(data stored in ACNUC13479 zone)

EMBL: FN594950

ID   FN594950; SV 1; linear; genomic DNA; STD; PLN; 13101952 BP.
XX
AC   FN594950;
XX
PR   Project:PRJEA18785;
XX
DT   25-NOV-2009 (Rel. 102, Created)
DT   24-MAY-2011 (Rel. 108, Last updated, Version 4)
XX
DE   Vitis vinifera cv. PN40024, annotated scaffold_0.assembly12x
XX
KW   .
XX
OS   Vitis vinifera (wine grape)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; Vitales; Vitaceae; Viteae; Vitis.
XX
RN   [1]
RP   1-13101952
RA   Vitulo N., Olivier J., Forcato C., Albiero A., D'Angelo M., Zimbello R.,
RA   Schiavon R., Rigobello C., Policriti A., Clepet C., Casagrande A.,
RA   Choisne N., Vezzi A., Hugueney P., Horner D., Mica E., Cattonaro F.,
RA   Del Fabbro C., Alaux M., Di Gaspero G., Scalabrin S., Pesole G.,
RA   Delledonne M., Pezzotti M., Pe E.M., Caboche M., Adam-Blondon A.-F.,
RA   Weissenbach J., Quetier F., Wincker P., Morgante M., Valle G.;
RT   "High quality assembly and annotation of grapevine genome";
RL   Unpublished.
XX
RN   [2]
RP   1-13101952
RA   Vitulo N.;
RT   ;
RL   Submitted (20-MAY-2011) to the INSDC.
XX
DR   MD5; 0df6583c713654e8e668a0469a8fbfaf.
DR   ENA-CON; FN597042.
DR   BioSample; SAMEA2272750.
DR   EuropePMC; PMC5612791; 28971018.
DR   RFAM; RF00004; U2.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00020; U5.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00055; SNORD96.
DR   RFAM; RF00344; snoZ267.
DR   RFAM; RF00357; snoR44_J54.
DR   RFAM; RF00638; MIR159.
DR   RFAM; RF00643; MIR171_1.
DR   RFAM; RF00645; MIR169_2.
DR   RFAM; RF00742; MIR162_2.
DR   RFAM; RF00865; MIR169_5.
DR   RFAM; RF00975; MIR845_2.
DR   RFAM; RF01231; snoR74.
DR   RFAM; RF01420; snoR113.
XX
CC   This is a 'working draft' sequence, generated by whole genome
CC   shotgun. The assembly was made at a 12X coverage of the genome,
CC   sequenced by Sanger method. Sequencing effort has been performed by
CC   GENOSCOPE, CRIBI and IGA.  This annotation is done on an updated
CC   gene prediction version (V1).   More information available at
CC   http://genomics.cribi.unipd.it , http://www.genoscope.cns.fr/vitis
CC   and http://www.appliedgenomics.org/ Email: seqref@genoscope.cns.fr.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..13101952
FT                   /organism="Vitis vinifera"
FT                   /chromosome="chr17"
FT                   /cultivar="PN40024"
FT                   /mol_type="genomic DNA"
FT                   /note="scaffold_0.assembly12x"
FT                   /db_xref="taxon:29760"
FT   gap             6707..6806
FT                   /estimated_length=100
FT   gap             17362..18348
FT                   /estimated_length=987
FT   gene            67187..67547
FT                   /locus_tag="VIT_17s0000g10480"
FT                   /old_locus_tag="Vv17s0000g10480"
FT   mRNA            join(67187..67195,67196..67450,67451..67547)
FT                   /locus_tag="VIT_17s0000g10480"
FT                   /old_locus_tag="Vv17s0000g10480"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           67187..67195
FT                   /locus_tag="VIT_17s0000g10480"
FT                   /old_locus_tag="Vv17s0000g10480"
FT   CDS_pept        67196..67450
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10480"
FT                   /old_locus_tag="Vv17s0000g10480"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR030070"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSG6"
FT                   /protein_id="CCB42882.1"
FT                   /translation="MGQSPPHSLRATQSSLMFTPHIPFISLQKPDEMLVTNHSLMQASS
FT                   GYEDMCNEQGFPTVFTWTYSDKEIALEGSWDNWNTRKPL"
FT   3'UTR           67451..67547
FT                   /locus_tag="VIT_17s0000g10480"
FT                   /old_locus_tag="Vv17s0000g10480"
FT   gap             87250..87349
FT                   /estimated_length=100
FT   gene            98145..98567
FT                   /locus_tag="VIT_17s0000g10470"
FT                   /old_locus_tag="Vv17s0000g10470"
FT   mRNA            join(98145..98207,98208..98567)
FT                   /locus_tag="VIT_17s0000g10470"
FT                   /old_locus_tag="Vv17s0000g10470"
FT                   /product="Predicted protein"
FT   5'UTR           98145..98207
FT                   /locus_tag="VIT_17s0000g10470"
FT                   /old_locus_tag="Vv17s0000g10470"
FT   CDS_pept        98208..98567
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10470"
FT                   /old_locus_tag="Vv17s0000g10470"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR030070"
FT                   /db_xref="InterPro:IPR032640"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSG9"
FT                   /protein_id="CCB42883.1"
FT                   /translation="MGQSPPHSPRATQSPLMFTPHIPFISLQKPDEMLVINHSLMQASS
FT                   GYEDMCNEQGFPTAFTWTYSDKEIALEGSWDNWNTRKPLQRLGEKFTIMRVPLSGVYQY
FT                   RFIVDGQWRILSLKT"
FT   gap             111420..111519
FT                   /estimated_length=100
FT   gap             123074..125688
FT                   /estimated_length=2615
FT   gap             142653..142752
FT                   /estimated_length=100
FT   gap             163439..163538
FT                   /estimated_length=100
FT   gap             172741..172840
FT                   /estimated_length=100
FT   gap             202562..202661
FT                   /estimated_length=100
FT   gene            complement(237872..243826)
FT                   /locus_tag="VIT_17s0000g10450"
FT                   /old_locus_tag="Vv17s0000g10450"
FT   mRNA            complement(join(237872..237928,243797..243826))
FT                   /locus_tag="VIT_17s0000g10450"
FT                   /old_locus_tag="Vv17s0000g10450"
FT   CDS_pept        complement(join(237872..237928,243797..243826))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10450"
FT                   /old_locus_tag="Vv17s0000g10450"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSH0"
FT                   /protein_id="CCB42884.1"
FT                   /translation="MGNLVAYDAMGNAQVLDEELNLIWPGFL"
FT   gene            281290..285285
FT                   /locus_tag="VIT_17s0000g10440"
FT                   /old_locus_tag="Vv17s0000g10440"
FT   mRNA            join(281290..281307,285005..285030,285255..285285)
FT                   /locus_tag="VIT_17s0000g10440"
FT                   /old_locus_tag="Vv17s0000g10440"
FT   CDS_pept        join(281290..281307,285005..285030,285255..285285)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10440"
FT                   /old_locus_tag="Vv17s0000g10440"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSG5"
FT                   /protein_id="CCB42885.1"
FT                   /translation="MASMSKSSKPKHKEREKQNKKEKP"
FT   gene            complement(290001..294875)
FT                   /locus_tag="VIT_17s0000g10430"
FT                   /old_locus_tag="Vv17s0000g10430"
FT   mRNA            complement(join(290001..290259,290260..290305,
FT                   290587..290676,291083..291166,291431..291573,
FT                   292400..292497,292588..292648,292739..292885,
FT                   293608..293707,293797..293912,294340..294440,
FT                   294650..294673,294798..294801,294802..294875))
FT                   /locus_tag="VIT_17s0000g10430"
FT                   /old_locus_tag="Vv17s0000g10430"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(290001..290259)
FT                   /locus_tag="VIT_17s0000g10430"
FT                   /old_locus_tag="Vv17s0000g10430"
FT   CDS_pept        complement(join(290260..290305,290587..290676,
FT                   291083..291166,291431..291573,292400..292497,
FT                   292588..292648,292739..292885,293608..293707,
FT                   293797..293912,294340..294440,294650..294673,
FT                   294798..294801))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10430"
FT                   /old_locus_tag="Vv17s0000g10430"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSG7"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSG7"
FT                   /protein_id="CCB42886.1"
FT                   /translation="MGKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTY
FT                   MFKYDSVHGQWKHHELKVKDSNTLLFGEKPVTVFGIRNPEEIPWGETGAEFVVESTGVF
FT                   TDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEKEYKPELHIVSNASCTTNCLAPLA
FT                   KVINDRFGIVEGLMTTVHSITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKV
FT                   LPSLNGKLTGMAFRVPTVDVSVVDLTVRLEKAATYEQVKAAIKEESEGKMKGILGYTED
FT                   DVVSTDFIGDNRSSIFDAKAGIALNEKFLKIVAWYDNEWGYSSRVIDLIVHMASCK"
FT   5'UTR           complement(294802..294875)
FT                   /locus_tag="VIT_17s0000g10430"
FT                   /old_locus_tag="Vv17s0000g10430"
FT   gene            complement(295780..305332)
FT                   /locus_tag="VIT_17s0000g10420"
FT                   /old_locus_tag="Vv17s0000g10420"
FT   mRNA            complement(join(295780..296104,296105..296253,
FT                   296342..296569,297278..297409,304720..305239,
FT                   305240..305332))
FT                   /locus_tag="VIT_17s0000g10420"
FT                   /old_locus_tag="Vv17s0000g10420"
FT                   /product="GT-1"
FT   3'UTR           complement(295780..296104)
FT                   /locus_tag="VIT_17s0000g10420"
FT                   /old_locus_tag="Vv17s0000g10420"
FT   CDS_pept        complement(join(296105..296253,296342..296569,
FT                   297278..297409,304720..305239))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10420"
FT                   /old_locus_tag="Vv17s0000g10420"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SH98"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="UniProtKB/TrEMBL:D7SH98"
FT                   /protein_id="CBI14857.3"
FT                   /translation="MPRPMSFFVEEDEDMLMDADGNNVEHVPQHDPHRHHPQRQHLQQI
FT                   LLTESSGEDIEIKVPRRRAETWVHDETHSLIAFRRELDEFFNTSKSNKHLWEQIAARMS
FT                   ELGYDRTAAMCTDKWRNLLKDYKKAQQRDGGSGKMYYEELEEFYAEKKRNDPYRKITSS
FT                   RAPFMHISEKDGRKARFNSEKVMDYDQHSLGISEAEVVAANGLPPWNRKETPGSGTENE
FT                   SAYTGRVIWVNYGECTKRIGIDGSSDSIKEAIRSSFGLRTNRAFWLEDENEIVRSLDRD
FT                   MPLTTYTLCLDAGLTIKICLYDQPCQLLPVRTEEKTFYCEDDLRDFLHHRGWMGLRRFK
FT                   LL"
FT   5'UTR           complement(305240..305332)
FT                   /locus_tag="VIT_17s0000g10420"
FT                   /old_locus_tag="Vv17s0000g10420"
FT   gene            337475..337849
FT                   /locus_tag="VIT_17s0000g10410"
FT                   /old_locus_tag="Vv17s0000g10410"
FT   mRNA            join(337475..337624,337625..337849)
FT                   /locus_tag="VIT_17s0000g10410"
FT                   /old_locus_tag="Vv17s0000g10410"
FT   CDS_pept        337475..337624
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10410"
FT                   /old_locus_tag="Vv17s0000g10410"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSF5"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSF5"
FT                   /protein_id="CCB42887.1"
FT                   /translation="MKRRADLVSVDNPGGTGYNFVDDTKLLVKTGVEAAVDLTILLKEI
FT                   FNKE"
FT   3'UTR           337625..337849
FT                   /locus_tag="VIT_17s0000g10410"
FT                   /old_locus_tag="Vv17s0000g10410"
FT   gap             358950..363617
FT                   /estimated_length=4668
FT   gene            367202..367510
FT                   /locus_tag="VIT_17s0000g10400"
FT                   /old_locus_tag="Vv17s0000g10400"
FT   mRNA            join(367202..367399,367400..367510)
FT                   /locus_tag="VIT_17s0000g10400"
FT                   /old_locus_tag="Vv17s0000g10400"
FT   CDS_pept        367202..367399
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10400"
FT                   /old_locus_tag="Vv17s0000g10400"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSF8"
FT                   /protein_id="CCB42888.1"
FT                   /translation="MSSEEAPAETMLEVREPNGESATFGLIRDLGSHHWLHERENRRGG
FT                   IFTMRSNAGCPRCFTMMQGT"
FT   3'UTR           367400..367510
FT                   /locus_tag="VIT_17s0000g10400"
FT                   /old_locus_tag="Vv17s0000g10400"
FT   gap             379454..380062
FT                   /estimated_length=609
FT   gap             384224..384413
FT                   /estimated_length=190
FT   gene            395134..395478
FT                   /locus_tag="VIT_17s0000g10380"
FT                   /old_locus_tag="Vv17s0000g10380"
FT   mRNA            395134..395478
FT                   /locus_tag="VIT_17s0000g10380"
FT                   /old_locus_tag="Vv17s0000g10380"
FT                   /product="Predicted protein"
FT   CDS_pept        395134..395478
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10380"
FT                   /old_locus_tag="Vv17s0000g10380"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SH99"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:D7SH99"
FT                   /protein_id="CBI14858.3"
FT                   /translation="MEKMQPLDLLETLVRTTGGMKEKTDGEESSPCAAMPAAQDVSQEC
FT                   KELDITVLHVKLHAARGNKTKTPGPGAQSALQAPCSFWNENVAVTPFPTHSSLFSFTCR
FT                   HPKTFSQAFS"
FT   gene            403935..404514
FT                   /locus_tag="VIT_17s0000g10370"
FT                   /old_locus_tag="Vv17s0000g10370"
FT   mRNA            join(403935..404021,404022..404234,404235..404514)
FT                   /locus_tag="VIT_17s0000g10370"
FT                   /old_locus_tag="Vv17s0000g10370"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           403935..404021
FT                   /locus_tag="VIT_17s0000g10370"
FT                   /old_locus_tag="Vv17s0000g10370"
FT   CDS_pept        404022..404234
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10370"
FT                   /old_locus_tag="Vv17s0000g10370"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSG1"
FT                   /protein_id="CCB42889.1"
FT                   /translation="MVSKVDEAMKKSGKELYQHQQQQQMQKLQIQYCNKGKASKFKRSS
FT                   SNLEEDGASSAILLLACIACAPSYP"
FT   3'UTR           404235..404514
FT                   /locus_tag="VIT_17s0000g10370"
FT                   /old_locus_tag="Vv17s0000g10370"
FT   gap             433980..434079
FT                   /estimated_length=100
FT   gap             436759..436858
FT                   /estimated_length=100
FT   gap             529006..529105
FT                   /estimated_length=100
FT   gene            543649..545223
FT                   /locus_tag="VIT_17s0000g10300"
FT                   /old_locus_tag="Vv17s0000g10300"
FT   mRNA            join(543649..545208,545209..545223)
FT                   /locus_tag="VIT_17s0000g10300"
FT                   /old_locus_tag="Vv17s0000g10300"
FT                   /product="GRAS family transcription factor"
FT   CDS_pept        543649..545208
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10300"
FT                   /old_locus_tag="Vv17s0000g10300"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSG2"
FT                   /db_xref="InterPro:IPR005202"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSG2"
FT                   /protein_id="CCB42890.1"
FT                   /translation="MASDLLSEERSDEVSGLDTSLSAQAYYSRSYLPIFQNGSATNWFH
FT                   YSDEARNHKRLKRTQSIAESIGSNSSLYSGGKSYSNSSSSFINRSSSTNSLNSLPRLHF
FT                   RDHIWTYTQRYLAAEAVEEAAAAMISAAEGEVEEDGSGDGMRLVQLLIACAEAVACRDK
FT                   THASSLLSELRANALVFGSSFQRVASCFVQGLADRLSLVQPLGAVGFIAPSINPLDTAW
FT                   EKKEEALRLVYEICPHIKFGHFVANASILEAFEGENFAHVVDLGMTLGLAHGQQWRQLI
FT                   HSLANRAGRPPRRLRITGVGLCVDRFKIIGEELEAYAQDLDINLEFSAVESNLENLRPE
FT                   DIKREDGEALVVNSILQLHCVVKESRGALNSVLQKINELSPKVLVLVEQDSSHNGPFFL
FT                   GRFMEALHYYSAIFDSLEAMLPKYDTRRAKIEQFYFGEEIKNIVSCEGPARVERHERVD
FT                   QWRRRMSRAGFQAAPIKMMAQAKQWLGKVKACEGYNIMEEKGCLVLGWKSKPIVAASCW
FT                   KC"
FT   3'UTR           545209..545223
FT                   /locus_tag="VIT_17s0000g10300"
FT                   /old_locus_tag="Vv17s0000g10300"
FT   gene            complement(548210..548671)
FT                   /locus_tag="VIT_17s0000g10290"
FT                   /old_locus_tag="Vv17s0000g10290"
FT   mRNA            complement(join(548210..548285,548286..548291,
FT                   548411..548503,548663..548671))
FT                   /locus_tag="VIT_17s0000g10290"
FT                   /old_locus_tag="Vv17s0000g10290"
FT   3'UTR           complement(548210..548285)
FT                   /locus_tag="VIT_17s0000g10290"
FT                   /old_locus_tag="Vv17s0000g10290"
FT   CDS_pept        complement(join(548286..548291,548411..548503,
FT                   548663..548671))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10290"
FT                   /old_locus_tag="Vv17s0000g10290"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHA1"
FT                   /protein_id="CBI14860.3"
FT                   /translation="MVQYLIRKSVEIQELRITLQQQQEDVTTSLRNLGL"
FT   gene            568981..571285
FT                   /locus_tag="VIT_17s0000g10280"
FT                   /old_locus_tag="Vv17s0000g10280"
FT   mRNA            join(568981..568992,568993..569229,569451..569507,
FT                   569821..569907,570339..570419,570537..570649,
FT                   570762..570811,571018..571085,571086..571285)
FT                   /locus_tag="VIT_17s0000g10280"
FT                   /old_locus_tag="Vv17s0000g10280"
FT                   /product="Nucleoside diphosphate kinase"
FT   5'UTR           568981..568992
FT                   /locus_tag="VIT_17s0000g10280"
FT                   /old_locus_tag="Vv17s0000g10280"
FT   CDS_pept        join(568993..569229,569451..569507,569821..569907,
FT                   570339..570419,570537..570649,570762..570811,
FT                   571018..571085)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10280"
FT                   /old_locus_tag="Vv17s0000g10280"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHA2"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHA2"
FT                   /protein_id="CBI14861.3"
FT                   /translation="MEAAAVLGARPSVSSSYLHSQTQRHCSLYVVSQKPTLRSDHRRLA
FT                   AFHSPSNLFSYSPFRPHARSTKPRIFLPHLVASMEQVEETYIMVKPDGVQRGLVGEIIS
FT                   RFEKKGFKLTGLKLFQCPKQLAEEHYKDLKEKSFFPKLIEYITSGPVVCMAWEGVGVVA
FT                   SARKLIGSTNPLQAEPGTIRGDLAVQTGRNVVHGSDSPENGKREISLWFKEGELCEWAP
FT                   VQAPWLRE"
FT   3'UTR           571086..571285
FT                   /locus_tag="VIT_17s0000g10280"
FT                   /old_locus_tag="Vv17s0000g10280"
FT   gene            complement(571654..574346)
FT                   /locus_tag="VIT_17s0000g10270"
FT                   /old_locus_tag="Vv17s0000g10270"
FT   mRNA            complement(join(571654..571879,571880..572280,
FT                   574187..574292,574293..574346))
FT                   /locus_tag="VIT_17s0000g10270"
FT                   /old_locus_tag="Vv17s0000g10270"
FT                   /product="Predicted protein"
FT   3'UTR           complement(571654..571879)
FT                   /locus_tag="VIT_17s0000g10270"
FT                   /old_locus_tag="Vv17s0000g10270"
FT   CDS_pept        complement(join(571880..572280,574187..574292))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10270"
FT                   /old_locus_tag="Vv17s0000g10270"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHA3"
FT                   /protein_id="CBI14862.3"
FT                   /translation="MLGRVRPLSSSSSSSLDSLERPSPKIIKHDSLSIYEATIMKLKLA
FT                   SQRDISSIQEEAMTIETDATSASVSASSQNELSLPSMEAIEMETSKQTNCSASVSKSYQ
FT                   HSPSSSYEEAMTIDATGLSPGCSDCQSMINSVKQQRNKNLSIADLFSKYKSSQHAQSSA
FT                   CEETM"
FT   5'UTR           complement(574293..574346)
FT                   /locus_tag="VIT_17s0000g10270"
FT                   /old_locus_tag="Vv17s0000g10270"
FT   gene            complement(585611..593550)
FT                   /locus_tag="VIT_17s0000g10260"
FT                   /old_locus_tag="Vv17s0000g10260"
FT   mRNA            complement(join(585611..585939,586051..586067,
FT                   586068..586132,586389..586533,587143..587296,
FT                   587671..587760,588104..588238,588662..588772,
FT                   589935..590059,591023..591151,591234..591281,
FT                   592280..592474,593008..593136,593244..593357,
FT                   593358..593550))
FT                   /locus_tag="VIT_17s0000g10260"
FT                   /old_locus_tag="Vv17s0000g10260"
FT                   /product="Predicted protein"
FT   3'UTR           complement(join(585611..585939,586051..586067))
FT                   /locus_tag="VIT_17s0000g10260"
FT                   /old_locus_tag="Vv17s0000g10260"
FT   CDS_pept        complement(join(586068..586132,586389..586533,
FT                   587143..587296,587671..587760,588104..588238,
FT                   588662..588772,589935..590059,591023..591151,
FT                   591234..591281,592280..592474,593008..593136,
FT                   593244..593357))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10260"
FT                   /old_locus_tag="Vv17s0000g10260"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHA4"
FT                   /protein_id="CBI14863.3"
FT                   /translation="MPPLDFKDFQEKLSTHFRPFHRSFQFWVRAVDIYTGYKVFQLRVS
FT                   FVKDVKKQEEMWEVQHELAAEKIYATCADLGGFFLKIAQIIGKPDLAPAAWVRRLVTLC
FT                   DRAPATPFDAIQPVLEKELGQSIGEIFERFDVDPIGSASIAQVHRARLRGDKNDVVVKV
FT                   QHPGVQDLMMTDIRNLQAFALYMQKTDIKFDLYSVTKEMEKQIGYEFDFIREADAMERI
FT                   KRFLYENNKKRPVLVPRVIRDMVTRRVLVMEYIDGIPILNLGDEIAKRGINPGGKLAAA
FT                   AKQKILESLTIAYGQMILKSGFFHADPHPGNILICKGSEASGQYKLVLTSPDKLRIGYA
FT                   NLILAIADNDPVKASESYRELGIETLSNCKDEQNELFKLAQTMFDTKLPPGVVMLQPFA
FT                   EDSSIKKVGVQAFPEELFSILRTVHLLRGLSVGLGINYSCADQWRPIAEEALVRAGRLK
FT                   DKDVKSRARQSSFFRRIFSQQ"
FT   5'UTR           complement(593358..593550)
FT                   /locus_tag="VIT_17s0000g10260"
FT                   /old_locus_tag="Vv17s0000g10260"
FT   gene            complement(594916..600284)
FT                   /locus_tag="VIT_17s0000g10250"
FT                   /old_locus_tag="Vv17s0000g10250"
FT   mRNA            complement(join(594916..595204,595205..595379,
FT                   595468..595636,595834..595942,596019..596238,
FT                   596568..596713,596803..596893,599838..599952,
FT                   600046..600181,600182..600284))
FT                   /locus_tag="VIT_17s0000g10250"
FT                   /old_locus_tag="Vv17s0000g10250"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(594916..595204)
FT                   /locus_tag="VIT_17s0000g10250"
FT                   /old_locus_tag="Vv17s0000g10250"
FT   CDS_pept        complement(join(595205..595379,595468..595636,
FT                   595834..595942,596019..596238,596568..596713,
FT                   596803..596893,599838..599952,600046..600181))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10250"
FT                   /old_locus_tag="Vv17s0000g10250"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHA5"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR019585"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHA5"
FT                   /protein_id="CBI14864.3"
FT                   /translation="MESQDGTQQPHLVLAHKLFLLTHPDAQDIEKVRLKEEVFAAVKVD
FT                   DMASLYETLAADSVLEMDQAVLDTMRAKIDDELKKLDEKIADAEENLGESEVREAHLAK
FT                   SLFYIRIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLLLGFFYMDFDLISKSIDKAKN
FT                   LFEEGGDWERKNRLKVYEGLYCMSTRNFKKAANLFLDSISTFTTYELFPYDTFIFYTVL
FT                   TSIISLDRVSLKQKVVDAPEILAVIGKIPYLSEFLNSLYDCQYKSFFSAFAGLAEQIKL
FT                   DRYLHPHFRYYMREVRTVVYSQFLESYKSVTIEAMAKAFGVTVEFIDLELSRFIAAGKL
FT                   HCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQKLSRVIDL"
FT   5'UTR           complement(600182..600284)
FT                   /locus_tag="VIT_17s0000g10250"
FT                   /old_locus_tag="Vv17s0000g10250"
FT   gene            603580..607069
FT                   /locus_tag="VIT_17s0000g10240"
FT                   /old_locus_tag="Vv17s0000g10240"
FT   mRNA            join(603580..603628,603629..603689,604947..605196,
FT                   605286..605453,605544..605675,606385..606466,
FT                   606551..606664,606755..606835,606836..607069)
FT                   /locus_tag="VIT_17s0000g10240"
FT                   /old_locus_tag="Vv17s0000g10240"
FT                   /product="unknown predicted protein"
FT   5'UTR           603580..603628
FT                   /locus_tag="VIT_17s0000g10240"
FT                   /old_locus_tag="Vv17s0000g10240"
FT   CDS_pept        join(603629..603689,604947..605196,605286..605453,
FT                   605544..605675,606385..606466,606551..606664,
FT                   606755..606835)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10240"
FT                   /old_locus_tag="Vv17s0000g10240"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHA6"
FT                   /db_xref="InterPro:IPR003653"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHA6"
FT                   /protein_id="CBI14865.3"
FT                   /translation="MVKKKPRNSNAPIDLASADSESYLDYSKHRSCWRHMVAHLQAQNK
FT                   RMTKHEIEEIKEIFEFTTPCFSNTFPRHERSKRRINCKNIIIRKEKKKLDTAAFEWYFR
FT                   NLWKSFSDDKKSSFGYLDCLWFSFYLKTSSREKVLNWIKKKRIFSRKYVFVPIVCWNHW
FT                   SLLILCHFGESLESKIRAPCMLLLDSLQMANPKRLEPNIRKFVFDIYKEEGRPESKQLI
FT                   SKIPLLVPKVPQQRNGEECGNFVLYFINLFMDGAPENFSVSEGYPYFMKKNWFGPEALE
FT                   HFFRKLDSIPKPDL"
FT   3'UTR           606836..607069
FT                   /locus_tag="VIT_17s0000g10240"
FT                   /old_locus_tag="Vv17s0000g10240"
FT   gap             612772..612871
FT                   /estimated_length=100
FT   gene            complement(614639..622855)
FT                   /locus_tag="VIT_17s0000g10210"
FT                   /old_locus_tag="Vv17s0000g10210"
FT   mRNA            complement(join(614639..614662,615078..615276,
FT                   615553..616322,616666..617195,617278..617376,
FT                   617649..617863,618473..618749,619091..619251,
FT                   620526..620711,621444..621615,622083..622185,
FT                   622283..622311,622663..622855))
FT                   /locus_tag="VIT_17s0000g10210"
FT                   /old_locus_tag="Vv17s0000g10210"
FT                   /product="putative uncharacterized protein"
FT   CDS_pept        complement(join(614639..614662,615078..615276,
FT                   615553..616322,616666..617195,617278..617376,
FT                   617649..617863,618473..618749,619091..619251,
FT                   620526..620711,621444..621615,622083..622185,
FT                   622283..622311,622663..622855))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10210"
FT                   /old_locus_tag="Vv17s0000g10210"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSG3"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR019337"
FT                   /db_xref="InterPro:IPR038528"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSG3"
FT                   /protein_id="CCB42891.1"
FT                   /translation="MENGPKRRRRELEPTVLHKVGDVISAINEAKHVDQLICALHSLAV
FT                   RLFPLDSSAFSGRKISYSFCSIDEQYRDQVLRTEVPSSDERSDWWWVFYQGTAFPTLAR
FT                   VLLYEVASNWLACFPISAQKHVYDVFFVEGLATEVVQTLVPCLQHNARDSLRVNTVCLN
FT                   AERLLVLCLFENDGILQMAREFGSSFQSEDSISERMKPAVSRVAQLMVSIPDKAPLGAP
FT                   TSLSSHFFFKQIAIQLLAGVEEKSMKLHDEAASLDKNGMDGTFLFVGETFARICRRGSI
FT                   DVLLGEVIPRILAHIRSCLQSNTDLIDADVFETNPGFLFWSKMMEAIKDPYAVERMSEQ
FT                   ILHYLATEQASDTEAYWTLWMLFHQIFYRQKSVRSMFIDKFLLWKVFPLCCLRWILQFA
FT                   VLECPPGANSLTKGHNTRGLIDTVQHLVTVWSKQEFVQSAPIEQQTYITAAVGISLEKM
FT                   SKEELDATKEVMHSILRGVSCRLESPDHLVRRMASSVALVFSKVVDPKNPLHLDDSCSG
FT                   ETIDWEFGLVTPDKGIQVASSSTEKGIKEIENSTASVAGKELDSAVDGGAGNNLKDRDK
FT                   KLSKFRLVDPDEIIDPAMLNDESTSGGSDDDNASDNSESSNDSSLQPYDLSDDDTDLKK
FT                   KITQVVDVVGALRKSDDADGVERALDVAENLVRASPDELRHLTGDLVRTLVQVRCSDLT
FT                   IEGEEESAEEKRQKALVALLVTCPFESLDALHKLLYSPNVDVSQRILILDIMTDAAQEL
FT                   ADTRTMKPKRQPGALISTISETQPWFLPSSIGPPGAGSWKEMSGTGSLLNLSYSYEREL
FT                   PPKPNQVKRGKTRRWSLRLKNMPESQTEWSQNKFPLYAAAFMLPAMQGFDKRRHGVDLL
FT                   ARDFIVLGKLIYMLGVCMKCASMHPEASALASPLLDMLSSREVCYHKEAYVRRSVLFAA
FT                   SCVLMALHPSYVASALVEGNPELSKGLEWVRTWALNVADTDTDKDCYTREKGEKP"
FT   gene            complement(645488..646429)
FT                   /locus_tag="VIT_17s0000g10200"
FT                   /old_locus_tag="Vv17s0000g10200"
FT   mRNA            complement(645488..646429)
FT                   /locus_tag="VIT_17s0000g10200"
FT                   /old_locus_tag="Vv17s0000g10200"
FT                   /product="Predicted protein"
FT   CDS_pept        complement(645488..646429)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10200"
FT                   /old_locus_tag="Vv17s0000g10200"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSG4"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSG4"
FT                   /protein_id="CCB42892.1"
FT                   /translation="MSTLPKELGWTSDHMYQYQGFWYTSMNLEGVMWAQQHFKATHLDV
FT                   FLASTPKSGTTWLKALMFAIMNRTRFDFSTHPLLTSNPHELVTLLEFYFHWNIPYPNPN
FT                   TPLPKTQLFQTHIPFTSLPESIVDSQCRILYLCRNPKDVFVSMYCFKENLTDINLAPLS
FT                   IEEAIEQFCKGVSLFGPFWDHVLGYWKVSLEWPERVLFLKYEDLKRDSLFHVKRLAEFL
FT                   GCPFSLEEEKEGIVHEIIKLCSFENLSNLKVNKTGVLQARDFIIEKKKFFQKGEVGDWK
FT                   NHLTTEMGDCLNRIMDQKLDGSGLTFHDSLET"
FT   gap             647622..652517
FT                   /estimated_length=4896
FT   gap             668659..668758
FT                   /estimated_length=100
FT   gene            713342..721986
FT                   /locus_tag="VIT_17s0000g10190"
