FT   CDS_pept        760890..761744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0717"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0717"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26868"
FT                   /protein_id="CBH26868.1"
FT                   /translation="MNATEKLVASSLERNFGQEISTRYQGNEQAQMRSKEVIKEIAAVV
FT                   EPLVATLGIESKTVKKTIPFLYELQKNQFCDMSAYPYPLLLVNGTSENTEKYWRDLPTY
FT                   WTDEANKIALPYVVEHIKRNPARQKMLEFHEWLLTVVEQINQQLDAAFRVKLVFESDMR
FT                   IRLRVYEVNQIAIEVHFLDNHDTEQQHLAYDVSLDAELEIKARLLLRQGILTENLNLEA
FT                   LKIYTKAVLPIAHSLENLSGRGLTAEETKKLTKLLTKEEPKIMEDTDLTSKAVAFLQEA
FT                   VQK"
FT   gene            761856..762413
FT                   /locus_tag="lse_0718"
FT   CDS_pept        761856..762413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0718"
FT                   /product="acetyltransferase, GNAT family"
FT                   /function="Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0718"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26869"
FT                   /protein_id="CBH26869.1"
FT                   /translation="MIRQAKKTDAPKIAPLLLIIWKDMELPILEMESEEAITNALIEAI
FT                   QTETYRYSYRHLHVYEKDGDIAGVLAGYPGKLEPKIDDVWDDIAKKHGITFEEPIFEDK
FT                   ETFAGEWYLDSIVASEKYRGYGVGTALLNKLTEIAAKDGEKVVGLNCDKGNPNAKRLYE
FT                   RIGFHVTGEVVLNGHKYDHMQK"
FT   gene            762431..763090
FT                   /locus_tag="lse_0719"
FT   CDS_pept        762431..763090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0719"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0719"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26870"
FT                   /protein_id="CBH26870.1"
FT                   /translation="MKKIIFTAIVSLVLLLSGCADVTNTVKVDKKGDATISFDIDISSV
FT                   AGIFASSYSEEALTKLEDAGFKVDKKSNTSYHIEKKLEQSSTKSDMKPEDFGVKITNTK
FT                   SFFTQKVRIDANIDPEKIWKKEVADVPFPKEILDQINYTLILDLPVSTIGDNNAKSVDG
FT                   GKLTWDVPLAEKSEMYFEVTLPNVKNIAIVGGVLLVGVIVLIIYLVRKHRKKKKIA"
FT   gene            complement(763105..763494)
FT                   /locus_tag="lse_0720"
FT   CDS_pept        complement(763105..763494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0720"
FT                   /product="transcriptional regulator, MerR family"
FT                   /function="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0720"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26871"
FT                   /protein_id="CBH26871.1"
FT                   /translation="MQQTIKEASARTGLSAHTIRYYEREGLIPFLGRDKNNNRIFDHDA
FT                   LHWLELLTCLRVTGMPLAKQKEIVELTKCGDDTVSDRIAVLKEHQEEMYRRQAEMDRAF
FT                   KKIEKKLACYEELEKEVNKKVDKLG"
FT   gene            763613..764437
FT                   /locus_tag="lse_0721"
FT   CDS_pept        763613..764437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0721"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /function="Aldo/keto reductases related to diketogulonate
FT                   reductase"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0721"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26872"
FT                   /protein_id="CBH26872.1"
FT                   /translation="MNLKDTVKLTNGVEMPRLGFGVWKVKDGDEAVNSVKWAIEAGYVS
FT                   IDTAAAYKNEEGVGQAIKESGVKREDLFVTTKLWNAEQGYESTLAAFDESLRKLELDYV
FT                   DLYLIHWPVKGKFKDTWRAFEKLYNDKRVRAIGVCNFHEHHLKELMEDAEIAPMVNQIE
FT                   LHPELTQEPLRNYCAEHNIVVEAWSPLGNGKLLDNAEIKAIAEAHGKSVAQVILRWDLQ
FT                   IGVVTIPKSVHQERIIQNADIFDFELTEDEVAKISALNKDKRTGPDPDNFNF"
FT   gene            complement(764516..771388)
FT                   /locus_tag="lse_0722"
FT   CDS_pept        complement(764516..771388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0722"
FT                   /product="conserved hypothetical protein (LPXTG motif)"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0722"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26873"
FT                   /protein_id="CBH26873.1"
FT                   /translation="MKRIYLSAVIICLTFSIVAPIPATVYAETTPSDETTPNNAEEQAT
FT                   LETPTPPPSETDEKEATKTEPSKDEIANSSDTSANKANSDEKETTTDKNTTNTNAKEQT
FT                   PTNQVLAAGDTFIETFPDEAFAKVIALQVTGSEDTSQVVTQTQLDSVTTLDVSSQNITD
FT                   VTGISELTNLTSINLSENQLTSIAPITGLTNLTTINLSDNLLNTIELSSAQNIPNLTTL
FT                   DLSDNPTITKLSIADLPKLETANMTTSAGQTSLLEEITLSNLPVLTSVGKTSANAINFS
FT                   NYSANLSNVKLDSLPKIGTVDFSSNNLSDINVQDMSSVTLINLDTNNLSDISNFLNLPV
FT                   LDNLVVSTNHIGVLPTNLETEAPALRTLFANNQIITLPNKVVTGDLSIPNEVSNNGVIS
FT                   APTGISNSGVYADGNVNWDFDNIKNSSSVSYSFSEALNYTNIQGTFFGTVTQPITVSVA
FT                   PVITADDSFSYPKSSTVTETEFLSDINATTSDGSPITSDFATVVDFSTPGDYTVTLNSV
FT                   NTDGATADPVTVTVTVEKAPAPVITADNTISYPKNSTVDSEQFLADVNATTDDGSPITS
FT                   DFATVVDFATPGDYTVTLNSVNSDGVAASPVTVTVTVEKATAPVITADSTISYPKNSTV
FT                   DSQQFFDDINASTNDGSPITSDFDTVVDFSTPGDYTVTLNSVNADGVAASPVTVTVTVE
FT                   KAPAPIITADNEITYMKNSTISSAQFLTDISATTNDSSPITSDFDTVVDFTTAGDYTVT
FT                   LQSLNSDGVAANPVSVIVHVAKDPAPVITADNTISYPKNSTIDSQQFLADVNATTDDGS
FT                   SITSDFATVVDFATPGDYTVTLNSVNSDGVAANPVTVTVTVEKAPAPVITADSAISYPK
FT                   NSTVDSQKFFDDINASTNDGSPITSDFDTVVDFTTAGDYTVTLNSVNSDGVAASPVTVT
FT                   VTVEKAPAPIITADNEITYMKNSTISSTQFLTDISATTNDSSPITSDFDTVVDFTTAGD
FT                   YTVTLQSINSDGVSANPVNVIVHIAKDPAPVITADSAISYPKNSTIGSQQFLADVNATT
FT                   DDGSSITSDFATVVDFATPGDYTVTLNSVNSDGVAANPVTVTVTVEKAPAPVITADSAI
FT                   SYPKNSTVDSQKFFDDINASTNDGSPITSDFDTVVDFTTAGNYTVTLNSVNSDGVAANP
FT                   VTVTVTVEKAPAPVITADSAISYPKNSTVDSQKFLTDVSAATDDGSSITSDFDTVVDFT
FT                   TAGNYTVTLNSVNSDGVAADPVTVTVTVEKAPAPIITADNEITYMKNSTISSAQFLTDI
FT                   SATTNDSSPITSDFDTVVDFTTAGDYTVTLQSLNSDGVAANPVSVIVHVAKDPAPVITA
FT                   DNTISYPKNSTIDSQQFLADVNATTDDGSSITSDFDTVVDFTTAGDYTVTLNSVNADGV
FT                   AANPVTVTVTVEKAPAPVITADNTISYPKNSTVDSQQFFDDINASTNDGSPITSDFDTV
FT                   VDFATPGDYTVTLNSVNSDGVAASPVTVTVTVEKAPAPIITADNEITYMKNSTISSTQF
FT                   LTDISATTNDSSPITSDFDTVVDFTTAGDYTVTLQSINSDGVSANPVNVIVHIAKDPAP
FT                   VITADSAISYPKNSTIGSQQFLADVNATTDDGSSITSDFDTVVDFTTAGDYTVTLNSVN
FT                   SDGVAADPVTVTVTVEKAPAPVITADSEITYMKHSTISSAQFLTDISATTNDSSPITSD
FT                   FATVVDFETAGDYTVTLQSLNSDGVTASPVTTVVHVEKDPAPVITADNTISYPKNSTID
FT                   SQQFYTDVNATTDDGSAITSDFDTVVDFTTAGNYTVTLNSVNSDGVAASPVTITVTVEK
FT                   APAPVITADNEVSYPENSTIDSQQFLTDINATTDDSSPITSDFATVVDFSTAGDYTVTL
FT                   NSVNSDGVAANPVTVTVTIEKAPAPVITADNEVSYPENSTIDSQQFLTDIHASTSDSSP
FT                   ITSDFATVIDFSTAGDYTVTLNSVNSDGVAANPVTVTVHVEKAPAPVITANNEVSYPEN
FT                   STINSQQFLTDINAITNDGSLITSNFDTAVDFSTAGDYTVTLQSVNADGVAANPVTVIV
FT                   HIEKAPAPIITADSKVSYPEKSKITAAQFYKDIHAKTNDGSSITSDFDTIVNFQVAGDY
FT                   KVTLRSVNADGVAAKPVTVTVHIEKAPAPVISTDSEISYKINSKVDSQQFYKDIHAITN
FT                   DGSTITSDFDTVVNFAVAGDYTVTLQAINSDGVAADPVKVIVHITANEPTPTPTPPTPP
FT                   NNGNNSGNNTGNTNNPTSNSGSNTSLPSTGDTTTGSSAGILLLLIACSLLYASRKNKHT
FT                   DKK"
FT   gene            complement(771627..776780)
FT                   /locus_tag="lse_0723"
FT   CDS_pept        complement(771627..776780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0723"
FT                   /product="internalin-like cell wall surface anchor (LPXTG)
FT                   protein"
FT                   /function="Leucine-rich repeat (LRR) protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0723"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26874"
FT                   /protein_id="CBH26874.1"
FT                   /translation="MKKFYLSIVTICLIFSATAPLPVTVYAETNSPEEISPNNTEEKPT
FT                   QEGATTPSTETNEKEPATADKTNEETTNTSNKATDTTSSSEKETTPDIKTTTPSPKEKA
FT                   AVNQVLAAGDTYIDTFPDEAFAKVIALQITGSDDTSQVVTQEQLDAITSLNASGKNITD
FT                   VTGINQLTNLTTIDLSQNQLTSIEPITNLTSLTSLNVSNNLLSSVVITTAQNIPNLTSL
FT                   NISNNPTITKLSIADQANLTSFSASLGGGVQSALEELTLSNLPALTQATGSTNSANSVN
FT                   FSNYSDVLATVKLNGLPKIQRANFDSNLINDIDVHDMAGLTYLDLHSNELTDINKLADL
FT                   PALTSLDVDSNQLTNAGIANVVQLDALQTLDLSSNLLTSFTLDAENDLPNLTNLSLSSM
FT                   PTITNIHIADQAKLTSFNASLGGGVQSALEELTLSNLPALTQAVGSTNSANSVYFSNYS
FT                   DVLTTVKLNGLPKIQRVYLQNNLIDDIDVHDMAELTYLDLDSNELTEINKLADLPALTS
FT                   LDVDSNQLTNAGIANVVQLDALQTLYLSSNLLTSFTLDAENDLPNLTNLSLSSMPTITN
FT                   IHIADQPKLATVTATLNTNQVSQLEELTLSNLPALTQVAGSSNSANSIYFTNYSDVLTT
FT                   VKLNGLPKIQRVYLQNNLIDDIDVHDMAGLTYLDLHSNELTDINKLADLPALTSLDVDS
FT                   NQLTNAGIANVVQLDALQTLYLSSNLLTSFTLDAENDLPNLTNLSLSSMPTITNIHIAD
FT                   QPKLATVTATLNTNQVSQLEELTLSNLPALTQVAGSSNSANSVYFSNYSDVLTTVKLNG
FT                   LPKIQRANFDRNLINDIDVHDMAGLTYLDLHSNELTDINKLADLPALTSLDVDSNQLTN
FT                   AGIANVVQLDALQTLDLSSNLLTSFTLDAENDLPNLTNLSLSSMPTITNIHIADQAKLT
FT                   SFNASLGGGVQSALEELTLSNLPALTQAVGSASSANSVYFSNYSDVLATVKLNGLPKIQ
FT                   NADFDSNFIDEVDVHDMAALTTLDLHANELTDINNLQDVPLLNNINVDNNHIAVLPTNL
FT                   ETQVPNLKTLSAGSQTISLPTQIVSGDLSVANGISNNGVISAPTTISNSGVYQDGNVNW
FT                   VYDDIKNLSSVSYNFSEPVNYSGVVGTFSGTVTQPIKVSLAPVITAEDSITYPKFSTVT
FT                   EAEFLTDIQASTSDDSSITSDFGTVVDFSTPGDYTVTLNSENEDGVPANPVTVTVTVEK
FT                   APAPIITADSEITYMKHSTITSAEFLTGIHATTNDGSPITSDFETVVDFETAGDYTVTL
FT                   QSVNSDGIAATPVTVTVHVEKAPAPIITADSEISYAKNSAIDSQQFYNDIHASTSDGSP