FT                   /old_locus_tag="Vv17s0000g10190"
FT   mRNA            join(713342..713354,713355..713824,714577..714646,
FT                   714762..714934,715503..715677,719429..719595,
FT                   719679..719898,719990..720094,721388..721540,
FT                   721662..721820,721821..721986)
FT                   /locus_tag="VIT_17s0000g10190"
FT                   /old_locus_tag="Vv17s0000g10190"
FT                   /product="Histone acetyltransferase"
FT   5'UTR           713342..713354
FT                   /locus_tag="VIT_17s0000g10190"
FT                   /old_locus_tag="Vv17s0000g10190"
FT   CDS_pept        join(713355..713824,714577..714646,714762..714934,
FT                   715503..715677,719429..719595,719679..719898,
FT                   719990..720094,721388..721540,721662..721820)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10190"
FT                   /old_locus_tag="Vv17s0000g10190"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSF4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR034687"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSF4"
FT                   /protein_id="CCB42893.1"
FT                   /translation="MATAVVAESRKLPRPGRGGVVSHGLSEEEARVRAIAEIVNNMVEL
FT                   SHRGENVDLNALKSAACRKYGLSRAPKLVEMIAALPESERDSLLPRLRAKPVRTASGIA
FT                   VVAVMSKPHRCPHIATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQ
FT                   ARSRIDQLKRLGHSVDKVEFILMGGTFMSLPAEYRDYFTRNLHDALSGHTSANVEEAVA
FT                   YSEHSAIKCIGMTIETRPDYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVA
FT                   AVADCFCLAKDAGFKVVAHMMPDLPNVGVERDLESFREFFESPMFRADGLKIYPTLVIR
FT                   GTGLYELWKTGRYRNYPPEQLVDIVARILAMVPPWTRVYRVQRDIPMPLVTSGVEKGNL
FT                   RELALARMDDLGLKCRDVRTREAGIQDIHHKIKPEEVELVRRDYTANEGWETFLSYEDI
FT                   RQDILVGLLRLRKCGRNTTCPELIGRCSIVRELHVYGTAVPVHGRDADKLQHQGYGTLL
FT                   MEAAERIAGREHRSTKIAVISGVGTRHYYRKLGYELEGPYMVKYLV"
FT   3'UTR           721821..721986
FT                   /locus_tag="VIT_17s0000g10190"
FT                   /old_locus_tag="Vv17s0000g10190"
FT   gene            723711..725609
FT                   /locus_tag="VIT_17s0000g10180"
FT                   /old_locus_tag="Vv17s0000g10180"
FT   mRNA            join(723711..723711,723712..724508,724594..725218,
FT                   725219..725609)
FT                   /locus_tag="VIT_17s0000g10180"
FT                   /old_locus_tag="Vv17s0000g10180"
FT                   /product="unknown predicted protein"
FT   5'UTR           723711..723711
FT                   /locus_tag="VIT_17s0000g10180"
FT                   /old_locus_tag="Vv17s0000g10180"
FT   CDS_pept        join(723712..724508,724594..725218)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10180"
FT                   /old_locus_tag="Vv17s0000g10180"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSF6"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSF6"
FT                   /protein_id="CCB42894.1"
FT                   /translation="MLKSTFTPILSIITPKPTTSKPSKIFTKAFSQSPPTVRKNDSHNP
FT                   STTTPPHNLPPVSAYIHLPFCRKRCHYCDFPIVALGSSFTPPPEDDPRILNYTQLICRE
FT                   IEATKPECYPTPPLETVFFGGGTPSLVPPRLVSDIVEALRLKFGLCLDAEMSMEMDPGT
FT                   FDAEKLKGLMELGVNRVSLGVQAFQEEMLRGCGRAHGVKEIYEAIETVKSCGVENWSVD
FT                   LISSLPHQTPEMWEESLQLVIEAQPTHVSVYDLQVEQGTKFGILYTPGEFPLPSEIQSA
FT                   DFYRMASTTLSNAGYNHYEISSYCKGGFECKHNLTYWENKPFYGFGLGSASYVGGVRFS
FT                   RPRKMKEYMGYVQSLETEVVGCGGNSVDAKDVAMDVVMLSLRTARGLDLKSFRNSFGSS
FT                   FVASLCMAYRPYVKSGHVVCLDEQRRPVTSDEFSSLLSKDDGIEERLAFVRLSDPDGFL
FT                   LSNELISLAFQAIAP"
FT   3'UTR           725219..725609
FT                   /locus_tag="VIT_17s0000g10180"
FT                   /old_locus_tag="Vv17s0000g10180"
FT   gene            complement(726251..734986)
FT                   /locus_tag="VIT_17s0000g10170"
FT                   /old_locus_tag="Vv17s0000g10170"
FT   mRNA            complement(join(726251..726529,726833..726835,
FT                   726836..726905,726999..727087,727495..727568,
FT                   727714..727771,727849..727971,732882..733091,
FT                   733174..733258,733587..733612,734830..734925,
FT                   734926..734986))
FT                   /locus_tag="VIT_17s0000g10170"
FT                   /old_locus_tag="Vv17s0000g10170"
FT                   /product="Predicted protein"
FT   3'UTR           complement(join(726251..726529,726833..726835))
FT                   /locus_tag="VIT_17s0000g10170"
FT                   /old_locus_tag="Vv17s0000g10170"
FT   CDS_pept        complement(join(726836..726905,726999..727087,
FT                   727495..727568,727714..727771,727849..727971,
FT                   732882..733091,733174..733258,733587..733612,
FT                   734830..734925))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10170"
FT                   /old_locus_tag="Vv17s0000g10170"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHB1"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHB1"
FT                   /protein_id="CBI14870.3"
FT                   /translation="MGRATEIASILLLISLSLQGALPISSLSHTTQDFEESAAARNLKQ
FT                   QKDHAHEVHCSRERSRAAWKIIEEYMMPFVEREQYQISSSCKLHPDNHLFSDQEQHKIH
FT                   VDINEWRCGYCKKSFRAEKFLDQHFDNRHYGLLNVSHSKCLADLCGALHCDLVMNSKTP
FT                   KAKCNPAAAVRNRHLCESLADSCFPVNHGLSASRLHDIFLRQFCDAHTCSGGGKPFSRG
FT                   GMKQPSIFYLAISILTLMMLPVFYVIVYLYQREMRNGTQELKRISRHGLKTKPS"
FT   5'UTR           complement(734926..734986)
FT                   /locus_tag="VIT_17s0000g10170"
FT                   /old_locus_tag="Vv17s0000g10170"
FT   gene            746750..747477
FT                   /locus_tag="VIT_17s0000g10160"
FT                   /old_locus_tag="Vv17s0000g10160"
FT   mRNA            join(746750..747406,747407..747477)
FT                   /locus_tag="VIT_17s0000g10160"
FT                   /old_locus_tag="Vv17s0000g10160"
FT   CDS_pept        746750..747406
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10160"
FT                   /old_locus_tag="Vv17s0000g10160"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSF7"
FT                   /protein_id="CCB42895.1"
FT                   /translation="MSFDQHSSTVVLDIMRSMSYLPGMGLGRRQHGPSEFIAFPDCDVP
FT                   FGLKFIPTEADYRHMVLLRRERARARLTHTPFYYPVRPYTMSLANYFVRASEPHAPSDG
FT                   IIGGLSTTQEAELQRLIQQLQLSDGALGPSTSVLIAPPSPDRTSLMTLCFPDEIDDHKT
FT                   FAEIGDVVDGAVPRDEYVDEMLAMSLSQTKEIAPLELASPFDLFGVSVLEIAEDI"
FT   3'UTR           747407..747477
FT                   /locus_tag="VIT_17s0000g10160"
FT                   /old_locus_tag="Vv17s0000g10160"
FT   gene            777948..788266
FT                   /locus_tag="VIT_17s0000g10130"
FT                   /old_locus_tag="Vv17s0000g10130"
FT   mRNA            join(777948..777980,777981..778112,778204..778290,
FT                   778572..778640,778749..778881,778981..779027,
FT                   779159..779245,781117..781178,781560..781602,
FT                   781708..781788,782204..782320,782913..783018,
FT                   783629..783692,784116..784158,784547..784816,
FT                   784899..785060,785440..785568,786601..786750,
FT                   787053..787139,787713..787781,787895..788005,
FT                   788006..788266)
FT                   /locus_tag="VIT_17s0000g10130"
FT                   /old_locus_tag="Vv17s0000g10130"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           777948..777980
FT                   /locus_tag="VIT_17s0000g10130"
FT                   /old_locus_tag="Vv17s0000g10130"
FT   CDS_pept        join(777981..778112,778204..778290,778572..778640,
FT                   778749..778881,778981..779027,779159..779245,
FT                   781117..781178,781560..781602,781708..781788,
FT                   782204..782320,782913..783018,783629..783692,
FT                   784116..784158,784547..784816,784899..785060,
FT                   785440..785568,786601..786750,787053..787139,
FT                   787713..787781,787895..788005)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10130"
FT                   /old_locus_tag="Vv17s0000g10130"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR025183"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHB2"
FT                   /protein_id="CBI14871.3"
FT                   /translation="MGKKTKKPGKGKEKTEKKTAKAEEKRARRENKKISEEDDIDAILL
FT                   SIQKEEAKKKEVHIDENVPAPTPRSNCSLTMNPLKETELILYGGEFYNGNKTFVYGDLY
FT                   RHDIEKQEWKLISSPNSPPPRSSHQAVAWKNYLYIFGGEFTSPNQECFHHYKDFWVLDL
FT                   KTNQWEQLNLKGCPSPRSGHRMVLYKHKIIVFGGFYDTLREVRYFNDLHVFDLDQFKWQ
FT                   EIKPRLGSMWPSARSGFQFFVFQDEIFLYGGYSKEVSSDKNNSEKGIVHSDMWSLDPRT
FT                   WEWNKVKKSGMPPGPRAGFSMCVHKKRAVLFGGVVDMEVEGDVMMSLFLNELYGFQLDT
FT                   HRWYPLELRKEKSTKDKVKKSSDKKYNGATLDNKIGSIDLEKCEENDGDDNLESHEEAA
FT                   DLESSIDEISRHMTTNITVNDGGPSIKSDGRPHESGAQLDLQNSISSEIVKPCGRINCS
FT                   MVVGKDTLYIYGGMMEVKDQEITLDDLYCLNLSKLDEWKCIIPASKSEWIEASEEEDED
FT                   EDEDDSEDEDCNSGSNSDETDDDDDVEAKDGSRSLEMGDAVAIIKGEGKNLRRKEKRAR
FT                   IEQIRANLGLSDSQRTPIPGETLKDFYKRTNLYWQMAAHEHTQHTGKELRKDGFDLAEA
FT                   RYRELKPILDELAILEAEQKAEEAEGVETSMRKRGNKKNSKRSAPQK"
FT   3'UTR           788006..788266
FT                   /locus_tag="VIT_17s0000g10130"
FT                   /old_locus_tag="Vv17s0000g10130"
FT   gene            complement(788822..790715)
FT                   /locus_tag="VIT_17s0000g10120"
FT                   /old_locus_tag="Vv17s0000g10120"
FT   mRNA            complement(join(788822..789040,790671..790715))
FT                   /locus_tag="VIT_17s0000g10120"
FT                   /old_locus_tag="Vv17s0000g10120"
FT   CDS_pept        complement(join(788822..789040,790671..790715))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10120"
FT                   /old_locus_tag="Vv17s0000g10120"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSG8"
FT                   /protein_id="CCB42896.1"
FT                   /translation="MSRIIKLIQNKSRTKVVNLNCLNDWEPSQQKVFAVGDSSLGSQVG
FT                   CAYTESIGLQDMDLFNYYNSEILAELEETCYYDHLGFKWSND"
FT   gene            complement(795730..817397)
FT                   /locus_tag="VIT_17s0000g10110"
FT                   /old_locus_tag="Vv17s0000g10110"
FT   mRNA            complement(join(795730..795869,814203..814800,
FT                   815248..815324,815485..815850,815946..816098,
FT                   817373..817397))
FT                   /locus_tag="VIT_17s0000g10110"
FT                   /old_locus_tag="Vv17s0000g10110"
FT                   /product="unknown predicted protein"
FT   CDS_pept        complement(join(795730..795869,814203..814800,
FT                   815248..815324,815485..815850,815946..816098,
FT                   817373..817397))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10110"
FT                   /old_locus_tag="Vv17s0000g10110"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSF2"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR017053"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSF2"
FT                   /protein_id="CCB42897.1"
FT                   /translation="MLKKCSYEMTTCCVARDALSMLQERKNSFDIIISDVNMPDMDGFQ
FT                   LLEHLEVEMDLPVILISVDGEMNRVMKGVQSGACDYLLKPVRMEELKNIWQHVLRKKIH
FT                   EGKNSQVMISRSSNELDDGQQLNGGEVSATRKRKDMENRRHDDQKSVEPSTSKKARVVW
FT                   SIDLHQKFVDVVTQIGYDKARPKKILDLMNVPWLTRENVASHLQKYRFYLSKLRKENKV
FT                   KSSQGMMQQDFTRPAGSFGFQTSNLMHQKHAANGNPKYTGNNMPLIDKGTRFCHEADKK
FT                   ATASILPVDLKETSASNFLDCQRANVSSQTILSHPFNHQSSQSNTTTQTWNEVLMEQQF
FT                   KQPPNQDPELYVLLDDDFSHALLSAPQHLLQVDLQCSANAVGPGTSVPERDKPGSVMII
FT                   PLCSQSRRFYILHIGKKIIEKDDYGKKISMMKVVGGVNGMIMGRRLRILGFGK"
FT   gap             799366..799465
FT                   /estimated_length=100
FT   gene            complement(828434..832324)
FT                   /locus_tag="VIT_17s0000g10100"
FT                   /old_locus_tag="Vv17s0000g10100"
FT   mRNA            complement(join(828434..828633,828634..829599,
FT                   830339..830415,830576..830965,831054..831206,
FT                   832198..832324))
FT                   /locus_tag="VIT_17s0000g10100"
FT                   /old_locus_tag="Vv17s0000g10100"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(828434..828633)
FT                   /locus_tag="VIT_17s0000g10100"
FT                   /old_locus_tag="Vv17s0000g10100"
FT   CDS_pept        complement(join(828634..829599,830339..830415,
FT                   830576..830965,831054..831206,832198..832324))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10100"
FT                   /old_locus_tag="Vv17s0000g10100"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSF9"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSF9"
FT                   /protein_id="CCB42898.1"
FT                   /translation="MESGFCSPRTEAFPAGLRVLVVDDDPTWLKILEKMLKKCSYEVTT
FT                   CCLARDALNMLRERKDGFDIVISDVNMPDMDGFKLLEHVGLEMDLPVIMMSVDGETSRV
FT                   MKGVQHGACDYLLKPVRMKELKNIWQHVFRKKIHEGKDVESYECMREIQMIMSRSDEFD
FT                   DGHQLNGGELGATRKRKDMENRRHDDQELVDPSSSKKARVVWSIDLHQKFVDAVNQIGF
FT                   DKVGPKKILDLMNVPWLTRENVASHLQKYRLYLSRLQKENELKTSEGMKQQDFTCPAGS
FT                   LGFQTSTLIHPKDAANCDLKYTGNNMLLIDMGTRICREADKKGTVSILPMDLKETSTSN
FT                   FLDSQRANVSSQTILSRPFNYQSSQSNTTSQKWNEAPMEQFKQPPKQEPEPYALLEDDF
FT                   SHALQSAPQHLVQVDLQCSAYSVGPGTAVPERDKPGSVMITPVRSQSRSNHSQIVNPET
FT                   SDAISNFKVGMKNQMVGLNCLNDCEPIQQKIFTVGDSSLGSQVGCAYTESIGLQDIDLL
FT                   DYYNSELIDELETSYYADLGLNWDNDCDSVQNPFVDQSLFTARAEASGVCYPG"
FT   gene            842758..844344
FT                   /locus_tag="VIT_17s0000g10090"
FT                   /old_locus_tag="Vv17s0000g10090"
FT   mRNA            842758..844344
FT                   /locus_tag="VIT_17s0000g10090"
FT                   /old_locus_tag="Vv17s0000g10090"
FT                   /product="unknown predicted protein"
FT   CDS_pept        842758..844344
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10090"
FT                   /old_locus_tag="Vv17s0000g10090"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSF3"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029950"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSF3"
FT                   /protein_id="CCB42899.1"
FT                   /translation="MGTGFCTKLGKTWAKAEKGLNDAVSRSFVGKYFKLQARKTCFTKE
FT                   LRAATATFLTMAYILTVNATIVADSGGTCSLSDCTPPGGPDCVVKPNSGYETCLARIRN
FT                   DLVVVTALSAMIGSFFMGVLANLPLAVAPAMGPNAYFTYDLVGFHGTGSMTYGTGLAVL
FT                   CVEGLAFIFLSASGLRAKVARLIPQSVRLAFAAGIGLFIAFVGLQAHQGVGLVGPDPST
FT                   LVTAAACAHTDPVTGACVDGKMRSPTFWLGMVGLVITCYGLMKEVKGSMIYGILFVTLI
FT                   SWIRGTAVTYFPYTKVGDTKFNYFKKVVDFHRIESTAGAISFTNFNRSEVWVALMTLLY
FT                   VDVLATTGILYTMAELGGFVDDKGSFEGEYMAYLVDAGTTVVASTLGGSPVATYVESSA
FT                   GLREGGRTGLTAVIVSFYFMLSLFFTPLLTSVPPWAIGPSLVMVGVLMMKVVKDIEWGN
FT                   VKDAVPAFATMVLMPLTYSIANGIIGGAGIYIVLSLYDYVVWVVRRAAKMRREKNQVSA
FT                   AGGGGQDVEMT"
FT   gene            complement(844778..849895)
FT                   /locus_tag="VIT_17s0000g10080"
FT                   /old_locus_tag="Vv17s0000g10080"
FT   mRNA            complement(join(844778..844929,844930..845181,
FT                   845776..845951,846130..846204,846628..847615,
FT                   849761..849895))
FT                   /locus_tag="VIT_17s0000g10080"
FT                   /old_locus_tag="Vv17s0000g10080"
FT                   /product="Predicted protein"
FT   3'UTR           complement(844778..844929)
FT                   /locus_tag="VIT_17s0000g10080"
FT                   /old_locus_tag="Vv17s0000g10080"
FT   CDS_pept        complement(join(844930..845181,845776..845951,
FT                   846130..846204,846628..847615,849761..849895))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10080"
FT                   /old_locus_tag="Vv17s0000g10080"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHB6"
FT                   /db_xref="InterPro:IPR003340"
FT                   /db_xref="InterPro:IPR015300"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHB6"
FT                   /protein_id="CBI14875.3"
FT                   /translation="MDCKEEACLECTKQCLLLHKKKKRPIPNISSFFKVMIGDKFSEIL
FT                   FLPPKFARTVSALVDEKTHLEDSSGRQWEITVSNLNGSLAFHQGWHAFALDHRLEIGDF
FT                   VVFHYIMGSHFITQIYDRTGCEKPKYSENGQHKKITRNKRSPISKDRAFRTIDKGSINE
FT                   QVSSTSVLSGSDIGIIQSQCDATDVEKVPMIVENTSNCKNSNGKLKSVCKAEYVEEPYY
FT                   IIDRDLGYKRGEYRSSIFDLSNFEMQNNEFGADGSKKIVAGVEKSPHHADKLLISQTEA
FT                   MVADVYTVAEEVGRKVVASDASKFETGKKKDSDVVEKIILRHNKDSCDNKVSGQFLTTS
FT                   AEEPGENGKDSSDLGNEGIKEHQMAEMKIINTHSIDMKGLKKECVEMTSKMHGLEEMIG
FT                   ERALELMKGLHHHSWNPTRKDNDEVYEVVKTEAVDFIGSPLPIAANLSCIVGTDDRSFL
FT                   ELPASLPSFSYRGRTKMERKVVVLQDPDKKSWPVLYHERQGFKALTSGWEDFSRANNIQ
FT                   PGDECVFTLENELKGIYAVRIVQK"
FT   gap             863793..871568
FT                   /estimated_length=7776
FT   gap             884321..884420
FT                   /estimated_length=100
FT   gene            886909..889264
FT                   /locus_tag="VIT_17s0000g10070"
FT                   /old_locus_tag="Vv17s0000g10070"
FT   mRNA            join(886909..887171,887172..887254,887879..888041,
FT                   888174..888240,888570..888804,888912..889122,
FT                   889123..889264)
FT                   /locus_tag="VIT_17s0000g10070"
FT                   /old_locus_tag="Vv17s0000g10070"
FT                   /product="Predicted protein"
FT   5'UTR           886909..887171
FT                   /locus_tag="VIT_17s0000g10070"
FT                   /old_locus_tag="Vv17s0000g10070"
FT   CDS_pept        join(887172..887254,887879..888041,888174..888240,
FT                   888570..888804,888912..889122)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10070"
FT                   /old_locus_tag="Vv17s0000g10070"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHB7"
FT                   /protein_id="CBI14876.3"
FT                   /translation="MLDYQLARSSFRDSLKALEADIQHANFLAASIPRTKNGSWLQMKL
FT                   AYNNLTPIFLFFIQWMNCSCTYLLPSYLNLVHIVIYKVHPERRLKISSYGRKATLREFY
FT                   AVILPSLQHLHSYSSELDYAQEEDQRLQPVVRKRPEERKKLLNVDLEREDECGICLEPC
FT                   TKMVLPNCCHMMCISCFRDWNTKSESCPFCRVSLKRVNSGDLWVLPCRDDVVDMETVSK
FT                   EDVLHFYLYIHNLPKVIPDALFLMYYEFLI"
FT   3'UTR           889123..889264
FT                   /locus_tag="VIT_17s0000g10070"
FT                   /old_locus_tag="Vv17s0000g10070"
FT   gene            complement(891637..893302)
FT                   /locus_tag="VIT_17s0000g10060"
FT                   /old_locus_tag="Vv17s0000g10060"
FT   mRNA            complement(join(891637..891828,891829..892335,
FT                   892535..893182,893183..893302))
FT                   /locus_tag="VIT_17s0000g10060"
FT                   /old_locus_tag="Vv17s0000g10060"
FT                   /product="Predicted protein"
FT   3'UTR           complement(891637..891828)
FT                   /locus_tag="VIT_17s0000g10060"
FT                   /old_locus_tag="Vv17s0000g10060"
FT   CDS_pept        complement(join(891829..892335,892535..893182))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10060"
FT                   /old_locus_tag="Vv17s0000g10060"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSG0"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR035669"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSG0"
FT                   /protein_id="CCB42900.1"
FT                   /translation="MASSFKLFSSLSSLTTILILILLSSLCTASTAPTGTNSPPFKRIY
FT                   AFGDSYTDTGNTRSATGPNAFTYVSNLPYGSTFFHHPTNRYSDGRLVIDFVAQALSLPF
FT                   LPPYRSQKANTSTGVNFAVAGSTAIPHEFFVKNNLTLDITPQSIQTQLIWFNEFLEKQG
FT                   CRGATKNSGCTFDDTLFWVGEIGANDYAYTVGSSVPGSTIQELGIKSITSFLQALLKKG
FT                   VKYLVVQGLPPTGCLTLALTLAPDDDRDAIGCVGSVNKQSYSHNTILQAKLHDLRVQFP
FT                   HAVIVYADYWNAYHTIMKNGDRYGFKEPFKTCCGSGGDPYNFDVFATCGSSSASACPNP
FT                   SQYINWDGVHLTEAMYKVVANSFLHGGFCHPPFDYLLSRKQHLG"
FT   5'UTR           complement(893183..893302)
FT                   /locus_tag="VIT_17s0000g10060"
FT                   /old_locus_tag="Vv17s0000g10060"
FT   gene            complement(895288..903205)
FT                   /locus_tag="VIT_17s0000g10050"
FT                   /old_locus_tag="Vv17s0000g10050"
FT   mRNA            complement(join(895288..895604,895605..895898,
FT                   897886..898217,902846..902893,902950..903091,
FT                   903092..903205))
FT                   /locus_tag="VIT_17s0000g10050"
FT                   /old_locus_tag="Vv17s0000g10050"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(895288..895604)
FT                   /locus_tag="VIT_17s0000g10050"
FT                   /old_locus_tag="Vv17s0000g10050"
FT   CDS_pept        complement(join(895605..895898,897886..898217,
FT                   902846..902893,902950..903091))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10050"
FT                   /old_locus_tag="Vv17s0000g10050"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTL7"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTL7"
FT                   /protein_id="CCB42901.1"
FT                   /translation="MGGRSTSIWERLPRPSFALDPRPRLHSLCTPISLSFSSSRTRSSL
FT                   STEFSRAILRVEADLKVNEPLSPEVDAIPVNIAPRRPRILLAASGSVAAMKFGNLVHSF
FT                   CEWAEVRAVVTKASLHFIDRAALPKDLYLYTDDDEWSSWTKLGDSVLHIELRRWADVMV
FT                   IAPLSANTLGKIAGGLCDNLLTCIVRAWDYSKPMFVAPAMNTFMWTNPFTERHLMTIDE
FT                   LGISLIPPVTKRLACGDYGTGAMAEPFLIHSTVRLFLETRAQSSSSNVQ"
FT   5'UTR           complement(903092..903205)
FT                   /locus_tag="VIT_17s0000g10050"
FT                   /old_locus_tag="Vv17s0000g10050"
FT   gap             910313..917700
FT                   /estimated_length=7388
FT   gene            complement(926314..926683)
FT                   /locus_tag="VIT_17s0000g10040"
FT                   /old_locus_tag="Vv17s0000g10040"
FT   mRNA            complement(join(926314..926337,926624..926683))
FT                   /locus_tag="VIT_17s0000g10040"
FT                   /old_locus_tag="Vv17s0000g10040"
FT   CDS_pept        complement(join(926314..926337,926624..926683))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10040"
FT                   /old_locus_tag="Vv17s0000g10040"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTL8"
FT                   /protein_id="CCB42902.1"
FT                   /translation="MESSCRNERNHMLCNKFIQMIQIMGFL"
FT   gene            complement(932753..945811)
FT                   /locus_tag="VIT_17s0000g10030"
FT                   /old_locus_tag="Vv17s0000g10030"
FT   mRNA            complement(join(932753..932795,945762..945811))
FT                   /locus_tag="VIT_17s0000g10030"
FT                   /old_locus_tag="Vv17s0000g10030"
FT   CDS_pept        complement(join(932753..932795,945762..945811))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10030"
FT                   /old_locus_tag="Vv17s0000g10030"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTL9"
FT                   /protein_id="CCB42903.1"
FT                   /translation="MLCIVLAGSPSSGLRIELRGVSRRTIVPSQ"
FT   gene            952899..977769
FT                   /locus_tag="VIT_17s0000g10020"
FT                   /old_locus_tag="Vv17s0000g10020"
FT   mRNA            join(952899..953106,973376..973473,973642..973805,
FT                   975418..975538,976045..976155,976584..976709,
FT                   977728..977769)
FT                   /locus_tag="VIT_17s0000g10020"
FT                   /old_locus_tag="Vv17s0000g10020"
FT                   /product="Predicted protein"
FT   CDS_pept        join(952899..953106,973376..973473,973642..973805,
FT                   975418..975538,976045..976155,976584..976709,
FT                   977728..977769)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10020"
FT                   /old_locus_tag="Vv17s0000g10020"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTM0"
FT                   /protein_id="CCB42904.1"
FT                   /translation="MGRVSDNWERLVRATLRREQLRNAGQGHERTSSGIAGAVPPSLGR
FT                   ETNIDAILQAADEVEAEDQNVARILCEQAYTMAQNLDPNSDGRGVLQFKTGLQSIIKQK
FT                   LAKRDGTQIDRSRDVERLWNFYLSYKRRHRVDDIQREEQKWRETGTFSANLGEMELRSL
FT                   KMKKVFATLRALVEVMEALNKDADSGVGLHIREELRRIKRSDGTLSGELMPYNIVPLEA
FT                   PSLTNAIGVFPEVKGAISAIRYTEHFPQLPANFEISGQRDVDMFDLLEYVFGFQNAKIL
FT                   EDKKEIGG"
FT   gene            1003435..1070799
FT                   /locus_tag="VIT_17s0000g10010"
FT                   /old_locus_tag="Vv17s0000g10010"
FT   mRNA            join(1003435..1003539,1003884..1003981,1004064..1004181,
FT                   1004521..1004649,1015952..1016028,1016123..1016201,
FT                   1018145..1018237,1018343..1018445,1018562..1018685,
FT                   1018810..1018996,1019099..1019151,1019826..1019886,
FT                   1020037..1020118,1026848..1026897,1027297..1027383,
FT                   1027522..1027607,1028344..1028371,1029799..1029917,
FT                   1030040..1030121,1030223..1030383,1030589..1030709,
FT                   1031112..1031209,1031298..1031388,1031479..1031639,
FT                   1031743..1031852,1040009..1040143,1040732..1040800,
FT                   1040922..1041096,1052014..1052131,1053199..1053318,
FT                   1054998..1055113,1055203..1055286,1056407..1056519,
FT                   1057322..1057374,1057455..1057631,1057744..1057791,
FT                   1065624..1065782,1066039..1066152,1066246..1066334,
FT                   1066491..1066649,1066846..1066948,1067478..1067597,
FT                   1069617..1069667,1069790..1069972,1070500..1070736,
FT                   1070737..1070799)
FT                   /locus_tag="VIT_17s0000g10010"
FT                   /old_locus_tag="Vv17s0000g10010"
FT                   /product="Predicted protein"
FT   CDS_pept        join(1003435..1003539,1003884..1003981,1004064..1004181,
FT                   1004521..1004649,1015952..1016028,1016123..1016201,
FT                   1018145..1018237,1018343..1018445,1018562..1018685,
FT                   1018810..1018996,1019099..1019151,1019826..1019886,
FT                   1020037..1020118,1026848..1026897,1027297..1027383,
FT                   1027522..1027607,1028344..1028371,1029799..1029917,
FT                   1030040..1030121,1030223..1030383,1030589..1030709,
FT                   1031112..1031209,1031298..1031388,1031479..1031639,
FT                   1031743..1031852,1040009..1040143,1040732..1040800,
FT                   1040922..1041096,1052014..1052131,1053199..1053318,
FT                   1054998..1055113,1055203..1055286,1056407..1056519,
FT                   1057322..1057374,1057455..1057631,1057744..1057791,
FT                   1065624..1065782,1066039..1066152,1066246..1066334,
FT                   1066491..1066649,1066846..1066948,1067478..1067597,
FT                   1069617..1069667,1069790..1069972,1070500..1070736)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10010"
FT                   /old_locus_tag="Vv17s0000g10010"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTM1"
FT                   /db_xref="InterPro:IPR003440"
FT                   /db_xref="InterPro:IPR026899"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTM1"
FT                   /protein_id="CCB42905.1"
FT                   /translation="MSYLQKDNIQNQRENVVLTVANAQCRLGIPVEANPKIDEKAVTEV
FT                   FLKVLDNYIKWCKYLRIRLAWNSIEAINRDRRLFLVSLYFLIWGEAANVRFLPECICYI
FT                   FHHMARELDAILDHGEANHAASCITADGSVSFLEQIICPIYETMEKEAARNNNGKAAHS
FT                   AWRNYDDFNEFFWSPACLELSWPMKRDSSFLLKPKGRKRTGKTTFVEHRTFLHLYRSFH
FT                   RLWIFLALMFQALTIIAFNHGNIDLDTFKTILSIGPTFAIMNFAESCLDVLLMFGAYAT
FT                   ARGMAISRLVIRFFWCGFSSVFVTYVYLKLLQERKNPNSDSFYFRIYIIVLGVYAALRL
FT                   VLAMLLKFPSCHALSEMSDQAFFRFFKWIYQERYYVGRGLFESTSDYFRYVVYWLVIFA
FT                   CKFTFAYFLQIRPLVKPTNIIVDLPSLTYSWHDLISKNNNNLLTLASIWAPVIAIYLMD
FT                   ILIWYTILSAIVGGVKGARARLGEIRSIEMVHKRFESFPAAFVNNLVSPMMKRMPFNTQ
FT                   SAQIFVLSMQVSQDMNKTHAAIFSPFWNEIIKSLREEDYISNREMDLLSIPSNTGSLRL
FT                   VQWPLFLLSSKILLAIDLALDCKDSQADLWSRIRRDEYMAYAVQECYYSVEKILHSLVD
FT                   GEGSLWVERIFREINNSILEDSLFTILDPQKLPMVLQRLTALTGLLIRNETPDRAIGAA
FT                   KSVREIYDVVTHDLLTSNLREQLDTWNILARARNEGRLFSRIEWPKDPEIKEQVKRLHL
FT                   FLTVKDSAANIPKNLEAQRRLQFFTNSLFMDMPSAKPVCEMMPFSVFTPYYSETVLYSS
FT                   TDLRSENEDGISTLFYLQKIFPDEWENFLERIGRLGSNEDADLQESSSDSLELRFWASY
FT                   RGQTLARTVRGMMYYRRALMLQSYLESRSFGVDDNNSLANFPTTQGFELSREARAQVDL
FT                   KFTYVVSCQIYGQQKQKKASEAADIALLLQRNEALRVAFIHVEDNGATDGKTTKEYYSK
FT                   LVKADGNGKDQEVYSIKLPGDPKLGEGKPENQNHAIIFTRGEAIQTIDMNQDNYLEEAM
FT                   KMRNLLEEFRGNHGLRPPTILGVREHVFTGSVSSLAWFMSNQETSFVTLGQRVLASPLK
FT                   VRMHYGHPDVFDRIFHISRGGISKASRVINISEDIYAGFNSTLRQGNITHHEYIQVGKG
FT                   RDVGLNQIALFEGKVAGGNGEQVLSRDIYRLGQLFDFFRMLSFFFTTVGYYVCTMMTVI
FT                   TVYIFLYGRVYLAFSGLDEGIERFAKLTGNTALSAALNAQFLVQIGVFTAVPMVVGFIL
FT                   ESGLLKAVFSFITMQLQLCSVFFTFSLGTRTHYFGRTILHGGAKYRATGRGFVVRHIKF
FT                   AENYRLYSRSHFVKALEVALLLIVYIAYGHTGGGSVSFILLTLSSWFLVISWLFAPYIF
FT                   NPSGFEWQKTVEDFDDWTSWLLYKGGVGVKGDHSWESWWEEEQAHIQTLRGRILETILS
FT                   LRFIIFQYGIVYKLHLTQKDTSLAIYGFSWVVLVGIVMIFKLFSFSPKKSSNIQLVMRF
FT                   SQGVFSLGLVAALCLVVAFTDLSIVDLFASILAFIPTGWMILSLAITWKRVVRSLGLWD
FT                   SVREFARMYDAGMGMIIFAPIAVLSWFPFISTFQSRLLFNQAFSRGLEISIILAGNKAN
FT                   VQA"
FT   gap             1041675..1041774
FT                   /estimated_length=100
FT   gap             1051290..1051389
FT                   /estimated_length=100
FT   gap             1052637..1052638
FT                   /estimated_length=2
FT   3'UTR           1070737..1070799
FT                   /locus_tag="VIT_17s0000g10010"
FT                   /old_locus_tag="Vv17s0000g10010"
FT   gene            1097087..1100371
FT                   /locus_tag="VIT_17s0000g10000"
FT                   /old_locus_tag="Vv17s0000g10000"
FT   mRNA            join(1097087..1097281,1097282..1097290,1099808..1099999,
FT                   1100106..1100129,1100130..1100371)
FT                   /locus_tag="VIT_17s0000g10000"
FT                   /old_locus_tag="Vv17s0000g10000"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           1097087..1097281
FT                   /locus_tag="VIT_17s0000g10000"
FT                   /old_locus_tag="Vv17s0000g10000"
FT   CDS_pept        join(1097282..1097290,1099808..1099999,1100106..1100129)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g10000"
FT                   /old_locus_tag="Vv17s0000g10000"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHC3"
FT                   /db_xref="InterPro:IPR008700"
FT                   /db_xref="InterPro:IPR040387"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHC3"
FT                   /protein_id="CBI14882.3"
FT                   /translation="MASQDRGRPLPKFGEWDVNNPASAEGFTVIFNKARDEKKTNAAGN
FT                   VASPRRNGNGYKQNEDYHYSPKRKWFCCG"
FT   3'UTR           1100130..1100371
FT                   /locus_tag="VIT_17s0000g10000"
FT                   /old_locus_tag="Vv17s0000g10000"
FT   gene            complement(1100991..1107971)
FT                   /locus_tag="VIT_17s0000g09990"
FT                   /old_locus_tag="Vv17s0000g09990"
FT   mRNA            complement(join(1100991..1101257,1101258..1101476,
FT                   1101788..1102072,1103556..1103831,1103925..1104044,
FT                   1106782..1106853,1107417..1107899,1107900..1107971))
FT                   /locus_tag="VIT_17s0000g09990"
FT                   /old_locus_tag="Vv17s0000g09990"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(1100991..1101257)
FT                   /locus_tag="VIT_17s0000g09990"
FT                   /old_locus_tag="Vv17s0000g09990"
FT   CDS_pept        complement(join(1101258..1101476,1101788..1102072,
FT                   1103556..1103831,1103925..1104044,1106782..1106853,
FT                   1107417..1107899))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09990"
FT                   /old_locus_tag="Vv17s0000g09990"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHC4"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHC4"
FT                   /protein_id="CBI14883.3"
FT                   /translation="MDGSENTVSIPNEDELGLGLRPSSPAQPDVEKLNQEFLSLVLEQH
FT                   EPVVESLALEQHEPVVESLALEQHEPVVESLALEEREEEKEEDEESDSNGEVKASDDEE
FT                   EQCENLEDESAAKDDKSARFQYPVRPDAVDCSFYLRTGTCKFGSNCKFNHPIRRKNQVA
FT                   KEKVKEKEKEEFPERPGQTECKYYLRTGGCKFGKACRYNHTKAKPSAVPVLELNFLGLP
FT                   IRMGEKECPYYMRTGSCKYGANCRFNHPDPTAAGGYESPSGYGNGGSVPLQGASQSNMA
FT                   SWSSPRALNEPAPFVPIMFSPTQGVPPPNPEWNGYQAPLYPPPPPERSMHPPPAFVINN
FT                   TATDANVYGHHQQQQQSLIEDFPERPGQPECSYFLKTGDCKFRAACKYHHPKNRIPKSP
FT                   PCTLSDKGLPLRPDQNICTHYNRYGICKFGPACKFDHPVNYGNSASAPSAESGQDQPPP
FT                   FGGSVTADGVRPGSGNGNEILIQQPV"
FT   5'UTR           complement(1107900..1107971)
FT                   /locus_tag="VIT_17s0000g09990"
FT                   /old_locus_tag="Vv17s0000g09990"
FT   gene            complement(1108725..1122983)
FT                   /locus_tag="VIT_17s0000g09980"
FT                   /old_locus_tag="Vv17s0000g09980"
FT   mRNA            complement(join(1108725..1108977,1108978..1110365,
FT                   1111031..1111322,1111572..1111774,1115710..1116416,
FT                   1116958..1117108,1117231..1117298,1117636..1117714,
FT                   1121978..1122830,1122831..1122983))
FT                   /locus_tag="VIT_17s0000g09980"
FT                   /old_locus_tag="Vv17s0000g09980"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(1108725..1108977)
FT                   /locus_tag="VIT_17s0000g09980"
FT                   /old_locus_tag="Vv17s0000g09980"
FT   CDS_pept        complement(join(1108978..1110365,1111031..1111322,
FT                   1111572..1111774,1115710..1116416,1116958..1117108,
FT                   1117231..1117298,1117636..1117714,1121978..1122830))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09980"
FT                   /old_locus_tag="Vv17s0000g09980"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTM2"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR003349"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTM2"
FT                   /protein_id="CCB42906.1"
FT                   /translation="MASTTVAAEPNPEVFSWLKTLPLAPEYHPTLAEFQDPISYIFKIE
FT                   KEASRYGICKIVPPVPPPPKKTAIANLTRSLANRAASSNPKSAPTFTTRQQQVGFCPRK
FT                   PRPVKKPVWQSGEYYTFQEFEAKARAFEKNYLKKSSKKPLSALEIETLFWKASVDKPFS
FT                   VEYANDMPGSAFVPVSSKKWREAGEAVTVGETAWNMRGISRAKGSLLRFMKEEIPGVTS
FT                   PMVYVAMMFSWFAWHVEDHDLHSLNYLHMGAGKTWYGVPREAAVAFEEVVRVHGYGGEI
FT                   NPLVTFAVLGEKTTVMSPEVFVSAGIPCCRLVQNPGEFVVTFPRAYHSGFSHGFNCGEA
FT                   ANIATPEWLRVAKDAAIRRASINYPPMVSHFQLLYDLALALCSRIPMSISVEPRSSRLK
FT                   DKKRGEGETVVKELFVQNIMQNNDLLHILGKGSSIVLLPKRSSDISVCPNLRVGSSSRV
FT                   KPRLSLGLCNLEEAMKTSKSIVSDDSDMGMNHDFEHLRGFYSVKGKFASSCDRDKLHLS
FT                   HGNDNGSALTSQTQNMETKIESISHGDGLSDQALFSCVTCGILSFACVALIQPREAAAR
FT                   YLMSADCSFFNDWIVGSGPSGVANEDFTGVSGDVHNSELNSCSGWMRKRVPNALFDVPI
FT                   QSANYQIQTVDQNNEVVSNTGTQKNTSALGLLALTYANSSDSEEDQLEPDIPLEADNLA
FT                   STESNSSEGIFRDPLAISWATSKYSPVGHDAERAKFSNAIVPVENTNMSFAPRSDEDYS
FT                   RIHVFCLEHAVEVEQQLRPIGGVNMLLLCHPDYPKVEAEAKLVAEDLGIDYLWNDFVYR
FT                   DATKEDGEMIQSALDSEECIPGNGDWAVKLGVNLYYSANLSRSPLYIKQMPYNSVIYNV
FT                   FGRSSANSPTAPDVYGRGPGKQKKIVVAGKWCGKVWMSNQVHPLLAQKDPEEQEEDRNF
FT                   HVWVKKPDEKPERKSESSRKAETSSAPRKSGRKRKMMVENGSTKKANRPEREDPVSDSD
FT                   DAPDDNSHQQRTRILRSKQVKQETPRRRNSCEQSAREFDSYVEDELEGGPSTRLRRRNP
FT                   KPPKELEAKPVVKKQTGRRKVKKTPVLKAPASFKMREEEEYQSDSEVGAKNISARKKAK
FT                   KAPAAKAPGNHNNAKIQDEEEEYQCDMEGCTMSFSSKPELALHKKNICPVKGCGKKFFS
FT                   HKYLVQHRRVHIDDRPLKCPWKGCKMTFKWAWARTEHIRVHTGARPYICTEAGCGQTFR
FT                   FVSDFSRHKRKTGHSAKKARG"
FT   5'UTR           complement(1122831..1122983)
FT                   /locus_tag="VIT_17s0000g09980"
FT                   /old_locus_tag="Vv17s0000g09980"
FT   gene            complement(1134945..1143564)
FT                   /locus_tag="VIT_17s0000g09970"
FT                   /old_locus_tag="Vv17s0000g09970"
FT   mRNA            complement(join(1134945..1135072,1135073..1135146,
FT                   1135763..1135866,1136094..1136180,1136831..1136892,
FT                   1137158..1137236,1137947..1138148,1139729..1139873,
FT                   1141571..1141663,1143331..1143558,1143559..1143564))
FT                   /locus_tag="VIT_17s0000g09970"
FT                   /old_locus_tag="Vv17s0000g09970"
FT                   /product="Predicted protein"
FT   3'UTR           complement(1134945..1135072)
FT                   /locus_tag="VIT_17s0000g09970"
FT                   /old_locus_tag="Vv17s0000g09970"
FT   CDS_pept        complement(join(1135073..1135146,1135763..1135866,
FT                   1136094..1136180,1136831..1136892,1137158..1137236,
FT                   1137947..1138148,1139729..1139873,1141571..1141663,
FT                   1143331..1143558))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09970"
FT                   /old_locus_tag="Vv17s0000g09970"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHC6"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHC6"
FT                   /protein_id="CBI14885.3"
FT                   /translation="MKRYFQPIGKDGSSKKPSLSKEDGDENTDQVSEEEKKEPLKFLTW
FT                   NANSFLIRVKNNWPEFTKFVSDLDPDVIAVQEVRMPAAGSKGAPKNHGELKDDTSSSRE
FT                   EKKILMHALSRPPFGNYRVWWSLADSKYAGTALFVKKCFQPKKVSFSIDQKASKHEPEG
FT                   RVILAEFESFRLLNTYVPNNGWKDEETSFQRRRKWDKRMLEFVVQSSDKPLIWCGDLNV
FT                   SHEEIDVSHPEFFSAAKHNGYVPPNKEDCGQPGFTLAERRRFGGILKEGKLVDAYRLLH
FT                   KEKDMEGGFSWSGNPIGKYRGKRMRIDYFIVPEALKDRIVACEIHGQGIELKGFYGSDH
FT                   CPVSLELSETSSGSNQS"
FT   5'UTR           complement(1143559..1143564)
FT                   /locus_tag="VIT_17s0000g09970"
FT                   /old_locus_tag="Vv17s0000g09970"
FT   gene            complement(1150304..1152544)
FT                   /locus_tag="VIT_17s0000g09960"
FT                   /old_locus_tag="Vv17s0000g09960"
FT   mRNA            complement(join(1150304..1150424,1152507..1152544))
FT                   /locus_tag="VIT_17s0000g09960"
FT                   /old_locus_tag="Vv17s0000g09960"
FT   CDS_pept        complement(join(1150304..1150424,1152507..1152544))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09960"
FT                   /old_locus_tag="Vv17s0000g09960"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTM3"
FT                   /protein_id="CCB42907.1"
FT                   /translation="MFIFDLFYVIIYKKEEPRGPMIGVVLLLSRGESLKNYLSNVVDNL
FT                   KMNSNIF"
FT   gene            1174460..1174588
FT                   /locus_tag="VIT_17s0000g09950"
FT                   /old_locus_tag="Vv17s0000g09950"
FT   mRNA            1174460..1174588
FT                   /locus_tag="VIT_17s0000g09950"
FT                   /old_locus_tag="Vv17s0000g09950"
FT                   /product="Heat shock protein 70"
FT   CDS_pept        1174460..1174588
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09950"
FT                   /old_locus_tag="Vv17s0000g09950"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHC7"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHC7"
FT                   /protein_id="CBI14886.3"
FT                   /translation="MELVEKRVRNAKMGKNTIHDVVLVGRSTRIPKVQQLMQDFLK"
FT   gene            complement(1175128..1175232)
FT                   /locus_tag="VIT_17s0000g09940"
FT                   /old_locus_tag="Vv17s0000g09940"
FT   mRNA            complement(1175128..1175232)
FT                   /locus_tag="VIT_17s0000g09940"
FT                   /old_locus_tag="Vv17s0000g09940"
FT   CDS_pept        complement(1175128..1175232)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09940"
FT                   /old_locus_tag="Vv17s0000g09940"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHC8"
FT                   /protein_id="CBI14887.3"
FT                   /translation="MQMQYWMYPFRDSSLFGYLWLVASRNRPFPSPRH"
FT   gap             1176738..1176978
FT                   /estimated_length=241
FT   gap             1179297..1179396
FT                   /estimated_length=100
FT   gap             1180894..1181002
FT                   /estimated_length=109
FT   gene            complement(1189003..1189714)
FT                   /locus_tag="VIT_17s0000g09930"
FT                   /old_locus_tag="Vv17s0000g09930"
FT   mRNA            complement(join(1189003..1189177,1189254..1189360,
FT                   1189448..1189657,1189658..1189714))
FT                   /locus_tag="VIT_17s0000g09930"
FT                   /old_locus_tag="Vv17s0000g09930"
FT                   /product="unknown predicted protein"
FT   CDS_pept        complement(join(1189003..1189177,1189254..1189360,
FT                   1189448..1189657))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09930"
FT                   /old_locus_tag="Vv17s0000g09930"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniProtKB/TrEMBL:A5B4U7"
FT                   /protein_id="CBI14889.3"
FT                   /translation="MALRSLDNALPTTPERPKKQAKVAVSIQKQSDFGVNDENKAPLPP
FT                   TADATIDYISFENLKAMSDRETQITGLTKGLDSKDWAKVCESLNDARRFALYHSALMAP
FT                   ILEKVLLVLVKAMKNPRSALSKTSIMASTDIFNTFCDELLQPRPDNTYLGRGWDLILTL
FT                   "
FT   5'UTR           complement(1189658..1189714)
FT                   /locus_tag="VIT_17s0000g09930"
FT                   /old_locus_tag="Vv17s0000g09930"
FT   gene            1225807..1227349
FT                   /locus_tag="VIT_17s0000g09920"
FT                   /old_locus_tag="Vv17s0000g09920"
FT   mRNA            join(1225807..1225946,1226163..1226779,1226896..1227190,
FT                   1227328..1227349)
FT                   /locus_tag="VIT_17s0000g09920"
FT                   /old_locus_tag="Vv17s0000g09920"
FT                   /product="putative uncharacterized protein"
FT   CDS_pept        join(1225807..1225946,1226163..1226779,1226896..1227190,
FT                   1227328..1227349)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09920"
FT                   /old_locus_tag="Vv17s0000g09920"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHD1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHD1"
FT                   /protein_id="CBI14890.3"
FT                   /translation="MKLMQLSREEGMRGQAFLEALWKSLERMIPRDEHVNMEACTPRLT
FT                   INLRFSLNFFCVSGPRYRPPCLPALPTSGVSSPPPEQPSRLPPDLLQIASVSAILFLGF
FT                   GVRACSATSGRFPVVVAAECRTVQEQRIQDEILVLEFSEVLPLEVGVLAIGFEGTLNDK
FT                   MKGFYRSTFEHNGEKRNMAVTQFEPADARRCFPCWDEPACKATFKITLDMPSDLIALSN
FT                   MPVIEEKTEWASQDSFLSRIANYVYIFGGSYTWLIQRILCLSILTTQIGHDSNPQDAAR
FT                   ALDVLNFTPLNGKPLRIMYSHRDPSIRKSGTENIFIKNLDKGIDHKALHDTFSAFGNIL
FT                   SCKEATDASGMQGCHIN"
FT   gene            1241784..1245219
FT                   /locus_tag="VIT_17s0000g09910"
FT                   /old_locus_tag="Vv17s0000g09910"
FT   mRNA            join(1241784..1241817,1241818..1242147,1242594..1242664,
FT                   1242817..1242975,1243579..1243645,1244033..1244128,
FT                   1244440..1244486,1244705..1244785,1244904..1245027,
FT                   1245028..1245219)
FT                   /locus_tag="VIT_17s0000g09910"
FT                   /old_locus_tag="Vv17s0000g09910"
FT                   /product="Predicted protein"
FT   5'UTR           1241784..1241817
FT                   /locus_tag="VIT_17s0000g09910"
FT                   /old_locus_tag="Vv17s0000g09910"
FT   CDS_pept        join(1241818..1242147,1242594..1242664,1242817..1242975,
FT                   1243579..1243645,1244033..1244128,1244440..1244486,
FT                   1244705..1244785,1244904..1245027)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09910"
FT                   /old_locus_tag="Vv17s0000g09910"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHD2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHD2"
FT                   /protein_id="CBI14891.3"
FT                   /translation="MASTVISSSSASTKALLSHRKASVTTLQSHERTFSSSLFGTRPGI
FT                   TRRAITTTTTTTTTRPVIRRGARHSGVRFSVCSALPSALLFDCDGVLVDTEKDGHRISF
FT                   NDTFAERELGVTWDVDLYGELLKIGGGKERMTAYFNKTGWPEKAPKSEEERKEFIASLH
FT                   KRKTELFMVLIEKKLLPLRPGVAKLIDQALGKGVNVAVCSTSNEKAVSAIVSCLLGPER
FT                   AEKIKIFAGDVVPRKKPDPAIYTLAASTLGVEPSRCVVVEDSAIGLAAAKAAGMKCIVT
FT                   KSGYTADEDFLNADAVFDCIGDPPEERFDLAFCGSLLEKQYVS"
FT   3'UTR           1245028..1245219
FT                   /locus_tag="VIT_17s0000g09910"
FT                   /old_locus_tag="Vv17s0000g09910"
FT   gene            complement(1246475..1247437)
FT                   /locus_tag="VIT_17s0000g09900"
FT                   /old_locus_tag="Vv17s0000g09900"
FT   mRNA            complement(join(1246475..1246589,1246590..1247348,
FT                   1247349..1247437))
FT                   /locus_tag="VIT_17s0000g09900"
FT                   /old_locus_tag="Vv17s0000g09900"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(1246475..1246589)
FT                   /locus_tag="VIT_17s0000g09900"
FT                   /old_locus_tag="Vv17s0000g09900"
FT   CDS_pept        complement(1246590..1247348)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09900"
FT                   /old_locus_tag="Vv17s0000g09900"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTM4"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTM4"
FT                   /protein_id="CCB42908.1"
FT                   /translation="MQNVHAGMKNPILKLPLLLLKPFFLSLFLSLAVLFFLALQTPRHR
FT                   NPKLSPGLRIRPGYSSYDSYIQHQLNKTLNPKLRKIWTTRDWDRKVLVFSQFFRGLKER
FT                   KLLFNDSKALCIGARVGQEVEALRRVGVGDSVGMDLVPYPPLVLKGDFHSQPFDDETFD
FT                   FEFSNVFDHALHPWKFVREIERTLRAGGICVLHVALSRRADKYSANDLYSVAPLVELFR
FT                   KSDLVGVRNVDGFGLDTEVVFRKKEKEKKN"
FT   5'UTR           complement(1247349..1247437)
FT                   /locus_tag="VIT_17s0000g09900"
FT                   /old_locus_tag="Vv17s0000g09900"
FT   gene            complement(1248879..1275285)
FT                   /locus_tag="VIT_17s0000g09890"
FT                   /old_locus_tag="Vv17s0000g09890"
FT   mRNA            complement(join(1248879..1248949,1248950..1249323,
FT                   1249424..1249571,1270988..1271272,1271930..1272111,
FT                   1272305..1272426,1272808..1272896,1272968..1273135,
FT                   1273265..1273366,1273456..1273548,1274060..1274279,
FT                   1275066..1275259,1275260..1275285))
FT                   /locus_tag="VIT_17s0000g09890"
FT                   /old_locus_tag="Vv17s0000g09890"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(1248879..1248949)
FT                   /locus_tag="VIT_17s0000g09890"
FT                   /old_locus_tag="Vv17s0000g09890"
FT   CDS_pept        complement(join(1248950..1249323,1249424..1249571,
FT                   1270988..1271272,1271930..1272111,1272305..1272426,
FT                   1272808..1272896,1272968..1273135,1273265..1273366,
FT                   1273456..1273548,1274060..1274279,1275066..1275259))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09890"
FT                   /old_locus_tag="Vv17s0000g09890"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHD3"
FT                   /protein_id="CBI14892.3"
FT                   /translation="MSEPAATKPQPLPIKSEVGVTENSADESSKRPQISKVVVLADLNV
FT                   DPPETDDDDSLHVSAPDLTRLTNDDSSQDKSTLVSKDTDMVDGEGKRLNKLGKPRSRVT
FT                   KVEYPLDYGADADADQHGQGAPTSREEKVSSLKTGLVHVARKMPKNAHAHFILGLMYQR
FT                   LGQPQKAVSAYEKAAEILLRCEEEIDRPELLSLVQIHHAQCLLLGSSGDHSADKELEPE
FT                   ELEEILLKMKDSMQSDIRQAAVWNTLGLILLRTGRLQNAISVLSSLLTIAPDNLDCLGN
FT                   LGIAYLRSGNLELAEKCFQNLILKDQNHPAALINYAAVLMCKYGSIIAGAGANSGEGAS
FT                   EDQLIAANVAKECLLAAVKVEPKAAHVWANLANAYYLMGDCRSSSKCFEKAAKLEPNCM
FT                   STRYAVAVHQIKDAERYQDPSEQLSWAGNEMASILREGDSALIEHPIAWAGLAMVHKIQ
FT                   NEIAAAFETEHKGLMEMEERAVHILKQAIAEDPDDAVQWHQLGLHNLCVQQFKTSQKYL
FT                   KAAVARSKECSYMWSNLGISLQLSEEPAQAEQVYKRALSLVTPQQAYTIFSNLGNLYRQ
FT                   QKKYQSAKAMFTKSLELQPGYAPAYNNLGLVFIAEGRWKEAEFCFNKALQADPLLDAAK
FT                   SNMIKAAAMSRVCQHLSSCSLQD"
FT   gap             1253760..1253859
FT                   /estimated_length=100
FT   gap             1255201..1270165
FT                   /estimated_length=14965
FT   5'UTR           complement(1275260..1275285)
FT                   /locus_tag="VIT_17s0000g09890"
FT                   /old_locus_tag="Vv17s0000g09890"
FT   gap             1289144..1289243
FT                   /estimated_length=100
FT   gene            complement(1302453..1309618)
FT                   /locus_tag="VIT_17s0000g09880"
FT                   /old_locus_tag="Vv17s0000g09880"
FT   mRNA            complement(join(1302453..1302635,1309586..1309618))
FT                   /locus_tag="VIT_17s0000g09880"
FT                   /old_locus_tag="Vv17s0000g09880"
FT   CDS_pept        complement(join(1302453..1302635,1309586..1309618))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09880"
FT                   /old_locus_tag="Vv17s0000g09880"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTM5"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTM5"
FT                   /protein_id="CCB42909.1"
FT                   /translation="MGNKIKVSIAQIRPSITWYLYFGSIYLIISLRCLNLDLVIVSHTV
FT                   IHTPILILSICSLIFISRSNCFKIFF"
FT   gene            complement(1311016..1318566)
FT                   /locus_tag="VIT_17s0000g09870"
FT                   /old_locus_tag="Vv17s0000g09870"
FT   mRNA            complement(join(1311016..1311361,1311362..1313161,
FT                   1313317..1313411,1317801..1318020,1318021..1318036,
FT                   1318120..1318196,1318403..1318566))
FT                   /locus_tag="VIT_17s0000g09870"
FT                   /old_locus_tag="Vv17s0000g09870"
FT                   /product="Predicted protein"
FT   3'UTR           complement(1311016..1311361)
FT                   /locus_tag="VIT_17s0000g09870"
FT                   /old_locus_tag="Vv17s0000g09870"
FT   CDS_pept        complement(join(1311362..1313161,1313317..1313411,
FT                   1317801..1318020))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09870"
FT                   /old_locus_tag="Vv17s0000g09870"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTM6"
FT                   /db_xref="InterPro:IPR003891"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR039778"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTM6"
FT                   /protein_id="CCB42910.1"
FT                   /translation="MASNEGFLTNEQRETLKMATQNAEGLSSSPKSPTSLLSEHHIKVP
FT                   VSGKAPTAGIAVRHVRRSHSGKFVRVKKDGAGGKGTWGKLLDTDGESHIDRNDPNYDSG
FT                   EEPYQLVGSTISDPLDEYKKAVVSIIEEYFSTGDVELAASDLRELGSNEYHPYFIKRLV
FT                   SMAMDRHDKEKEMASVLLSALYADVISSAQISQGFFILLESADDLAVDILDAVDVLALF
FT                   IARAVVDDILPPAFLTRAKKTLPESSKGHQVIQTAEKSYLSAPHHAELVERRWGGSTHI
FT                   TVEEVKKKIADLLREYVESGDAFEACRCIRELGVSFFHHEVVKRALVLAMEIRTAEPLI
FT                   LKLLKEAAEEGLISSSQMLKGFARLAESLDDLALDIPSAKTLFELLVPKAISQGWLDAS
FT                   FLKPAGEDGEVHNEDDEKVRRFKEEAVAIIHEYFLSDDIPELIRSLEDLGMPKFNPIFL
FT                   KKLITLAMDRKNREKEMASVLLSSLHIEIFSTEDIVNGFVMLLESAEDTALDVLDASNE
FT                   LALFLARAVIDDVLAPLNLEEIGSKLPPNCSGSETVHMARSLIAARHAGERILRCWGGG
FT                   TGWAVEDAKDKIMKLLEEYESGGDVGEACQCIRDLGMPFFNHEVVKKALVMAMEKKNDR
FT                   MLDLLQECFCEGLITINQMTKGFGRIKDGLDDLALDIPNAEEKFSFYVEYARKMGWLLA
FT                   SFESSAATDS"
FT   5'UTR           complement(1318403..1318566)
FT                   /locus_tag="VIT_17s0000g09870"
FT                   /old_locus_tag="Vv17s0000g09870"
FT   gene            complement(1320842..1325905)
FT                   /locus_tag="VIT_17s0000g09860"
FT                   /old_locus_tag="Vv17s0000g09860"
FT   mRNA            complement(join(1320842..1320990,1320991..1321047,
FT                   1323083..1323207,1323418..1324706,1325136..1325905))
FT                   /locus_tag="VIT_17s0000g09860"
FT                   /old_locus_tag="Vv17s0000g09860"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(1320842..1320990)
FT                   /locus_tag="VIT_17s0000g09860"
FT                   /old_locus_tag="Vv17s0000g09860"
FT   CDS_pept        complement(join(1320991..1321047,1323083..1323207,
FT                   1323418..1324706,1325136..1325905))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09860"
FT                   /old_locus_tag="Vv17s0000g09860"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHD5"
FT                   /protein_id="CBI14894.3"
FT                   /translation="MAFMHQTFSSPSCPLFYRKPHFSKTLIRFSATPSSPVPTPSSHSS
FT                   SPIFLPFLQEQDRTLQHQRQQKEEEDEDPNDPILRFFKSRTSTQDPRFESKFSLQKNRR
FT                   PSWRLASTTDPESDAEFDVEEEKEQVVSDSCTSLQGISGEILHFARNLPENSTLGEVLG
FT                   PYVGRVGERECVEVLGLMCEEDLVMGCLYFFEWMGLQEPSLVTARACSLLFPMLGRAGM
FT                   GDDLMVLLRNLPKTRQFRDVRIYNSAISGLSSCGRYDDAWKVYDEMETNNIRPDHVTCS
FT                   IMITVMRKDGHSAKDAWEFFQRMNRKGVKWSLEVLGALIKSFCDEGLKNEALIIQSEME
FT                   KKGISSNAIVYNTLMDAYSKSNRVEEAEGLFGEMKAKGVMPTSATYNILMDAYSRRMQP
FT                   EIIENLLLEMQDMGLEPNVKSYTCLISAYGRQKKMSDMAADAFLRMKKVGIKPTSHSYT
FT                   ALIHAYSVGGWHEKAYTAFENMKREGIKPSIETYTALLDAFRRAGDTQTLMKIWKLMLS
FT                   DKIEGTRVTFNILLDGFAKQGHYMEARDVIFEFGKIGFQPTVMTYNMLMNAYARGGQHS
FT                   RLPQLLKEMTSLNLKPDSITYSTMIYAYVRVRDFKRAFFYHKQMVKSGQVPDPQSYQKL
FT                   RSILDVKAATKNRKDRSAILGIVNSNMGLLKPKKGKKDEFWKNKKGQRRIQKRKAYTHF
FT                   SFNDENLHMNLIIISQTITFAALSLFAIHQLHHKIHVKKCFITRTNGEGNCM"
FT   gap             1330753..1330852
FT                   /estimated_length=100
FT   gene            complement(1335403..1344692)
FT                   /locus_tag="VIT_17s0000g09850"
FT                   /old_locus_tag="Vv17s0000g09850"
FT   mRNA            complement(join(1335403..1335728,1335729..1335958,
FT                   1336739..1336841,1336926..1337037,1337167..1337255,
FT                   1339415..1339491,1339582..1339629,1339754..1339879,
FT                   1340762..1340852,1341563..1341738,1341880..1341967,
FT                   1342131..1342390,1343961..1344329,1344440..1344614,
FT                   1344615..1344692))
FT                   /locus_tag="VIT_17s0000g09850"
FT                   /old_locus_tag="Vv17s0000g09850"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(1335403..1335728)
FT                   /locus_tag="VIT_17s0000g09850"
FT                   /old_locus_tag="Vv17s0000g09850"
FT   CDS_pept        complement(join(1335729..1335958,1336739..1336841,
FT                   1336926..1337037,1337167..1337255,1339415..1339491,
FT                   1339582..1339629,1339754..1339879,1340762..1340852,
FT                   1341563..1341738,1341880..1341967,1342131..1342390,
FT                   1343961..1344329,1344440..1344614))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09850"
FT                   /old_locus_tag="Vv17s0000g09850"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR012462"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHD6"
FT                   /protein_id="CBI14895.3"
FT                   /translation="MEKTSVRVLCPKLLIIRNVSGLQWLIGSPFFPQFTIVSTLTCIHT
FT                   LGDSTSPDYNKESEDLRTLLLRGFHVIGALVVGSKCDLERVAGEAADASRRMRKFLYGD
FT                   EYGGKLGNQDLIGAVADSESGEIHFFVSRGENPAGLECVSSVIYEDNSGKYVWDTGCLL
FT                   HCVLPIKLPFYFPVNSPSDAGEMYLRATDVIIAKLKDSDVTYMVETLNETSVEAPGPVI
FT                   LHGAKLDFHADLFDVNQFGDSSQGSGAKSFPCSYFCSKNKAVFSVEHADIIQVSLLLNK
FT                   SRTSSKSAAPIAEYFPASEQTKLLVVDYKLEVLCYAAKDLPVTYAVSKLVVPGLVDQLN
FT                   SIKNTILPNLLTQHLQLHPYHFCPPGFLHPITVIYELSYGETEMKQVEVRRSLHSRLGL
FT                   PFDRPLLRIANALNLSTTKDSAKSNSIRKGSSLLRDVHVGIPSSGVSGGVVSLVQGSYE
FT                   YYHYLQDGFDDSGWGCAYRSLQTIVSWFRCQHYSSIEVPSHREIQQALVEIGDKDPSFV
FT                   GSREWIGAIELSFVLDKLLGVSCKVINVRSGAELPEKCRELALHFENQGTPIMIGGGVL
FT                   AYTLLGVDYNESSGDCAFLILDPHYTGNDDLKKIVNGGWCGWKKAVDSRGKNFFLHDKF
FT                   YNLLLPQRPNMV"
FT   5'UTR           complement(1344615..1344692)
FT                   /locus_tag="VIT_17s0000g09850"
FT                   /old_locus_tag="Vv17s0000g09850"
FT   gene            complement(1363821..1366008)
FT                   /locus_tag="VIT_17s0000g09840"
FT                   /old_locus_tag="Vv17s0000g09840"
FT   mRNA            complement(join(1363821..1364005,1364006..1364752,
FT                   1365293..1366003,1366004..1366008))
FT                   /locus_tag="VIT_17s0000g09840"
FT                   /old_locus_tag="Vv17s0000g09840"
FT                   /product="Adenosylhomocysteinase"
FT   3'UTR           complement(1363821..1364005)
FT                   /locus_tag="VIT_17s0000g09840"
FT                   /old_locus_tag="Vv17s0000g09840"
FT   CDS_pept        complement(join(1364006..1364752,1365293..1366003))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09840"
FT                   /old_locus_tag="Vv17s0000g09840"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTM7"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR034373"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTM7"
FT                   /protein_id="CCB42911.1"
FT                   /translation="MALVVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTE
FT                   FGPQQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSA
FT                   AVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYERSGKL
FT                   PDPASTDNAEFQIVLGIIKEGLSVDPCKYRKMKERLVGVSEETTTGVKRLYQMQANGTL
FT                   LFAAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAL
FT                   KQAGAQVIVTEIDPICALQALMEGIPVLTLEDVVSKADIFVTTTGNKDIIMVHHMKQMK
FT                   NNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNSGIIILAEGRLMNLG
FT                   CATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGAK
FT                   LTKLSPEQAAYISVPVEGPYKPTHYRY"
FT   5'UTR           complement(1366004..1366008)
FT                   /locus_tag="VIT_17s0000g09840"
FT                   /old_locus_tag="Vv17s0000g09840"
FT   gene            complement(1384783..1385670)
FT                   /locus_tag="VIT_17s0000g09830"
FT                   /old_locus_tag="Vv17s0000g09830"
FT   mRNA            complement(join(1384783..1384964,1384965..1385244,
FT                   1385387..1385508,1385509..1385525,1385635..1385670))
FT                   /locus_tag="VIT_17s0000g09830"
FT                   /old_locus_tag="Vv17s0000g09830"
FT                   /product="Florfenicol resistance protein-like"
FT   3'UTR           complement(1384783..1384964)
FT                   /locus_tag="VIT_17s0000g09830"
FT                   /old_locus_tag="Vv17s0000g09830"
FT   CDS_pept        complement(join(1384965..1385244,1385387..1385508))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09830"
FT                   /old_locus_tag="Vv17s0000g09830"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHD8"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHD8"
FT                   /protein_id="CBI14897.3"