FT                   ITSDFETVVDFSTSGDYTVTLNSVNEDGIAASPITVVVHVEKTPAPIITADSEISYAKN
FT                   STIDSQQFYNDIHASTSDDSPITSDFETVVDFTTPGDYTVTLNSVNSDGVAADPVSVTV
FT                   HVSKDPAPIISADSEITYSKHSNISPAEFLTGIHATTNDGSPITSNFETVVNFEKAGDY
FT                   TVTLQSMNSDGVLATPVTVIVHIAKDSAPIITADSEISYKINSKVDLQQFYKDVHAATN
FT                   DGSPITSNFKTAVNFAVTGDYTVTLQAKNSDGVEADPVKVIVHITANEPTPPDNNGNSS
FT                   NSGNSSNSGNSSNSSNSSNNSSTSSSNSAGNSTTNNSNKEGQQTNNSLPDTGDTNNSLV
FT                   GIFFLLIAFSIFRTAKKKVK"
FT   gene            777465..778433
FT                   /locus_tag="lse_0724"
FT   CDS_pept        777465..778433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0724"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0724"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26875"
FT                   /protein_id="CBH26875.1"
FT                   /translation="MNTNILIENRFINQKLAPITWLDSPEDIVAHFGAMQAQNYGQALW
FT                   AVGSRLITPNELAVKTAINEGRIIRAWLLRGTIHLFAAKDYHWMMDLIAPMIDKICQPY
FT                   RTKLGLTNEVLLKASEVVQGFVSNGPVTRKNLAEHLAQNHLPSAGIPFAQLLVYLSSRK
FT                   IICSGPDETYQNTLHIPAATRDYSRSEAIGELAKRYVQSHAPATLKDFCFWSGLSVADA
FT                   KIGLAQFSKYGDFFATELTKNPVTLETIPLAGFDEWIIGYRDRSIVLDEVWREEIITKN
FT                   GIFRPAIISAGKVVGKWEKPKKLNELETDYWKRYIQFRSML"
FT   gene            778471..779748
FT                   /locus_tag="lse_0725"
FT   CDS_pept        778471..779748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0725"
FT                   /product="hydroxymethylglutaryl-CoA reductase, degradative"
FT                   /function="Hydroxymethylglutaryl-CoA reductase"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0725"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26876"
FT                   /protein_id="CBH26876.1"
FT                   /translation="MEAFDKFYKKTLEERREILAEYAELTEEEQAFLASTGALSLEKAN
FT                   HMIENTIGIYSLPLGLGMNMRLNDKDYIVPMAVEEPSVIAAQSSGAKIIAQNGGVTGTA
FT                   TERKMIGQIELIDVPDTKLAIEKITVNQDKLLLIANEAHPSLQRRGGGAVDLVARTVTT
FT                   MQEDELLIVHLLVDTKEAMGANMINTMVESLAPELEQLTAGIANMRILSNLVDDATATV
FT                   SCRIAPASLATKTHTGEWVRDRIIAAYEFADADVYRAATHNKGIMNGIDAVVMAFGNDW
FT                   RAVEAASHAYAARTGSYKPMTKWSKDKDGFLLGELTLPMPVAFVGGSIAVHPIATLSKK
FT                   IARMESAKELAMLVCAVGLTQNLAALKALVTEGIQRGHMSLQAKSLAMTAGAEANEIEA
FT                   VAAYLQETKQMNVMAAKEYITKLRQN"
FT   gene            complement(779811..780380)
FT                   /locus_tag="lse_0726"
FT   CDS_pept        complement(779811..780380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0726"
FT                   /product="acetyltransferase, CysE/LacA/LpxA/NodL family"
FT                   /function="Acetyltransferase (isoleucine patch
FT                   superfamily)"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0726"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26877"
FT                   /protein_id="CBH26877.1"
FT                   /translation="MNDSNLLKKIVEKDILPDSALFKEIHLVKQSNERLIAKLNTQYHP
FT                   KEEVLDYLQKITGKTIDASVDISLPFYSDFGKHITFGKNIFINQNVTFVDLGGIIIEDN
FT                   VLIGPRAMLITVNHLIAPKARRGVRASPIHVKKNAWIGANATILPGVTIGENSIIAANS
FT                   TVTKDVPANVIVAGTPAKQISKVEAI"
FT   gene            780501..781367
FT                   /locus_tag="lse_0727"
FT   CDS_pept        780501..781367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0727"
FT                   /product="transcriptional regulator, LysR family"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0727"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26878"
FT                   /protein_id="CBH26878.1"
FT                   /translation="MELRVLNYFLTVAREKTISKAAEVLHLSQPTLSKQLKDFEEELGV
FT                   KLFIRGNRYITLTEEGVYLANRGKEILSLVEITTANIHKSDMISGQIGIGAGETRAFEF
FT                   IVERLHELKSKHPAINFQLYSGNANDVLDKIDHGLLDFGLVIDPVEKQKYDYLRLPLVD
FT                   KWGLLVNNSSDLAGKKSIAPNDLRQVPLLISNQSLVDNQLSEWLGGNLDSLNIIGTYNL
FT                   LYNASLLVKENISSALCIDGIINTTNTNLTFIPLSPSLTASINIVWKKQQSFSSASKAF
FT                   LQLIQEE"
FT   gene            781571..783205
FT                   /locus_tag="lse_0728"
FT   CDS_pept        781571..783205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0728"
FT                   /product="Na+/Phosphate-cotransporter family protein"
FT                   /function="Na+/phosphate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0728"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26879"
FT                   /protein_id="CBH26879.1"
FT                   /translation="MGDIDIQQMIFQFIGGLGIFLFGIKYMGDGLQMAAGDRLRDILDK
FT                   YTTNPFMGVLAGILVTVLIQSSSGTTVLTVGLVSAGFMTLKQAIGVIMGANIGTTVTAF
FT                   IIGIKLSEYALPIIAVGAVLLFFFKNHKVKNIGQVFFGFGALFYGLDLMGQGMEPLAGM
FT                   ESFHELTAQMSTNPFLGLLIGTIFTAVVQSSSATIGILQELYGQGAIDLQAALPVLFGD
FT                   NIGTTITAILAAIGASVAAKRAAATHVIFNLIGALIFMLILPLFTSFITYLQGLFGLNP
FT                   EMTIAVAHGTFNVTNTFIQFWFIGAFAWLVTKLIPGDDSRIDYKTKHLDTNLIDQSPGI
FT                   ALEMAREETLRMADYAKFGLQEAREYLVNRESKHAESTVQVEEAVNNLDRKITEYLTKI
FT                   SSVALTDNETEEHALMLDTVRDIERVGDHMENIVENIDQLIKNKAKMSEAASDQLIGMF
FT                   ELTTANFERAVKAMHKKDRALAEETIVVEKDIDKAERKLRKDHIKRLNAGECQVVSGIL
FT                   YIDIVSDLERIGDHANNIAEAVLELNE"
FT   gene            783364..787014
FT                   /locus_tag="lse_0729"
FT   CDS_pept        783364..787014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0729"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase"
FT                   /function="Pyruvate:ferredoxin oxidoreductase and related
FT                   2-oxoacid:ferredoxin oxidoreductases alpha subunit"
FT                   /EC_number="1.2.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0729"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26880"
FT                   /protein_id="CBH26880.1"
FT                   /translation="MRNRKTMDGNTAAAYISYAFTEVAAIYPITPSSTMAELVDEWASK
FT                   DKKNLFNEPVKVVEMQSEAGAAGTVHGSLQAGALTSTYTASQGLLLMIPNMYKIAGELL
FT                   PTVFHVSARTISAASLNIFGDHSDVMAARQTGFVMLAEGSVQEVMDLSAVAHLASLKGS
FT                   LPFLNFFDGFRTSHELQKVEVLEYSELENLLDKKALQQFRDRAMTPNNPKTIGSNQNPD
FT                   IFFQQRETVNRYYEEIPSIVQNYMEEINQLRGTNYDLVNYYGAKDATEVIVAMGSVTPV
FT                   IEQVIDYLTNQGKKVGLLNIRLYRPFPVENFLEKLPKTVERVAVLDRTKEPGSGGEPLL
FT                   LDVQSVLYDSDVRPVVIGGRYGLGSKDVTPDQILGVYSHLTEAKPKPRFTIGITDDITN
FT                   LSIENTGPSDLTSEKTFQCKFWGFGSDGTVGANKAAIKIIGDNTDLYAQGYFSYDSKKS
FT                   GGLTVSHLRFGEKRIRSAYLIQQADFVSCSTSAYLRSYDLLKGLKPGGTFLLNTIWEGE
FT                   QLERHLPAAMRSYIAKNNIQFYTLNAMKIAGNAGLGRRINTVMQTAFFRVTDILPFEKA
FT                   LADLKESAIATYGKKDMKVAEKNIIAMDQTVANLHKVDVPESWANPETTLAEKASTERP
FT                   AYVKNILEPVNRLEGDALTVGDLIANGMVSGAYPAGTAAYEKRGIALEVPEWISENCTM
FT                   CNECAFVCPHAAIRPILTDEAEMASAPEGFMTRKMRGKDGLEYRIQVSPMDCTGCNLCA
FT                   ETCPAKDKALVMKPFEEIAAKENPNWSFAINVKPKKNPGKKNTVPGSQFEQPLLEFSGA
FT                   CAGCGETPYVKLLTQMFGDRMMIANATGCSSIWGASAPATPYTVNDQGHGPAWGNSLLE
FT                   DNAEYGYGMYLANQTMRKALSNKVSKALTEETLSANLRDALVDWQTNMAVSEDTRERAE
FT                   QLQLALLSEMQGNAILESIYNDRELFIKRSQWMLGGDGWAYDIGFGGIDHVLASGEDVN
FT                   IFVMDNEVYSNTGGQSSKATPTAAIAKFASGGKSVGKKDLGIMAMSYGNIYVAQIAMGA
FT                   SKRQTLKAIEEAEAYPGPSLIIAYTPCINHGISSGMKTMLTETQKAVECGYWSLYRYNP
FT                   ALEAKGKNPMIMDFKKVDFDQFEDFLKRETRYSALYKANPEVASKLSEKTRSDAEKRFK
FT                   RYAVMAGLDLEKILKKKELTETSDAPPVDDERAARKAAREARRLAREQEK"
FT   gene            complement(787266..789227)
FT                   /gene="fbp"
FT                   /locus_tag="lse_0730"
FT   CDS_pept        complement(787266..789227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbp"
FT                   /locus_tag="lse_0730"
FT                   /product="fructose-1,6-bisphosphatase"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /EC_number="3.1.3.11"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0730"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26881"
FT                   /protein_id="CBH26881.1"
FT                   /translation="MEEIDMKYLRLLAKQYPTIAKTATEIINLEAIMNLPKGTEHFLSD
FT                   VHGEYSAFEQVLRNGSGVVKRKIRDIFGTELDDAEINSLSTLIYYPEEKMDLIAEELED
FT                   MHDWYRTTLFRLIEFCQYVASKYTRSKVRKAMPEDFAYILEELLQENYNEDDKKMYYEE
FT                   IIQHIISLDRAEEFISALSRLIQQLVVDHLHIVGDVYDRGPYPDKIIDTLMNYHSVDFQ
FT                   WGNHDILWMGAASGSKVCAANVIRISARYLNLDILEDSYGISLRPLALFADEIYHDDPC
FT                   TYFQPKNEDGAEYSNAEITQIARMHKAIAIIQFKLEGEIIARHKEFKMEHRLLLNFIDY
FT                   QTGTIRLKGQKYDLLDTNFPTIDPANPYQLTSAEKELIEKITAAFKNCRRLQKHVQFLY
FT                   AKGSMFLTYNGNLLYHGCIPLHEDGSFMAMELRNKNYSGQALLEQFEILTREAYVRPAG
FT                   TKEKKYACDIVWYLWTGAISSLFGKSEMTTFERYFIADKATHTEEKNPYYKLRNEEVIC
FT                   QQILEEFGLDADCGHIINGHTPVKENKGESPIKADGKMLVIDGGFAKAYHKKQDLAGYT
FT                   LLFNSYGLQLVSHQPFTTKEDAIKNETDILSTRQVIEMEINRKRVKDTDIGKQLNTQAE
FT                   DLKKLLTAYRNGLLHESH"
FT   gene            complement(789340..790251)
FT                   /locus_tag="lse_0731"
FT   CDS_pept        complement(789340..790251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0731"
FT                   /product="membrane protein, putative permease"
FT                   /function="Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0731"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26882"
FT                   /protein_id="CBH26882.1"
FT                   /translation="MQFLLILLPVFGIFAIGFIGQKTLKFDIPNLSKLTLYLMSPFLAF