FT                   /translation="MPINRKYNLSLLLQTLREELRSKHNYKVLFEYVMLAGVNDSLEDA
FT                   RRLIDLVQGIPCKVNLISFNPHCGSQFKPTSEEKIIEFRNILAEAGCIVFLRPSRGDDQ
FT                   MAACGQLGKPGQVQAPLLQVPAKFQSALT"
FT   5'UTR           complement(1385635..1385670)
FT                   /locus_tag="VIT_17s0000g09830"
FT                   /old_locus_tag="Vv17s0000g09830"
FT   gene            complement(1400870..1407516)
FT                   /locus_tag="VIT_17s0000g09820"
FT                   /old_locus_tag="Vv17s0000g09820"
FT   mRNA            complement(join(1400870..1400944,1401194..1401251,
FT                   1402351..1403086,1404621..1404809,1404983..1405168,
FT                   1405596..1405815,1405900..1406836,1407233..1407516))
FT                   /locus_tag="VIT_17s0000g09820"
FT                   /old_locus_tag="Vv17s0000g09820"
FT                   /product="unknown predicted protein"
FT   CDS_pept        complement(join(1400870..1400944,1401194..1401251,
FT                   1402351..1403086,1404621..1404809,1404983..1405168,
FT                   1405596..1405815,1405900..1406836,1407233..1407516))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09820"
FT                   /old_locus_tag="Vv17s0000g09820"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTM8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTM8"
FT                   /protein_id="CCB42912.1"
FT                   /translation="MMDGRRHSVDIPISKTLVALRRVRSLRDPSTNSMSKFSALVDSLN
FT                   WETNSSNGISLRFVNGFQEGGPDNNGLLGLENFPGQREELYGGLRKPDPNTSLLANEES
FT                   NAIDHNDRGCGIRCCWSRTPRFRESNLLSDVEDNPLLLGEVGETILSGQKWSWKCFNNE
FT                   ITPYSESPRSLSQKFRPKAFNELVGQNVVARSLLGAISRGRITSFYLFHGPRGTGKTSA
FT                   SRIFAAALNCLSLEEHRPCGLCRECVLFFSGRSRDSKEIDTVRINQTGRMRSLIKHAIG
FT                   RPVSSRFKVFIIDECHLLRGETWATVLNSLDDLPQHVVFIMITPSLDKLPRSAVSRSQR
FT                   YHFPKIKDADIASKLGRICVEECLEFDQVALDFIAAKSNGSLRDAEMMLDQLSLLGKRI
FT                   TMSMTYELIGIVSDDELLDLLDLALSSDTSNTVRRARELMRSRIDPMQLISQLANLIMD
FT                   ILAGKCQEGTSEVRRNFFEGHTSEVDLQKLSHALKILSETEKQLRASKNQTTWLTVALL
FT                   QLSSVESSFLDANDSRAFLRTEHPRGENVKRLVTCACDNNKPHICEVQEDCKGQLEFLW
FT                   KQATEICQSSSLKNFLRKQGKLSSVIVSQGMAVAELEFQHPDYVSKAEKSWKLIASSLQ
FT                   SILGCNVEIRINLAPCTSVKGYAKVKKPSFSFFSCSRRMRLKSHSTSEHGSDQSDCSDF
FT                   TSEKAMIRDKTIGTCSSDCGSQVSHVCYLRTEAARTLRNREGNVLGIGTITPHRPFQDE
FT                   IPKGTGFEVGSSKEEQSSCGCQEPENQPNCLFNTFGLHKKLRSSEASQMTCLRYQAQNK
FT                   LALSVPKNTSFEPYFWANDRYAFSSSSNNFNSCPRDEDGLREDSKVHCWGAPTFPLKKA
FT                   WQSRHRREGSNLVGWVLPCGATK"
FT   gene            1425198..1426823
FT                   /locus_tag="VIT_17s0000g09810"
FT                   /old_locus_tag="Vv17s0000g09810"
FT   mRNA            join(1425198..1425241,1425242..1425351,1425457..1426197,
FT                   1426358..1426496,1426592..1426813,1426814..1426823)
FT                   /locus_tag="VIT_17s0000g09810"
FT                   /old_locus_tag="Vv17s0000g09810"
FT                   /product="Pectate lyase"
FT   5'UTR           1425198..1425241
FT                   /locus_tag="VIT_17s0000g09810"
FT                   /old_locus_tag="Vv17s0000g09810"
FT   CDS_pept        join(1425242..1425351,1425457..1426197,1426358..1426496,
FT                   1426592..1426813)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09810"
FT                   /old_locus_tag="Vv17s0000g09810"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHE0"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR018082"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHE0"
FT                   /protein_id="CBI14899.3"
FT                   /translation="MASSSLSLFFLFSLLSPILIASSPVQDPELVIQEVHRSINESRRN
FT                   LGYLSCGSGNPIDDCWRCNANWEKNRQSLADCAIGFGKNAIGGKNGKIYVVTDSSDDDV
FT                   VNPKPGTLRYAVIQDEPLWIIFARDMVIKLKEELIMNSFKTIDGRGASVHIAGGPCITI
FT                   QFVTNIIIHGLNIHDCKQGGNTNVRDSPSHYGFRTISDGDGVSIFGGSHIWVDHCSLSN
FT                   CHDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLVQR
FT                   MPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAPNDRFSKEVTKHEDAPES
FT                   QWKNWNWRSEGDLMLNGAYFTPSGAGASSSYARASSLGARPSSLVASITGSAGALSCKK
FT                   GSRC"
FT   3'UTR           1426814..1426823
FT                   /locus_tag="VIT_17s0000g09810"
FT                   /old_locus_tag="Vv17s0000g09810"
FT   gene            1426824..1427225
FT                   /locus_tag="VIT_17s0000g09800"
FT                   /old_locus_tag="Vv17s0000g09800"
FT   mRNA            join(1426824..1426893,1426894..1426992,1426993..1427225)
FT                   /locus_tag="VIT_17s0000g09800"
FT                   /old_locus_tag="Vv17s0000g09800"
FT   5'UTR           1426824..1426893
FT                   /locus_tag="VIT_17s0000g09800"
FT                   /old_locus_tag="Vv17s0000g09800"
FT   CDS_pept        1426894..1426992
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09800"
FT                   /old_locus_tag="Vv17s0000g09800"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTM9"
FT                   /protein_id="CCB42913.1"
FT                   /translation="MKLGKARNGQVGKRRALVQATILWSFSRIYFS"
FT   3'UTR           1426993..1427225
FT                   /locus_tag="VIT_17s0000g09800"
FT                   /old_locus_tag="Vv17s0000g09800"
FT   gene            1456321..1459078
FT                   /locus_tag="VIT_17s0000g09790"
FT                   /old_locus_tag="Vv17s0000g09790"
FT   mRNA            join(1456321..1456420,1456421..1456528,1456686..1456819,
FT                   1457188..1457491,1457591..1457907,1458586..1458766,
FT                   1458767..1459078)
FT                   /locus_tag="VIT_17s0000g09790"
FT                   /old_locus_tag="Vv17s0000g09790"
FT                   /product="unknown predicted protein"
FT   5'UTR           1456321..1456420
FT                   /locus_tag="VIT_17s0000g09790"
FT                   /old_locus_tag="Vv17s0000g09790"
FT   CDS_pept        join(1456421..1456528,1456686..1456819,1457188..1457491,
FT                   1457591..1457907,1458586..1458766)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09790"
FT                   /old_locus_tag="Vv17s0000g09790"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHE1"
FT                   /db_xref="InterPro:IPR000197"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR034089"
FT                   /db_xref="InterPro:IPR035898"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHE1"
FT                   /protein_id="CBI14900.3"
FT                   /translation="MELASDCDQISGAIREPDVYIVTSGGLRIPANASVLASVSPVLEN
FT                   ILDRPRKYRRSEKIIPILGVPCDAVLAFVRFLYSSWCTDDEMETYGIHLLALSHVFLVP
FT                   QLKQRCTKGLAKRLTNDNVVDVLQLARLCDAPDLYIKCMRLISDHFKTVEKTEGWMFLQ
FT                   DHDPHLELEIMQFMEESESRKKRSRRRREERCLYLQLSEAMECLEHICTEGCTSVGPYH
FT                   LEPTTKKGPCGKFSTCHGLQMLIKHFGTCKKRVNGGCSRCKRMWQLLRLHSSICDQTDL
FT                   CRVPLCRQFKLKAQQVKKGEDARWKLLVRKVVSAKAMSSLSLPKRKREEEPRQTLDHRH
FT                   GLGSFRL"
FT   3'UTR           1458767..1459078
FT                   /locus_tag="VIT_17s0000g09790"
FT                   /old_locus_tag="Vv17s0000g09790"
FT   gene            1465010..1466430
FT                   /locus_tag="VIT_17s0000g09780"
FT                   /old_locus_tag="Vv17s0000g09780"
FT   mRNA            join(1465010..1465010,1465011..1465328,1465932..1466186,
FT                   1466187..1466430)
FT                   /locus_tag="VIT_17s0000g09780"
FT                   /old_locus_tag="Vv17s0000g09780"
FT                   /product="Methionine sulfoxide reductase A"
FT   5'UTR           1465010..1465010
FT                   /locus_tag="VIT_17s0000g09780"
FT                   /old_locus_tag="Vv17s0000g09780"
FT   CDS_pept        join(1465011..1465328,1465932..1466186)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09780"
FT                   /old_locus_tag="Vv17s0000g09780"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTP8"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTP8"
FT                   /protein_id="CCB42914.1"
FT                   /translation="MAANSTNPALERDPDRPDHPGLELAQFGAGCFWGVELAFQRLVGV
FT                   VKTEVGFSQGHVPDPTYKLVCTGTTNHVEVVRVQFDPDVCPYSNLLSLFWSRHDPTSLN
FT                   RQGADVGTQYRSGIYYYNEAQARLARESLEAKQKELNDKNIVTEILPAKRFYRAEEYHQ
FT                   QYLEKGGGKGLRQSAEKGCTDPIRCYG"
FT   3'UTR           1466187..1466430
FT                   /locus_tag="VIT_17s0000g09780"
FT                   /old_locus_tag="Vv17s0000g09780"
FT   gene            complement(1467004..1468856)
FT                   /locus_tag="VIT_17s0000g09770"
FT                   /old_locus_tag="Vv17s0000g09770"
FT   mRNA            complement(join(1467004..1467202,1467203..1467466,
FT                   1467809..1467949,1468055..1468290,1468404..1468845,
FT                   1468846..1468856))
FT                   /locus_tag="VIT_17s0000g09770"
FT                   /old_locus_tag="Vv17s0000g09770"
FT                   /product="Predicted protein"
FT   3'UTR           complement(1467004..1467202)
FT                   /locus_tag="VIT_17s0000g09770"
FT                   /old_locus_tag="Vv17s0000g09770"
FT   CDS_pept        complement(join(1467203..1467466,1467809..1467949,
FT                   1468055..1468290,1468404..1468845))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09770"
FT                   /old_locus_tag="Vv17s0000g09770"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTP9"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR013201"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="InterPro:IPR025661"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR039417"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTP9"
FT                   /protein_id="CCB42915.1"
FT                   /translation="MKRFFVVALSLVLVVGIVESFDFHQKELETEESLWNLYERWRSHH
FT                   TVSRSLDEKHKRFNVFKENVNFVHEFNKKDEPYKLKLNKFADMTNHEFRSTYAGSKVNH
FT                   HRMFRGSQHAAGSFMYEKVKSVPPSVDWRKKGAVTPIKDQGQCGSCWAFSTVVAVEGIN
FT                   HIKTNKLVSLSEQELVDCDTSENQGCNGGLMGYAFEFIKEKGGITTEQSYPYTAEDGTC
FT                   DVSKVNSPVVSIDGHETVPPNNEDALLKAAANQPISVAIDAGGSAFQFYSEGVFAGRCG
FT                   TDLDHGVAIVGYGTTLDGTKYWIVKNSWGTDWGENGYIRMKRGISAKEGLCGIAVEASY
FT                   PIKNSSTNPVGAPSSLKDEL"
FT   5'UTR           complement(1468846..1468856)
FT                   /locus_tag="VIT_17s0000g09770"
FT                   /old_locus_tag="Vv17s0000g09770"
FT   gene            1472384..1479157
FT                   /locus_tag="VIT_17s0000g09760"
FT                   /old_locus_tag="Vv17s0000g09760"
FT   mRNA            join(1472384..1472431,1472726..1472780,1473699..1473883,
FT                   1473992..1474449,1476041..1476581,1476742..1478624,
FT                   1478734..1479157)
FT                   /locus_tag="VIT_17s0000g09760"
FT                   /old_locus_tag="Vv17s0000g09760"
FT                   /product="unknown predicted protein"
FT   CDS_pept        join(1472384..1472431,1472726..1472780,1473699..1473883,
FT                   1473992..1474449,1476041..1476581,1476742..1478624,
FT                   1478734..1479157)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09760"
FT                   /old_locus_tag="Vv17s0000g09760"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTQ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTQ0"
FT                   /protein_id="CCB42916.1"
FT                   /translation="MNAYAVTSLSLADIDKYALALLYVALGIGAGSFLEGFCWARTAER
FT                   QTSRLRRKYLQAVLRQDVGFFERTHGASMTSQVVSSISTDILVIQGVLSEKLPNFIMNI
FT                   AMFITSQMTALYLCWRLAIVAIPALSMLIIPGIVYGKLLSGLGEKIQEAYSVAGGIVEQ
FT                   AISSIRTVYSYVGEERTVKSYSVALEPILKLGIKQGLMKGMAIGSIGVTYAVWALQGWY
FT                   GSILVTDKGVKGGNVFTTGVCIIYGGLALGSSFLNVKHFTEANAAAALILEMIERVPSI
FT                   DSADQQGKTITEVKGELVFEEIDFAYPSRPGNLVLRKFNLKVVACQTVGLVGSSGSGKS
FT                   TVINLLQRFYDPLGGEILLDGIGIKSLQLKWLRSQMGLVAQEPILFATTVKENILFGKE
FT                   EASQEEIVQAAKAANAHNFISQLPNGYDTLVGQLGIQMSEGQKQRISIARALLRDPRIL
FT                   LLDEATSALDSQSEKAVQDAFNQASLGRTTIIVAHRLSALRNADLIAVIQSGEVVEAGS
FT                   HDQLIQNRHGPYSAMVQLQKTTFMKDEIISEPKGNESHNSTSTTEEAAPTAEIANKLSP
FT                   QLPSHQTNSNQQSEDHYSPPSIWQLMWMTTPEWKPTLVGCIGALIFGLVQPMSSFCMGA
FT                   LLAVYFINDHDEIRSQTKMYCFAFLAFAIFAFITNVIQHYHFGVMGENLTRRVREASLT
FT                   KILTFEIEWFDQEHNSTGALCSRLSVDSTMARTLVADRLSLLTQAISAAALAVILGMVL
FT                   AWKLAIVVTALQPFIIGAFYTRAVMMRSMSKKILKAQNKSSELASEAVGNHRIITAFYS
FT                   QEKVLSLFEVTQKDPKNESLKQSWYAGLGLFTSQFLTSGSAGLIFWYGGRLLYNKEISY
FT                   KHLFQTFFILVATGRLIAETGSMTADLSKGTNALKSVFMTLERKSKMDPDEIKGIKPEK
FT                   LIGDIEFKEVDFFYPTRPKQMILMGVSLKVDAGKVVALVGQSGSGKSTVIRMIERFYDP
FT                   SKGSIEVDGIDIKHYNLRALRLHIALVSQEPTLFAGTIQENIAYAKENASEAEIIEAAT
FT                   VANAHEFISSMKDGYATYCGERGVQLSGGQKQRLALARAILKNPAILLLDEATSALDVK
FT                   LESLVQDALEKTMVGRTCLVVAHRLSTIQKSDKISVIDDGKIVEEGSHGELLAKGEKGA
FT                   YFSLVKLQQHATMEKRELNLIGRNIEPSKDE"
FT   gene            complement(1481630..1486597)
FT                   /locus_tag="VIT_17s0000g09750"
FT                   /old_locus_tag="Vv17s0000g09750"
FT   mRNA            complement(join(1481630..1481999,1482000..1483022,
FT                   1483946..1484141,1484232..1484413,1486233..1486359,
FT                   1486569..1486597))
FT                   /locus_tag="VIT_17s0000g09750"
FT                   /old_locus_tag="Vv17s0000g09750"
FT                   /product="Predicted protein"
FT   3'UTR           complement(1481630..1481999)
FT                   /locus_tag="VIT_17s0000g09750"
FT                   /old_locus_tag="Vv17s0000g09750"
FT   CDS_pept        complement(join(1482000..1483022,1483946..1484141,
FT                   1484232..1484413,1486233..1486359,1486569..1486597))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09750"
FT                   /old_locus_tag="Vv17s0000g09750"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTQ1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR013923"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTQ1"
FT                   /protein_id="CCB42917.1"
FT                   /translation="MENRGKEKELSQDEVAVDAIKHALKALRKRHLLEEGAHAPAIVAL
FT                   SKPFIYQGSEWKDKAENLEVELQQCYRAQARLSEQLVVEVAECRASKALVQEKEAIIND
FT                   IQNELTKTRDECLQLKVIVEEKTKALELVMSENQELKAQLQEMTVKAKNIEAENKMLID
FT                   RWMLQKMQEAEHLNEANALYQDFKDQLKASGIAQLARQQVDGVVRQSEEGAQYYGESTV
FT                   PNTCKHRIHAHEGGCAAILFEYNSGNLISGGHDRAVKMWDTNTGSLTRTLYGCVGSVLD
FT                   LAITHDNRSIIAASSSNNLCVWDVNSGRIRHTLTGHMDKVCSVDVSKISSRHVASAAYD
FT                   RTIKVWDLQKGYCINTIIFHSNCNALCFSTDGQTICSGHVDGNLRLWDIQTGKLLSEVA
FT                   AHSLAITSISLSRNGSVVLTSGRDNLHNLFDMRSLEVCGTLRANGNRVASNWSRSCISA
FT                   DDNYVAAGSTDGSVHIWSILTAEIVSTLKEHTASVLSCSWSGLGKPLASSDKSGIVYTW
FT                   T"
FT   gene            complement(1494780..1501718)
FT                   /locus_tag="VIT_17s0000g09740"
FT                   /old_locus_tag="Vv17s0000g09740"
FT   mRNA            complement(join(1494780..1495747,1495748..1496287,
FT                   1497985..1498032,1498143..1498379,1498496..1498532,
FT                   1501296..1501597,1501598..1501718))
FT                   /locus_tag="VIT_17s0000g09740"
FT                   /old_locus_tag="Vv17s0000g09740"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(1494780..1495747)
FT                   /locus_tag="VIT_17s0000g09740"
FT                   /old_locus_tag="Vv17s0000g09740"
FT   CDS_pept        complement(join(1495748..1496287,1497985..1498032,
FT                   1498143..1498379,1498496..1498532,1501296..1501597))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09740"
FT                   /old_locus_tag="Vv17s0000g09740"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTQ2"
FT                   /protein_id="CCB42918.1"
FT                   /translation="MGGVTSSMAAKLAFFPPNPPSYKLITDDATGLLLFNHFPHRENVD
FT                   ILKLPTRRGTEIVALYVRYPMATSTLLYSHGNAADIGQMYELFIELSIHLRVNLMGYDY
FT                   SGYGQSSGKPSEHNTYADIEAAYKCLEESFGAKQEDIILYGQSVGSGPTLDLAARLPRL
FT                   RAVVLHSPILSGLRVMYPVKRTYWFDIYKNIDKIPLVQCPVLVIHGTADEVVDCSHGKQ
FT                   LWELCKEKYEPLWLKGGNHCDLELYPEYIKHLKKFISTVEKSPSRRSSARRSVDRPEYS
FT                   RKSTDCYEAPRKSTDQAPRKSTDQAPRKSTDRRDKPRRSTDRPEKLKLYDYKSNDVDKL
FT                   EKLRTSLDQVERSRRSVEYNDKSRRSINQQLERARKSVDWLDRIRAG"
FT   5'UTR           complement(1501598..1501718)
FT                   /locus_tag="VIT_17s0000g09740"
FT                   /old_locus_tag="Vv17s0000g09740"
FT   gene            1507823..1509025
FT                   /locus_tag="VIT_17s0000g09730"
FT                   /old_locus_tag="Vv17s0000g09730"
FT   mRNA            1507823..1509025
FT                   /locus_tag="VIT_17s0000g09730"
FT                   /old_locus_tag="Vv17s0000g09730"
FT                   /product="unknown predicted protein"
FT   CDS_pept        1507823..1509025
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09730"
FT                   /old_locus_tag="Vv17s0000g09730"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHE6"
FT                   /protein_id="CBI14905.3"
FT                   /translation="MEDPSLLATADSTLPEQILPTSDTSINSETPSTSTLSQETTSFTA
FT                   SLQSRSPESRNVVVSHLCVSSLRTLTPHISCLAVHEKFLYAASGEDIHVYDLTTHTHID
FT                   TFRNNKPTSGSVKSIAFHEGKIFTAHQDSKIRVWRITASKRHRLISTLPTVKDFLRRSI
FT                   LPKNYVRVRRHKKRLWIEHNDAVSGLAMAEGFMYSASWDKSFKIWRTSDLRCVESVKAH
FT                   DDAVNAVAVSASGTVYTASADGCIRVWERTGEERTHTLITTLEKHKSTVNALALSGDGS
FT                   SLFSGGCESWILVWEREESANHMAATQALVGHTGPVLCLITVNNMIISGSSDRTVRIWR
FT                   PGVDGRYHCTLMLEGHVKPVKSLVAVSSGTSYDVVSICSGSLDGEIKVWEVSAAAFDAK
FT                   S"
FT   gene            1552054..1563446
FT                   /locus_tag="VIT_17s0000g09720"
FT                   /old_locus_tag="Vv17s0000g09720"
FT   mRNA            join(1552054..1552145,1556237..1556396,1556491..1556539,
FT                   1556677..1556717,1556983..1557022,1563132..1563185,
FT                   1563284..1563387,1563388..1563446)
FT                   /locus_tag="VIT_17s0000g09720"
FT                   /old_locus_tag="Vv17s0000g09720"
FT                   /product="Predicted protein"
FT   CDS_pept        join(1552054..1552145,1556237..1556396,1556491..1556539,
FT                   1556677..1556717,1556983..1557022,1563132..1563185,
FT                   1563284..1563387)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09720"
FT                   /old_locus_tag="Vv17s0000g09720"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHE7"
FT                   /db_xref="InterPro:IPR018552"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHE7"
FT                   /protein_id="CBI14906.3"
FT                   /translation="MKNKENFWDLNKLENTGFSQFEAIGSFIMVRGVEFHVTEHLISQK
FT                   TFLCAHSLHPFPRITTFSGAPSIALRLLQMDNANTRFDPDLIHAIFKLVWSRTALEREK
FT                   NEGADPLECEVGAATSKKNRPTSANANALKLSCELLRVFVIEAVERAATIAEAEGVNKI
FT                   EATHLERILPQLLLDF"
FT   3'UTR           1563388..1563446
FT                   /locus_tag="VIT_17s0000g09720"
FT                   /old_locus_tag="Vv17s0000g09720"
FT   gene            complement(1565484..1567662)
FT                   /locus_tag="VIT_17s0000g09710"
FT                   /old_locus_tag="Vv17s0000g09710"
FT   mRNA            complement(join(1565484..1565554,1565555..1567453,
FT                   1567454..1567662))
FT                   /locus_tag="VIT_17s0000g09710"
FT                   /old_locus_tag="Vv17s0000g09710"
FT                   /product="Predicted protein"
FT   3'UTR           complement(1565484..1565554)
FT                   /locus_tag="VIT_17s0000g09710"
FT                   /old_locus_tag="Vv17s0000g09710"
FT   CDS_pept        complement(1565555..1567453)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09710"
FT                   /old_locus_tag="Vv17s0000g09710"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTQ3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTQ3"
FT                   /protein_id="CCB42919.1"
FT                   /translation="MASISFSGESLISLLTLFSLLFLTHATLHLHPSDYDALLLIQKHL
FT                   GINGQRRSSPNPCNTPGVFCERRVSDNATVLRVTRLVFKSQRLSGFLSPQIGRLSQLKE
FT                   LSLPDNYLLDRIPSQIVDCRKLEILDLRNNRFSGEIPPELSSLVRLRILDLSSNKFSGN
FT                   LNFLRFFPNLEKLSLAENLFSGKVPVSVRSFRNLRVFNLSGNSFLEGPVPGMREVEVES
FT                   LASALPRRYVFAENLTRGSSNHSAVAPSGSSGYYGEAPAPSPSAPPHKHRKNKKLSAWI
FT                   LGFIAGAVAGCISGLVFSVLFKALLVLVRGGGKESGPAIFSPLIKKAEDLAFLEKDDGL
FT                   ASLEIIGKGGCGEVYRAELPGGKLIAIKKIVQPPKDAAELAEEDSKLLNKKMRQIRSEI
FT                   QTVGNIRHRNLLPLLAHVSRPNCHYLVYEFMKNGSLQDMLTQVSEGTRELDWLARHRVA
FT                   LGVAAGLEYLHMSHSPRIIHRDLKPGNILLDDDMEARIADFGLAKAVPDANTHVTTSNV
FT                   AGTVGYIAPEYHQTLKFTDKCDIYSFGVLLGVLVVGKLPSDDFFQHTAEMSLVKWMANI
FT                   RTSDDPSRAIDRKLMGNGFEEQMLLVLKIACFCTVDDAKIRPNSKDVRTMLSQIKH"
FT   5'UTR           complement(1567454..1567662)
FT                   /locus_tag="VIT_17s0000g09710"
FT                   /old_locus_tag="Vv17s0000g09710"
FT   gene            complement(1590201..1593208)
FT                   /locus_tag="VIT_17s0000g09700"
FT                   /old_locus_tag="Vv17s0000g09700"
FT   mRNA            complement(join(1590201..1590412,1590413..1591030,
FT                   1591211..1591690,1591787..1591929,1592017..1592126,
FT                   1592228..1592676,1592764..1592868,1592947..1593168,
FT                   1593169..1593208))
FT                   /locus_tag="VIT_17s0000g09700"
FT                   /old_locus_tag="Vv17s0000g09700"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(1590201..1590412)
FT                   /locus_tag="VIT_17s0000g09700"
FT                   /old_locus_tag="Vv17s0000g09700"
FT   CDS_pept        complement(join(1590413..1591030,1591211..1591690,
FT                   1591787..1591929,1592017..1592126,1592228..1592676,
FT                   1592764..1592868,1592947..1593168))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09700"
FT                   /old_locus_tag="Vv17s0000g09700"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHE9"
FT                   /db_xref="InterPro:IPR027942"
FT                   /db_xref="InterPro:IPR027944"
FT                   /db_xref="InterPro:IPR039299"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHE9"
FT                   /protein_id="CBI14908.3"
FT                   /translation="MAATAQPNRVQQQQQVVKGRDHPKFLRMSDDTTMMKQIQATHTPD
FT                   GREVEVKPIVQVIEDILNHATPAIDGTLYGNPPHLEALEDRSSQDGLHGILEELAYTIQ
FT                   KLSCELSCKCSGGGDAHATTMAVFNMLSHYSWDAKVVLSLAAFAANYGEFWLVIQLYAT
FT                   NPLAKSVALLKQLPDIIEHGNSLKSRFDAVTKLIKVMLDVTKSIIEFKELPSLYISPDM
FT                   PPMSSTMAHIPTAAYWTIRGIVACASQIISLIGTSNEYTSWTTESWELSTLAHKVSSIH
FT                   EHLIQQLIICHQHIEEKKQFESYNNLVRIFEMPHLDNQKVLKTLIYAKEDIQPLLQGNT
FT                   KARVNIEILRRKTVLLLISDLDLLHEEIVILHKFYREQIKSDVEYEVVWLSVVDRSKPL
FT                   TEENQNKFHELQKEMPWYTLLHPSLLEPAVVRYIKEVWHFTKKAILVVLDLQGKVVCRN
FT                   ALHMMWIWGNTAYPFTNSKEESLWKEETWRLKLLVDDIDATIFAWVNQGKYICMYGGVN
FT                   SDWILNFNTAAREVAKAAGIQLEMVYVGKSNAKEQVRKTITFIDSRSLGYCWTDPTNIW
FT                   FFWTRMESMLYSKTQHGKTIENDSIFAGVLTMLSFDGSDQGWSVICHGPTEMAKAKGDM
FT                   ILKCFTEYSDWSDNVQQNGFMPALNEHLQKLHTPEHCNRLILPGINGDIPEKVVCAECG
FT                   RPMEKYFMYRCCTD"
FT   5'UTR           complement(1593169..1593208)
FT                   /locus_tag="VIT_17s0000g09700"
FT                   /old_locus_tag="Vv17s0000g09700"
FT   gene            1632308..1635581
FT                   /locus_tag="VIT_17s0000g09690"
FT                   /old_locus_tag="Vv17s0000g09690"
FT   mRNA            join(1632308..1632467,1632468..1632473,1633205..1633475,
FT                   1634371..1634535,1635133..1635383,1635384..1635581)
FT                   /locus_tag="VIT_17s0000g09690"
FT                   /old_locus_tag="Vv17s0000g09690"
FT                   /product="Protein-L-isoaspartate O-methyltransferase"
FT   5'UTR           1632308..1632467
FT                   /locus_tag="VIT_17s0000g09690"
FT                   /old_locus_tag="Vv17s0000g09690"
FT   CDS_pept        join(1632468..1632473,1633205..1633475,1634371..1634535,
FT                   1635133..1635383)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09690"
FT                   /old_locus_tag="Vv17s0000g09690"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHF0"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHF0"
FT                   /protein_id="CBI14909.3"
FT                   /translation="MERFFSGSGINKNKAMVEHLQRYGVINSKKVAQVMETVDRALFVP
FT                   DGNPPYVDSPMQIGYNATISAPHMHATCLELLQENLQPGMHALDVGSGTGYLTACFALM
FT                   VGPQGCAVGVEHIPELVASSIKNIEKSAAAPLLKEGSLKLHAGDGRLGWPECAPYDAIH
FT                   VGAAAPEIPQPLIDQLKPGGRMVIPVGNIFQDLKVVDKNLDGSISIRSETSVRYVPLTS
FT                   REAQLRDY"
FT   3'UTR           1635384..1635581
FT                   /locus_tag="VIT_17s0000g09690"
FT                   /old_locus_tag="Vv17s0000g09690"
FT   gene            complement(1635801..1639111)
FT                   /locus_tag="VIT_17s0000g09680"
FT                   /old_locus_tag="Vv17s0000g09680"
FT   mRNA            complement(join(1635801..1636012,1636013..1636078,
FT                   1636401..1636682,1638334..1638435,1638517..1639050,
FT                   1639051..1639111))
FT                   /locus_tag="VIT_17s0000g09680"
FT                   /old_locus_tag="Vv17s0000g09680"
FT                   /product="Predicted protein"
FT   3'UTR           complement(1635801..1636012)
FT                   /locus_tag="VIT_17s0000g09680"
FT                   /old_locus_tag="Vv17s0000g09680"
FT   CDS_pept        complement(join(1636013..1636078,1636401..1636682,
FT                   1638334..1638435,1638517..1639050))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09680"
FT                   /old_locus_tag="Vv17s0000g09680"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTQ4"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTQ4"
FT                   /protein_id="CCB42920.1"
FT                   /translation="MSSATHHLLKPFSIPNGSPISLPTIFSTKTPHSYLPIPPHKPIKL
FT                   LLSCSQSSLFSPSLFLKSKTLSSSVVTFVAQTSDWAQQEEDNTVIIEEEQEEKVTWENE
FT                   EVEGPDAQASDWESEGEGAVTEAISDDGVVDDGEDSYSEPPEEAKVFVGNLPYDVDSER
FT                   LARLFEQAGVVEIAEVIYNRETDRSRGFGFVSMSTVEEAEKAVDMFHRYELDGRLLTVN
FT                   KAAPRGSQPERPPRVFEPAFRMYVGNLPWDVDSARLEQVFSEHGKVVEARVVFDRETGR
FT                   SRGFGFVTMSSQTELEDAIAATDGQTLDGRTIRVNVAEERPRRSAF"
FT   5'UTR           complement(1639051..1639111)
FT                   /locus_tag="VIT_17s0000g09680"
FT                   /old_locus_tag="Vv17s0000g09680"
FT   gene            complement(1639545..1644225)
FT                   /locus_tag="VIT_17s0000g09670"
FT                   /old_locus_tag="Vv17s0000g09670"
FT   mRNA            complement(join(1639545..1639837,1639838..1640119,
FT                   1640209..1640297,1640389..1640612,1640732..1640866,
FT                   1641075..1641142,1641448..1641589,1641668..1642078,
FT                   1642178..1642297,1642388..1642495,1642615..1642706,
FT                   1642790..1642838,1642961..1643051,1643156..1643418,
FT                   1644047..1644225))
FT                   /locus_tag="VIT_17s0000g09670"
FT                   /old_locus_tag="Vv17s0000g09670"
FT                   /product="Predicted protein"
FT   3'UTR           complement(1639545..1639837)
FT                   /locus_tag="VIT_17s0000g09670"
FT                   /old_locus_tag="Vv17s0000g09670"
FT   CDS_pept        complement(join(1639838..1640119,1640209..1640297,
FT                   1640389..1640612,1640732..1640866,1641075..1641142,
FT                   1641448..1641589,1641668..1642078,1642178..1642297,
FT                   1642388..1642495,1642615..1642706,1642790..1642838,
FT                   1642961..1643051,1643156..1643418,1644047..1644225))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09670"
FT                   /old_locus_tag="Vv17s0000g09670"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHF2"
FT                   /db_xref="InterPro:IPR008811"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHF2"
FT                   /protein_id="CBI14911.3"
FT                   /translation="MTITAKPSITDSGLMVGGRVVCNRVAENLVVSPESSGSAFLGATS
FT                   PAPRSRHVFNVGVLEGYRFICLFRAKFWWMIPRVGKSASEIPMETQMLLLDVREESALD
FT                   DENSSDMTSESTFYVLFLPVLDGPFRTSLQGTSENVLQFCVESGDPSVQASQVLEAVLI
FT                   NSGDNPFELLKNSIKILEKRKGTFAHIEHKKAPPHLDWFGWCTWDAFYTEVNPQGIREG
FT                   LQSFLEGGCPPKFLIIDDGWQETINEFHKGSKLHIDGTQFATRLVDIRENSKFKSSGSE
FT                   SSCIDLHDFIQTIKERYRLKFVYMWHAIIGYWGGVLPSSKMMEKYNPKLAYPIQSPGNI
FT                   GNLRDIAVDSLEKYGVGMIDPEKIFHFYNDLHGYLASSGVDGVKVDVQNILETIGKGYG
FT                   GRVLLTRQYQFALDESIARNFKDNSLICCMSHNSDSIYSSRKSAVARASEDFMPKEPTF
FT                   QTVHIASVAFNSLLLGEIVVPDWDTFHSNHSTAEFHGAARALGGCAVYVSDRPGTHDFR
FT                   ILKRLVLPDGSVLRAKYPGRPTRDCLFKDPVMDGESLLKIWNLNKLSGVVGVFNCQGAG
FT                   NWPMKDAEAVPVLASTPTFLSGHVSPLDVEYLDQVAGDNWRGDSAVYAFYSGSLSRLSK
FT                   KANLEVSLAVLKCEIFTICPVRVLGQNLQFAPIGLLDMYNSGGAVEALEHTNHPAGCRV
FT                   KISVRGCGRFGAYSSKKPLSCIVDMQEEEFQYNAEGGLLTLKLQGECSLREIKIVY"
FT   gap             1660870..1672884
FT                   /estimated_length=12015
FT   gap             1681278..1683163
FT                   /estimated_length=1886
FT   gene            complement(1683476..1683855)
FT                   /locus_tag="VIT_17s0000g09660"
FT                   /old_locus_tag="Vv17s0000g09660"
FT   mRNA            complement(join(1683476..1683494,1683769..1683830,
FT                   1683831..1683855))
FT                   /locus_tag="VIT_17s0000g09660"