FT                   NTFYTNPLTIDYLYLAIYIFALCLSLILLVSLISFLLGYNLQDRCALILASAFMNNGNY
FT                   GTPVVLLVFGAVGLDIAVVLMVLQQLAMSTIGIYFAAKGSKDSGGMKTVVKRVVRMPIA
FT                   YGALLGLSFQLLHISLPSALMTCIKLVGDAAIPTIMIVLGMQLAVISFRRIELAKVGIA
FT                   LVLKLFIAPLIAVGLTLILPVDEMTKQIMILLAAMPTAANTTLMAVQFDTKPDLVSSAT
FT                   FISTVLSIITLPIVLYFLHPIF"
FT   gene            790405..791376
FT                   /locus_tag="lse_0732"
FT   CDS_pept        790405..791376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0732"
FT                   /product="internalin-like Leucine-rich repeat (LRR) domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0732"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26883"
FT                   /protein_id="CBH26883.1"
FT                   /translation="MTIISRKNLMKVAFMAILAICLFGPKLGVNASEVQETYPLPAPII
FT                   EAFPDEDIAEWVAFATGKSSVDETITQDDLDSVTYLIMEGEPLTGEQLDVFNNEVFPNV
FT                   TELTIDGGRIGDLPVFTAFPNIEEMNLAADFVTSFPDADYPNLKSVDLSFNDLSKASLL
FT                   FIGMDGLQSINLFDCNITEIPLDAWSNLTHLGENEEEVNLSGNHLTQIPESVVFNSEWG
FT                   FPITAVNETYTFEPITIKQGESHSLYLPIIKQFFSQGGTTIMGEYIIDGHGQAVQTLSP
FT                   QDYYVSIPTEDLTVGTHNINLYVQDYYGSNLTGNYVIDVTVE"
FT   gene            791406..792374
FT                   /locus_tag="lse_0733"
FT   CDS_pept        791406..792374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0733"
FT                   /product="internalin-like Leucine-rich repeat (LRR) domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0733"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26884"
FT                   /protein_id="CBH26884.1"
FT                   /translation="MMITSKKNLMKVLFMAILAICLFGPKLGVNASEVQETYPLPAPII
FT                   EAFPDEDIAEWVAFETGKDSVNDTITQEDLDNVEGFMMEGVPFTGEQLAILNNEVFPNV
FT                   TLLSIEGGEIGDLPVFTAFPNIEKMELSNDHVTSFPDADYSSLKSVDLSFNDLSGAFPM
FT                   FVGMDGLQNINLFDCNITDIPLDAWSNLTDLGNNDGNVNLSENHITEIPESITYSHEWG
FT                   FPVTAVNEFYTYDPITIQQGESHPLYLPIVKQYWDQGIAMMGKYSVDGQSEGYGALTPE
FT                   DYYIPIPTEELTAGIHILELDIKDYYGSNVTGGYTILVNVE"
FT   gene            complement(792439..792849)
FT                   /locus_tag="lse_0734"
FT   CDS_pept        complement(792439..792849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0734"
FT                   /product="PsiE family membrane protein"
FT                   /function="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0734"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26885"
FT                   /protein_id="CBH26885.1"
FT                   /translation="MKRLEKISSIVPILLRVTLNLALIMVGFTLTAFLIREAFTIFNNI
FT                   FFLDTDVSYYYMTQDILTFFLYFEFIALIVKYFESHFHFPLRYFIYIGITAIIRFIIVD
FT                   HSSATSTLILSGAILLLVAALFLANTKMLKRE"
FT   gene            793029..794663
FT                   /locus_tag="lse_0735"
FT   CDS_pept        793029..794663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0735"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /function="ABC-type multidrug transport system ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0735"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26886"
FT                   /protein_id="CBH26886.1"
FT                   /translation="MAFPVAVNHVIDTLLPGKDFGLIITAAVALLFFYILNTFMQYVVT
FT                   YFGHMLGLNIETDMRRDLFSHLQKQPFGFYDNQKTGKLMSRMTTDLFEIGEVAHHGPED
FT                   IFISIMSLLGAFFLMLNINVKLAVSTFILVPILTVLIVYFNKRMTKVTTKIFKDLGNFN
FT                   AGVENAISGVRVVQAFANEPHEKGRFAVLNQAYRKSKLMFYKVMGVSFSFNYFLMRLIS
FT                   LFALLFGAYFTINGEISYGEFVGFILLTNVFIRPIEKINNVIESYPKGFAGFKRFLEVM
FT                   DTEPAIQDEKNAKPAGDFRGDIEYKQVSFEYNDGKKVLNHINLSIKAGETIAFVGPSGA
FT                   GKTTICNLLPRFYDVTSGEITIDGENIKQFTLPSLRAQIGVVQQDVFLFSGTVRENIAY
FT                   GKLDASDEEIERVVKLAHLSKVVAEMPDGLDTIIGERGVKLSGGQKQRLAIARMFLKNP
FT                   PILILDEATSALDTETEQVIQASLEELAEGRTTLIIAHRLATIKHADRIIVVNETGIAE
FT                   TGTHDELLAREEGAYKRLYDAQFNTLQ"
FT   gene            795091..796476
FT                   /gene="uhpT"
FT                   /locus_tag="lse_0736"
FT   CDS_pept        795091..796476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uhpT"
FT                   /locus_tag="lse_0736"
FT                   /product="hexose phosphate transport protein"
FT                   /function="Sugar phosphate permease"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0736"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26887"
FT                   /protein_id="CBH26887.1"
FT                   /translation="MSLFSLKRKNYHIPLETQRQQWFKHFIVAFMAVFVCYLTVYLLRN
FT                   NFKAAQVLLIEQNNLSTTQLGMIGLAFSVAYGIGKTILGYVIDGRNAKKIMSFLLGISA
FT                   IISLVIGILLVTKQATAGILFILWGANGFVQSPGGPASYSTITRWTPKMKRGKWLGFWN
FT                   ASHNIGGALAGIVAFWGATTFFNGGVGGMFIVPAIIAFIIAIFCFSVGHDEPEELGWNS
FT                   APEIFEEPDEQGEEKTKDLSRFQILCQFVIKNPWVWTLCVINIFIYIVRIGIDNWAPVY
FT                   CIQALGWNTHDAILTISFFETGALLGSLSWGWLSDIMKGRRMLCSIIAVAIEFFMLIAY
FT                   SQVTSIYSMYTVLFILGFLVFGPQLLIGVSVIEFVPKNALAVTNGLTGTCAYLFGDSFA
FT                   KVFLGYIADPTKSGMNIFGYTLHGWGATFTIMFTALIIAGLLMIPVALKQERIIRKSTI
FT                   LKL"
FT   gene            complement(796647..797870)
FT                   /locus_tag="lse_0737"
FT   CDS_pept        complement(796647..797870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0737"
FT                   /product="tetracycline resistance protein"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0737"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26888"
FT                   /protein_id="CBH26888.1"
FT                   /translation="MSSTIHPTKSTINKKTLLFGLISVFLSGMGFSIILPVVPFLVAPY
FT                   VSNSSEQALMVTLLTSVYAFCVFFAAPGLGALSDRFGRRPILLICFIGSAIGYFIFGLG
FT                   GALWVLFLGRIIEGITGGSISTLFAFFADITPQEQRTKYFGWVSAAAGAGGALGPAFGG
FT                   LIAHFGYAMPFFFGAAITLINFLFGYFYMPESLKEENRLKRIPLMRLNPFSQLLNILTI
FT                   KNLGRLLIAAFLIWVPNGSLQAVMSQFAIDSFSWKPALIGMMFSIMGIQDILSQAFVMP
FT                   KLLLKLTDKQIAILGMIAEIIGYALIAASSIFTLAPLLIIGMFVFGFGDSIFGPSFNGM
FT                   VSKSASASEQGRIQGGSQAIQSLARIIGPIIGGQIYITLGHAAPAVMGVILITGAIFIL
FT                   YRKNAGNK"
FT   gene            complement(798003..798473)
FT                   /locus_tag="lse_0738"
FT   CDS_pept        complement(798003..798473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0738"
FT                   /product="transcriptional regulator, MarR family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0738"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26889"
FT                   /protein_id="CBH26889.1"
FT                   /translation="MDKNELVMQEIRDLFNKLAWINKVKMEKALEGYKPSEVHCMEYIA
FT                   KHEDSNVTKLAEAFYMTKSAISKLTKKLIEKGFVESYQKPENKKEIYFRLTKKGAEINQ
FT                   VHDSLHQEFLERDKIIFDEVTDDQYEEVLQFLAKYSRHLDIEMKKVLEGKTE"
FT   gene            complement(798545..799411)
FT                   /locus_tag="lse_0739"
FT   CDS_pept        complement(798545..799411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0739"
FT                   /product="transcriptional regulator, LysR family"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0739"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26890"
FT                   /protein_id="CBH26890.1"
FT                   /translation="MDYNQLHYFIVTAETGHLTHASEKLSLSQSALSRSIAALEAELGL
FT                   PLFDRKNRSIQLNQVGKVFLADAKEIQLRWLAAQEKIQTLANPDFGEVTVSFVPTLGLS
FT                   FMPQLLKKFQQNYPTNTLRLKEAPAQQVLKDVLTNASDIGISTLRDKQADLEYIPLFTE
FT                   KFVLIMSKENKLALKNDITIQDIAEEEFIHFAENTYSREVVEHALKQAKVDLKVRYDGL
FT                   EISSILGLVEANMGISIVPKTAILDFERLEIFPIETPKIERTIYLVHAANGYVSSATKR
FT                   FIQFAQK"
FT   gene            799528..800496
FT                   /locus_tag="lse_0740"
FT   CDS_pept        799528..800496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0740"
FT                   /product="permease family protein, putative"
FT                   /function="Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0740"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26891"
FT                   /protein_id="CBH26891.1"
FT                   /translation="MNKGYVYIAIATVLFSTMEIAIKLTGGIFNPIQITFLRFALGGLC
FT                   LLPLVIKKMQKTTQKLTAKDIRFFCLTGFFCVVISMILFQLAIGYTKASTVAIIFSCNP
FT                   VFVITFAAIFLKEKLAGLTIVSIIVSMLGIIVIINPLKLSDPLGILLAILAAITFAIYS
FT                   VISRYGTKKYHYDGILITCFSFIFGSLELLVLICLTHLPLIATKFIAMDLPAFANVPIF
FT                   SGITFSALPILLYLGIGVTGIGFSSYFLAMDNVGVSLASLVFFIKPALAPILAWIILGE
FT                   SINLHTAVGIIIILIGSLLTFIASREIPKITLLNEKTAKPR"
FT   gene            800662..803310
FT                   /locus_tag="lse_0741"
FT   CDS_pept        800662..803310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0741"
FT                   /product="cation transport ATPase family protein"
FT                   /function="Cation transport ATPase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0741"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26892"
FT                   /protein_id="CBH26892.1"
FT                   /translation="MEIYRKSAAETFEKLEATEKGLTTSEVTKRQEKYGFNELKNKKKD
FT                   PLWKLFLETFKDPMVIVLVIAALVQLVLGEVVESLIIFLVLIVNSIISVVQTRKAESSL
FT                   DALREMSAPVAKVIRDGSKQSIHARELVPGDIVILDAGDFVPADGRLFESGSLKIDEGM
FT                   LTGESEAVEKYIDTISDEVGLGDRLNMVFSGSLVVYGRGMFVVTGTASETEIGKIAGLL
FT                   ETAEAKQTPLQRKLESFSKKLGLGILALCILIFAVEAGRVFLGNDSADMATAILNAFMF
FT                   AVAVAVAAIPEALSSIVTIVLAVGTNKMAKQHAIIRKLPAVETLGSTSVICTDKTGTLT
FT                   QNKMTVVDYYLPDGTKENFPDSPEKWSEGERRLIHIAVLCNDSNINSEGKELGDPTEVA
FT                   LIAFSNKNNQDYNEIRENFIREGEIPFDSDRKLMSTLHTFGENKAMLTKGGPDVMFARC
FT                   SYVYLDGEEKPMTDEILTKLKETNEEFSNQALRVLAYGYKRMSAETTELTLADESDIVL
FT                   VGLTAMIDPPREAVYASIEESKKAGIRTVMITGDHKTTAQAIGRDIGLMDANDIALTGQ
FT                   ELDAMPEEELDKKLEHIAVYARVSPENKIRIVKAWQKKGKITAMTGDGVNDAPALKQAD
FT                   IGVAMGSGTDVAKDSAAMILTDDNFVSIVDAVGVGRTVFDNIKKSIAYLFAGNLGAIIA
FT                   ILFALVLDWINPFTALQLLFINLVNDSLPAIALGMEKAEPNVMKRKPRDISEGIFAGGT
FT                   MRAVISRGVLIGIAVIISQYIGMQISPEMSVAMAFTTLILARTLQTFAARSNVQTAFGA
FT                   GFFSNKYVIGAVLLCFVLYGITVLPGAREIFSIPASFGLHEWSIAAGLALGAVIMMEII
FT                   KVIQNKFFKED"
FT   gene            803406..804227
FT                   /locus_tag="lse_0742"
FT   CDS_pept        803406..804227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0742"
FT                   /product="Cof-like hydrolase"
FT                   /function="Predicted hydrolases of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0742"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26893"
FT                   /protein_id="CBH26893.1"
FT                   /translation="MIQAISVDMDGTFLDANSEYDHERFEEIYANLRQNGIKFIVASGN
FT                   QYYQLKSFFPGKDHELFYVAENGAVIFHNNKLLSVNQFSNTLVEKILRTLTEDYQDLQV
FT                   ILCGVKSAYLLKKADPNFKEFARKYYFELKEVESFASLPDDTFIKFALDVAIHQTTKIV
FT                   EQLNQTFQDDIRAVSSGHGSIDIILPGVTKGSAIKQLLTDWQVDLEQLLAFGDANNDLE
FT                   MLQLTLHSYAMKESSKEVLATANHIAPSNNEAGVLAVIEHYLDDKSNTPTK"
FT   gene            complement(804208..804465)
FT                   /locus_tag="lse_0743"
FT   CDS_pept        complement(804208..804465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0743"
FT                   /product="putative membrane protein"
FT                   /function="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0743"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26894"
FT                   /protein_id="CBH26894.1"
FT                   /translation="MILTIYLIAMTLISFLLFAIDKRKAIKHAYRIPESALLLTAFLGG
FT                   AFGSWMSMQLFHHKTQKTKFRILVPLAMVWTVGVVIWLVY"
FT   gene            804546..804923
FT                   /locus_tag="lse_0744"
FT   CDS_pept        804546..804923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0744"
FT                   /product="endoribonuclease L-PSP, putative"
FT                   /function="Putative translation initiation inhibitor yjgF
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0744"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26895"
FT                   /protein_id="CBH26895.1"
FT                   /translation="MAKEIIQTNNAPKALGPYSQAVKVNGLIFTSGQLGINPATGELAE
FT                   GAVNQAEQAFRNLAAVLEEAGSGLDKIIKATVFFKDLNQFAAVNEVYATHFSSDFPARS
FT                   AFQVAKLPLDAEIEIEVIAEA"
FT   gene            805179..806282
FT                   /locus_tag="lse_0745"
FT   CDS_pept        805179..806282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0745"
FT                   /product="vitamin-B12 independent methionine synthase
FT                   family protein"
FT                   /function="Methionine synthase II (cobalamin-independent)"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0745"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26896"
FT                   /protein_id="CBH26896.1"
FT                   /translation="MNQVAPFYADHVGSILRTKAIKDARSKFAVGEISTKELREIENVE
FT                   IKYIVGKQKEVGLKAITDGEFRRAWWHFDFLENLDGVEGYDADGGIQFSQVQTKSHSVK
FT                   ITGPIDFTTHPFIADFEFLKEAVGADHVAKQTIPSPAMLHYRGEVVYQPYLDDAKGFVS
FT                   DLAKAYQKAIQAFYDAGCRYLQLDDTSWSYLCSDEQREMVRERGFDPDVLQETYKTLIN
FT                   EAVKFKPADMVITMHICRGNFRSTWIAEGGYGPVAKTLFSELNIDGFFLEYDNERSGDF
FT                   APLKYVNRPDLKIVLGLITSKTGELEDETLVKARINEASGIVPLNQLRLSPQCGFASTE
FT                   EGNILTEEQQWEKLRYVVKIAKDVWGN"
FT   gene            806257..806361
FT                   /locus_tag="lse_0746"
FT   CDS_pept        806257..806361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0746"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0746"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26897"
FT                   /protein_id="CBH26897.1"
FT                   /translation="MPKTYGEIKLVRELAGSFSASFFISLQIEQVALE"
FT   gene            806387..807487
FT                   /locus_tag="lse_0747"
FT   CDS_pept        806387..807487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0747"
FT                   /product="excinuclease ABC subunit C domain protein"
FT                   /function="Nuclease subunit of the excinuclease complex"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0747"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26898"
FT                   /protein_id="CBH26898.1"
FT                   /translation="MNIQLQQKLTLLPDAPGCYIYKDENNEILYIGKSKCLKNRVKSYF
FT                   TGKQIGKTARLVRQIRDLELIITSSEKEALLLEMILIQKYQPPFNIQLKEGQSYPYIKI
FT                   TNEKNPHIEVVFEAKQDGAHYFGPYPGRYSARQTVELIEKLFPLCRCDGKPGRPCLYYH
FT                   LGLCLGPCQAEIEPAVYQAQIHKITRFLEGNVKDVKTKLTLDMQAATEKLQFERAAELR
FT                   DTIHAINETIEKQHIIFPGLKNRDIIGCYEQDNYLGVFVFFVRNGAINGTKWHVFEIQK
FT                   SLQEDLADFINQFYQDPNNIQPKELLISEKLAKMSLSVPLQKAISFPQKGGKKHQINLA
FT                   VENAKSTYIAYAKMKEYDFENQLKNT"
FT   gene            807659..809101
FT                   /locus_tag="lse_0748"
FT   CDS_pept        807659..809101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0748"
FT                   /product="glutamine ABC transporter,
FT                   permease/substrate-binding protein"
FT                   /function="ABC-type amino acid transport/signal
FT                   transduction systems periplasmic component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0748"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26899"
FT                   /protein_id="CBH26899.1"
FT                   /translation="MKKFSRFILTLAIACVAIFIFTGNGLDAKAAEKTYLIGTDTTFAP
FT                   FEYEENGEQVGIDMDILKAIAKDQNFKYEIKAMGFNAAVQALESNQVDGVIAGMSITDE
FT                   RKQKFDFSDPYYESGVVMGVLKDNDEIKSYDDLKGKKVAVKTGTEGYAFAEKVKDKYGF
FT                   DIVVFDDSAQMYDDVKTRNSVACFDDYPVLAYGVQKGNGLKIVTKQEKGNSYGFAVNKG
FT                   ENQELLEKFNAGLTNIHASGEYDDIVEKYLGKDAIKANETEKGFMGILKSSWPALLDGM
FT                   WLTIKLAVVSLIIAFIIGITFGFMKVSNSKILRGIATVYVDIFRGTPLIVQAFFFYFGI
FT                   PAALDFRMPVFLAGVIALSLNAGAYMVEIVRGGIQSVDKGQMEAARSLGLPHKKAMLKV
FT                   VLPQAIRMMIPSFINQFVITLKDTSIMSAIGLVELTQSGKIIMARTFESTWTWLIIGIM
FT                   YLIVITILTKVSDRLERRLRND"
FT   gene            809094..809822
FT                   /locus_tag="lse_0749"
FT   CDS_pept        809094..809822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0749"
FT                   /product="glutamine ABC transporter, ATP-binding protein"
FT                   /function="ABC-type polar amino acid transport system
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0749"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26900"
FT                   /protein_id="CBH26900.1"
FT                   /translation="MTKLKVTGLKKNFGANKVLKGIDIEVKEGEVVCVIGPSGSGKSTF
FT                   LRCMNNLEDITAGQVVVDDFNITDKKVDINKVRENIGMVFQHFNLFPHLSVLENITLAP
FT                   VELKKMDKEKAKNNAFRLLEQVGLKEKADEFPSQLSGGQKQRVAIARALAMDPDIMLFD
FT                   EPTSALDPEMVGEVLGVMKELAKGGMTMMIVTHEMGFAREVGDRVIFMDGGYIVEEGKP
FT                   ADIFDHPTNPRTISFLDKVL"
FT   gene            810077..810229
FT                   /locus_tag="lse_0750"
FT   CDS_pept        810077..810229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0750"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0750"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26901"
FT                   /protein_id="CBH26901.1"
FT                   /translation="MSLDNNQKDLNQVIRQLKEKGIVVEKTKSRKDIWQSVSSKALPNM
FT                   TLRLQ"
FT   gene            810457..811215
FT                   /locus_tag="lse_0751"
FT   CDS_pept        810457..811215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0751"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0751"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26902"
FT                   /protein_id="CBH26902.1"
FT                   /translation="MKKEAVNQQSIYVHIDHVINNVATSGISFSDFLSGVGQPPENILL
FT                   IKHNIEDASYNAHTAFHYLEPSDLANISKENFSPLCWIDFEDVELLNQLTPQEVAEMLY
FT                   LAHTGRHLRSPFYYKLQNNFVYLTREDGRYNKVYYRNLNHFYMLLSFVIARKTSELVNE
FT                   KTFLSFGKKRYVAEPPVELLKKMSDYFRDGACIALDDVVKTRTQIEVPIGLGLTEEMTE
FT                   LEITSKIYYEKEAARLVYDLKQNEWNYIEK"
FT   gene            811295..811849
FT                   /locus_tag="lse_0752"
FT   CDS_pept        811295..811849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0752"
FT                   /product="transcriptional regulator, TetR family"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0752"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26903"
FT                   /protein_id="CBH26903.1"
FT                   /translation="MTKKLVKEVALAIFAEKGYDGTALSEIAKAVGIKTPSLYAHFPSK
FT                   EALFLEVYQDSIHTELFELQQVSQNESLVGEEKLQKLFFTATDFSSNPDEKKFFQRAVF
FT                   YPPKSLFLELKEATRTYEQLTNDILRETLEDIVAEATLLRWMHVFYALLDGLSVEHGIY
FT                   DEAEFELRRESAWEVLASLLK"
FT   gene            811866..812207
FT                   /gene="sugE-1"
FT                   /locus_tag="lse_0753"
FT   CDS_pept        811866..812207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sugE-1"
FT                   /locus_tag="lse_0753"
FT                   /product="small multidrug resistance protein"
FT                   /function="Membrane transporters of cations and cationic