FT                   /old_locus_tag="Vv17s0000g09660"
FT   CDS_pept        complement(join(1683476..1683494,1683769..1683830))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09660"
FT                   /old_locus_tag="Vv17s0000g09660"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTQ5"
FT                   /protein_id="CCB42921.1"
FT                   /translation="MEGFRLIRDTIFSRLRGGLSSKQQLS"
FT   5'UTR           complement(1683831..1683855)
FT                   /locus_tag="VIT_17s0000g09660"
FT                   /old_locus_tag="Vv17s0000g09660"
FT   gene            complement(1693301..1695095)
FT                   /locus_tag="VIT_17s0000g09650"
FT                   /old_locus_tag="Vv17s0000g09650"
FT   mRNA            complement(join(1693301..1693301,1693302..1695095))
FT                   /locus_tag="VIT_17s0000g09650"
FT                   /old_locus_tag="Vv17s0000g09650"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           1693301..1693301
FT   CDS_pept        complement(1693302..1695095)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09650"
FT                   /old_locus_tag="Vv17s0000g09650"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTQ6"
FT                   /db_xref="InterPro:IPR009880"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015202"
FT                   /db_xref="InterPro:IPR037293"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTQ6"
FT                   /protein_id="CCB42922.1"
FT                   /translation="MTPMHFGFNQTHSSINFSFFLFFSMPIPLSMEDKKHFPLAFKLMV
FT                   VVLFLLLHCVCFCTAVAGSSGGKKGKWQLLLNNTGVVGMHMALTHHGTVIIFDQIGVGQ
FT                   SGYGLRRRYNGTRCMNTQHDLTDWSCFAHSVEYDMSLNKVRPLRLDTDPWCSSGSFLSN
FT                   GTLLQTGGYGRGSRRIRYFRPCENGHCDWRQSKTLLSDDRWYASSQILPEKDRAIVVGG
FT                   RQVFSYEFVPKLHSNHRSFDLPFLHRTTNKNEGGNNLYPFVHLSSDGNLFIFANRDSIL
FT                   FNYKRNRVVKSFPRIPGAGSRNYPSSGSSVILPLDHGDRFHKVEVMVCGGAASGAHQAA
FT                   EQGKFLKGLSSCGRMVITGNTHKWNMENMPGPRLLNDMLILPTGDILIINGAKRGCAGW
FT                   KNAADPSLQPYLYKPKKTLGRRFSVLKSTKIARMYHSSAILTPDGRVLVAGSNPNNKYT
FT                   FRNVRYPTELRLQAFVPAYMDRQYHNTRPGNVSIHYGSGTNGGVRYGEGFSVRFWLGKK
FT                   PSKTVEFSAYAPPFTTHSISMNQRMLKLRCKSMVRGEGGWINAALEAPPSPNVAPSGYY
FT                   MLTVINGGIPSISQWIRIIHA"
FT   gene            complement(1695723..1700386)
FT                   /locus_tag="VIT_17s0000g09640"
FT                   /old_locus_tag="Vv17s0000g09640"
FT   mRNA            complement(join(1695723..1696071,1696072..1696152,
FT                   1696238..1696294,1696501..1696681,1696789..1696916,
FT                   1697066..1697171,1697250..1697329,1697792..1697889,
FT                   1697992..1698105,1698191..1698331,1698408..1698492,
FT                   1698868..1699098,1699099..1699121,1700161..1700386))
FT                   /locus_tag="VIT_17s0000g09640"
FT                   /old_locus_tag="Vv17s0000g09640"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(1695723..1696071)
FT                   /locus_tag="VIT_17s0000g09640"
FT                   /old_locus_tag="Vv17s0000g09640"
FT   CDS_pept        complement(join(1696072..1696152,1696238..1696294,
FT                   1696501..1696681,1696789..1696916,1697066..1697171,
FT                   1697250..1697329,1697792..1697889,1697992..1698105,
FT                   1698191..1698331,1698408..1698492,1698868..1699098))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09640"
FT                   /old_locus_tag="Vv17s0000g09640"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR010734"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHF5"
FT                   /protein_id="CBI14914.3"
FT                   /translation="MGGKSSKRSISRQSSHLGSSSYSWGHHDQSQIPYAQPAPGYLPQQ
FT                   HYNHPPPTYGGQNPGSKRKYSKIEDNYNSLDQVTSALAQAGLESSNLIVGIDFTKSNEW
FT                   TGARSFYRRSLHHVGDDQNPYEQAISIIGKTLSKFDDDNLIPCFGFGDASTHDRDVFSF
FT                   YSDERFCNGFEEVLKRYRELVPHLRLAGPTSFAPIVEMAITIVEQSGGQYHVLLIIADG
FT                   QVTRSVDTEHGQLSPQEKRTVEAIVKASEYPLSIILVGVGDGPWDMMKEFDDNMPARAF
FT                   DNFQFVNFTEIMSKNMDRSRKETEFALSALMEIPSQYKATMELNILGSHRGKAIDRVPL
FT                   PPPLYGANSFSYSKPPQSSSFQPSAPSSDQHSASIHTSAPASSLADNNVCPICLTNKKD
FT                   MAFGCGHQTCCECGPDLDLCPICRSPIQTRIKLY"
FT   5'UTR           complement(1700161..1700386)
FT                   /locus_tag="VIT_17s0000g09640"
FT                   /old_locus_tag="Vv17s0000g09640"
FT   gene            1741987..1749373
FT                   /locus_tag="VIT_17s0000g09620"
FT                   /old_locus_tag="Vv17s0000g09620"
FT   mRNA            join(1741987..1742150,1742151..1742282,1742390..1742485,
FT                   1743921..1744028,1744462..1744558,1746028..1746067,
FT                   1746167..1746241,1747447..1747534,1747643..1747710,
FT                   1748832..1748904,1749008..1749091,1749092..1749373)
FT                   /locus_tag="VIT_17s0000g09620"
FT                   /old_locus_tag="Vv17s0000g09620"
FT                   /product="Predicted protein"
FT   5'UTR           1741987..1742150
FT                   /locus_tag="VIT_17s0000g09620"
FT                   /old_locus_tag="Vv17s0000g09620"
FT   CDS_pept        join(1742151..1742282,1742390..1742485,1743921..1744028,
FT                   1744462..1744558,1746028..1746067,1746167..1746241,
FT                   1747447..1747534,1747643..1747710,1748832..1748904,
FT                   1749008..1749091)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09620"
FT                   /old_locus_tag="Vv17s0000g09620"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHF7"
FT                   /protein_id="CBI14916.3"
FT                   /translation="MEALGLPPLSTLSVSRCRAGVLGRTCYSNFSVPSSLKLSTTHHKR
FT                   HGIVRMQAYEEEYELKQMKDMAAARKRWEALIREEKVKILSPREAGYAIQLSNKTLLDV
FT                   RPSTERKKAWVKGSTWIPIFEVDDRFDVGTLSRKITNFMMGGWWSGVPALSYDSQFLTK
FT                   VEQKFPKDTDLIVACQKGLRSLAACELLYNAGYSNLFWVQGGLEAAEEEDLVREGPEPF
FT                   KLAGIGGLSEFLGWTDQQRVAATKEGWGYRLVFSARLVGVFLVADALFIGAQQLGRYLQ
FT                   DIRSH"
FT   3'UTR           1749092..1749373
FT                   /locus_tag="VIT_17s0000g09620"
FT                   /old_locus_tag="Vv17s0000g09620"
FT   gene            complement(1750317..1752093)
FT                   /locus_tag="VIT_17s0000g09610"
FT                   /old_locus_tag="Vv17s0000g09610"
FT   mRNA            complement(join(1750317..1750431,1750432..1751043,
FT                   1751173..1752084,1752085..1752093))
FT                   /locus_tag="VIT_17s0000g09610"
FT                   /old_locus_tag="Vv17s0000g09610"
FT                   /product="Cytochrome P450"
FT   3'UTR           complement(1750317..1750431)
FT                   /locus_tag="VIT_17s0000g09610"
FT                   /old_locus_tag="Vv17s0000g09610"
FT   CDS_pept        complement(join(1750432..1751043,1751173..1752084))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09610"
FT                   /old_locus_tag="Vv17s0000g09610"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTQ7"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTQ7"
FT                   /protein_id="CCB42923.1"
FT                   /translation="MALLQWLKEGFLPSFLFAGIILVAVLKFLQKGMLRKRKFNLPPSP
FT                   RKLPIIGNLHQLGNMPHISLHRLAQKFGPIIFLQLGEVPTVVVSSARVAKEVMKTHDLA
FT                   LSSRPQIFSAKHLFYDCTDIVFSPYSAYWRHLRKICILELLSAKRVQSFSFVREEEVAR
FT                   MVHRIAESYPCPTNLTKILGLYANDVLCRVAFGRDFSAGGEYDRHGFQTMLEEYQVLLG
FT                   GFSVGDFFPSMEFIHSLTGMKSRLQNTFRRFDHFFDEVVKEHLDPERKKEEHKDLVDVL
FT                   LHVKEEGATEMPLTMDNVKAIILDMFAAGTDTTFITLDWGMTELIMNPKVMERAQAEVR
FT                   SIVGERRVVTESDLPQLHYMKAVIKEIFRLHPPAPVLVPRESMEDVTIDGYNIPAKTRF
FT                   FVNAWAIGRDPESWRNPESFEPQRFMGSTIDFKGQDFELIPFGAGRRSCPAITFGAATV
FT                   ELALAQLLHSFDWELPPGIQAQDLDMTEVFGITMHRIANLIVLAKPRFP"
FT   5'UTR           complement(1752085..1752093)
FT                   /locus_tag="VIT_17s0000g09610"
FT                   /old_locus_tag="Vv17s0000g09610"
FT   gap             1759231..1759330
FT                   /estimated_length=100
FT   gene            complement(1772154..1772303)
FT                   /locus_tag="VIT_17s0000g09600"
FT                   /old_locus_tag="Vv17s0000g09600"
FT   mRNA            complement(1772154..1772303)
FT                   /locus_tag="VIT_17s0000g09600"
FT                   /old_locus_tag="Vv17s0000g09600"
FT   CDS_pept        complement(1772154..1772303)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09600"
FT                   /old_locus_tag="Vv17s0000g09600"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHF8"
FT                   /protein_id="CBI14917.3"
FT                   /translation="MMLLLYSSDEMKNIVSVQFLSDTHQKKIGSFLGLLYKENYCSLCY
FT                   FSFF"
FT   gene            complement(1779486..1780231)
FT                   /locus_tag="VIT_17s0000g09590"
FT                   /old_locus_tag="Vv17s0000g09590"
FT   mRNA            complement(join(1779486..1779978,1780032..1780102,
FT                   1780103..1780231))
FT                   /locus_tag="VIT_17s0000g09590"
FT                   /old_locus_tag="Vv17s0000g09590"
FT   CDS_pept        complement(join(1779486..1779978,1780032..1780102))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09590"
FT                   /old_locus_tag="Vv17s0000g09590"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHF9"
FT                   /protein_id="CBI14918.3"
FT                   /translation="MGLGLYPKPNILTMGKPEMDPKLGLIFFTNSRLEVTLRRSSCRRR
FT                   HQEALPPSPTTGAAVHLVGAMHGEPRAGVGENRLATSRRDCCCWGGGAGEEGSCGGGLV
FT                   VFRRCRRQWLLVQARALPEQVAAAWRRPEGAAAIGDWCTRAHSRCRKTRGGAACMAPMQ
FT                   VGERLRGSYGGALGAGMARCRYEG"
FT   5'UTR           complement(1780103..1780231)
FT                   /locus_tag="VIT_17s0000g09590"
FT                   /old_locus_tag="Vv17s0000g09590"
FT   gene            complement(1815048..1817065)
FT                   /locus_tag="VIT_17s0000g09570"
FT                   /old_locus_tag="Vv17s0000g09570"
FT   mRNA            complement(join(1815048..1815094,1815095..1815706,
FT                   1816136..1817065))
FT                   /locus_tag="VIT_17s0000g09570"
FT                   /old_locus_tag="Vv17s0000g09570"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(1815048..1815094)
FT                   /locus_tag="VIT_17s0000g09570"
FT                   /old_locus_tag="Vv17s0000g09570"
FT   CDS_pept        complement(join(1815095..1815706,1816136..1817065))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09570"
FT                   /old_locus_tag="Vv17s0000g09570"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTQ8"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTQ8"
FT                   /protein_id="CCB42924.1"
FT                   /translation="MGSFLDLLYKENASFFLLFLPFFVFIYFLIKWLYPTTPAVTTKRL
FT                   PPSPPKLPIIGNLHQLGLLPHRSLWALAQRHGPIMLLHFGKVPVVIVSAADAAREIMKT
FT                   NDVIFLNRPKSSIFAKLLYDYKDVSMAPYGEYWRQMRSICVLHLLSNRRVQSFRGVREE
FT                   ETALLMEKISSSSSSSTPIDLSKMFLSLTNDLICRVALGRKYSGDETGRKYRELLKEFV
FT                   GLLGGFDVADYIPWLSWVNFINGLDAKVEKVAKEFDRFLDEVVKEHVERRKRGVDEEVK
FT                   DFVDVLLGIQEDNVTGVAITGVCIKALTLDMFAAGSDTTYTVLEWAMTELLRHPQVMRQ
FT                   LQNEVRGIAQGKLLITEDDLDKMQYLKAVIKETLRLHPPVPLLLPRESTRGAKIMGYDI
FT                   EVGTQVITNAWAIGRDPLLWDEAEEFRPERFLNSSIDFTGKDFELIPFGAGRRGCPGTL
FT                   FAAMAIEVALANLVHQFDWEVGGGGRREDLDMTECTGLTIHRKVPLLAVATPWPR"
FT   gap             1853422..1853521
FT                   /estimated_length=100
FT   gap             1860984..1861569
FT                   /estimated_length=586
FT   gap             1869118..1870262
FT                   /estimated_length=1145
FT   gene            complement(1897520..1899312)
FT                   /locus_tag="VIT_17s0000g09550"
FT                   /old_locus_tag="Vv17s0000g09550"
FT   mRNA            complement(join(1897520..1897617,1897757..1898309,
FT                   1898701..1898925,1898926..1899312))
FT                   /locus_tag="VIT_17s0000g09550"
FT                   /old_locus_tag="Vv17s0000g09550"
FT                   /product="unknown predicted protein"
FT   CDS_pept        complement(join(1897520..1897617,1897757..1898309,
FT                   1898701..1898925))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09550"
FT                   /old_locus_tag="Vv17s0000g09550"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTQ9"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTQ9"
FT                   /protein_id="CCB42925.1"
FT                   /translation="MASWVNFINGLDAKVEKVAKEFDRFLDEVVKEHVERRKRGVDEEV
FT                   KDFVDVLLGIQEDNVTGVAITGVCIKALTLDMFAAGSDTTYTVLEWAMTELLRHPQVMR
FT                   QLQNEVRGIAQGKLLITEDDLDKMQYLKAVIKETLRLYPPIPLLVPRESTRDAKIMGYD
FT                   IAARTQVITNVWAIGRDPLLWDEAEEFRPERFLNSSIDFRGQDFELIPFGSGRRGCPGT
FT                   LFAAMAIEVVLANLVHRFDWEVGGGGRREDLDMTECTEFFSSVFIPRIIINILLICALI
FT                   LYSKIIFKML"
FT   5'UTR           complement(1898926..1899312)
FT                   /locus_tag="VIT_17s0000g09550"
FT                   /old_locus_tag="Vv17s0000g09550"
FT   gene            complement(1899313..1899798)
FT                   /locus_tag="VIT_17s0000g09540"
FT                   /old_locus_tag="Vv17s0000g09540"
FT   mRNA            complement(join(1899313..1899537,1899538..1899798))
FT                   /locus_tag="VIT_17s0000g09540"
FT                   /old_locus_tag="Vv17s0000g09540"
FT   CDS_pept        complement(1899313..1899537)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09540"
FT                   /old_locus_tag="Vv17s0000g09540"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTR0"
FT                   /protein_id="CCB42926.1"
FT                   /translation="MAISYYSCSHHKKVTSFPTKAPNHWKPPPTRLAPSPFSLGLGSAP
FT                   WPPYAAPLWQGSSGHRLSCRRCKRDHEDQ"
FT   5'UTR           complement(1899538..1899798)
FT                   /locus_tag="VIT_17s0000g09540"
FT                   /old_locus_tag="Vv17s0000g09540"
FT   gene            complement(1919191..1919732)
FT                   /locus_tag="VIT_17s0000g09530"
FT                   /old_locus_tag="Vv17s0000g09530"
FT   mRNA            complement(join(1919191..1919215,1919644..1919732))
FT                   /locus_tag="VIT_17s0000g09530"
FT                   /old_locus_tag="Vv17s0000g09530"
FT   CDS_pept        complement(join(1919191..1919215,1919644..1919732))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09530"
FT                   /old_locus_tag="Vv17s0000g09530"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHG4"
FT                   /protein_id="CBI14923.3"
FT                   /translation="MIIDTQKVQDINSLSRLEYSKRFMGSYGCLIYIIFNV"
FT   gene            complement(1919734..1920046)
FT                   /locus_tag="VIT_17s0000g09520"
FT                   /old_locus_tag="Vv17s0000g09520"
FT   mRNA            complement(join(1919734..1919803,1920024..1920046))
FT                   /locus_tag="VIT_17s0000g09520"
FT                   /old_locus_tag="Vv17s0000g09520"
FT   CDS_pept        complement(join(1919734..1919803,1920024..1920046))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09520"
FT                   /old_locus_tag="Vv17s0000g09520"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHG5"
FT                   /protein_id="CBI14924.3"
FT                   /translation="MRYCSFSIMKFADIIIILSRIDIIMGEVDC"
FT   gene            1920532..1922409
FT                   /locus_tag="VIT_17s0000g09510"
FT                   /old_locus_tag="Vv17s0000g09510"
FT   mRNA            join(1920532..1920627,1920628..1921392,1921801..1922409)
FT                   /locus_tag="VIT_17s0000g09510"
FT                   /old_locus_tag="Vv17s0000g09510"
FT                   /product="unknown predicted protein"
FT   5'UTR           1920532..1920627
FT                   /locus_tag="VIT_17s0000g09510"
FT                   /old_locus_tag="Vv17s0000g09510"
FT   CDS_pept        join(1920628..1921392,1921801..1922409)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09510"
FT                   /old_locus_tag="Vv17s0000g09510"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHG6"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHG6"
FT                   /protein_id="CBI14925.3"
FT                   /translation="MHQLGIYPYRSLLCLARCYGPLMLLQLGRVRTLVVSSPDAAQEIM
FT                   KTHDLIFANRPKMSLGKRLLYDYKDVSVAPYGEYWRQMRSICVLHLLSNKRVQSFNTVR
FT                   REEISLLIQKIEEFSSLSTSMDLSGMFMRLTNDVICRVAFGRKYSGDERGKKFRRLLGE
FT                   FVELLGGFNVGDYIPWLAWVEYVNGWSAKVERVAKEFDEFLDGVVEEHLDGGTGSIAKG
FT                   DNEKDFVDVLLEIQRDGTLGFSMDRDSIKALILDIFAGGTDTTYTVLEWAMTELLRHPK
FT                   AMKELQNEVRGITRGKEHITEDDLEKMHYLKAVIKETLRLHPPIPLLVPRESSQDVNIM
FT                   GYHIPAGTMVIINAWAIGRDPMSWDEPEEFRPERFLNTNIDFKGHDFELIPFGAGRRGC
FT                   PGISFAMATNELVLANLVNKFDWALPDGARAEDLDMTECTGLTIHRKFPLLAVSTPCF"
FT   gene            1925308..1929557
FT                   /locus_tag="VIT_17s0000g09500"
FT                   /old_locus_tag="Vv17s0000g09500"
FT   mRNA            join(1925308..1925308,1925309..1925413,1926436..1926628,
FT                   1927125..1927151,1927246..1927399,1927505..1927553,
FT                   1927651..1927765,1928073..1928164,1928277..1928433,
FT                   1928602..1928666,1928759..1928856,1928972..1929074,
FT                   1929195..1929344,1929345..1929557)
FT                   /locus_tag="VIT_17s0000g09500"
FT                   /old_locus_tag="Vv17s0000g09500"
FT                   /product="unknown predicted protein"
FT   5'UTR           1925308..1925308
FT                   /locus_tag="VIT_17s0000g09500"
FT                   /old_locus_tag="Vv17s0000g09500"
FT   CDS_pept        join(1925309..1925413,1926436..1926628,1927125..1927151,
FT                   1927246..1927399,1927505..1927553,1927651..1927765,
FT                   1928073..1928164,1928277..1928433,1928602..1928666,
FT                   1928759..1928856,1928972..1929074,1929195..1929344)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09500"
FT                   /old_locus_tag="Vv17s0000g09500"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHG7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHG7"
FT                   /protein_id="CBI14926.3"
FT                   /translation="MEMVERVTEFPHTHMDRRPRKRPRLGWDVLPQAPKAQLGMFCGQE
FT                   VGNVASFAPSKAHSDQTTSSMFVKGVARNGSPPWREDDKDGHYIFALGENLTSRYKINS
FT                   KMGEGTFGQVLECWDRERKEMVAVKIVRGIKKYREAAMIEIEVLQQLAKHDKGGNRCVQ
FT                   IRNWFDYRNHICIVFEKLGPSLYDFLRKNNYRSFPIDLVREIGRQLLECVAFMHDLRLI
FT                   HTDLKPENILLVSPEYVKVPDYKVSSRSPKDGSYFKRVPKSSAIKVIDFGSTTYERQDQ
FT                   NYIVSTRHYRAPEVILGLGWSYPCDIWSVGCILVELCTGEALFQTHENLEHLAMMERVL
FT                   GPLPQHMLKRVDRHAEKYVRRGRLDWPEGATSRESIKAVLKLPRLQNLIMQHVDHSAGD
FT                   LIHLLQGLLRYDPSDRLTALGALRHPFFTRDHLRRS"
FT   3'UTR           1929345..1929557
FT                   /locus_tag="VIT_17s0000g09500"
FT                   /old_locus_tag="Vv17s0000g09500"
FT   gene            1942569..1948275
FT                   /locus_tag="VIT_17s0000g09490"
FT                   /old_locus_tag="Vv17s0000g09490"
FT   mRNA            join(1942569..1942697,1942698..1943063,1943849..1944133,
FT                   1945316..1945534,1945696..1945875,1946560..1947072,
FT                   1947710..1947871,1947965..1948045,1948046..1948275)
FT                   /locus_tag="VIT_17s0000g09490"
FT                   /old_locus_tag="Vv17s0000g09490"
FT                   /product="Predicted protein"
FT   5'UTR           1942569..1942697
FT                   /locus_tag="VIT_17s0000g09490"
FT                   /old_locus_tag="Vv17s0000g09490"
FT   CDS_pept        join(1942698..1943063,1943849..1944133,1945316..1945534,
FT                   1945696..1945875,1946560..1947072,1947710..1947871,
FT                   1947965..1948045)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09490"
FT                   /old_locus_tag="Vv17s0000g09490"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHG8"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHG8"
FT                   /protein_id="CBI14927.3"
FT                   /translation="MGCTAQVWLEVKMDGEGRMRFAADSDSEITKGFCSCLIWVLDGAA
FT                   PEEVLALKTDDLAALNVGLPGAGHSRVNTWHNVLIVMHKRTKALVAERAGKPRADPFPS
FT                   LVINADGIHAKGSYAEAQARFLFPEELKVKELVNVLKEKKIGVVAHFYMDPEVQGVLTA
FT                   AQKEWPHIYISDSLIMADMAVKMAKAGCQFIAVLGVDFMAENVRAILDQAGFGEVGVYR
FT                   MSNERIGCSLADAAATPAYMNYLEAASASPPALHVVYINTSLETKAYAHELVPTITCTS
FT                   SNVVQTILQAFAQVPNLNIWYGPDTYMGANIRELLQQMTTMTDEEIAVIHPQHNRDSIK
FT                   SLLSHLHYYQDGTCIVHHLFGHEVVEKINEMYCDAFLTAHLEVPGEMFSLAMEAKRRGT
FT                   GVVGSTQNILDFIKQRVQESLDKNRNDHLQFVLGTESGMVTSIVAAVRTLLGSAKSSSG
FT                   SADVTVEIVFPVSSESLTKTSSNSYLGRNSAEMGGFILPVIPGVASGEGCSIHGGCASC
FT                   PYMKMNSLSSLLKVCHHLPHEKEVLSDYEAGRFHLQTPNGNSIADVGCEPILNMRHFQA
FT                   TKELPEKLVSQILHSHSNGRSTSIS"
FT   3'UTR           1948046..1948275
FT                   /locus_tag="VIT_17s0000g09490"
FT                   /old_locus_tag="Vv17s0000g09490"
FT   gene            1962824..1964146
FT                   /locus_tag="VIT_17s0000g09480"
FT                   /old_locus_tag="Vv17s0000g09480"
FT   mRNA            join(1962824..1962841,1962842..1963804,1963805..1964146)
FT                   /locus_tag="VIT_17s0000g09480"
FT                   /old_locus_tag="Vv17s0000g09480"
FT                   /product="unknown predicted protein"
FT   5'UTR           1962824..1962841
FT                   /locus_tag="VIT_17s0000g09480"
FT                   /old_locus_tag="Vv17s0000g09480"
FT   CDS_pept        1962842..1963804
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09480"
FT                   /old_locus_tag="Vv17s0000g09480"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHG9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041869"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHG9"
FT                   /protein_id="CBI14928.3"
FT                   /translation="MGSANGLVSVQGKQPLFSFGVISDVQYADIPNGQSFMGVPRYYRH
FT                   SIHVLQRAVQKWNNLQKLKFVVNFGDIVDGFCPKDQSLNAVQKIVDEFKNFDGPSYHMI
FT                   GNHCLYNLPRNMLLPLLNIPSFEDRAYYDFSPTPTYRFVVLDGYDISAIGWPSDHPKTL
FT                   EALKFLREKNPNLDKNSPVGLVGLERRFLMFNGAVGKEQMEWLDCVLQDATKLKQKVVV
FT                   CCHLPLDPGTLSPEALLWNYDEVMDVIHKYNCVKVCLSGHDHKGGHSIDSHGIHHRVLE
FT                   AALECPPGSDAFGYIDVYDDRLTLSGTDRMESTDMIFNP"
FT   3'UTR           1963805..1964146
FT                   /locus_tag="VIT_17s0000g09480"
FT                   /old_locus_tag="Vv17s0000g09480"
FT   gene            complement(1964466..1966075)
FT                   /locus_tag="VIT_17s0000g09470"
FT                   /old_locus_tag="Vv17s0000g09470"
FT   mRNA            complement(join(1964466..1964708,1964709..1965187,
FT                   1965842..1965968,1965969..1966075))
FT                   /locus_tag="VIT_17s0000g09470"
FT                   /old_locus_tag="Vv17s0000g09470"
FT                   /product="Predicted protein"
FT   3'UTR           complement(1964466..1964708)
FT                   /locus_tag="VIT_17s0000g09470"
FT                   /old_locus_tag="Vv17s0000g09470"
FT   CDS_pept        complement(join(1964709..1965187,1965842..1965968))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09470"
FT                   /old_locus_tag="Vv17s0000g09470"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHH0"
FT                   /db_xref="InterPro:IPR016605"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHH0"
FT                   /protein_id="CBI14929.3"
FT                   /translation="MATRAFLLTSLLLSCLLQICSGAYFSSLQRTLIVTASPKAGEVLK
FT                   SGEDKITVTWGLNQSYPAGTDSAYKTVKVKLCYAPISQVDRAWRKTVDHLTKDKTCQHK
FT                   IVSQPYKASNNSVEWTIEKDVPTATYFIRAYAYDAEDQEVAYGQTTDAHKTTNLFGIEA
FT                   ITGRHASLDIAAVCFSAFSVVSLCGFFWVEKRKSRVAK"
FT   5'UTR           complement(1965969..1966075)
FT                   /locus_tag="VIT_17s0000g09470"
FT                   /old_locus_tag="Vv17s0000g09470"
FT   gap             1975671..1975770
FT                   /estimated_length=100
FT   gene            complement(1977687..1979248)
FT                   /locus_tag="VIT_17s0000g09450"
FT                   /old_locus_tag="Vv17s0000g09450"
FT   mRNA            complement(join(1977687..1978129,1978130..1978242,
FT                   1978314..1978424,1978805..1978922,1979003..1979011,
FT                   1979012..1979248))
FT                   /locus_tag="VIT_17s0000g09450"
FT                   /old_locus_tag="Vv17s0000g09450"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(1977687..1978129)
FT                   /locus_tag="VIT_17s0000g09450"
FT                   /old_locus_tag="Vv17s0000g09450"
FT   CDS_pept        complement(join(1978130..1978242,1978314..1978424,
FT                   1978805..1978922,1979003..1979011))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09450"
FT                   /old_locus_tag="Vv17s0000g09450"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHH2"
FT                   /protein_id="CBI14931.3"
FT                   /translation="MQQLYGLRAIFLPGSDSRSGSCGTGVFFPRGTGNPLDSRKKQGVS
FT                   TALIPARVAQALKLNFDEMGVVSPSLGGRFSLQHDAAPGRRNSLYPPQKQHWPAPPAMK
FT                   HQEMDVPRGWTH"
FT   5'UTR           complement(1979012..1979248)
FT                   /locus_tag="VIT_17s0000g09450"
FT                   /old_locus_tag="Vv17s0000g09450"
FT   gap             1993494..1993593
FT                   /estimated_length=100
FT   gap             2031716..2031843
FT                   /estimated_length=128
FT   gap             2039982..2041190
FT                   /estimated_length=1209
FT   gap             2064561..2064660
FT                   /estimated_length=100
FT   gene            2079855..2082263
FT                   /locus_tag="VIT_17s0000g09420"
FT                   /old_locus_tag="Vv17s0000g09420"
FT   mRNA            join(2079855..2079956,2079957..2080055,2080766..2080846,
FT                   2080960..2081046,2081203..2081335,2081431..2081502,
FT                   2081906..2082055,2082235..2082263)
FT                   /locus_tag="VIT_17s0000g09420"
FT                   /old_locus_tag="Vv17s0000g09420"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           2079855..2079956
FT                   /locus_tag="VIT_17s0000g09420"
FT                   /old_locus_tag="Vv17s0000g09420"
FT   CDS_pept        join(2079957..2080055,2080766..2080846,2080960..2081046,
FT                   2081203..2081335,2081431..2081502,2081906..2082055,
FT                   2082235..2082263)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09420"
FT                   /old_locus_tag="Vv17s0000g09420"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTR1"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTR1"
FT                   /protein_id="CCB42927.1"
FT                   /translation="MNVRRGNMWKLLRAAWLFHHIGIDATSLLFSDEVDLENLMMAKQL
FT                   SILVVGQDVLRTNGEVGSQCTILTDNYCEDAYDLLQIPVLKNLLLAGILLDTRNLNASA
FT                   KLSMARDAEAVQLLLVGSAPNHRNTLFDQLMQDQRDNSFFEALRHNYGKPPNENGRDSG
FT                   VLVEHTVLERKSTSISRNEAITQNAYRNSNDVKSAKPSRVSPKSAIIEVQGPQ"
FT   gene            2086331..2087847
FT                   /locus_tag="VIT_17s0000g09410"
FT                   /old_locus_tag="Vv17s0000g09410"
FT   mRNA            join(2086331..2086996,2086997..2087093,2087346..2087467,
FT                   2087468..2087847)
FT                   /locus_tag="VIT_17s0000g09410"
FT                   /old_locus_tag="Vv17s0000g09410"
FT   5'UTR           2086331..2086996
FT                   /locus_tag="VIT_17s0000g09410"
FT                   /old_locus_tag="Vv17s0000g09410"
FT   CDS_pept        join(2086997..2087093,2087346..2087467)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09410"
FT                   /old_locus_tag="Vv17s0000g09410"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHH7"
FT                   /protein_id="CBI14937.3"
FT                   /translation="MHFGHHSLSLSSCCNLLLCLFLDQLLSLGVDASKPKSSTVQAPTV
FT                   APAEAAPNSSGGKNKFFLAKWFGFGSK"
FT   3'UTR           2087468..2087847
FT                   /locus_tag="VIT_17s0000g09410"
FT                   /old_locus_tag="Vv17s0000g09410"
FT   gene            complement(2088251..2089861)
FT                   /locus_tag="VIT_17s0000g09400"
FT                   /old_locus_tag="Vv17s0000g09400"
FT   mRNA            complement(join(2088251..2088752,2088753..2089742,
FT                   2089743..2089861))
FT                   /locus_tag="VIT_17s0000g09400"
FT                   /old_locus_tag="Vv17s0000g09400"
FT                   /product="Predicted protein"
FT   3'UTR           complement(2088251..2088752)
FT                   /locus_tag="VIT_17s0000g09400"
FT                   /old_locus_tag="Vv17s0000g09400"
FT   CDS_pept        complement(2088753..2089742)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09400"
FT                   /old_locus_tag="Vv17s0000g09400"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR008586"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTR2"
FT                   /protein_id="CCB42928.1"
FT                   /translation="MQDPIGIPACFSSVEKQTDDPAAVTRSGQSVFMYVYRTKIADQCR
FT                   LITITWCKNLLLHGLSVAVEGPDGESQYTCKVELKPWYFWRKQGSKRFVVDDKPVDIFW
FT                   DLKAAKFNGETEPSSEYYVAVVCNEEVVLLLGDLKKDAYRKTGCRPALIDPILVSKKEH
FT                   IFGKKKFSTKAKFHERGRFHDISIECKNRSGGSGGSMGNGNSCGRVDPEMEIRIDGHLV
FT                   IHVKHLQWKFRGNESIHVNKLRVEVYWDVHDWLFSPGLRHALFIFKPLMSSTSPTSISI
FT                   STSSSLPLSSLTSTTPLSSQTGSCDAAEGFNAGGSSEFCLFLYAWKVE"
FT   5'UTR           complement(2089743..2089861)
FT                   /locus_tag="VIT_17s0000g09400"
FT                   /old_locus_tag="Vv17s0000g09400"
FT   gap             2097072..2097205