FT                   drugs"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0753"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26904"
FT                   /protein_id="CBH26904.1"
FT                   /translation="MAWFYLILAGLSEIVWAFGLKESHGFTMLGWSLLTVFFLIISFGL
FT                   FSVSMKSIPIGTAYAVFTGIGAAGTAIIGMLFLSEGVSFWKIISLLVLLTGIIGLKLVD
FT                   GSEPEKDGR"
FT   gene            812210..812530
FT                   /gene="sugE-2"
FT                   /locus_tag="lse_0754"
FT   CDS_pept        812210..812530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sugE-2"
FT                   /locus_tag="lse_0754"
FT                   /product="small multidrug resistance protein"
FT                   /function="Membrane transporters of cations and cationic
FT                   drugs"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0754"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26905"
FT                   /protein_id="CBH26905.1"
FT                   /translation="MDWIFLFVAGLCEMVFVVMLKLSDGFKRFGYAALTVLFMSASFFL
FT                   LSLALKTIPIGTGYAIWTGIGAVGSVTLGMIVFKERKSAGKMLFITMIIAGVIGLKLTS
FT                   GV"
FT   gene            812681..813793
FT                   /gene="ddlA"
FT                   /locus_tag="lse_0755"
FT   CDS_pept        812681..813793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /locus_tag="lse_0755"
FT                   /product="D-alanine-D-alanine ligase"
FT                   /function="D-alanine-D-alanine ligase and related ATP-grasp
FT                   enzymes"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0755"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26906"
FT                   /protein_id="CBH26906.1"
FT                   /translation="MKTKLILLYGGKSAEHEVSLQTAFSVINALNLDKFEAQPIYITNE
FT                   GEWVQGPLLSGKLDFVEQLRFAATDKIELALTETEKSSGELISPAVLEADGQETVVFPL
FT                   LHGPNGEDGTVQGLFEVLNIPYVGNGVLASSAAMDKIVMKKIFADAAIPQVPAVAVRLI
FT                   DWKNFKDEMIAEMEEVLEYPVFVKPANLGSSVGISKATNKQELTEAMTEAFLYDRRVVV
FT                   EQGVVAREIEMGVLGNDTPICSVPGEILPEGAVAKFYDYKAKYQDNNTTLIIPTEVEPE
FT                   VLAQMKDYAIQAFLGLDASGLVRADFFLTDDNQLFLNEVNTMPGFTPYSMYPLLWQESG
FT                   LPYPALIERLVDLAKERHAAKNALKYKLED"
FT   gene            813856..815229
FT                   /gene="murF"
FT                   /locus_tag="lse_0756"
FT   CDS_pept        813856..815229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="lse_0756"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /function="UDP-N-acetylmuramyl pentapeptide synthase"
FT                   /EC_number="6.3.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0756"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26907"
FT                   /protein_id="CBH26907.1"
FT                   /translation="MKKTVGEVVAMLDSSIHTDTFRDVVITGVCFDTRQIKPGDLFVPF
FT                   VGNLRDGHEFVGQAREMGAVATFWQKNVPNPPTDFPVILVEDTLLALQELAMKYMQEVR
FT                   PKVIAITGSNGKTTTKDIMAAIVETSYKVHYTGGNFNNHIGLPYTILTMPEDTEVAVLE
FT                   MGMNHRHEIEVLSKIAKPDIAIITNIGEAHIEYLGSRQEIAKAKLEITAGLNPSGILIY
FT                   PYEETLLLSQIDGDFRQLTFGKSTESEIYPLEIHAEAEGTSFVTNWEPDLEIFVPIIGE
FT                   HNVFNTMAAMLAAREIGIEGKKIQTALKNMERSKSRLEWLTAKNGARILNDAYNSSPTA
FT                   LQTVLKTFMHMDSKGKPKYLVLADMLELGELSVLLHQESAEVLEEGTIEKVFLYGDAMK
FT                   AFGAVAEDKIGQGKVQHFDTKESLENALLKEITGNEWILVKGSYGMGLKDVVENLIIK"
FT   gene            815297..816010
FT                   /locus_tag="lse_0757"
FT   CDS_pept        815297..816010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0757"
FT                   /product="esterase/lipase family protein"
FT                   /function="Esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0757"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26908"
FT                   /protein_id="CBH26908.1"
FT                   /translation="MVACLCIHGFTGSPTEVKPLADYLREHTDWDVLAPTLPGHDHLRH
FT                   LKNVTYKDWIVFVDSILSQMLKEDEEVYIIGFSMGGLLAGWLARHYPQVKKLVLLSTAV
FT                   NALEWPQIVENSKQLLAEAKEVKLKNSPMFKRYQKKVTETPPASTLQFEKMVALARPAF
FT                   EHIEIPTFIAQGSKDSVVPAEKSVQFLMDSIPGPKELFMLEGSGHAICHDKEADQLFAA
FT                   VLIFLQKDLAVLNVK"
FT   gene            complement(816029..817045)
FT                   /locus_tag="lse_0758"
FT   CDS_pept        complement(816029..817045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0758"
FT                   /product="transcriptional regulator, putative"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0758"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26909"
FT                   /protein_id="CBH26909.1"
FT                   /translation="MKKVTMQDIADKLNITKNSVSQALGNKNGVSEQTKLAVFKMADEL
FT                   GYKYKKEIAREVVKEKFALLATSFALSQRSFFGEIIDNMKQSITARQGELVIVPVTDEE
FT                   AEAQQIPDLLMNENWTGIFLLSHINTAYSKQIIELDIPVVLIDHHDPHLKADAVISQNK
FT                   DGAFTAVEFLIQNHHQNIGFLGDITFSPSYEERFEGYKKALGYYQIPFNEKYAITRIKE
FT                   EQTSLYKTLDALDELPTAWFCVNSGLGFILNTYLQSKGYNIPRDLSIICFDNTEFTVLS
FT                   KPPLTTMCTNLSFMGEKAVESMYNRIRKPDEGFVHLALATNLVVRESVNTNKKTIQP"
FT   gene            complement(817014..817163)
FT                   /locus_tag="lse_0759"
FT   CDS_pept        complement(817014..817163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0759"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0759"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26910"
FT                   /protein_id="CBH26910.1"
FT                   /translation="MQSFIFLKLFLTLLLNYKTFAILGINFYNRIKKKNGGGRNEKSND
FT                   ARYC"
FT   gene            817290..818612
FT                   /locus_tag="lse_0760"
FT   CDS_pept        817290..818612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0760"
FT                   /product="sugar ABC transporter, sugar-binding protein"
FT                   /function="ABC-type sugar transport system periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0760"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26911"
FT                   /protein_id="CBH26911.1"
FT                   /translation="MKIRKIAYAALSIAVAGSLLTACGGGDSKSSDDSGKTKVTFWAAP
FT                   NPTQVKYWDEMAKAYEKENPDVTIEVSQMKESPSSEATIQSAIASKTAPTMSENINRSF
FT                   AAQLADSKAIVPLNDVKGMDEVVDERNMTKTMDSWKFSDGNQYVLPVYSNPILFAWRLD
FT                   TLKELGYDAPPKTYSEALEVGKKLKEKYPDKVLWAKGDLSDPTGWMRWFDFFPLYDAAS
FT                   KGNEFVEDGKLVADDKAGTELLTFMSELQKNKLLLSSKATDPFETGTSIMTDNGPWTFP
FT                   NWDEKFPELKYNENYTISSPLVPDSMADEENISTYADSKGVVMYAQATEKEQEAAMDFL
FT                   KFVYSDDENDLKFLETTNLIPARDDATENDAFTAFFKENPELEVYAANVPYSIPAMDDA
FT                   KYNDIQQVIGEEAWNPIVRGEKKPAKAWSDMKKAEDGVLQE"
FT   gene            818609..819487
FT                   /locus_tag="lse_0761"
FT   CDS_pept        818609..819487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0761"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /function="ABC-type sugar transport systems permease
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0761"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26912"
FT                   /protein_id="CBH26912.1"
FT                   /translation="MKRRNNKLGWSFTSPYLIFTAIFFLVPLVWSIWLSVTDWNMMSPE
FT                   INFVGFDNFMKAFTSPAVQASFFVTYKFLIVFVPMALIISMVVAVLVNGLPKFKGLYLV
FT                   AFFLPYLSSGVVTSLIVQGLLSYNSPLNVFLRGHFGWDIDWLGTPMSALMIISLMIAWK
FT                   MSGYYALILISGLASINHEIYEAAAMDGSGRFRTFWKVTVPMLYPALFTVIVLAVGVSF
FT                   GIFTEVYQLTGGGPNFATNTWQMEIFNQAFVNLNSGYASAISLIAATVTFASIGVIKKM
FT                   LEKWGQRNGWT"
FT   gene            819474..820307
FT                   /locus_tag="lse_0762"
FT   CDS_pept        819474..820307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0762"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /function="ABC-type sugar transport system permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0762"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26913"
FT                   /protein_id="CBH26913.1"
FT                   /translation="MVGRNSKAGKIVRYVLTTLLMLIMIYPFIYLVLNSFAAWDQVDKK
FT                   LIPTEFTMRSWDWLFGNSVVAAPAPWIHAFINTVIVSTIATGLMLLFGLMVGYALAKVD
FT                   FKGKRLVNNAILFQMFFPAIILLIPQFLMITDLGMLDTYAGMIIPTMLSLWAVFMYTNF
FT                   FKAIPDTLIEAAKLDGASDLKILFRVVLPMSKSITTVIFLFLFTDRWTNLLWDMLVTKS
FT                   DSTVTLNVLISQMFGPYATYPGPMYAASVLLTLPLIILFLFFSKKFQEGMQFTLK"
FT   gene            820323..821855
FT                   /gene="treC"
FT                   /locus_tag="lse_0763"
FT   CDS_pept        820323..821855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treC"
FT                   /locus_tag="lse_0763"
FT                   /product="trehalose-6-phosphate hydrolase"
FT                   /function="Glycosidases"
FT                   /EC_number="3.2.1.93"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0763"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26914"
FT                   /protein_id="CBH26914.1"
FT                   /translation="MEFWRGSVFYEIYMKSFQDSNGDGLGDFKGLTSRLDYLADLGIDG
FT                   IWLTPFYPSPQVDNGYDVADYCAVNPDYGTMTDFRAFMKEANKREIKVIIDLVLNHSST
FT                   EHAWFKESRSSKTNPKRDYYIWRGKPNNWESFFGGSAWELDELTNDYYYHSFAKEQADL
FT                   NWSNPAVQKEMENVLAFWLNEGVAGFRLDVINNLTLVLEFPDNPTENGEMNHLYDRNQQ
FT                   GLEAALEHIAEFCRREQETFLVGEISSDNLTEIARYSSKKMLDVTFNFNFGSVEKIDAE
FT                   SVFASLNAMENKLQAGQWPTLFFGSHDMSRFTSRLANENFSKTKLLAFLMLTAKGIPFI
FT                   YYGEEMGMPDIDFTSVDEMRDIQGISAYYQALERGDSLDNALEIAVRKTRDKARGPMVF
FT                   PDGEPFTTGESWIKSASLPEKEAKSMWGFYQALLTFRKENDFKEKEYSYLKLDGELLSY
FT                   RRGNFLFFVHFGTEPVIYTPKEKTTLVFGEAMIEKTSISIAAYSGIALRVED"
FT   gene            821857..822771
FT                   /locus_tag="lse_0764"
FT   CDS_pept        821857..822771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0764"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0764"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26915"
FT                   /protein_id="CBH26915.1"
FT                   /translation="MKQIQTLLKEYRETATVNGTKIHLNGVVEKDVYNITAPFKWLGKE
FT                   FIAGRMESRDSELAEVHFFEKTAEDNYQIVENTTVLALQDPFVTFVQGELILGGVEVFE
FT                   KETDSTKLDWRTNLYRAKSLTQFEKVLTGPIGMKDLRIKELADGRILVLTRPQGEKGGR
FT                   GKIGATVIDSLDELTIEKITAAPLLNRNFSGEEWGGGNEIHLLEDGKVGVLGHIACFDE
FT                   AGDRHYYSFSFQLNDDFTQIEQEKIIAERANFAPSEPKRPDLADVVFSGGLIRRADGYA
FT                   ELYAGIGDSDAQKIIIQDPFKNN"
FT   gene            822793..823860
FT                   /locus_tag="lse_0765"
FT   CDS_pept        822793..823860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0765"
FT                   /product="glycosidase family protein"
FT                   /function="Predicted glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0765"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26916"
FT                   /protein_id="CBH26916.1"
FT                   /translation="MNIYRYEENPLITPLDVKPIHGGFEVIGAFNAGVAKYNGEVLLLL
FT                   RVAEKPVSEDPEVVLAPVYNAKEEKLELQSFRLDDENYDFEDPRMIRDKAKLEGFSYLT
FT                   SLSYIRIARSKDGHNFTLDEKPFLYPFNEYQTFGIEDARVTQIGDTYHINFSAVSEFGV
FT                   ADALITTKDFENLEYQGNIFAPENKDVLIFPEKISGKYYALHRPSLKSIGNLDIWIASS
FT                   PDLRSFGDHRHLLGIRPGEYDSGRVGGGCVPIKTEEGWLILYHGATEENRYVMGAALLD
FT                   LADPTIVLKRTTTPILEPEAEYEKNGFFGDVVFACGAIQEGDILHMYYGVADTSMAGCD
FT                   LKVSEILRQLEVESK"
FT   gene            823857..825530
FT                   /locus_tag="lse_0766"
FT   CDS_pept        823857..825530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0766"
FT                   /product="phosphoglucomutase/phosphomannomutase family
FT                   protein"
FT                   /function="Phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0766"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26917"
FT                   /protein_id="CBH26917.1"
FT                   /translation="MTWQNYLKDWQEADLSDDWKAELKQVETEQERFDGYLTFGTGGMR
FT                   GKMGIGSKRMNIFTIRRVARALGEYVVANGGAESGVAIAYDSRNNSSLFARETAKVLSA
FT                   LSVRVYLSDAIRPTPALSFCVREKAAFAGVVITASHNPSIYNGFKVYDKNGCQITLGAA
FT                   EEISTYLERITNIFTIPIRELPNLLVTSLGKEMDDAYLKALQKVVFRRDLLADYGSELT
FT                   VCYTPLHGAGKELVMRVLTENGFSNVAIVPEQSEPDGNFSTVVSPNPEEENSFELAKKQ
FT                   AKNIHADIILATDPDADRLGVAVLTKNGEYQILTGNQLGALLLDYILAAKVNLTSEDTM
FT                   INTIVTGDLGGEIAAEYGINHIQTLTGFKFIGEKIAEMEQGEARFVFGYEESYGYLIAP
FT                   FVRDKDAVQAALLVSEMALYYKKEGTTLLRKLTRLYEKYGYHEELLHTITLESTNGKEK
FT                   MTQVMEMLRKQPMFIPEISRVEDFEASECVNLTNGKVSPINLPKENVLKFYLKNNSWFA
FT                   IRPSGTEPKCKIYFQTTGESKEIAEKTMNDLKKDVLTLWD"
FT   gene            825987..827567
FT                   /gene="deaD"
FT                   /locus_tag="lse_0767"
FT   CDS_pept        825987..827567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deaD"
FT                   /locus_tag="lse_0767"
FT                   /product="ATP-dependent RNA helicase, DEAD/DEAH box family"
FT                   /function="Superfamily II DNA and RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0767"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26918"
FT                   /protein_id="CBH26918.1"
FT                   /translation="MTLTKFSEFGLDEKIVKSVNRMGFEEATPIQEKTIPLGLAGKDLI
FT                   GQAQTGTGKTAAFGLPMIHKIDQKSNNVQALIIAPTRELAIQVSEELYKLSYDKHVRVL
FT                   AVYGGSDISRQIRSLKKFPQIVVGTPGRILDHINRRTLKLENVETLVLDEADEMLNMGF
FT                   IDDIETILKEVPAERQTLLFSATMPDPIRRIGERFMHSPELIRIKAKEMTALLIEQFFV
FT                   KVHEKEKFDVLSRLLDVQAPELAIIFGRTKRRVDELSRALDMRGYVAEGIHGDLTQAKR
FT                   MSVLRKFKEGKIDVLVATDVAARGLDISGVTHVYNYDIPQDPESYVHRIGRTGRAGKEG
FT                   MAITFVQPREMGYLRIVEETTKKRMQPLQAPTWDEAFAGQLRVATEKIQEAVTEENLSD
FT                   YKTYANQLLEKYDATDIAAAMLKMLAKEPDKTPVHITEERPLPSRGGGGYKGKGGNGKG
FT                   GKGGGGYRGGSGKGGSYRDRNNSGKGRRSGGGSGGGNGSGGGNRDRRGNGEQRPSGGGN
FT                   KGSYSQKSK"
FT   gene            827759..828247
FT                   /locus_tag="lse_0768"
FT   CDS_pept        827759..828247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0768"
FT                   /product="putative membrane protein"
FT                   /function="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0768"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26919"
FT                   /protein_id="CBH26919.1"
FT                   /translation="MKMKILTVNAIIAALYVVLGMIVAPIGFMALQFRLPEIFNHLIVF
FT                   NKKYFWGIILGVFITNLFFSGLGWIDLVFGVAQSAISLLLMIGISKYIKGIIPRMIINT
FT                   VLFSLTMAIIAWELVIVFDLPFLITWATTALSEFIVMGIGIPLMYLLNKRLNFKKMID"
FT   gene            complement(828281..828865)
FT                   /locus_tag="lse_0769"
FT   CDS_pept        complement(828281..828865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0769"
FT                   /product="transcriptional regulator, putative"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0769"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26920"
FT                   /protein_id="CBH26920.1"
FT                   /translation="MYHKLEMTSINTRIKVHQPLNIDLRAQKTQTKFYTVIENYYLTGR
FT                   SFESISIKELCAKADVSRATFYRHHEEIIQIVEVQLLRNMQQFSKKLDQITLSRQNIQQ
FT                   LIISLLQEKQQLFQIIAWSKAESIFLDVIAGEILRICLLKEITFSDNHFVPNYLARMIL
FT                   NLGLEISPQQRKYTNQQLYELISETIHFLAK"
FT   gene            828942..829940
FT                   /locus_tag="lse_0770"
FT   CDS_pept        828942..829940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0770"
FT                   /product="amidohydrolase 2 family protein"
FT                   /function="Predicted metal-dependent hydrolase of the TIM-
FT                   barrel fold"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0770"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26921"
FT                   /protein_id="CBH26921.1"
FT                   /translation="MKIITIEEHFESEVITNEINKVTGNLISGQVSEEMFEYMQKELPS
FT                   QAEMQDTKERLKFMDKHGIDVQVLSYGNTSPQNLDPKDSVPLVKQANNELAKVISENPD
FT                   RFAGFAVLPVGSPVEAANELKRAVEELGFKGALVKGTYNNKYLDDAFFFPIFEMAEKLD
FT                   VPIYFHPSFIPANVTEQYFTSDAWSDVVTGIFSSAGFGWHMDVGIQVVRMIVSGIFDKL
FT                   PNLKIITGHLGEMVPMFLERMDDTISHWAKLDRKISDYYRTNIYVTPSGLLYKNEWKFL
FT                   LNELDEEHIIYALDYPFVKPENAGTFLDSLDLSDETKAKIAYKNAEKLLHL"
FT   gene            829956..830282
FT                   /locus_tag="lse_0771"
FT   CDS_pept        829956..830282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0771"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0771"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26922"
FT                   /protein_id="CBH26922.1"
FT                   /translation="MSLTKDQKIATKQELAENLALTNLTIAEVAAELNTSEAKIERILN
FT                   LKQNSLNDGWIFRNYLLKKVAEKGLEQVPFTALGGDYHDYWFLDAGIIDAGIIDAGILS
FT                   KGNR"
FT   gene            complement(830324..830680)
FT                   /locus_tag="lse_0772"
FT   CDS_pept        complement(830324..830680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0772"
FT                   /product="transcriptional regulator, putative"
FT                   /function="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0772"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26923"
FT                   /protein_id="CBH26923.1"
FT                   /translation="MTKVYNIGVEATLEVIGGKWKPVILCHLREGKKRTGELKRLIPNI
FT                   TQKMLTQQLRELEKSGVIIRRVYEQIPPKVEYSLSEYGESLSEILNKLCLWGENHVDLL
FT                   LTQKEDIVLLKRDS"
FT   gene            830808..831974
FT                   /locus_tag="lse_0773"
FT   CDS_pept        830808..831974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0773"
FT                   /product="major facilitator family transporter"
FT                   /function="Arabinose efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0773"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26924"
FT                   /protein_id="CBH26924.1"
FT                   /translation="MDNKKVNPSLTLLALAISAFGIGSTEFISVGLLPLISSNMDVSIS
FT                   TAGLTVSIYALGVMVGAPVLTTVTAKMNRKNLLMLVMVVFILGNIISAFAASFAILLTG
FT                   RVIAAFAHGVFMSIASVIAADVVQPSKRASAIAVMFTGLTVATVTGVPLGTFIGQLLGW
FT                   RMSFIFIVAIGVIALIANYFLVPKNLSSAKSISLKSIGQILLNKKIGIVLLMTAFGYGG
FT                   TFVVYTYLSPMFIKMGYTANMIVVLLIIYGIMVAIGNTIGGHFANEKPAKALFVMFSLQ
FT                   AATLLLLQFTSPNPILGLIVVMLMGFFAFMSVSGLQLYVVELAERYLPETVSMASALNI
FT                   SAFNVGIAMGAFIGGLVTEYIGLSYTPIVGFLMVLIAIILSYYMKKEK"
FT   gene            832182..834200
FT                   /locus_tag="lse_0774"
FT   CDS_pept        832182..834200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0774"
FT                   /product="PTS system IIA 2 / PRD domain protein"
FT                   /function="Transcriptional antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0774"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26925"
FT                   /protein_id="CBH26925.1"
FT                   /translation="MKLNQQCIQILDFLMEQEDFKNIGYISSELGHSERSVRYSLEKID
FT                   IFLEEQNLPALIRHTRKGVLLPEKNIVSPVVNKFKQRITPKKYRYSQEEVQQFLLLKLL
FT                   LSEEVLPVTYFEEVLFISRSSVLNHLRAIEGELFLNNLDLSHQPRHGFLVNGNLITKSS