FT                   /estimated_length=134
FT   gene            2115560..2119257
FT                   /locus_tag="VIT_17s0000g09390"
FT                   /old_locus_tag="Vv17s0000g09390"
FT   mRNA            join(2115560..2115618,2115750..2115753,2115754..2115921,
FT                   2116518..2116757,2116862..2116948,2117076..2117209,
FT                   2118914..2119016,2119017..2119257)
FT                   /locus_tag="VIT_17s0000g09390"
FT                   /old_locus_tag="Vv17s0000g09390"
FT                   /product="unknown predicted protein"
FT   5'UTR           2115560..2115618
FT                   /locus_tag="VIT_17s0000g09390"
FT                   /old_locus_tag="Vv17s0000g09390"
FT   CDS_pept        join(2115754..2115921,2116518..2116757,2116862..2116948,
FT                   2117076..2117209,2118914..2119016)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09390"
FT                   /old_locus_tag="Vv17s0000g09390"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTR3"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTR3"
FT                   /protein_id="CCB42929.1"
FT                   /translation="MQSFRGGIRSKIVHFKLATRLCSFETNDGVVAVANLCGKSFDSSI
FT                   RKFTSRSSLPLQSKFGSQAEFFTPSGSLLDRSSRSGLFQWTAAMPTFPSRCITTTVNPI
FT                   SASQDSSAAPVSDLAPRIKFKRLDKTSKHIMQILDKEAVEEVRAKREIPEIKPGYIVQL
FT                   KVEVPENKRRTSVLKGIVIARRNAGLNTTFRLRRLVAGVGVESLFPLYSPSIKEIKVLD
FT                   KKKVRRAKLYYLRDKMNALRK"
FT   3'UTR           2119017..2119257
FT                   /locus_tag="VIT_17s0000g09390"
FT                   /old_locus_tag="Vv17s0000g09390"
FT   gene            2121559..2135701
FT                   /locus_tag="VIT_17s0000g09380"
FT                   /old_locus_tag="Vv17s0000g09380"
FT   mRNA            join(2121559..2121632,2121633..2121719,2121939..2121976,
FT                   2122130..2122357,2122453..2122676,2122787..2122944,
FT                   2133755..2133938,2134016..2134150,2134260..2135215,
FT                   2135216..2135701)
FT                   /locus_tag="VIT_17s0000g09380"
FT                   /old_locus_tag="Vv17s0000g09380"
FT                   /product="Predicted protein"
FT   5'UTR           2121559..2121632
FT                   /locus_tag="VIT_17s0000g09380"
FT                   /old_locus_tag="Vv17s0000g09380"
FT   CDS_pept        join(2121633..2121719,2121939..2121976,2122130..2122357,
FT                   2122453..2122676,2122787..2122944,2133755..2133938,
FT                   2134016..2134150,2134260..2135215)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09380"
FT                   /old_locus_tag="Vv17s0000g09380"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTR4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR024678"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTR4"
FT                   /protein_id="CCB42930.1"
FT                   /translation="MPQVLSSEQDPDDPDTEFVEIDPTGRYGRYKEVLGKGAFKKVYRA
FT                   FDELEGIEVAWNQVKVADLLRNSEEFERLYSEVHLLKTLKHKNIIKFYISWVDTRNENI
FT                   NFITEIFTSGTLRQYRKKHKHVDLRALKKWSRQILEGLLYLHSHDPPVIHRDLKCDNIF
FT                   VNGNQGEVKIGDLGLAAILRQARSAHSVIGTPEFMAPELYEEEYNELVDIYAFGMCLLE
FT                   LVTFEYPYVECANAAQIYKKVTSGIKPASLAKVKDPRVRAFIDKCIANVSDRLSAKELL
FT                   RDPFLQSDEENGSVGRSLQPHPHHSGSHDHFNTGTSSKVSLPESSRDFKVQGQRRDVNT
FT                   IFLKLRIADSKGHIRNIHFPFDIGADTAISVAGEMVEELDLTDQDVSTIAAMIDSEIRS
FT                   IISDWPPSREVFGDNLSTEVAISDICPPESEGDALPLMNESATSSCGLVLERLPSGRRY
FT                   WSDSPKAVGGNSPIRPAFSNLSSQVDSVTTEGRFSELNEQSLASPRDGDKLNTAASLDK
FT                   REDERVCGDDDVEEKEASISAETQFSDQNDVAVELLGGYRAPSWGGNCKILRETELGDA
FT                   KVIVEKLKHLFVKQQKELDELKRKHELAILDLVKELPPDIRNKVSSLCNLKISGSFSKM
FT                   EPMSSEVSNLAVYNNLDTYSIGPTNVKLSLPKKG"
FT   3'UTR           2135216..2135701
FT                   /locus_tag="VIT_17s0000g09380"
FT                   /old_locus_tag="Vv17s0000g09380"
FT   gene            2142756..2144354
FT                   /locus_tag="VIT_17s0000g09370"
FT                   /old_locus_tag="Vv17s0000g09370"
FT   mRNA            join(2142756..2142815,2142816..2144276,2144277..2144354)
FT                   /locus_tag="VIT_17s0000g09370"
FT                   /old_locus_tag="Vv17s0000g09370"
FT                   /product="unknown predicted protein"
FT   5'UTR           2142756..2142815
FT                   /locus_tag="VIT_17s0000g09370"
FT                   /old_locus_tag="Vv17s0000g09370"
FT   CDS_pept        2142816..2144276
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09370"
FT                   /old_locus_tag="Vv17s0000g09370"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTR5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTR5"
FT                   /protein_id="CCB42931.1"
FT                   /translation="MAISATSASASTKLIYPSPPPSSPSSSTTLALCTPSPRTRKHPSN
FT                   LSSSFLSKPSTTFLLTPTTTATTTQRRSFTVRAARGKFERNKPHLNIGTIGHVDHGKTT
FT                   LTAALTMALAAMGNSAPKKYDEIDAAPEERARGITINTATVEYETENRHYAHVDCPGHA
FT                   DYVKNMITGAAQMDGAILVVSGADGPMPQTKEHILLAKQVGVPNMVVFLNKQDQVDDEE
FT                   LLQLVELEVRELLSSYEFPGDDVPIISGSALLALEALMANPSIKRGENQWVDKIYELMD
FT                   SVDSYIPIPQRQTDLPFLLAIEDVFSITGRGTVATGRVERGTIKVGETVDIVGLKDTRS
FT                   TTVTGVEMFQKILDEALAGDNVGILLRGVQKADIQRGMVLAKPGTITPHTKFAAIVYVL
FT                   KKEEGGRHSPFFAGYRPQFYMRTTDVTGKVTSIMNDKDEESKMVMPGDRVKMVVELIMP
FT                   VACEQGMRFAIREGGKTVGAGVIQSIIE"
FT   3'UTR           2144277..2144354
FT                   /locus_tag="VIT_17s0000g09370"
FT                   /old_locus_tag="Vv17s0000g09370"
FT   gene            2144355..2144514
FT                   /locus_tag="VIT_17s0000g09360"
FT                   /old_locus_tag="Vv17s0000g09360"
FT   mRNA            join(2144355..2144392,2144444..2144447,2144485..2144508,
FT                   2144509..2144514)
FT                   /locus_tag="VIT_17s0000g09360"
FT                   /old_locus_tag="Vv17s0000g09360"
FT   CDS_pept        join(2144355..2144392,2144444..2144447,2144485..2144508)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09360"
FT                   /old_locus_tag="Vv17s0000g09360"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTR6"
FT                   /protein_id="CCB42932.1"
FT                   /translation="MHLVPPFYGSSRILLCCFSCC"
FT   3'UTR           2144509..2144514
FT                   /locus_tag="VIT_17s0000g09360"
FT                   /old_locus_tag="Vv17s0000g09360"
FT   gene            complement(2147097..2153038)
FT                   /locus_tag="VIT_17s0000g09350"
FT                   /old_locus_tag="Vv17s0000g09350"
FT   mRNA            complement(join(2147097..2147437,2147438..2147540,
FT                   2149212..2149417,2149497..2149574,2149962..2150077,
FT                   2152808..2152883,2152884..2153038))
FT                   /locus_tag="VIT_17s0000g09350"
FT                   /old_locus_tag="Vv17s0000g09350"
FT                   /product="Predicted protein"
FT   3'UTR           complement(2147097..2147437)
FT                   /locus_tag="VIT_17s0000g09350"
FT                   /old_locus_tag="Vv17s0000g09350"
FT   CDS_pept        complement(join(2147438..2147540,2149212..2149417,
FT                   2149497..2149574,2149962..2150077,2152808..2152883))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09350"
FT                   /old_locus_tag="Vv17s0000g09350"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR008598"
FT                   /db_xref="InterPro:IPR027935"
FT                   /db_xref="InterPro:IPR033347"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHI3"
FT                   /protein_id="CBI14943.3"
FT                   /translation="MDDFWASRVHSAKHLTAVQAARLNSEGDDDARAYFPCPFCYVDIE
FT                   IPVLCSHLQEEHCFDLKNAVCPLCAANLGKDVIGHFTLQHAHSLKRRRKSQKSGAWTNS
FT                   PLRELSSFLGSRGNSYESAPDPLLSPFLCSISVSDGNQQDKCSSDNASFASDMKSTVPS
FT                   TPSEGQEQDYEERQQRAIFVQQLIGSTIF"
FT   5'UTR           complement(2152884..2153038)
FT                   /locus_tag="VIT_17s0000g09350"
FT                   /old_locus_tag="Vv17s0000g09350"
FT   gene            complement(2189916..2190172)
FT                   /locus_tag="VIT_17s0000g09340"
FT                   /old_locus_tag="Vv17s0000g09340"
FT   mRNA            complement(join(2189916..2189993,2190074..2190133,
FT                   2190134..2190172))
FT                   /locus_tag="VIT_17s0000g09340"
FT                   /old_locus_tag="Vv17s0000g09340"
FT   CDS_pept        complement(join(2189916..2189993,2190074..2190133))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09340"
FT                   /old_locus_tag="Vv17s0000g09340"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHI4"
FT                   /protein_id="CBI14944.3"
FT                   /translation="MREYKIRVSTECVRPPQCHTYIYVHFPLLPSLKQDSSYLLRHVGI
FT                   "
FT   5'UTR           complement(2190134..2190172)
FT                   /locus_tag="VIT_17s0000g09340"
FT                   /old_locus_tag="Vv17s0000g09340"
FT   gene            2206298..2208479
FT                   /locus_tag="VIT_17s0000g09330"
FT                   /old_locus_tag="Vv17s0000g09330"
FT   mRNA            join(2206298..2206363,2206364..2206456,2206556..2208259,
FT                   2208260..2208479)
FT                   /locus_tag="VIT_17s0000g09330"
FT                   /old_locus_tag="Vv17s0000g09330"
FT                   /product="unknown predicted protein"
FT   5'UTR           2206298..2206363
FT                   /locus_tag="VIT_17s0000g09330"
FT                   /old_locus_tag="Vv17s0000g09330"
FT   CDS_pept        join(2206364..2206456,2206556..2208259)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09330"
FT                   /old_locus_tag="Vv17s0000g09330"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTR7"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTR7"
FT                   /protein_id="CCB42933.1"
FT                   /translation="MNRAKAILFSIRFTNSFRSTQFRRASSLCYQPNSIVELVLENDWS
FT                   DELESELEKSSSVLTHETVIYVLKKLDKDPQRTWNFFNWVTEKNGFRPSSAMYSLILRS
FT                   LVHGESMKQFWVTIRKMKEQGFCIDKETYLTILGVFKKGKMASEEVALTHFYNRMVQEN
FT                   AMDEVVKKVVELVTMSVWSSEVEKKLGELKNSFSDNFVLHVLRELRGYPLKALRFFQWV
FT                   GECPGYEHSSITYNVIARVLGRDDSIGEFWSMVEEMKSKGHEMDIDTYIKISRQFQKNK
FT                   MLEDAVKLYEIMMDGPYKPSVQDCTMLLRSISLSSNPDLALVFRVTEKYEAVGNSLCKA
FT                   VYDGIHRSLTSVGRFDEAGKIMESMRSAGCEPDNITYSQLVYGLCKARKLEEACKLLDE
FT                   MEACGCVPDIKTWTILIQGHCAAKEVDKALICFAKMMEKNCDADADLLEVLINGFLSQK
FT                   RIDGAYKLLVEMVNTAHLVPWQATYKLMINKLLGVRKLEEAINLLHLMKKQNYPPFPEP
FT                   FIEYISKFGTVEDAGEFLNALSAKKYPSQSAYVHVFESFFQEGRESEAKDLLYKCPHHI
FT                   RKHPDICKLFGSAKSEYATEKR"
FT   3'UTR           2208260..2208479
FT                   /locus_tag="VIT_17s0000g09330"
FT                   /old_locus_tag="Vv17s0000g09330"
FT   gene            complement(2209194..2216386)
FT                   /locus_tag="VIT_17s0000g09320"
FT                   /old_locus_tag="Vv17s0000g09320"
FT   mRNA            complement(join(2209194..2209318,2209319..2209465,
FT                   2209567..2209692,2209836..2209963,2211632..2211722,
FT                   2211915..2211985,2212079..2212148,2212414..2212489,
FT                   2212612..2212701,2214910..2215014,2215086..2215189,
FT                   2215492..2215559,2215646..2215752,2216046..2216109,
FT                   2216189..2216309,2216310..2216386))
FT                   /locus_tag="VIT_17s0000g09320"
FT                   /old_locus_tag="Vv17s0000g09320"
FT                   /product="Predicted protein"
FT   3'UTR           complement(2209194..2209318)
FT                   /locus_tag="VIT_17s0000g09320"
FT                   /old_locus_tag="Vv17s0000g09320"
FT   CDS_pept        complement(join(2209319..2209465,2209567..2209692,
FT                   2209836..2209963,2211632..2211722,2211915..2211985,
FT                   2212079..2212148,2212414..2212489,2212612..2212701,
FT                   2214910..2215014,2215086..2215189,2215492..2215559,
FT                   2215646..2215752,2216046..2216109,2216189..2216309))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09320"
FT                   /old_locus_tag="Vv17s0000g09320"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHI6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHI6"
FT                   /protein_id="CBI14946.3"
FT                   /translation="MSEPMEISLQNATVGDSSDQNGVSESIPSPILTQEKVLVSVEVCL
FT                   KASSTARSDDVRSAVERMLENRSLSYTDGSVPVSLDDPFLVENVQRICICETDEWVEKH
FT                   DVLLFWQVKPVVHVFQLSEEGPCEESSGDGQLSIFNEWILPAKEFDGLWESLIYEPGLK
FT                   QRLLRYAASALLFTEKGVNPFLVSWNRIILLHGPPGTGKTSLCKALAQKLSIRFNTRYP
FT                   QCQLVEVNAHSLFSKWFSESGKLVAKLFQKIQEMVEEETNLVFVLIDEVESLAAARKAA
FT                   LSGSEPSDSIRVVNALLTQLDKLKSSPNVIILTTSNITAAIDIAFVDRADIKAYVGPPT
FT                   IHARYEILRSCLQELVRAGILTNSQECDRLSLLSYTGLKEKLNVAQIEEPGNSHLCKQL
FT                   LEAAEACEGLSGRSLRKLPFLAHAALANPYSCDPSKFLCTMTDTAKRECAGLLSES"
FT   5'UTR           complement(2216310..2216386)
FT                   /locus_tag="VIT_17s0000g09320"
FT                   /old_locus_tag="Vv17s0000g09320"
FT   gene            complement(2218207..2220117)
FT                   /locus_tag="VIT_17s0000g09310"
FT                   /old_locus_tag="Vv17s0000g09310"
FT   mRNA            complement(join(2218207..2218549,2219636..2219705,
FT                   2219811..2220117))
FT                   /locus_tag="VIT_17s0000g09310"
FT                   /old_locus_tag="Vv17s0000g09310"
FT   CDS_pept        complement(join(2218207..2218549,2219636..2219705,
FT                   2219811..2220117))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09310"
FT                   /old_locus_tag="Vv17s0000g09310"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHI7"
FT                   /protein_id="CBI14947.3"
FT                   /translation="MGNQMQPHHLGMKGKIKCLSIRRHLLLPEIASRANLEADPKKTML
FT                   GSSDRKPVHGWDTTPDDYLSHIKRMERSLSIVPGAPHYPVVHKAFNNKSPFEEAQGNAE
FT                   AEGFIQQKHRGFELCKWKTFKAIPKRLPKIPPCRGSSRVIGRRLADGFKLEPTGLALEI
FT                   PLVRIKLIGGSIVTHRMTMPSLRHSLEDFKLILVMALKLLPFLHGLFSNRVLVVGAMLF
FT                   GENESLILVGRGWVGER"
FT   gene            2221079..2223175
FT                   /locus_tag="VIT_17s0000g09300"
FT                   /old_locus_tag="Vv17s0000g09300"
FT   mRNA            2221079..2223175
FT                   /locus_tag="VIT_17s0000g09300"
FT                   /old_locus_tag="Vv17s0000g09300"
FT                   /product="putative uncharacterized protein Sb06g020256"
FT   CDS_pept        2221079..2223175
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09300"
FT                   /old_locus_tag="Vv17s0000g09300"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTR8"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR032867"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTR8"
FT                   /protein_id="CCB42934.1"
FT                   /translation="MAVTLPLLPAKTPTAKTSISLFPENPKTLILEQCKTIRDLNEIHA
FT                   HLIKTRLLLKPKVAENLLESAAILLPTSMDYAVSIFRQIDEPDSPAYNIMIRGFTLKQS
FT                   PHEAILLFKEMHENSVQPDEFTFPCILKVCSRLQALSEGEQIHALIMKCGFGSHGFVKN
FT                   TLIHMYANCGEVEVARRVFDEMSERNVRTWNSMFAGYTKSGNWEEVVKLFHEMLELDIR
FT                   FDEVTLVSVLTACGRLADLELGEWINRYVEEKGLKGNPTLITSLVDMYAKCGQVDTARR
FT                   LFDQMDRRDVVAWSAMISGYSQASRCREALDLFHEMQKANIDPNEITMVSILSSCAVLG
FT                   ALETGKWVHFFIKKKRMKLTVTLGTALMDFYAKCGSVESSIEVFGKMPVKNVLSWTVLI
FT                   QGLASNGQGKKALEYFYLMLEKNVEPNDVTFIGVLSACSHAGLVDEGRDLFVSMSRDFG
FT                   IEPRIEHYGCMVDILGRAGLIEEAFQFIKNMPIQPNAVIWRTLLASCKVHKNVEIGEES
FT                   LKQLIILEPTHSGDYILLSNIYASVGRWEDALKVRGEMKEKGIKKTPGCSLIELDGVIH
FT                   EFFAEDNVHSQSEEIYNAIEDMMKQIKSAGYVPNTAEARLDAEEDDKESSVSHHSEKLA
FT                   IAFGLIKSPPGTTIRITKNLRVCTDCHNATKLVSKVFNREIVVRDRTRFHHFKEGSCSC
FT                   NDYW"
FT   gene            complement(2224515..2226700)
FT                   /locus_tag="VIT_17s0000g09290"
FT                   /old_locus_tag="Vv17s0000g09290"
FT   mRNA            complement(join(2224515..2224829,2224936..2225094,
FT                   2225184..2225308,2225811..2226006,2226089..2226221,
FT                   2226570..2226700))
FT                   /locus_tag="VIT_17s0000g09290"
FT                   /old_locus_tag="Vv17s0000g09290"
FT                   /product="Predicted protein"
FT   CDS_pept        complement(join(2224515..2224829,2224936..2225094,
FT                   2225184..2225308,2225811..2226006,2226089..2226221,
FT                   2226570..2226700))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09290"
FT                   /old_locus_tag="Vv17s0000g09290"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5BI87"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A5BI87"
FT                   /protein_id="CBI14949.3"
FT                   /translation="MESGNRFYSVDEFHLDPKWLIDPKHLFVGPRIGEGAHAKVYEGKY
FT                   KNQNVAIKIVHRGETPEEITKREARFAREVSMLSRVQHKNLAKFIGVCKEPVMVIVTEL
FT                   LLGGTLRKYLLNMRPRCLDARIAVGFALDIARAMECLHSHGIIHRDLKPENLILTADHK
FT                   TVKLVDFGLAREESLTEMMTAETGTYRWMAPELYSTVTLRHGEKKHYNNKVDAYSFAIV
FT                   LWELLHNKLPFEGMSNLQAAYAAAFKNVRPSAENLPEELAIILTSCWKEDPNARPNFSQ
FT                   IVQMLLHYLSTISPPEPAIPSRVFASENTILPPESPGTSSLMAVRDDSGETPKVKMENK
FT                   PKGFFFCFNQCY"
FT   gene            complement(2227827..2232889)
FT                   /locus_tag="VIT_17s0000g09280"
FT                   /old_locus_tag="Vv17s0000g09280"
FT   mRNA            complement(join(2227827..2228051,2228052..2228150,
FT                   2228246..2228788,2228966..2229115,2229343..2229594,
FT                   2229682..2229802,2229919..2230540,2230697..2231498,
FT                   2232604..2232627,2232628..2232889))
FT                   /locus_tag="VIT_17s0000g09280"
FT                   /old_locus_tag="Vv17s0000g09280"
FT                   /product="Predicted protein"
FT   3'UTR           complement(2227827..2228051)
FT                   /locus_tag="VIT_17s0000g09280"
FT                   /old_locus_tag="Vv17s0000g09280"
FT   CDS_pept        complement(join(2228052..2228150,2228246..2228788,
FT                   2228966..2229115,2229343..2229594,2229682..2229802,
FT                   2229919..2230540,2230697..2231498,2232604..2232627))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09280"
FT                   /old_locus_tag="Vv17s0000g09280"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTR9"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR000433"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR032350"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTR9"
FT                   /protein_id="CCB42935.1"
FT                   /translation="MESTKVIKVKYGNTLRRFNACLDENGELDLDINGLRAKVITLFNL
FT                   VPDADLTLTYIDEDGDVVTLVDDEDLHDVMRQRLKFLRITVLLNIEKDGRSHTRSSGSS
FT                   TPMRSPFNLRPFQDGNAGVAPMRSPFDLRPFQDGNAGVAPMRPPFDLRPFQDGNAGVAE
FT                   FIKSVPEPLLEAFSKLSTDFTSKAASSAPVLSEVLTCLSKMGESYLNSVSPSEVGADSS
FT                   THNRSSDNSVDPLVTENTKAPQADSKQELLPTAELKDSNSKLNEVGTTGPVSRGIASNV
FT                   PATDNKEANVESNVAPVASNDPSVDKRKETKKESKYAPIACSDCANDPSVDKRKETKKE
FT                   SKYPPVACSDCASDGRKGTKKGSVDHYGEKLADCVASTWNAGYPRPYNPDPSHITCLDS
FT                   GISKKISSDGRNYAAPNFGNPFSDCPFTGMPPVNNSLLSTGARPRPPLFKRSYKDAMGG
FT                   TFHKGIQCDGCGVHPITGPRFKSKVKEDYDLCSICFSDMGNEADYIRIDWPARQHPWSF
FT                   KMSHDPMQQPEVHSPAQPYPSIGCGIRVRQPHLDSRFILDVNVIDGTVMAPSIPFTKTW
FT                   RMRNTGNAVWARGTRLVWIGGDRFSEKDSVEICRDCVPIGEELEISVDFTAPEFPGRYI
FT                   SYWRMAAPSGQTFGQRVWVLIQVDSSLKDLLGDSMPVINLNFPPSSGGSKSPQIIDVNV
FT                   EPVVDGGLVEVNEPVKPIVKEHANKNQELNFPIDDNLLATNVVPGPVSPENNSSVSYPI
FT                   IDFSDAAPISGVDKAALDQAALEEVMGKNDGVEQSLLKALDEMGFKCDAFNKEILRMHE
FT                   YDLEETVNHLCGVGEWDPILEELKEMGFNDTELNKKLLRKNNGSLKRVVMDLIAVEKY"
FT   5'UTR           complement(2232628..2232889)
FT                   /locus_tag="VIT_17s0000g09280"
FT                   /old_locus_tag="Vv17s0000g09280"
FT   gene            complement(2239314..2242288)
FT                   /locus_tag="VIT_17s0000g09270"
FT                   /old_locus_tag="Vv17s0000g09270"
FT   mRNA            complement(join(2239314..2239373,2239472..2239558,
FT                   2239633..2239751,2239942..2240180,2240275..2240331,
FT                   2240794..2240880,2241004..2241548,2242117..2242269,
FT                   2242270..2242288))
FT                   /locus_tag="VIT_17s0000g09270"
FT                   /old_locus_tag="Vv17s0000g09270"
FT                   /product="unknown predicted protein"
FT   CDS_pept        complement(join(2239314..2239373,2239472..2239558,
FT                   2239633..2239751,2239942..2240180,2240275..2240331,
FT                   2240794..2240880,2241004..2241548,2242117..2242269))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09270"
FT                   /old_locus_tag="Vv17s0000g09270"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHJ1"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHJ1"
FT                   /protein_id="CBI14951.3"
FT                   /translation="MKLAGPLVVVNFLQYSLQMISIMFVGHLGELSLSSASMATSFAGV
FT                   TGFSIMLGMGSALDTFCGQAYGAEQYHMLGVHMQRALLVLMPTCIPIAFVWAYTGKIFT
FT                   IIGQDPEISMQAGIYAHWLIPSIFPYGILQCQIRFLQTQNNVWPSTISTGFTSLVHILM
FT                   FWTLVFKFSFGIKGAALSIAISYWTNVLIMAIYIKFSPACQKTWTGFSKEGMKNLLSFT
FT                   SLAIPSCLMVCLEFWSYEFLALMSGFLPNPKLEASMMSISLDTSAVVYRIPYGFGSAVS
FT                   TRVSNELGAGRPHAARLAVQVVLFLAITEGLSVSLLAVAVRGVWGYMYTNEEELIRYLA
FT                   AIMPVLAVSNFIDGIQGALSGTARGCGWQKICAYVSLGAYYLVGLPAAIILTFVLQFGG
FT                   KGLWMGILCGSTLQTFLLLAITMSTNWEQEARKAKGRLCASSIQTDMAS"
FT   5'UTR           complement(2242270..2242288)
FT                   /locus_tag="VIT_17s0000g09270"
FT                   /old_locus_tag="Vv17s0000g09270"
FT   gene            complement(2248486..2249158)
FT                   /locus_tag="VIT_17s0000g09260"
FT                   /old_locus_tag="Vv17s0000g09260"
FT   mRNA            complement(join(2248486..2248789,2248790..2248878,
FT                   2248963..2249158))
FT                   /locus_tag="VIT_17s0000g09260"
FT                   /old_locus_tag="Vv17s0000g09260"
FT   3'UTR           complement(2248486..2248789)
FT                   /locus_tag="VIT_17s0000g09260"
FT                   /old_locus_tag="Vv17s0000g09260"
FT   CDS_pept        complement(join(2248790..2248878,2248963..2249158))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09260"
FT                   /old_locus_tag="Vv17s0000g09260"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHJ2"
FT                   /protein_id="CBI14952.3"
FT                   /translation="MQYIYISCIVPHFYVLVCRKGRSSPSLKNIYCHPSLVDAHRNPLW
FT                   EYSENIFAFCYYHEHQLGATSKAGKDRVCTSSILTDVASGSCLCHDIWT"
FT   gene            complement(2267026..2267629)
FT                   /locus_tag="VIT_17s0000g09250"
FT                   /old_locus_tag="Vv17s0000g09250"
FT   mRNA            complement(join(2267026..2267135,2267136..2267259,
FT                   2267352..2267408,2267530..2267582,2267583..2267629))
FT                   /locus_tag="VIT_17s0000g09250"
FT                   /old_locus_tag="Vv17s0000g09250"
FT                   /product="putative uncharacterized protein Sb10g029392"
FT   3'UTR           complement(2267026..2267135)
FT                   /locus_tag="VIT_17s0000g09250"
FT                   /old_locus_tag="Vv17s0000g09250"
FT   CDS_pept        complement(join(2267136..2267259,2267352..2267408,
FT                   2267530..2267582))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09250"
FT                   /old_locus_tag="Vv17s0000g09250"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSH1"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSH1"
FT                   /protein_id="CCB42936.1"
FT                   /translation="MSGLFPNPNLEASMMSISLNTSLVVFRIPFGFGSAVSMRVSNELG
FT                   VERPRAAQIAIQVVIFLAITEGLLLSLLAVAV"
FT   5'UTR           complement(2267583..2267629)
FT                   /locus_tag="VIT_17s0000g09250"
FT                   /old_locus_tag="Vv17s0000g09250"
FT   gene            complement(2267797..2270602)
FT                   /locus_tag="VIT_17s0000g09240"
FT                   /old_locus_tag="Vv17s0000g09240"
FT   mRNA            complement(join(2267797..2268008,2268009..2268284,
FT                   2270419..2270517,2270518..2270602))
FT                   /locus_tag="VIT_17s0000g09240"
FT                   /old_locus_tag="Vv17s0000g09240"
FT                   /product="Os04g0373400 protein"
FT   3'UTR           complement(2267797..2268008)
FT                   /locus_tag="VIT_17s0000g09240"
FT                   /old_locus_tag="Vv17s0000g09240"
FT   CDS_pept        complement(join(2268009..2268284,2270419..2270517))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09240"
FT                   /old_locus_tag="Vv17s0000g09240"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHJ5"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHJ5"
FT                   /protein_id="CBI14955.3"
FT                   /translation="MISIMFVGHLGELSLSSASIATSFVGVIGFSFMLRMGSPPETLCG
FT                   QAYGAKQYHMLGIYMHRVLLVLMLMCIPIAFIRAYTTQMFKMVGQNPKISMQIGIYARW
FT                   FIPSIFSYGIFQCQLRFLQA"
FT   5'UTR           complement(2270518..2270602)
FT                   /locus_tag="VIT_17s0000g09240"
FT                   /old_locus_tag="Vv17s0000g09240"
FT   gene            complement(2276771..2280974)
FT                   /locus_tag="VIT_17s0000g09230"
FT                   /old_locus_tag="Vv17s0000g09230"
FT   mRNA            complement(join(2276771..2276930,2276931..2277570,
FT                   2277696..2277862,2280031..2280573,2280574..2280974))
FT                   /locus_tag="VIT_17s0000g09230"
FT                   /old_locus_tag="Vv17s0000g09230"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(2276771..2276930)
FT                   /locus_tag="VIT_17s0000g09230"
FT                   /old_locus_tag="Vv17s0000g09230"
FT   CDS_pept        complement(join(2276931..2277570,2277696..2277862,
FT                   2280031..2280573))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09230"
FT                   /old_locus_tag="Vv17s0000g09230"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSH2"
FT                   /protein_id="CCB42937.1"
FT                   /translation="MTLAISDVAQTRSVLQTLGERPDHEAVDKAKAKIVEIDSRLSKQL
FT                   EEIVLSPRPSSIERLQFRAHQAEKEQECRQAAEKEKQIYKAVVQLDEMHEAYEKLLKEA
FT                   EERLVKLYESASAFADDVEHLPVKEETNEEVVGVLQEASGKGLERVDLSGRRLRFLPEA
FT                   FGKIRSLVALNLSCNQLEFIPDSIATLENLEELNLSSNLLELLPDSIGLLVNLKILDAS
FT                   GNKLLALPDSICHCRSLVELDVSFNNLAYLPTNIGYELVNLKRLSINLNKIRSLPTSIG
FT                   EMRSLCHLDAHFNELRGLPSAIGRLTNLETLNLSSNFSDLTELPETIGDLTNLRELDLS
FT                   NNQIQALPDTFGRLDNLNKLNLDQNPLVIPPMEVVNEGVEAVKVFMAKRWLDILVEEEQ
FT                   KSLLEVKEQTETGWLTRSTSWLGSVVSGVSQSVSGYLGPGPRDPYLDQQL"
FT   5'UTR           complement(2280574..2280974)
FT                   /locus_tag="VIT_17s0000g09230"
FT                   /old_locus_tag="Vv17s0000g09230"
FT   gene            complement(2287180..2297328)
FT                   /locus_tag="VIT_17s0000g09220"
FT                   /old_locus_tag="Vv17s0000g09220"
FT   mRNA            complement(join(2287180..2287329,2287330..2287374,
FT                   2288045..2288169,2288803..2288911,2288997..2289131,
FT                   2289239..2289326,2293996..2294093,2294197..2294315,
FT                   2294546..2294655,2294750..2294811,2294812..2294934,
FT                   2296910..2297328))
FT                   /locus_tag="VIT_17s0000g09220"
FT                   /old_locus_tag="Vv17s0000g09220"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(2287180..2287329)
FT                   /locus_tag="VIT_17s0000g09220"
FT                   /old_locus_tag="Vv17s0000g09220"
FT   CDS_pept        complement(join(2287330..2287374,2288045..2288169,
FT                   2288803..2288911,2288997..2289131,2289239..2289326,
FT                   2293996..2294093,2294197..2294315,2294546..2294655,
FT                   2294750..2294811))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09220"
FT                   /old_locus_tag="Vv17s0000g09220"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHJ7"
FT                   /db_xref="InterPro:IPR006958"
FT                   /db_xref="InterPro:IPR029004"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHJ7"
FT                   /protein_id="CBI14957.3"
FT                   /translation="MQHDEVIWQVIRHNHCSFMTKITTGNFCRNPYNVTGICNRSSCPL
FT                   ANSRYATIRDHDGVFYLYMKTIERAHMPNKLWERVKLPRNYGKALELIDKHLMFWPKLL
FT                   VHKTKQRLTKMTQMRIRMRKLALKTREKIMTTPRKEKKREARREEKAEKAAVLDKSIEK
FT                   ELLERLKRGVYGDIYNYPVKEYNKVLDMEGLQAASEDEEEEEPEIEYVEGYEELEEEDD
FT                   IEDFGGLEIDESLKDEDLDDDEMDLIDRKRVRRGSGSAHGKLDKDERGANLKKRPRVLV
FT                   EVEHEGTDERQKAIQ"
FT   5'UTR           complement(2296910..2297328)
FT                   /locus_tag="VIT_17s0000g09220"
FT                   /old_locus_tag="Vv17s0000g09220"
FT   gene            complement(2298079..2303731)
FT                   /locus_tag="VIT_17s0000g09210"
FT                   /old_locus_tag="Vv17s0000g09210"
FT   mRNA            complement(join(2298079..2298203,2299596..2299797,
FT                   2299885..2300157,2300916..2301090,2301202..2301464,
FT                   2301819..2301935,2302087..2302370,2302456..2302638,
FT                   2302765..2303731))
FT                   /locus_tag="VIT_17s0000g09210"
FT                   /old_locus_tag="Vv17s0000g09210"
FT                   /product="putative uncharacterized protein"
FT   CDS_pept        complement(join(2298079..2298203,2299596..2299797,
FT                   2299885..2300157,2300916..2301090,2301202..2301464,
FT                   2301819..2301935,2302087..2302370,2302456..2302638,
FT                   2302765..2303731))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09210"
FT                   /old_locus_tag="Vv17s0000g09210"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSH3"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR031968"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSH3"
FT                   /protein_id="CCB42938.1"
FT                   /translation="MDDSSEVSSIPSDYEDCIEEQRPSCCSFEEAIELMQSRNGEQEMP
FT                   ENLQGGILLDQTYIVASKVLNMLLFAPNSQFRQDLAELQRTTNMKEGPWTWKSGALSCL
FT                   TRVVSYTQAATKLVKAVDALEEQTYIKADGREFAVLVNVDTPDVPYGNSFKVELLYKIM
FT                   PGPELSSGEESSHLVVSWGLSFSQNTIMRGMIEGGARQGLKESFDQFANLLAQNFKTLG
FT                   SIDSLDKDQMLATLQTEQQSDWELATEYFGNFTVVSAFFMVIYILVHILLSVRSEQQGL
FT                   EFSGLDLPDSFGELITCGILVIQLERVYAMILHFVQARFQRGSDHGVKAQGDGWVLTVA
FT                   LIEGINLASLDSTGLSDPYVVFTCNGKTRTSSVKLQTHDPQWNEILEFDAMEEPPAVLD
FT                   VEVFDFDGPFDEAASLGHAEINFLRHTSTELADMWVSLEGKLAQSSQSKLHLRIFLDNN
FT                   NGVETIKEYLAKMEKEVGKKITLQSPHRNSTFLALFGLPPEEFLINDFTCYLKRKVPLQ
FT                   GRLFLSARIVGFYANLFGHKTKFFFLWEDIEDIQVHPPSLASLGSPSLVIILRKGRGLD
FT                   ARHGAKSQDEEGRLKFYFQSFVSFNVASRTIMALWRTRTLTPEQKAQIADEQQDEDGSS
FT                   LLLEDPGSVFNVEEAKMSKVYSAELPIDIKSLMEMFDGGNLEHKIMEKSGYLNYKATGW
FT                   ETVKPDLYERHLCFKFNRHVSIFGGEVTCTQKKSPIGNDNGWILNEVMALHDIPFGDHF
FT                   RVHFRYQIENFGLAPGKCKCEVHMEILWLKSTVFQQRITRNITEKFTSRLKEIIELVER
FT                   EALLNCPQDKFCRILYTIFGTIASLWKCVNISLNFYELLVPISSPTKVLQ"
FT   gene            2326490..2328663
FT                   /locus_tag="VIT_17s0000g09200"
FT                   /old_locus_tag="Vv17s0000g09200"
FT   mRNA            join(2326490..2326534,2326535..2326678,2328301..2328456,
FT                   2328457..2328663)
FT                   /locus_tag="VIT_17s0000g09200"
FT                   /old_locus_tag="Vv17s0000g09200"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           2326490..2326534
FT                   /locus_tag="VIT_17s0000g09200"
FT                   /old_locus_tag="Vv17s0000g09200"
FT   CDS_pept        join(2326535..2326678,2328301..2328456)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09200"
FT                   /old_locus_tag="Vv17s0000g09200"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSH4"
FT                   /db_xref="InterPro:IPR026182"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSH4"
FT                   /protein_id="CCB42939.1"
FT                   /translation="MLQYPAYMTQYPWSTNTIPTSFLLPSQWPHPHSDELLLAMEESDF
FT                   DDKCNEITKINSNLVVIGKPAADNDKEDLDNDADDDDPDNAEESEGDEFEQETG"
FT   3'UTR           2328457..2328663
FT                   /locus_tag="VIT_17s0000g09200"
FT                   /old_locus_tag="Vv17s0000g09200"
FT   gene            complement(2330951..2331982)
FT                   /locus_tag="VIT_17s0000g09190"
FT                   /old_locus_tag="Vv17s0000g09190"
FT   mRNA            complement(join(2330951..2331295,2331296..2331394,
FT                   2331447..2331673,2331763..2331916,2331917..2331982))
FT                   /locus_tag="VIT_17s0000g09190"
FT                   /old_locus_tag="Vv17s0000g09190"
FT                   /product="Predicted protein"
FT   3'UTR           complement(2330951..2331295)
FT                   /locus_tag="VIT_17s0000g09190"
FT                   /old_locus_tag="Vv17s0000g09190"
FT   CDS_pept        complement(join(2331296..2331394,2331447..2331673,
FT                   2331763..2331916))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09190"
FT                   /old_locus_tag="Vv17s0000g09190"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSH5"
FT                   /protein_id="CCB42940.1"
FT                   /translation="MGGDLDSASNRIIKFLYSYGGKILPRRIDGKLRYVGGHTRVLAVD
FT                   RSISYAELMVKLGELCGSSVTLRCQLPKEDLDVLVTVTSDEELANVIDEYHRASSSCSK
FT                   IRAVLSPPKSLKTISPVSSTTSSPLRLCWLTVILVLVQYLRLRRRIDGPPVSRRQ"
FT   5'UTR           complement(2331917..2331982)
FT                   /locus_tag="VIT_17s0000g09190"
FT                   /old_locus_tag="Vv17s0000g09190"
FT   gene            2335996..2342850
FT                   /locus_tag="VIT_17s0000g09180"
FT                   /old_locus_tag="Vv17s0000g09180"
FT   mRNA            join(2335996..2336196,2342719..2342850)
FT                   /locus_tag="VIT_17s0000g09180"
FT                   /old_locus_tag="Vv17s0000g09180"
FT   CDS_pept        join(2335996..2336196,2342719..2342850)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09180"
FT                   /old_locus_tag="Vv17s0000g09180"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHK1"
FT                   /protein_id="CBI14961.3"
FT                   /translation="MENSREKKKNFFTETVVGAGERQALGNDTGGEDDGISQDGLRIGE
FT                   DFEVSGGKIDLGDSFNEDLSVEWRDWARQRSMISLPLIPSVKPGKFSTSILRMDAYGVQ
FT                   FVYNEK"
FT   gene            2350151..2352378
FT                   /locus_tag="VIT_17s0000g09170"
FT                   /old_locus_tag="Vv17s0000g09170"
FT   mRNA            join(2350151..2350389,2350390..2352369,2352370..2352378)
FT                   /locus_tag="VIT_17s0000g09170"
FT                   /old_locus_tag="Vv17s0000g09170"
FT                   /product="unknown predicted protein"
FT   5'UTR           2350151..2350389
FT                   /locus_tag="VIT_17s0000g09170"
FT                   /old_locus_tag="Vv17s0000g09170"
FT   CDS_pept        2350390..2352369
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09170"
FT                   /old_locus_tag="Vv17s0000g09170"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSH6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001220"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR019825"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSH6"
FT                   /protein_id="CCB42941.1"
FT                   /translation="MLPLLLVPLFTFLFVSPSLSVNFLYNSFNASDASYLELINDARVE
FT                   GSVIRLTNDSNQFSFGRVFYPTRLTMKPTSNSTAVASFSTSFVFSILPDISDSPGFGLA
FT                   FVLSNSTSPPGALASQYFGLFSNATVPSVAPLLAVEFDTGQNPEFNDIDGNHVGIDLNN
FT                   IESESDGTQTAGYYNSSGDFVAVEMRNGQNIRAWIEFDGPQFEINVTIAPVAVSKPSRP
FT                   LISYRNPKIANYVSTEMYVGFSASKTNWVEAQRILAWSLSDTGVAADINTTNLPVFSPE
FT                   TASSSLSAGAIAGIAIASVVFLLICLSGGYWFWRKTKIEEEDEIEDWELEYWPHRFSYE
FT                   ELKQATDGFSKNELLGLGGFGRVYRGTLPNNTQVAVKCVNHDSKQGLREFMAEIASMGR
FT                   LQHINLVQMRGWCRKGNELMLVYDFMPNGSLNRWIFDNPKTLLGWEGRRRVLADVAEGL
FT                   NYLHQGWDKVVIHRDIKSSNILLDSEMRGRLGDFGLAKLYEHGAAPNTTRVVGTLGYLA
FT                   PELATVTAPTAASDVYSFGVVVLEVACGRRPIETWAAEEEQVLIDWVREKYLDGRVCEA
FT                   ADKRIAGQYVVEEMERVLKLGLACCHPDPQHRPTMKEVVTVLVGEEAAAAPAAVLSELA
FT                   QAGESVGCSGGDTNAEEPPLQSTV"
FT   3'UTR           2352370..2352378
FT                   /locus_tag="VIT_17s0000g09170"
FT                   /old_locus_tag="Vv17s0000g09170"
FT   gene            complement(2353499..2356538)
FT                   /locus_tag="VIT_17s0000g09160"
FT                   /old_locus_tag="Vv17s0000g09160"
FT   mRNA            complement(join(2353499..2353617,2353618..2353802,
FT                   2353885..2354561,2354681..2354939,2355039..2355366,
FT                   2355454..2355691,2355834..2356010,2356085..2356178,
FT                   2356363..2356516,2356517..2356538))
FT                   /locus_tag="VIT_17s0000g09160"
FT                   /old_locus_tag="Vv17s0000g09160"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(2353499..2353617)
FT                   /locus_tag="VIT_17s0000g09160"
FT                   /old_locus_tag="Vv17s0000g09160"
FT   CDS_pept        complement(join(2353618..2353802,2353885..2354561,
FT                   2354681..2354939,2355039..2355366,2355454..2355691,
FT                   2355834..2356010,2356085..2356178,2356363..2356516))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09160"
FT                   /old_locus_tag="Vv17s0000g09160"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHK3"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHK3"
FT                   /protein_id="CBI14963.3"
FT                   /translation="MAKATLLILKLLMILICAGWITLWILKPTQLWTKKWHTAEDSART
FT                   TVFGYYGLNFVVYTFPVIALAAIGFVYLDLQSRESRRRQARRSASVLSNPLVVNNYLGV
FT                   LSALEILAVSLFFLYLAWTFYVHISNDFEKMVPAKSLKRQFKFLRVATRFGLLAEACLA
FT                   LLLLPVLRGMALFRFVGVQFEASVRYHVWLGTAMIFFATFHGVSTLIVWGIKDRIQDEM
FT                   GKWQKTGRIYLAGEIALVTGLVIWITSLPPIRRKRFEIFYYTHHLYIVFLLFFLFHGGD
FT                   RHFYMVFGGVFLFGLDKLLRIIQSRPQTCILSARVFPCKAIELVVAKDPGLKYAPTSII
FT                   FMKIPSISRFQWHSFSITSSSNIDDNTMSVIIKCGGWWTNSLSDIIHAELDSGSNQMKC
FT                   IPIAIEGPYGPASLDFLSYESLLLVAGGVGITPFLSILQEITSTQSSIRYRFPRRIELL
FT                   YIMKKSQDICLLNPILHLLQNQLAEQWHLKLKVFVTQEEECGATIRDLLNEFCQVQVVN
FT                   FASKCSSYAANGLENLLWMAAMAGFSSVMFLVFLSSLNHAFLPSQDKSSKEKSPSWVAD
FT                   ILLICSFIIAILCSTIVAIVLRWRKLRREIPPVSQKEGKAKEGLMDTRGTALEEHEIHF
FT                   GGRPNFQDIFSKFPKETRGSNIGVLVCGPETMKESVASICSQTSQCCNMGNDQKRKSHF
FT                   SFHSLNFTL"
FT   5'UTR           complement(2356517..2356538)
FT                   /locus_tag="VIT_17s0000g09160"
FT                   /old_locus_tag="Vv17s0000g09160"
FT   gene            2363321..2365303
FT                   /locus_tag="VIT_17s0000g09150"
FT                   /old_locus_tag="Vv17s0000g09150"
FT   mRNA            join(2363321..2363364,2363365..2363626,2364449..2364567,
FT                   2364671..2364789,2365081..2365303)
FT                   /locus_tag="VIT_17s0000g09150"
FT                   /old_locus_tag="Vv17s0000g09150"
FT                   /product="unknown predicted protein"
FT   5'UTR           2363321..2363364
FT                   /locus_tag="VIT_17s0000g09150"
FT                   /old_locus_tag="Vv17s0000g09150"
FT   CDS_pept        join(2363365..2363626,2364449..2364567,2364671..2364789,
FT                   2365081..2365303)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09150"
FT                   /old_locus_tag="Vv17s0000g09150"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHK4"
FT                   /protein_id="CBI14964.3"
FT                   /translation="MEEENYKKQAEEWQYQSMPMKSPEIVEIGEDSKSFTSSREGGFKD
FT                   VYVAVGRDDLDVLKWALDHSVSPQARIFLVHVFPPQTYISTPVGRLSRSQLSKEQLKVY
FT                   INEENNRRRNLLQKYIRLCTDAKVTVDTMLLESNTTTKAILDLIPVLNITNLVIGTKRP
FT                   PCPRRSWKKLGTGEFIQKNAPEFCEVTIVFDGKKVLDGEQVGELVHSSPASSHRKPETT
FT                   RNSERNFFECACFSGKFN"
FT   gene            2381010..2381492
FT                   /locus_tag="VIT_17s0000g09140"
FT                   /old_locus_tag="Vv17s0000g09140"
FT   mRNA            2381010..2381492
FT                   /locus_tag="VIT_17s0000g09140"
FT                   /old_locus_tag="Vv17s0000g09140"
FT                   /product="Predicted protein"
FT   CDS_pept        2381010..2381492
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09140"
FT                   /old_locus_tag="Vv17s0000g09140"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSH7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSH7"
FT                   /protein_id="CCB42942.1"
FT                   /translation="MGVALEDNDDYGTPPFNAEQLVSLHGKTTLTAAITRVLAEEGKAK
FT                   VVALDEIDKAPKEKKRGITIAMAHVEYETAKRHYAHVDCPGHADYEKNMITGAAQMDVS
FT                   IQVVFAPNGPMPRTKEHILLARQKWNSVSFLASTSSLGMKFPSFGAQIYARYKDTQ"
FT   gene            2388070..2392487
FT                   /locus_tag="VIT_17s0000g09130"
FT                   /old_locus_tag="Vv17s0000g09130"
FT   mRNA            join(2388070..2388125,2388212..2389068,2389154..2389333,
FT                   2389429..2389590,2389678..2389832,2391870..2391962,
FT                   2392084..2392169,2392241..2392487)
FT                   /locus_tag="VIT_17s0000g09130"
FT                   /old_locus_tag="Vv17s0000g09130"
FT                   /product="unknown predicted protein"
FT   CDS_pept        join(2388070..2388125,2388212..2389068,2389154..2389333,
FT                   2389429..2389590,2389678..2389832,2391870..2391962,
FT                   2392084..2392169,2392241..2392487)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09130"
FT                   /old_locus_tag="Vv17s0000g09130"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHK5"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHK5"
FT                   /protein_id="CBI14965.3"
FT                   /translation="MNHYDLRFSDPHSYRERRSDLMVAPPPVAPPPMMGGVVGGPSPTY
FT                   GRGGPASYGGPSVSFPNGGRGGGDVSGSVPGGGGFNAYPPFQPGSGRFEIGRGGGGGGG
FT                   VGRGFSGGKGSGGEFGGRMANGDLGNRRGDGDRGRGGGGARGREGGRGTGDGGRRAYDS
FT                   GRGGGRTGGSRSSDGGRGGGGSRTFDGGHGRGGIRSSDAGRGGRSFTGGRGGGRSGFDG
FT                   GRGGGRGGRHGGASRGDLDNIALPKQDFGSLVPFEKNFYIESPSVQAMSEQEAMLYRAR
FT                   REITVEGYDVPKPIRHFQEANFPGYCLEVIAKLGFVEPTPIQAQGWPMALKGRDLIGIA
FT                   ETGSGKTLAYLLPALVHVSAQPPLVRGEGPIVLVLAPTRELAVQIQEEALKFGSFTKIR
FT                   STCIYGGAPKGPQIRDLQRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVLDEADRMLDM
FT                   GFEPQIRKIISQIRPDRQTLYWSATWPREVETLARQFLRNPYKVIIGSQDLKANQSIQQ
FT                   VVEVVTETEKYNRLIRLLKEVMDGSRILIFMETKKGCDQVTRQMRMDGWPSLSIHGDKN
FT                   QAERDWVLAEFKSGRSPIMTATDVAARGLGRITVC"
FT   gene            2393249..2394195
FT                   /locus_tag="VIT_17s0000g09120"
FT                   /old_locus_tag="Vv17s0000g09120"
FT   mRNA            join(2393249..2393288,2393307..2393540,2393631..2393737,
FT                   2393738..2394195)
FT                   /locus_tag="VIT_17s0000g09120"
FT                   /old_locus_tag="Vv17s0000g09120"
FT                   /product="Os01g0911100 protein"
FT   CDS_pept        join(2393249..2393288,2393307..2393540,2393631..2393737)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09120"
FT                   /old_locus_tag="Vv17s0000g09120"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSH8"
FT                   /protein_id="CCB42943.1"
FT                   /translation="MLQTAFLFVLPNFYVKDIKCVINYDFPSSLEDYVHRIGRTGRAGA
FT                   KGTAITFFTHSNAKFARDLIKILQEAGQVVSPALSAMARSSGSAFGGSGGNFRSRGRGG
FT                   SFGNRGLISGSNTIPLGARRPW"
FT   3'UTR           2393738..2394195
FT                   /locus_tag="VIT_17s0000g09120"
FT                   /old_locus_tag="Vv17s0000g09120"
FT   gene            2394894..2395505
FT                   /locus_tag="VIT_17s0000g09110"
FT                   /old_locus_tag="Vv17s0000g09110"
FT   mRNA            join(2394894..2394914,2394915..2395355,2395356..2395505)
FT                   /locus_tag="VIT_17s0000g09110"
FT                   /old_locus_tag="Vv17s0000g09110"
FT                   /product="unknown predicted protein"
FT   5'UTR           2394894..2394914
FT                   /locus_tag="VIT_17s0000g09110"
FT                   /old_locus_tag="Vv17s0000g09110"
FT   CDS_pept        2394915..2395355
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09110"
FT                   /old_locus_tag="Vv17s0000g09110"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5BE36"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:A5BE36"
FT                   /protein_id="CCB42944.1"
FT                   /translation="MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILF
FT                   DKYHPGYFGKVGMRYFHKLRNKFYCPIVNIDKLWSLIPQDVKDKASPENAPLIDVTQFG
FT                   YFKVLGKGALPESKPIVVKAKLVSKIAEKKIKEAGGAVVLTA"
FT   3'UTR           2395356..2395505
FT                   /locus_tag="VIT_17s0000g09110"
FT                   /old_locus_tag="Vv17s0000g09110"
FT   gene            2419633..2429087
FT                   /locus_tag="VIT_17s0000g09100"
FT                   /old_locus_tag="Vv17s0000g09100"
FT   mRNA            join(2419633..2419715,2419716..2419965,2420982..2421091,
FT                   2421201..2421506,2422624..2422736,2422843..2423173,
FT                   2423270..2423485,2423601..2423837,2424283..2424468,
FT                   2426014..2426154,2427506..2427774,2428102..2428183,
FT                   2428760..2428894,2428895..2429087)
FT                   /locus_tag="VIT_17s0000g09100"
FT                   /old_locus_tag="Vv17s0000g09100"
FT                   /product="unknown predicted protein"
FT   5'UTR           2419633..2419715
FT                   /locus_tag="VIT_17s0000g09100"
FT                   /old_locus_tag="Vv17s0000g09100"
FT   CDS_pept        join(2419716..2419965,2420982..2421091,2421201..2421506,
FT                   2422624..2422736,2422843..2423173,2423270..2423485,
FT                   2423601..2423837,2424283..2424468,2426014..2426154,
FT                   2427506..2427774,2428102..2428183,2428760..2428894)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09100"
FT                   /old_locus_tag="Vv17s0000g09100"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSI0"
FT                   /db_xref="InterPro:IPR000269"
FT                   /db_xref="InterPro:IPR015798"
FT                   /db_xref="InterPro:IPR015800"
FT                   /db_xref="InterPro:IPR015802"
FT                   /db_xref="InterPro:IPR016182"
FT                   /db_xref="InterPro:IPR036460"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSI0"
FT                   /protein_id="CCB42945.1"
FT                   /translation="MATASKKATSCCIGDDSRSIRREAVAAAAAAPSVAAAAAAAVADV
FT                   EQDWSGVGVVGDGKKAALASLIRPVEPIAGASANASVKGIQIMTRAQTCHPLDPLSATE
FT                   ISVAVATVRAAGATPEVRDGMRFVEVVLYEPDKHVVALADAYFFPPFQPSLLPRTKGGP
FT                   VIPSKLPPRKARLIVYNKKSNETSIWIVELSEVHAATRGGHHRGKAITTQVVPDIQPPM
FT                   DAVEYAECEAVVKDCPLFREAMKKRGVEDMDLVMVDAWCVGYHGEADAPSRRLAKPLIF
FT                   CRTESDCPMENGYARPVEGIYVVVDMQNMVVIEFEDRKLVPLPPADPLRNYTPGETRGG
FT                   VDRSDVKPLQIVQPEGPSFRVHGHYVEWQKWNFRIGFTPREGLVIHSVAYVDGSRGRRP
FT                   VAHRLSFVEMVVPYGDPNEPHYRKNAFDAGEDGLGKNANSLKKGCDCLGFIKYFDAHFT
FT                   NFTGGVETIENCVCLHEEDHGILWKHQDWRTGLAEVRRSRRLTASFICTVANYEYGFFW
FT                   HFYQDGRIEAEVKLTGILSLGALQPGESRKYGTTIAPGLYAPVHQHFFIARMDMAVDCK
FT                   PGEAFNQVVEVNMKVENPGKDNVHNNAFYAEEKLLRSEMQAMRDCDPLSARHWIVRNTR
FT                   TVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMFPGGEFPNQ
FT                   NPRVGEGLATWVKQNRPLEETDIVLWYVFGLVHVPRLEDWPVMPVERIGFMLQPHGFFN
FT                   CSPAVDVPPNACELDGKDNDVKDNGVAKPIQTGLLSKI"
FT   3'UTR           2428895..2429087
FT                   /locus_tag="VIT_17s0000g09100"
FT                   /old_locus_tag="Vv17s0000g09100"
FT   gene            2429365..2432326
FT                   /locus_tag="VIT_17s0000g09090"
FT                   /old_locus_tag="Vv17s0000g09090"
FT   mRNA            join(2429365..2429374,2430338..2432108,2432126..2432150,
FT                   2432151..2432326)
FT                   /locus_tag="VIT_17s0000g09090"
FT                   /old_locus_tag="Vv17s0000g09090"
FT                   /product="Predicted protein"
FT   CDS_pept        join(2429365..2429374,2430338..2432108,2432126..2432150)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09090"
FT                   /old_locus_tag="Vv17s0000g09090"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSI1"
FT                   /protein_id="CCB42946.1"
FT                   /translation="MAKVAAIMGEVEEKTIQDELTVTIQLADRVIKSAEEAESSKAECS
FT                   EIARQVERLSKMLRSAARLATSTQWLYERPVRRIAADVTKNLDRALTLVRKCKHSGVLR
FT                   QVFSITTAADFRKVLALLESSIGDLKWLVTIVDPDDINLTLPPIANNDPTLAWVWSYIA
FT                   TIQMGQLRDRVEAANALVLLAHKNDRTKKIVVDEGGIMPLLKLLKEGASADAQIAAANA
FT                   LFHIGNEEERVRSIADAAGVPIIVQVLGESVMRVQVSVANLVARMAEMDSAVREAFARE
FT                   NVTRPLVSLLSVDTVLVLDDPKLKPSKPSISSLVQFNKELAGKSAGHNSYNPSLNSVSS
FT                   FTSSGGHSSLSVHSSSEGSSRGGHNRKDREVETPELKLKLKVSCAEALWKLSKDSVLNS
FT                   RKITETKGLICLAKIIEKEKGELQYNCLMAVMEIAMVAEQDADLRRAAFKTSSPAAKAV
FT                   LDQLLRVIQEESSSTMKIPAIKSIGSLARTFPARETRIIGPLVAQLSNSDNEVAIEATI
FT                   ALGKFVHPENFNRVEHAKAIIEFDGVPPLLRLLRTSERANIYGLILLSYLALHVGNSKA
FT                   LEQAQALSVLDLAIRSGVVVCQSYT"
FT   3'UTR           2432151..2432326
FT                   /locus_tag="VIT_17s0000g09090"
FT                   /old_locus_tag="Vv17s0000g09090"
FT   gap             2434882..2435958
FT                   /estimated_length=1077
FT   gap             2438322..2444196
FT                   /estimated_length=5875
FT   gene            complement(2449959..2451740)
FT                   /locus_tag="VIT_17s0000g09080"
FT                   /old_locus_tag="Vv17s0000g09080"
FT   mRNA            complement(join(2449959..2450045,2450466..2451207,
FT                   2451300..2451429,2451511..2451643,2451644..2451740))
FT                   /locus_tag="VIT_17s0000g09080"
FT                   /old_locus_tag="Vv17s0000g09080"
FT                   /product="Predicted protein"
FT   CDS_pept        complement(join(2449959..2450045,2450466..2451207,
FT                   2451300..2451429,2451511..2451643))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09080"
FT                   /old_locus_tag="Vv17s0000g09080"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSI2"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSI2"
FT                   /protein_id="CCB42947.1"
FT                   /translation="MGRHSCCLKQKLRKGLWSPEEDEKLYNYITRFGVGCWSSVPKLAG
FT                   LQRCGKSCRLRWINYLRPDLKRGMFSQQEEDIIISLHQVLGNRWAQIAAQLPGRTDNEI
FT                   KNFWNSCLKKKLLKQGMDPNTHKPLNETEVGDGKNCTEKASLQVLQPKGLPAVPSSAAE
FT                   FEQPFMVNNSSCYDGGLTEGSRVQFMNKPGFDPMSFFEFQAGVDPMGYSSNLLSQYHQT
FT                   IRPFDQNQLEANSNVGFASLPGLTNFDQGNLTETDFSDNSASRMGSFFFNEAKESSSNS
FT                   SNITSHPAGFQINNMGENVAFSWDAENKLEALFQYQISGIKSEELKPSSWYGDQLQHHF
FT                   HCCHFPDFSYIQTRKFYPLLPFL"
FT   5'UTR           complement(2451644..2451740)
FT                   /locus_tag="VIT_17s0000g09080"
FT                   /old_locus_tag="Vv17s0000g09080"
FT   gap             2467924..2468023
FT                   /estimated_length=100
FT   gene            2471268..2487390
FT                   /locus_tag="VIT_17s0000g09070"
FT                   /old_locus_tag="Vv17s0000g09070"
FT   mRNA            join(2471268..2471302,2471303..2471842,2475982..2476422,
FT                   2476589..2476731,2479874..2479964,2480092..2480231,
FT                   2486935..2486974,2486975..2487390)
FT                   /locus_tag="VIT_17s0000g09070"
FT                   /old_locus_tag="Vv17s0000g09070"
FT                   /product="Histone deacetylase"
FT   5'UTR           2471268..2471302
FT                   /locus_tag="VIT_17s0000g09070"
FT                   /old_locus_tag="Vv17s0000g09070"
FT   CDS_pept        join(2471303..2471842,2475982..2476422,2476589..2476731,
FT                   2479874..2479964,2480092..2480231,2486935..2486974)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09070"
FT                   /old_locus_tag="Vv17s0000g09070"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSI3"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSI3"
FT                   /protein_id="CCB42948.1"
FT                   /translation="MEDGIGGASLPSGPDAKKRRVCYFYEPTIGDYYYGQGHPMKPHRI
FT                   RMAHNLVVHYALHRRMEINRPFPAGPDDIRRFHSDDYVDFLASVTPDSLHDHAHSRYLK
FT                   RFNVGEDCPVFDGLFGFCQASAGGSIGAAVKLNRRDADIALNWAGGLHHAKKSEASGFC
FT                   YVNDIVLGILELLKVHRRVLYVDIDIHHGDGVEEAFFTTDRVMTVSFHKFGDFFPGTGH
FT                   IRDIGVGPGKYYALNVPLNDGMDDESFRGLFRPIIQKVMAVYQPDAVVLQCGADSLSGD
FT                   RLGCFNLSVNGHADCLRFLRSFNVPLMVLGGGGYTIRNVARCWCYETAVAVGVEPDNKL
FT                   PYNEYYEYFGPDYTLHIEPCNMENQNSPKDLEKIRNMLLEQLSRLPHAPSVPFQTTPPI
FT                   TKVPEEEEEDMDKRPKPRIWNGEDCESDPDEDEKPRAQFSNTNHHPTSNVEMRGVTGKI
FT                   KEEKTT"
FT   3'UTR           2486975..2487390
FT                   /locus_tag="VIT_17s0000g09070"
FT                   /old_locus_tag="Vv17s0000g09070"
FT   gene            2487920..2489179
FT                   /locus_tag="VIT_17s0000g09060"
FT                   /old_locus_tag="Vv17s0000g09060"
FT   mRNA            join(2487920..2488887,2488958..2489129,2489130..2489179)
FT                   /locus_tag="VIT_17s0000g09060"
FT                   /old_locus_tag="Vv17s0000g09060"
FT                   /product="Predicted protein"
FT   CDS_pept        join(2487920..2488887,2488958..2489129)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09060"
FT                   /old_locus_tag="Vv17s0000g09060"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSI4"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSI4"
FT                   /protein_id="CCB42949.1"
FT                   /translation="MRSTPLGLASHQIRPFTLPPVQVSLHFLPRAPLNLKLYPKTPSPS
FT                   RFHPITAKAQHTHLSTHQTRTQDDGIPVDLVKILVKFKSRHNYIRVLDVSRKADHPFAG
FT                   SRLLLLDGPGNIHSISFLLKSFTDTYFDVLATLPAILPPGPLGILGFGAGSAARLILET
FT                   YPQVVVHGWELDPSVIEVGREYFGLSKLEKEHPHRLFIYIGNALNASVRNGFSGILVDL
FT                   FCKGSLIPELQDPGTWEKLRKRLRKGGRIMVNVGGSCVEAEDSRRDGKVVMEESLKAMH
FT                   KVFGDQVFVLNLGNRKEDSSIALTGELPDLDEWKKALPRSLRSIQEQSTDAVHIFVFIP
FT                   VRSNVFFFPWIVQSLFMRFELFSHLKSSSLLSLCSRLVH"
FT   3'UTR           2489130..2489179
FT                   /locus_tag="VIT_17s0000g09060"
FT                   /old_locus_tag="Vv17s0000g09060"
FT   gene            2494043..2494728
FT                   /locus_tag="VIT_17s0000g09050"
FT                   /old_locus_tag="Vv17s0000g09050"
FT   mRNA            join(2494043..2494156,2494157..2494301,2494429..2494643,
FT                   2494644..2494728)
FT                   /locus_tag="VIT_17s0000g09050"
FT                   /old_locus_tag="Vv17s0000g09050"
FT   5'UTR           2494043..2494156
FT                   /locus_tag="VIT_17s0000g09050"
FT                   /old_locus_tag="Vv17s0000g09050"
FT   CDS_pept        join(2494157..2494301,2494429..2494643)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09050"
FT                   /old_locus_tag="Vv17s0000g09050"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHL2"
FT                   /protein_id="CBI14972.3"
FT                   /translation="MSCGLLQKKVPLLRKMSAFWAKLAAAIAAVFLLVSGFPARYASHP
FT                   HAAGCDTSPWWVGGTRKIVAGRKGNSGCEGQISIYNKKVVPLRSLRSGTPSQPPAPTVN
FT                   RSKSNRTKVPPPQIP"
FT   3'UTR           2494644..2494728
FT                   /locus_tag="VIT_17s0000g09050"
FT                   /old_locus_tag="Vv17s0000g09050"
FT   gene            2496352..2498188
FT                   /locus_tag="VIT_17s0000g09040"
FT                   /old_locus_tag="Vv17s0000g09040"
FT   mRNA            join(2496352..2498034,2498035..2498188)
FT                   /locus_tag="VIT_17s0000g09040"
FT                   /old_locus_tag="Vv17s0000g09040"
FT                   /product="putative uncharacterized protein"
FT   CDS_pept        2496352..2498034
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09040"
FT                   /old_locus_tag="Vv17s0000g09040"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSI5"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSI5"
FT                   /protein_id="CCB42950.1"
FT                   /translation="MKLQILRLPQFSKLLFELSKIHQTLPRTKKLHAFIIRNHLSDDPF
FT                   YATRILRFYAINSDLCSARNLFDGTSYRSVYLWNSVIRAYAGEHQFDDALLLFAKMLRT
FT                   EIKPDSFTFACVLRACAENFDPDGLRVVHGGVVVSGLGFDSVCGSALVTAYSKLCMVDE
FT                   ASRVFYGMAEPDLVLWNAMAAGYGYCGFWDKGLQLFSAMRSMGEQPDSYTMVGLISGLA
FT                   DPSLLGIGKGIHGFCLKSSFDCNDHVGSALVSMYSRCHCLNSAYGVFTILSQPDLVTWS
FT                   ALITGLSKSGDYEKALLFFRKMNMEGKRVDPILIASVLAASGQSAILGPGSEIHGYVLR
FT                   HGLESEVMISSALIDMYSKCGFVNLGVRVFDSMPNRNTVSYNSMILGLGIHGLAPQAFK
FT                   MFEEVLEKGFKPDESTFSALLCTCCHAGLVKNGREIFSRMTEEFHIQARTDHYVHMVKL
FT                   LGMAGELQEAYDLILSLQQPVDSGIWGALLSCCNFHGNPELAEIVAQQLFENKPEKSAY
FT                   RVMLSNIYAGDDRWDDVKKLRDDIQEAGIKKMPGLSWIGVGRI"
FT   3'UTR           2498035..2498188
FT                   /locus_tag="VIT_17s0000g09040"
FT                   /old_locus_tag="Vv17s0000g09040"
FT   gene            complement(2499241..2500015)
FT                   /locus_tag="VIT_17s0000g09030"
FT                   /old_locus_tag="Vv17s0000g09030"
FT   mRNA            complement(join(2499241..2499459,2499460..2499480,
FT                   2499481..2500015))
FT                   /locus_tag="VIT_17s0000g09030"
FT                   /old_locus_tag="Vv17s0000g09030"
FT   3'UTR           complement(2499241..2499459)
FT                   /locus_tag="VIT_17s0000g09030"
FT                   /old_locus_tag="Vv17s0000g09030"
FT   CDS_pept        complement(2499460..2499480)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09030"
FT                   /old_locus_tag="Vv17s0000g09030"
FT                   /product="unknown"
FT                   /protein_id="CCB42951.1"
FT                   /translation="MSLKMM"
FT   5'UTR           complement(2499481..2500015)
FT                   /locus_tag="VIT_17s0000g09030"
FT                   /old_locus_tag="Vv17s0000g09030"
FT   gene            2512111..2515576
FT                   /locus_tag="VIT_17s0000g09020"
FT                   /old_locus_tag="Vv17s0000g09020"
FT   mRNA            join(2512111..2512179,2512196..2512439,2513131..2513196,
FT                   2513338..2513343,2513344..2513423,2513607..2513752,
FT                   2514562..2514599,2514852..2514879,2515282..2515340,
FT                   2515341..2515576)
FT                   /locus_tag="VIT_17s0000g09020"
FT                   /old_locus_tag="Vv17s0000g09020"
FT   5'UTR           2512111..2512179
FT                   /locus_tag="VIT_17s0000g09020"
FT                   /old_locus_tag="Vv17s0000g09020"
FT   CDS_pept        join(2513344..2513423,2513607..2513752,2514562..2514599,