FT                   LFARSFLRFINIREFYQFLDSENSLSKKGELFFYNLFEMEVLQEVNLEAHSVEENASRA
FT                   MDEQLYLTLIAVLLKQHEAKPEFRFDASFGVVDELDKALETIIGSLKQYQHGQEDEAVI
FT                   DAFVKGICEKMGEIYQVDFVNGETDFFAQIKAHIKLMIRRVRAGVIIENPIFNEFMRDN
FT                   REIFMRVKESLEALKTLLPISVSSQEISFLAIYFASEVQRNLQTEEMKPNLLIICPEGV
FT                   AVSKMIATQLEKMFEFESIQTIGLRKFKREMMTAFDFVISTVDLPDMHDSKVLRIHSYL
FT                   QKEDLELLQKHLRMKLVKDDKQIINKFSKILAIIGENTQINNLSKLEFDLLEALISDNG
FT                   ESPKKNIPPFYFTEETIMLEKSCPTWRQAIKVGTKCLEDLSIIEPCYHEKIIENLKTYG
FT                   PYMVIAPGVAIAHAGANDGVLMDGLVVTVIEDGILFYDRYEEPVHVIFTLALNTKEAHS
FT                   IVEQLMKLALNEEKMNKIKLASSKRDIYHYVKSAIFE"
FT   gene            834215..834544
FT                   /locus_tag="lse_0775"
FT   CDS_pept        834215..834544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0775"
FT                   /product="PTS system, lactose-specific IIA component"
FT                   /function="Phosphotransferase system cellobiose-specific
FT                   component IIA"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0775"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26926"
FT                   /protein_id="CBH26926.1"
FT                   /translation="MDIEKISFSLISLAGDSFSKLIEALQAAKESDNERVEVLLKEADE
FT                   LMIQAHKEQTEMLIQETRGEKASYSVLLVHAQDTLMNTILASTLIREMIEMYQEIKTIK
FT                   IEGEK"
FT   gene            834545..834880
FT                   /locus_tag="lse_0776"
FT   CDS_pept        834545..834880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0776"
FT                   /product="PTS system, beta-glucoside enzyme IIB component"
FT                   /function="Phosphotransferase system cellobiose-specific
FT                   component IIB"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0776"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26927"
FT                   /protein_id="CBH26927.1"
FT                   /translation="MEMDQLHVLLVCNLGASTGVMVTKMKEIAQNSEKLKNTDVKIEAH
FT                   PAGELREYIEAFDVILVGPQIKHQLKHLSEIAAEFDKPIQVIDTKDYGTVNGANILKDA
FT                   IILKLNK"
FT   gene            834900..836225
FT                   /locus_tag="lse_0777"
FT   CDS_pept        834900..836225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0777"
FT                   /product="PTS system, beta-glucoside-specific, IIC
FT                   component"
FT                   /function="Phosphotransferase system cellobiose-specific
FT                   component IIC"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0777"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26928"
FT                   /protein_id="CBH26928.1"
FT                   /translation="MSSKNKQSFMNRFIAFMEKYFEPVAARIEKQRHISSIKNGMIALI
FT                   SVLIIGSFSLIISAIGNMFPAGSGVKEFFVQNAAALNLPFQFTFGLLSIYAAITISYSH
FT                   AKQMKVPVLHSVMAAVMVTLILNTKMVDGVLNTEFLDSRGLFIAIFGALISVELIGLFI
FT                   RKNITIRIKGLPAGIATTFEAIIPLVVLLFGAVGLSILMQSITSGQIIPEAFTTMLAPA
FT                   INSIDTPYAVFLICFLEMLFWFIGLNGYAILIGFVLPFMTQYLGANAAAYAAGEPIPHV
FT                   FAPNFWDYFMGFSGSGITGALVILALFSKSKELKAVGKVSVVPAIFTISEPVVFGLPIC
FT                   FNPYLFIPFVLGTPILAVGQWFVFHFGWVRPPIANVGGTPIPLAQYLATMDWRAIVLIV
FT                   FVLAAAVCMYYPFFKMYEKSLIKEEAVVSEREAAHDALNLDF"
FT   gene            836246..836974
FT                   /locus_tag="lse_0778"
FT   CDS_pept        836246..836974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0778"
FT                   /product="glucosamine-6-phosphate isomerase, putative"
FT                   /function="6-phosphogluconolactonase/Glucosamine-6-phosphate
FT                   isomerase/deaminase"
FT                   /EC_number="3.5.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0778"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26929"
FT                   /protein_id="CBH26929.1"
FT                   /translation="MKVVIKENPQIVAETISQKIIEIVKEKPTSLICIAGGDTPLLTIE
FT                   ALIKANQAGEVDFSKTQFVGLDEWVGLGRETKGSCIQTLYDTFFDRLENVSSDQICFFD
FT                   GQTADFEAECARVDAFIEACGGIDFILLGIGLNGHIGFNEPFVPVDVNCHVVELDNVTK
FT                   RVMNKYFDTDLPLTHGISLGMKQILTAKEIYLVATGEKKAEIVQQVIEKEPTVSIPATL
FT                   VKQAIATLVLDEKAASRWEK"
FT   gene            836974..837927
FT                   /locus_tag="lse_0779"
FT   CDS_pept        836974..837927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0779"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /function="Predicted oxidoreductases (related to
FT                   aryl-alcohol dehydrogenases)"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0779"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26930"
FT                   /protein_id="CBH26930.1"
FT                   /translation="MGKIIVQGNKNGQKIDIACSNLVMGAGDFLRVDNMDFAGAVLDQY
FT                   FALGGNVFDTARHYRHSERAIGAWMEMRGNRDNVIIQTKGGHPVREASDIPRVTPEAIY
FT                   EDISVSLEMLKTDHVELFALHRDNPEVEVGPIMEALHKEVETGRVYAIGLSNWELPRII
FT                   EANEYAVTHGLTPLSFNSPNFSLAKVNRPRWENCVSANMEMIRWHEKTNLPLFSWSSQA
FT                   GGFFSGRYTENDKTDTEMVEVYYSDANWERYKRAKELAQQKACTPIQISLAYVLTQSFP
FT                   TAAVIGPENETELKSSVAAAGIQLTQSEVDWLDLKA"
FT   gene            837944..838711
FT                   /locus_tag="lse_0780"
FT   CDS_pept        837944..838711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0780"
FT                   /product="sugar phosphate isomerase/epimerase family
FT                   protein"
FT                   /function="Sugar phosphate isomerases/epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0780"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26931"
FT                   /protein_id="CBH26931.1"
FT                   /translation="MDIKNKIAVQLYSVRKEMEQDLEGTFKKIHDIGFRYVQLDGMRGN
FT                   DPSEVLRLLNKYELKVIGMHIKHDRFMNDLEGIVSEAYYFGCKTIFDKYIEEEDQTIAG
FT                   YHATKNALIQAAQKLTALDFRVGLHNPEYDFNEQINGRRVMDFITDPVNGISIYAEPDT
FT                   YWIRAAGHDEVEFIKRYSGRAPIVHMKDFISGFELEDMDHNLVEIGQGEVDFCAIIEWG
FT                   EASGVEYYCIEQDRSKRNMFETLEASYHYLLAL"
FT   gene            838833..840224
FT                   /locus_tag="lse_0781"
FT   CDS_pept        838833..840224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0781"
FT                   /product="surface-associated abcterial adhesion domain
FT                   protein"
FT                   /function="Predicted outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0781"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26932"
FT                   /protein_id="CBH26932.1"
FT                   /translation="MNKKWLVFAIIFLLTTIFFIPKAEAATDYGSKFFTNVALQNQNGE
FT                   NTSNFKENSKVRVAYDFVITEPVVSGETMTLTIPEQLKLINFGGFPVNDAEGNTIAEAT
FT                   VNPTTGTITLTFTDYVNSHTDLSGSLFYNASFNSKNIQTDQVNPIVFPVENTTQTENVY
FT                   ISKVSTGGGTGSPTVVFKQGRMDDKDHSTIHWTVTLNNALLPIDNAVYTDTLGSGQNLL
FT                   GKATIKYRDASKKVTSTTEQPISLDKSRNFQLTIGTLSNQSVVITYDSKIIDKQKSYTN
FT                   KATITGDNLEAVSRNASVINYESGGQGVGTTPPPVTEEPPFIPAEKQPIEKIVETDFGP
FT                   LEIVKDSEQDGKITVIYKVKSGDTLPGVAKKFDVTVEGIKDWNKLESGNLQTGQKLQLT
FT                   IEKTLLTNITTPATPKVTSTTTVGNVVEVEAVGTLPHTGDSNPLLAFLSGLSLVFFGFT
FT                   SIYKK"
FT   gene            complement(840322..840798)
FT                   /locus_tag="lse_0782"
FT   CDS_pept        complement(840322..840798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0782"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0782"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26933"
FT                   /protein_id="CBH26933.1"
FT                   /translation="MREKWQILLMIVLLSFTLNWLPEIANAQNDSTGVTYTTQNSSELM
FT                   ELFLTYSLQNPYIEITKNSAELMFETKENATITITTNNHTEKITGSTTYHQFTVAGLKP
FT                   GNNLITITATMTDSTTSSKTITVNLPNKPKKDSKSIHHQTTNENFILRKKGLLL"
FT   gene            840932..841414
FT                   /locus_tag="lse_0783"
FT   CDS_pept        840932..841414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0783"
FT                   /product="putative membrane protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0783"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26934"
FT                   /protein_id="CBH26934.1"
FT                   /translation="MELENLEKKLPKKIKTVWRQTEGIAVFVFLLCSVAAAVIFYYTEI
FT                   SLWWSLIGFGFTCLYAVFIYGFIIPFRFARWSYQIKPDEMEIQHGIIFRSRVLIPMVRI
FT                   QHVETGQGPLLRRQKLVSLSITTAAKTHVIEAVNESESEELRHHILELVKVAKEDV"
FT   gene            841407..842894
FT                   /locus_tag="lse_0784"
FT   CDS_pept        841407..842894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0784"
FT                   /product="membrane protein, putative"
FT                   /function="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0784"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26935"
FT                   /protein_id="CBH26935.1"
FT                   /translation="MFEERRLHPIALIKEIITNVRRNIVPIVVALFSIFRGIESTGYLP
FT                   SWAIYFIIIIVILLILTPAVLKYFTYRYTLEDQGIRIKYGLIFRKNTYIPYERIQTVQK
FT                   KQWFFFIPFDVCQILIETAGGNGKAEADLVAVPVSVVDELKDLRDGKQQTIIEENNTDE
FT                   EHLVAEEVTEVPEKTVMLQTKQLILMAVTSGGVFGTLLIVLAFLQQFREVIPTDWMESQ
FT                   AEELWKMGVIVMIVLIVIVLLVLWGISIVTTLFKYFQFKLMKFSDSLVVEKGLLERNHT
FT                   TISLARIQGIIIIESPLRQMLGLVAVKVITAGNSGDEKQSGDILLLPIMKKELAFQILK
FT                   EMLPNYLFDLEEMERAPKTSLRRFLQIYLGWTLIPAIIASILFFPFGLISMILPILAGM
FT                   KAIASYRATGVLTGKHTLLIQARPIISKLTYVMRKERIQGLSIRKSIWMEKGHTSHLNV
FT                   WLKSGSTSAEAYVRYLNQAQAVTIYNWYSPSKTTNEA"
FT   gene            843027..844406
FT                   /gene="hemG"
FT                   /locus_tag="lse_0785"
FT   CDS_pept        843027..844406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemG"
FT                   /locus_tag="lse_0785"
FT                   /function="Protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0785"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26936"
FT                   /protein_id="CBH26936.1"
FT                   /translation="MKHIVIIGGGLSGLAAAYELQKTHPNYTWELVEKEEKLGGKFETV
FT                   KRDGFLIEKGPDSFLARKPAGVELVNELGLADNLVANATGRSYIYHQKALHPIPEGSVM
FT                   GIPTNKQALLASTLVSEIGKARALQEPTIPKNTTKEDQSIGDFFEVRFGKELVKTLIEP
FT                   LLSGIYAGDIYKMSLRATFPQFEQTVAKHGSLMDGLQQNQKNTTGTKGTIGAFRTLTDG
FT                   LETLPKAIEQALPSQNLHTNKQATQVLKKGSSYEISFENGDKISADGVIIAATHDVLVD
FT                   LLADATTEPFANQPLTTLATVSLAYNENDVPILPDGTGYLVARTAPYKTTACTWVQKKW
FT                   PHMVPKDKMLLRGFVGKAGETWLEEASDEAIVSAVLNDYAEIMDIESAPLFYEVSRMKS
FT                   AMPQYLVTHQARLKQLKKNINADYPGVYFAGMSYQGVGIPDCIAGAKSAVNELTDFLKE
FT                   V"
FT   gene            844408..844764
FT                   /gene="acpS"
FT                   /locus_tag="lse_0786"
FT   CDS_pept        844408..844764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="lse_0786"
FT                   /product="holo-acyl-carrier protein synthase"
FT                   /function="Phosphopantetheinyl transferase (holo-ACP
FT                   synthase)"
FT                   /EC_number="2.7.8.7"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0786"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26937"
FT                   /protein_id="CBH26937.1"
FT                   /translation="MIKGIGLDMIDLARVKQVLEKNPRFIERILTKKEIIQFEKYEGSR
FT                   KIEFLAGRFAAKEAYAKANGTGFGRHLSFTDVEILQVEDGRPHVTMPIKSGETVFVSIT
FT                   HTERSAAAQVIIEV"
FT   gene            844782..845888
FT                   /gene="alr"
FT                   /locus_tag="lse_0787"
FT   CDS_pept        844782..845888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="lse_0787"
FT                   /function="Alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0787"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26938"
FT                   /protein_id="CBH26938.1"
FT                   /translation="MVTGWHRPTWIEIDRSAIRENIKNEQNKLPKNVVVWAVVKANAYG
FT                   HGIIEVAKTAKEAGAKGFCVAILDEALALREAGFQDDFILVLGATRKEDANLAAHNNIS
FT                   LTIFREDWLDGVHLETPLKVHLKIDSGMGRLGIRSAEEAEQIEAKIVQTDMFFLEGAYT
FT                   HFATADQLETSYFEQQLAKFDAILKGLKSRPRFVHTANSAAALLQSQIGFDAVRFGISM
FT                   YGLTPSIEIKSNLPFKLKPALALYTEMVHVKELAPGDSVSYGATYTATEREWVATLPIG
FT                   YADGLIRHYSGFQVLVDGKKAPIIGRVCMDQTIIKLPYEFQTGSKVTIIGMDHGNSVTA
FT                   DDAAKYLDTINYEVTCLLTERIPRKYIN"
FT   gene            846094..846372
FT                   /locus_tag="lse_0788"
FT   CDS_pept        846094..846372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0788"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted transcriptional regulators containing
FT                   the CopG/Arc/MetJ DNA-binding domain and a metal-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0788"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26939"
FT                   /protein_id="CBH26939.1"
FT                   /translation="MLEKEKRMVISVELTQEMVQELDVVVEKEKMGRSEVIMEATQQFL
FT                   QEKRARELRDEMERGYAEMATINFAIACECTHVEAEAEDRNISILGG"
FT   gene            846379..846723
FT                   /locus_tag="lse_0789"
FT   CDS_pept        846379..846723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lse_0789"
FT                   /product="transcriptional regulator, PemK family"
FT                   /function="Growth inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0789"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26940"
FT                   /protein_id="CBH26940.1"
FT                   /translation="MVKRGDVYYADLSPVVGSEQGGIRPVLIIQNDIGNRFSPTVIVAA
FT                   ITAKIQKAKLPTHVEATRKDGFERDSVILLEQIRTIDKQRLTDKITHLDEELMAKVNKA
FT                   LEVSLGVVEF"
FT   gene            846972..847808
FT                   /gene="rsbR"
FT                   /locus_tag="lse_0790"
FT   CDS_pept        846972..847808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbR"
FT                   /locus_tag="lse_0790"
FT                   /product="modulator protein RsbR"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0790"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26941"
FT                   /protein_id="CBH26941.1"
FT                   /translation="MYKDFANFIRTNKADLLNNWMNEMEKQSDQLINNIAKEPMYEETS
FT                   QEFVDLIVSNITENGSKFNEKLDDFAEKVVHLGWPIHFVTTGLRVFGLLVYTAMRDEDL
FT                   FLKREEKPENDAYYRFETWLSSMYNKVVTAYADTWEKTVSIQKSALQELSAPLLPIFEK
FT                   ISVMPLIGTIDTERAKLIIENLLIGVVKNRSEVVLIDITGVPVVDTMVAHHIIQASEAV
FT                   RLVGCQAMLVGIRPEIAQTIVNLGIELDQIITTNTMKKGMERALALTNREIVEKEG"
FT   gene            847814..848170
FT                   /gene="rsbS"
FT                   /locus_tag="lse_0791"
FT   CDS_pept        847814..848170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbS"
FT                   /locus_tag="lse_0791"
FT                   /product="anti-sigma factor B antagonist RsbS"
FT                   /function="Anti-anti-sigma regulatory factor (antagonist of
FT                   anti-sigma factor)"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0791"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26942"
FT                   /protein_id="CBH26942.1"
FT                   /translation="MGIPILKLGECLLISIQSELDDHTAVEFQEDLLAKIHETSARGVV
FT                   IDITSIDFIDSFIAKILGDVVSMSKLMGAKVVVTGIQPAVAITLIELGITFSGVLSAMD
FT                   LESGLEKLKQELGE"
FT   gene            848167..848583
FT                   /gene="rsbT"
FT                   /locus_tag="lse_0792"
FT   CDS_pept        848167..848583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbT"
FT                   /locus_tag="lse_0792"
FT                   /product="anti-sigma B factor RsbT"
FT                   /function="Anti-sigma regulatory factor (Ser/Thr protein
FT                   kinase)"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0792"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26943"
FT                   /protein_id="CBH26943.1"
FT                   /translation="MKMTFQSCVKIINEWDIVAARQLGRKISKEIGFGTVDQARITTAI
FT                   SELARNIFLYAGRGEICIEKVSESGKQGMIIVAKDKGPGIVDLRKVMQDGYTTSGGLGA
FT                   GLPGVKRLMDSFDIESSIEGESKGTVITTTKWVR"
FT   gene            848600..849604
FT                   /gene="rsbU"
FT                   /locus_tag="lse_0793"
FT   CDS_pept        848600..849604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbU"
FT                   /locus_tag="lse_0793"
FT                   /product="sigma factor B regulator protein RsbU"
FT                   /function="Serine phosphatase RsbU regulator of sigma
FT                   subunit"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0793"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26944"
FT                   /protein_id="CBH26944.1"
FT                   /translation="MEKAFEGRYRDILIQYLEHQDEELLYTCEKLSREAMEERVSPEEL
FT                   VHLHRSVLELYGKELPEFVRLSFDVLLEIMVGYGLAYMEHLSLRTEQKELRSEIAQAED
FT                   MQKTLMKTEVPEHDELDFGVISVAARQMSGDYYSFTEEGDKKIGIALADVIGKGIPAAF
FT                   SISMIKYALAGMTGDDRKPSIVLETLNQVAEENINDNMFITMFYGLYHEETHLFEYGSA
FT                   GHELGLYYQRQEGIFSDLYAKGLPLGVDKNAIYRQFDKKIEVGDAVFIMSDGVTETRTA
FT                   NGFLEREELTEIIAKQIDLSAEKMVRAIYDQLVKIQNFELHDDFTLICIKRTK"
FT   gene            849743..850087
FT                   /gene="rsbV"
FT                   /locus_tag="lse_0794"
FT   CDS_pept        849743..850087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbV"
FT                   /locus_tag="lse_0794"
FT                   /product="anti-sigma factor antagonist RsbV"
FT                   /function="Anti-anti-sigma regulatory factor (antagonist of
FT                   anti-sigma factor)"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0794"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26945"
FT                   /protein_id="CBH26945.1"
FT                   /translation="MNISIEIKERDTKHIDIFVAGEIDAYTAPKVKEALETYQVKEGIV
FT                   LRIDLTEVTYMDSTGLGVFVGTFKSLRQRQSELVLFGLSDRLFRLFEITGLSDIIEIKN
FT                   VEGEMNGNNA"
FT   gene            850071..850544
FT                   /gene="rsbW"
FT                   /locus_tag="lse_0795"
FT   CDS_pept        850071..850544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbW"
FT                   /locus_tag="lse_0795"
FT                   /product="sigma-B activity negative regulator RsbW"
FT                   /function="Anti-sigma regulatory factor (Ser/Thr protein
FT                   kinase)"
FT                   /EC_number="2.7.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:lse_0795"
FT                   /db_xref="EnsemblGenomes-Tr:CBH26946"
FT                   /protein_id="CBH26946.1"
FT                   /translation="MATMHDKITLQLPAKPEYVSLGRLSLSGIASRAGFSYEAIEDLKI
FT                   AVSEAITNSVKHAFKEEEGGEITVDFLVYEDRLEVRVSDNGTSFDLESRKQEIGPYDVG
FT                   EDAEMMRIGGLGLFLIETLMDDVKLYYDEGVSVVMTKYINEKQVEENAESIST"
FT   gene            850522..851301
FT                   /gene="sigB"
FT                   /locus_tag="lse_0796"
FT   CDS_pept        850522..851301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigB"
FT                   /locus_tag="lse_0796"
FT                   /product="RNA polymerase sigma-B factor SigB"
FT