FT                   2514852..2514879,2515282..2515340)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09020"
FT                   /old_locus_tag="Vv17s0000g09020"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSI7"
FT                   /protein_id="CCB42952.1"
FT                   /translation="MKPERNSSELGKSSQFEFICSNGVQYRDAEDNKPPLSCEGMQYAY
FT                   SKDHDLEGNCATLPPSFTTLLAGVCIAPKKETPEEVLPDAQHVRYMTGSSFNDMLTRLE
FT                   MVISEMGGDLAL"
FT   3'UTR           2515341..2515576
FT                   /locus_tag="VIT_17s0000g09020"
FT                   /old_locus_tag="Vv17s0000g09020"
FT   gene            2520920..2523384
FT                   /locus_tag="VIT_17s0000g09010"
FT                   /old_locus_tag="Vv17s0000g09010"
FT   mRNA            join(2520920..2521169,2522136..2522175,2522244..2522266,
FT                   2522267..2522796,2523360..2523384)
FT                   /locus_tag="VIT_17s0000g09010"
FT                   /old_locus_tag="Vv17s0000g09010"
FT                   /product="Predicted protein"
FT   5'UTR           2520920..2521169
FT                   /locus_tag="VIT_17s0000g09010"
FT                   /old_locus_tag="Vv17s0000g09010"
FT   CDS_pept        join(2522267..2522796,2523360..2523384)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09010"
FT                   /old_locus_tag="Vv17s0000g09010"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR004883"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSI8"
FT                   /protein_id="CCB42953.1"
FT                   /translation="MASSSSYNSPCAACKFLRRKCMPGCIFAPYFPPEEPQKFANVHKI
FT                   FGASNVTKLLNELLPHQREDAVNSLAYEAEARVRDPVYGCVGAISFLQRQVERLQKELD
FT                   AANADLIRYACNEMSSQLPSPSLVRSTSRRIGNEGGGSYFQNPGYSHPYSLPWDDNPSG
FT                   NMNESGGGGGGGSMTTTLLSQ"
FT   gene            2532599..2533321
FT                   /locus_tag="VIT_17s0000g09000"
FT                   /old_locus_tag="Vv17s0000g09000"
FT   mRNA            join(2532599..2532658,2532659..2533087,2533088..2533321)
FT                   /locus_tag="VIT_17s0000g09000"
FT                   /old_locus_tag="Vv17s0000g09000"
FT                   /product="Oleosin"
FT   5'UTR           2532599..2532658
FT                   /locus_tag="VIT_17s0000g09000"
FT                   /old_locus_tag="Vv17s0000g09000"
FT   CDS_pept        2532659..2533087
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g09000"
FT                   /old_locus_tag="Vv17s0000g09000"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5B9G2"
FT                   /db_xref="InterPro:IPR000136"
FT                   /db_xref="UniProtKB/TrEMBL:A5B9G2"
FT                   /protein_id="CCB42954.1"
FT                   /translation="MAEHQQRPGFMPEKGPSTSQVLAVITLFPVGGILLVLSGLTLAGT
FT                   LIGLTVATPLFVIFSPILVPAALVLALAITGFLTSGAFGITALSSLSWIVNYLRKGRVT
FT                   EQMEHARWRVQEGAGQLGMKAKEVGHGIQGKAQETTRT"
FT   3'UTR           2533088..2533321
FT                   /locus_tag="VIT_17s0000g09000"
FT                   /old_locus_tag="Vv17s0000g09000"
FT   gene            complement(2537209..2541993)
FT                   /locus_tag="VIT_17s0000g08990"
FT                   /old_locus_tag="Vv17s0000g08990"
FT   mRNA            complement(join(2537209..2537303,2537304..2537521,
FT                   2537622..2537926,2538051..2538331,2539159..2539462,
FT                   2540611..2540899,2541626..2541650,2541651..2541919,
FT                   2541940..2541993))
FT                   /locus_tag="VIT_17s0000g08990"
FT                   /old_locus_tag="Vv17s0000g08990"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(2537209..2537303)
FT                   /locus_tag="VIT_17s0000g08990"
FT                   /old_locus_tag="Vv17s0000g08990"
FT   CDS_pept        complement(join(2537304..2537521,2537622..2537926,
FT                   2538051..2538331,2539159..2539462,2540611..2540899,
FT                   2541626..2541650))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08990"
FT                   /old_locus_tag="Vv17s0000g08990"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHL6"
FT                   /db_xref="InterPro:IPR006948"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHL6"
FT                   /protein_id="CBI14976.3"
FT                   /translation="MKHIEGYLRVSLFLSEMGKLSGVFSLRHFLVLSLALNVALISRVV
FT                   YEGENWREEQIRALMADASEKSAHVSMSSPPPPSPSTPSSMAVTSTEIKDDGERVINLD
FT                   HGDPTMYERFWQQMGDITTIVISGWQSMSYFSDVKNLCWFLEPEFAKQIIRLHKIVGNA
FT                   VTDNYYIVVGTGSTQLFQAALYALSPPNASEPMSVVSAAPFYSSYPSVTDFLKSGLYKW
FT                   AGDANNFNKDGPYIELVTSPNNPDGSIRQPVVNRSGENLVHDFAYYWPQYTPISSPADH
FT                   DLMLFTVSKATGHAGMRLGWALVKDKEVAKKMTSFIELNTIGVSKDSQQRAAKILQVIS
FT                   DSYEPVGNPKQSGPFFHFSHSMMEERWKALRSAVKQSGLFSLPEFPSSFCNFLGQAFGS
FT                   QPAFAWLKCEGGIEDCGNFLKRHKILTRNGKHFGASPEYVRVSMLDRDESFNLFTKRLS
FT                   SLHLSQSKDHEKESP"
FT   5'UTR           complement(2541940..2541993)
FT                   /locus_tag="VIT_17s0000g08990"
FT                   /old_locus_tag="Vv17s0000g08990"
FT   gene            2544411..2544979
FT                   /locus_tag="VIT_17s0000g08980"
FT                   /old_locus_tag="Vv17s0000g08980"
FT   mRNA            join(2544411..2544851,2544852..2544979)
FT                   /locus_tag="VIT_17s0000g08980"
FT                   /old_locus_tag="Vv17s0000g08980"
FT                   /product="putative uncharacterized protein"
FT   CDS_pept        2544411..2544851
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08980"
FT                   /old_locus_tag="Vv17s0000g08980"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSJ0"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR042160"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSJ0"
FT                   /protein_id="CCB42955.1"
FT                   /translation="MEDQHERVPVDGRVLVEEKVLVEQLVPVKRVHVEERFHLEERVPV
FT                   EGRILVEENFDPSVMGRTNENGYESMFGSGNLDGGLEDKQETLVLERPAKKLKYHRHTQ
FT                   EQINELETCFKKWPHPNDKQRLDLSRKLSLEPRQVNFWFQNR"
FT   3'UTR           2544852..2544979
FT                   /locus_tag="VIT_17s0000g08980"
FT                   /old_locus_tag="Vv17s0000g08980"
FT   gene            complement(2592542..2603273)
FT                   /locus_tag="VIT_17s0000g08970"
FT                   /old_locus_tag="Vv17s0000g08970"
FT   mRNA            complement(join(2592542..2592659,2592660..2593802,
FT                   2601932..2602198,2602199..2602210,2602334..2602529,
FT                   2602961..2603273))
FT                   /locus_tag="VIT_17s0000g08970"
FT                   /old_locus_tag="Vv17s0000g08970"
FT                   /product="Predicted protein"
FT   3'UTR           complement(2592542..2592659)
FT                   /locus_tag="VIT_17s0000g08970"
FT                   /old_locus_tag="Vv17s0000g08970"
FT   CDS_pept        complement(join(2592660..2593802,2601932..2602198))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08970"
FT                   /old_locus_tag="Vv17s0000g08970"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR010820"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSJ1"
FT                   /protein_id="CCB42956.1"
FT                   /translation="MDRFDSAKAAHEKVGTSYDGALISVVDKKMKEHTDTFLHVVDALI
FT                   TRLSQLESRTRNIESYVDELKASTEYNHGRTNGKLKQLENTLREVQGGIHDLRDKQEIV
FT                   EAQLQLAKLQVSKGKLQAENQISATQAQIVQGISSTAPQQTHQPLLVPVSCQQPPPALL
FT                   SNASPSLNHQNPPPPPPPPPPPPASAAVQLPTQVPQNQISFSHPGSYYLPHPPAPGTTH
FT                   QQCQIPPAPQSQLPPSVPHQPYQPAPQLQPSQLPQLPHVPPHLSAVNPQVPPSGHPIKE
FT                   IPYMSSQSYPPSFHQPPFRPPSSVPSTQQFYKGSTLKMDEEPPSRPNSEFPTGYGTPPA
FT                   YAHLSDFYARSGSNSYSNDSTMKPLQFSPLASVPSGGTSYTQLPTAQILPHALPTASSV
FT                   GGGSGPSVTGNRISSDDVVDKVAAMGFRRDLVRATVRKLTENGQSADLNVVLDKLMNDG
FT                   EDQAQTVWFTR"
FT   5'UTR           complement(2602961..2603273)
FT                   /locus_tag="VIT_17s0000g08970"
FT                   /old_locus_tag="Vv17s0000g08970"
FT   gene            complement(2603812..2607509)
FT                   /locus_tag="VIT_17s0000g08960"
FT                   /old_locus_tag="Vv17s0000g08960"
FT   mRNA            complement(join(2603812..2604387,2604482..2604849,
FT                   2604950..2605127,2606269..2607489,2607490..2607509))
FT                   /locus_tag="VIT_17s0000g08960"
FT                   /old_locus_tag="Vv17s0000g08960"
FT                   /product="Predicted protein"
FT   CDS_pept        complement(join(2603812..2604387,2604482..2604849,
FT                   2604950..2605127,2606269..2607489))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08960"
FT                   /old_locus_tag="Vv17s0000g08960"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHL8"
FT                   /db_xref="InterPro:IPR008811"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHL8"
FT                   /protein_id="CBI14978.3"
FT                   /translation="MAPSLSKGAPDVMGLEDGQSSSSITLQGSDFLANGHPVLTEVPSN
FT                   IVAIPSPSSPGNKAKTMVGCFVGFEAGEAKSRHVVPVGKLQEIPFMSIFRFKVWWTTHW
FT                   VGTRGGDVEHETQMMILDKSDMGRPYVLLLPLIEGPFRASLQPGEDDNVDICVESGSTS
FT                   VRTSAFRSCLYMHVGDNPYELVKDAMKVVRVHLGTFKLLEEKSPPGIVDKFGWCTWDAF
FT                   YLKVHPEGVWEGVKGLVEGGCPPGMVLIDDGWQSIGHDDEPISDQEGINRTAAGEQMPC
FT                   RLIKFEENYKFREYESPRVPQEKGMGAFVRDLKDEFKSVEHVYVWHALCGYWGGIRPNV
FT                   PGMPESRVIAPKLSQGLQMTMEDLAVDKIVNNGVGLVPPESVAEMYDGLHSRLQSVGVD
FT                   GVKVDVIHLLEMVAEEYGGRVELAKAYYKALTASVRKHFKGNGVIASMEHCNDFMFLGT
FT                   ETISLGRVGDDFWCTDPSGDPNGTFWLQGCHMVHCAYNSLWMGNFIHPDWDMFQSTHPC
FT                   AEFHAASRAVSGGPIYVSDHVGKHNFQLLKTLVLPDGSLLRCQHYALPSRDCLFQDPLH
FT                   DGKTMLKIWNLNKYTGVLGAFNCQGGGWCRETRRNKSASEYSRTVSCLANPSKDIEWSA
FT                   GKSPISTKDVDLFAVYMFQEKTMKLLKPSESLEISLDPFKFELLTVSPVKVLPRNNNNS
FT                   IQFAPFGLVNMLNGGGAVEWVELDEDEDRVKIGVKGCGEMKAFASEKPTTCKINGEGVK
FT                   FSYEAHTVGVQVPWPSSSQVSIVEYLF"
FT   5'UTR           complement(2607490..2607509)
FT                   /locus_tag="VIT_17s0000g08960"
FT                   /old_locus_tag="Vv17s0000g08960"
FT   gene            2610526..2618039
FT                   /locus_tag="VIT_17s0000g08950"
FT                   /old_locus_tag="Vv17s0000g08950"
FT   mRNA            join(2610526..2610636,2610637..2610716,2611077..2611182,
FT                   2611280..2611448,2611853..2611910,2612000..2612124,
FT                   2612216..2612305,2612720..2612989,2615520..2615743,
FT                   2617036..2617254,2617682..2617792,2617793..2618039)
FT                   /locus_tag="VIT_17s0000g08950"
FT                   /old_locus_tag="Vv17s0000g08950"
FT                   /product="Predicted protein"
FT   5'UTR           2610526..2610636
FT                   /locus_tag="VIT_17s0000g08950"
FT                   /old_locus_tag="Vv17s0000g08950"
FT   CDS_pept        join(2610637..2610716,2611077..2611182,2611280..2611448,
FT                   2611853..2611910,2612000..2612124,2612216..2612305,
FT                   2612720..2612989,2615520..2615743,2617036..2617254,
FT                   2617682..2617792)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08950"
FT                   /old_locus_tag="Vv17s0000g08950"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHL9"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="InterPro:IPR041591"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHL9"
FT                   /protein_id="CBI14979.3"
FT                   /translation="MAEEPDYQYDESIFKWDEKSQLYFHPSSGFYHDPNAGWYYSSRDG
FT                   LYYKFEDGNYVLLDSQKVQGDECAIDEGGEVLPGNTIQDEQCTNSYCWNDEYYSSFQGD
FT                   ESEGMGTAADECTPGHTTCVSSHDAENPPPPSEWLEDTLIDLYLSGYSTTAINATDEVR
FT                   MPLETDEGDNFKLSAHGNGDDHELEGECVLEDHHGVTDSIGNVVAKGDSWDEENWRAQY
FT                   GQVIKSEDSIPNFPVVDLWDWAMVSGVKKDGKGQVARLVGRLVRQSTKLHPSMPSGGGL
FT                   MKTAPICEVHLDLVRVTSGQVYRLKSPSSRYLASLSIYDSSNPTKDWSFPKLSVDQNML
FT                   PLSKCRNSESKVTDGVAIQKDLSVLQDPKSASDKHKSHVYRDRAAERRTLHGGFGVGPG
FT                   QKNLVVGDAMPSSPVSVSTEEAAAEALNMSFGAGSYARRILESMGWKEGEALGNTAKGL
FT                   LEPLEAVANRGNAGLGWIHSRMKHN"
FT   3'UTR           2617793..2618039
FT                   /locus_tag="VIT_17s0000g08950"
FT                   /old_locus_tag="Vv17s0000g08950"
FT   gene            complement(2618604..2642165)
FT                   /locus_tag="VIT_17s0000g08940"
FT                   /old_locus_tag="Vv17s0000g08940"
FT   mRNA            complement(join(2618604..2618796,2618797..2618958,
FT                   2621107..2621162,2627347..2627416,2627785..2627946,
FT                   2629597..2629650,2631472..2631519,2632243..2632320,
FT                   2632415..2632479,2632639..2632726,2636981..2637017,
FT                   2637330..2637397,2641711..2641772,2641881..2641932,
FT                   2642013..2642045,2642046..2642165))
FT                   /locus_tag="VIT_17s0000g08940"
FT                   /old_locus_tag="Vv17s0000g08940"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(2618604..2618796)
FT                   /locus_tag="VIT_17s0000g08940"
FT                   /old_locus_tag="Vv17s0000g08940"
FT   CDS_pept        complement(join(2618797..2618958,2621107..2621162,
FT                   2627347..2627416,2627785..2627946,2629597..2629650,
FT                   2631472..2631519,2632243..2632320,2632415..2632479,
FT                   2632639..2632726,2636981..2637017,2637330..2637397,
FT                   2641711..2641772,2641881..2641932,2642013..2642045))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08940"
FT                   /old_locus_tag="Vv17s0000g08940"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHM0"
FT                   /db_xref="InterPro:IPR029732"
FT                   /db_xref="InterPro:IPR033757"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHM0"
FT                   /protein_id="CBI14980.3"
FT                   /translation="MSMASLPHIDDDDDFGGDFSGGHNGRRSGNKRGFGDLEDDEDDIF
FT                   SNKKGSFKLEETAPGVATGMILSLRESLQNCKDTLATCQTELEAARSEIQKWHSSFQND
FT                   SFIPAGTSLEPKLVVNYLQTLKSSEESLREQLEKAKKKEAAFIVTFAKREQEIAELKSA
FT                   VRDLKAQLKPPSMQARRLLLDPAIHEEFTRLKNLVEEKEKKVKELQDNVAAVNFTPQSK
FT                   MGKMLMAKCRTLQEENEEIGNIASEGKMHELTMKLALQKSQNAELRSQFEGLYKHMEGL
FT                   TNDVEKSNEMVLILQEQLEEKDSELKRLKEELEQKTQMEAENNDSASDKKVSDDATIPV
FT                   EDGN"
FT   5'UTR           complement(2642046..2642165)
FT                   /locus_tag="VIT_17s0000g08940"
FT                   /old_locus_tag="Vv17s0000g08940"
FT   gene            2653869..2678231
FT                   /locus_tag="VIT_17s0000g08930"
FT                   /old_locus_tag="Vv17s0000g08930"
FT   mRNA            join(2653869..2653895,2653896..2653927,2654323..2654533,
FT                   2661425..2661577,2664783..2664831,2667204..2667287,
FT                   2667657..2667760,2669255..2669341,2669475..2669528,
FT                   2670633..2670728,2672203..2672330,2672621..2672747,
FT                   2672844..2672903,2673073..2673180,2675293..2675393,
FT                   2677684..2677735,2677946..2678044,2678045..2678231)
FT                   /locus_tag="VIT_17s0000g08930"
FT                   /old_locus_tag="Vv17s0000g08930"
FT                   /product="Predicted protein"
FT   5'UTR           2653869..2653895
FT                   /locus_tag="VIT_17s0000g08930"
FT                   /old_locus_tag="Vv17s0000g08930"
FT   CDS_pept        join(2653896..2653927,2654323..2654533,2661425..2661577,
FT                   2664783..2664831,2667204..2667287,2667657..2667760,
FT                   2669255..2669341,2669475..2669528,2670633..2670728,
FT                   2672203..2672330,2672621..2672747,2672844..2672903,
FT                   2673073..2673180,2675293..2675393,2677684..2677735,
FT                   2677946..2678044)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08930"
FT                   /old_locus_tag="Vv17s0000g08930"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHM1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR006595"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHM1"
FT                   /protein_id="CBI14981.3"
FT                   /translation="MSSTLEIEARDVIKIVLQFCKENSLHQTFQTLQSECQVSLNTVDS
FT                   LETFIADINSGRWDAILPQVAQLKLPRKKLEDLYEQIVLEMIELRELDTARAILRQTQA
FT                   MGVMKQEQPERYLRLEHLLVRTYFDPHEAYQDSTKEKRRAQIAQALAAEVSVVPPSRLM
FT                   ALIGQALKWQQHQGLLPPGTQFDLFRGTAAMKQDVDDMYPTTLGHTIKFGTKSHAEYAR
FT                   FSPDGQFLVSCSVDGFIEVWDHISGKLKKDLQYQADETFMMHDDAVLCVDFSRDSEMLA
FT                   SGSQDGKIKVWRIRTGQCLRRLERAHSQGVTSLVFSRDGSQILSASFDSTARIHGLKSG
FT                   KLLKEFRGHSSYVNDAIFTNDGGRVVTASSDCTVKVWDVKTTDCLQTFKPPPPLRGGDA
FT                   SVNGVHLFPKNTDHIIVCNRTSSIYLMTLQGQVVKSFSSGKREGGDFVAACVSPKGEWI
FT                   YCVGEDRNIYCFSYQSGKLEHLMKVHEKDVIGVTHHPHRNLVATYSEDSTMKLWKP"
FT   3'UTR           2678045..2678231
FT                   /locus_tag="VIT_17s0000g08930"
FT                   /old_locus_tag="Vv17s0000g08930"
FT   gap             2679180..2679279
FT                   /estimated_length=100
FT   gene            2698402..2700881
FT                   /locus_tag="VIT_17s0000g08920"
FT                   /old_locus_tag="Vv17s0000g08920"
FT   mRNA            join(2698402..2698408,2698409..2698532,2699007..2699238,
FT                   2699501..2699580,2699711..2699864,2699959..2700037,
FT                   2700125..2700212,2700319..2700365,2700507..2700695,
FT                   2700696..2700881)
FT                   /locus_tag="VIT_17s0000g08920"
FT                   /old_locus_tag="Vv17s0000g08920"
FT                   /product="unknown predicted protein"
FT   5'UTR           2698402..2698408
FT                   /locus_tag="VIT_17s0000g08920"
FT                   /old_locus_tag="Vv17s0000g08920"
FT   CDS_pept        join(2698409..2698532,2699007..2699238,2699501..2699580,
FT                   2699711..2699864,2699959..2700037,2700125..2700212,
FT                   2700319..2700365,2700507..2700695)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08920"
FT                   /old_locus_tag="Vv17s0000g08920"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHM2"
FT                   /protein_id="CBI14982.3"
FT                   /translation="MKETLRYLAGLAGPSGYGSNSTAEQVTEDCSLPSQLTAIITGATS
FT                   GIGAETARVMAKRGVRVIIPARDLKKAGEMKERIQKESPKAEVIVLEIDLSSFASIKRF
FT                   CSEFLSLGLPLHILINNAGKFSHKLEFSEDKIEMSFATNYLGHFLLTELLIEKMVETAA
FT                   QTGIQGRIINVSSVIHSWVKRDGFRFNQMLNPKNYNGTRAYAQSKLANILHAKELARQL
FT                   KARNARVTINAVHPGIVKTGIIRDHKGFITDSLFFIASKLLKSTSQGASTTCYVGLSRK
FT                   TEGVSGKYYADCNECSCSSMANDESEAHNLWRQSRALIHRRLRLPAAAA"
FT   3'UTR           2700696..2700881
FT                   /locus_tag="VIT_17s0000g08920"
FT                   /old_locus_tag="Vv17s0000g08920"
FT   gene            complement(2708990..2719755)
FT                   /locus_tag="VIT_17s0000g08910"
FT                   /old_locus_tag="Vv17s0000g08910"
FT   mRNA            complement(join(2708990..2709148,2709149..2709160,
FT                   2710114..2710349,2710472..2710594,2710684..2710773,
FT                   2710857..2710970,2717691..2717837,2719034..2719099,
FT                   2719486..2719654,2719655..2719755))
FT                   /locus_tag="VIT_17s0000g08910"
FT                   /old_locus_tag="Vv17s0000g08910"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(2708990..2709148)
FT                   /locus_tag="VIT_17s0000g08910"
FT                   /old_locus_tag="Vv17s0000g08910"
FT   CDS_pept        complement(join(2709149..2709160,2710114..2710349,
FT                   2710472..2710594,2710684..2710773,2710857..2710970,
FT                   2717691..2717837,2719034..2719099,2719486..2719654))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08910"
FT                   /old_locus_tag="Vv17s0000g08910"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHM3"
FT                   /db_xref="InterPro:IPR013255"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHM3"
FT                   /protein_id="CBI14983.3"
FT                   /translation="MQSKVEQSARTKMQELRLICDKEIPIQQQKIDSAVLSFRRSLETL
FT                   QSKAHKTVENQVKLGKLKAQLREMEDDLVKALAVKTRKEAKKMAIMDSISATKAKIEEL
FT                   KRIVEEHKARKDQCAAIISQQDIALATYEGKGDQVTGRREEIQEAIAWYNEVLGFQIEG
FT                   GHGVKFIFTNINSKNPSEEYSFTIRHANDTYTLLDCSPHLNDIKELIHELNRTNGLFKF
FT                   VRIMREKFQKAAEFGVLPQFTPLHQHSSTISISAPVSSVSTDNRDESPAEKNELQIKHE
FT                   RTNWHSEKAIHEGGRHAFLSPGSALSLRRSPRFQVRK"
FT   5'UTR           complement(2719655..2719755)
FT                   /locus_tag="VIT_17s0000g08910"
FT                   /old_locus_tag="Vv17s0000g08910"
FT   gene            2727525..2731999
FT                   /locus_tag="VIT_17s0000g08900"
FT                   /old_locus_tag="Vv17s0000g08900"
FT   mRNA            join(2727525..2728136,2728137..2730912,2731222..2731712,
FT                   2731713..2731999)
FT                   /locus_tag="VIT_17s0000g08900"
FT                   /old_locus_tag="Vv17s0000g08900"
FT                   /product="unknown predicted protein"
FT   5'UTR           2727525..2728136
FT                   /locus_tag="VIT_17s0000g08900"
FT                   /old_locus_tag="Vv17s0000g08900"
FT   CDS_pept        join(2728137..2730912,2731222..2731712)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08900"
FT                   /old_locus_tag="Vv17s0000g08900"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSJ2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013210"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSJ2"
FT                   /protein_id="CCB42957.1"
FT                   /translation="MASAINQQGQALLWWKGSLKEAPEALSNWDQSNETPCGWFGISCN
FT                   SDNLVVELNLRYVDLFGPLPSNFSSLTSLNKLVLTGTNLTGSIPKEIGVLQDLNYLDLS
FT                   DNALTGEIPSEVCSLLKLEQLYLNSNWLEGSIPVQLGNLTSLTWLILYDNQLSGAIPSS
FT                   IGNLKKLEVIRAGGNKNLEGPLPQEIGNCTNLAMIGLAETSMSGFLPPSLGRLKKLQTL
FT                   AIYTALLSGPIPPELGDCTELQNIYLYENALTGSIPARLGSLRNLQNLLLWQNNLVGTI
FT                   PPELGNCKQLVVIDISMNSISGRVPQTFGNLSFLQELQLSVNQISGQIPAQIGNCLGLT
FT                   HIELDNNKITGTIPSSIGGLVNLTLLYLWQNMLEGNIPESISNCRSLEAVDFSENSLTG
FT                   PIPKGIFQLKKLNKLLLLSNNLAGEIPPEIGECSSLIRLRASDNKLAGSIPPQIGNLKN
FT                   LNFLDLALNRLTGVIPQEISGCQNLTFLDLHSNSIAGNLPENLNQLVSLQFVDVSDNLI
FT                   EGTLSPSLGSLSSLTKLILRKNRLSGLIPSELNSCAKLVLLDLSSNDLTGKIPSSVGEI
FT                   PALEIALNLSWNKLSGKIPSEFTDLDKLGILDLSHNQLSGDLQPLFDLQNLVVLNISYN
FT                   NFSGRVPDTPFFSKLPLSVLAGNPALCLSGDQCAADKRGGAARHAAAARVAMVVLLCAA
FT                   CALLLAALYIILGNKMNPRGPGGPHQCDGDSDVEMAPPWELTLYQKLDLSIADVVRCLT
FT                   VANVVGRGRSGVVYRANTPSGLTIAVKRFRSSEKFSAAAFSSEIATLARIRHRNIVRLL
FT                   GWAANRKTKLLFYDYLPSGTLGTLLHECNSAIVEWESRFNIALGVAEGLAYLHHDCVPP
FT                   IIHRDVKAHNILLGDRYEACLADFGLARLVEDDDGNGSFSANPQFAGSYGYIAPEYACM
FT                   LKITEKSDVYSFGVVLLEIITGKKPVDPSFPDGQHVIQWVREQLKSKRDPVQILDPKLQ
FT                   GHPDTQIQEMLQALGISLLCTSNRAEDRPTMKDVAVLLREIRHEPSTGTEPHKPNSNGS
FT                   KKPEAPAYSSQLLLLQGSSQYSLAYSSSSAGYNVNNDASV"
FT   3'UTR           2731713..2731999
FT                   /locus_tag="VIT_17s0000g08900"
FT                   /old_locus_tag="Vv17s0000g08900"
FT   gene            complement(2733838..2738960)
FT                   /locus_tag="VIT_17s0000g08890"
FT                   /old_locus_tag="Vv17s0000g08890"
FT   mRNA            complement(join(2733838..2734006,2734007..2734309,
FT                   2734705..2735064,2735206..2735487,2735840..2735911,
FT                   2736024..2736245,2736341..2737107,2737261..2737489,
FT                   2737565..2737730,2738867..2738910,2738911..2738960))
FT                   /locus_tag="VIT_17s0000g08890"
FT                   /old_locus_tag="Vv17s0000g08890"
FT                   /product="Predicted protein"
FT   3'UTR           complement(2733838..2734006)
FT                   /locus_tag="VIT_17s0000g08890"
FT                   /old_locus_tag="Vv17s0000g08890"
FT   CDS_pept        complement(join(2734007..2734309,2734705..2735064,
FT                   2735206..2735487,2735840..2735911,2736024..2736245,
FT                   2736341..2737107,2737261..2737489,2737565..2737730,
FT                   2738867..2738910))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08890"
FT                   /old_locus_tag="Vv17s0000g08890"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHM5"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHM5"
FT                   /protein_id="CBI14985.3"
FT                   /translation="MADPSSSGPSSSPEVKSVKKDFSTAILERKKSPNRLVVDEAVNDD
FT                   NSVVSMNPATMEKLQFFRGDTVLIKGKKRKDTVCIVLVDEQCEEPKIRMNKVVRANLRV
FT                   RLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGNLFDAYLKPYFLESYRPVRKGDLFL
FT                   VRGGMRSVEFKVIETDPGEYCVVAPDTEIFCEGEPIKREDEERLNEVGYDDVGGVRKQM
FT                   AQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFLINGP
FT                   EIMSKLAGESESNLRKAFEEAEKNAPSIIFIDELDSIAPKREKTHGEVERRIVSQLLTL
FT                   MDGLKTRAHVIVIGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKL
FT                   SDDVDLERVAKDTHGYVGADLAALCTEAALQCIREKMDVIDLEDETIDAEVLNSMAVTN
FT                   EHFQTALGSSNPSALRETVVEVPNVSWEDIGGLDNVKRELQETVQYPVEHPEKFEKFGM
FT                   SPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKAR
FT                   QSAPCVLFFDELDSIATQRGSSVGDAGGAADRVLNQLLTEMDGMTAKKTVFIIGATNRP
FT                   DIIDPALLRPGRLDQLIYIPLPDEASRLQIFKACLRKSPVSRDVDLVALARYTHGFSGA
FT                   DITEICQRSCKYAIRENIEKDIERERKKTENPEAMEEDDVDDVPEIKAAHFEESMKFAR
FT                   RSVSDADIRKYQLFAQTLQQSRGFGSEFRFPDQPNNATAASTAADPFSSAAAAGDDDDL
FT                   YS"
FT   5'UTR           complement(2738911..2738960)
FT                   /locus_tag="VIT_17s0000g08890"
FT                   /old_locus_tag="Vv17s0000g08890"
FT   gene            2763614..2770064
FT                   /locus_tag="VIT_17s0000g08880"
FT                   /old_locus_tag="Vv17s0000g08880"
FT   mRNA            join(2763614..2763614,2763615..2763824,2764940..2765107,
FT                   2765760..2765922,2766083..2766227,2767054..2767111,
FT                   2767279..2767359,2767974..2768030,2768137..2768248,
FT                   2769163..2769665,2769666..2770064)
FT                   /locus_tag="VIT_17s0000g08880"
FT                   /old_locus_tag="Vv17s0000g08880"
FT                   /product="unknown predicted protein"
FT   5'UTR           2763614..2763614
FT                   /locus_tag="VIT_17s0000g08880"
FT                   /old_locus_tag="Vv17s0000g08880"
FT   CDS_pept        join(2763615..2763824,2764940..2765107,2765760..2765922,
FT                   2766083..2766227,2767054..2767111,2767279..2767359,
FT                   2767974..2768030,2768137..2768248,2769163..2769665)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08880"
FT                   /old_locus_tag="Vv17s0000g08880"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHM6"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR041667"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHM6"
FT                   /protein_id="CBI14986.3"
FT                   /translation="MGLRIGGEIEKENGDELSYSDFVERYLMKNRPVVLRGLMDGWRAC
FT                   KDWVTHTGQPNLEFFSTHFGKSIVQVADCGTREFTDQKRMEMSVAEFIDHWLKDSANYH
FT                   VNATTNEHGKPLVYLKDWHFVKEYPEYLAYTTPLFFRDDWLNLYLDNYSMHNEPDACQE
FT                   KNEISCSDYRFVYMGAKGTWTPLHADVFRSYSWSANVCGKKKWLFLPPSQSHLVFDRHE
FT                   YVFLHIYSVYNICEDVNEAKFPGFKKAVWLECIQEQDEIIFVPSGWYHQVHNLEDTISI
FT                   NHNWFNAYNLSWVWDLLLKDYNEAKEYIEDVRDICDDFEGLCQRNLAANTGMNFCDFFI
FT                   FIACFSFANLVQLYHLHRVNENPSWCLFPKAQHLALNLLSAQKIVLKMKTVDALAGDHA
FT                   LLLDLRKMMDDSKFLELCSGLDRTYRGIHKEQQQNYDKKETLMDGLGDLDFIVKSCSQI
FT                   YAPEDLVSFIDSAVKKLSRAFNRESPLLPELDELRSPDAQ"
FT   3'UTR           2769666..2770064
FT                   /locus_tag="VIT_17s0000g08880"
FT                   /old_locus_tag="Vv17s0000g08880"
FT   gene            complement(2771345..2774784)
FT                   /locus_tag="VIT_17s0000g08870"
FT                   /old_locus_tag="Vv17s0000g08870"
FT   mRNA            complement(join(2771345..2771586,2771587..2771964,
FT                   2772694..2772840,2772931..2772979,2773073..2773260,
FT                   2773683..2773895,2774120..2774206,2774303..2774518,
FT                   2774519..2774784))
FT                   /locus_tag="VIT_17s0000g08870"
FT                   /old_locus_tag="Vv17s0000g08870"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(2771345..2771586)
FT                   /locus_tag="VIT_17s0000g08870"
FT                   /old_locus_tag="Vv17s0000g08870"
FT   CDS_pept        complement(join(2771587..2771964,2772694..2772840,
FT                   2772931..2772979,2773073..2773260,2773683..2773895,
FT                   2774120..2774206,2774303..2774518))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08870"
FT                   /old_locus_tag="Vv17s0000g08870"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR004314"
FT                   /db_xref="InterPro:IPR025521"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSL1"
FT                   /protein_id="CCB42958.1"
FT                   /translation="MASSSPIMFIFVAFLFAASSLSPVLSHPIPSDSGHHRPTANQTFH
FT                   PGLQLQKLKRVRAYLRKINKPAVKTIQSPDGDVIDCVLSHLQPAFDHPQLRGKKPLDPP
FT                   ERPKGHDSINAVAETFQIWMNSGESCPEGTIPIRRTTEKDILRASSIKRFGRKLRRNVK
FT                   RDSTSSDHEHAVVFVNGDQYYGAKASINVWAPHVADQYEFSLSQIWIISGSFGNDLNTI
FT                   EAGWQACIYTLFGPELYGDNYPRFFTYWTTDAYQATGCYNLLCSGFVQTNNKIAIGAAI
FT                   SPRSSYNGKQFDIGLMVWKDPKHGHWWLEYGSGLLVGYWPSFLFSHLGNHANMIQFGGE
FT                   IVNTRSTGFHTSTQMGSGHFAEEGFGKASYFRNLQVVDWDNSLLPLQNLHLLADHSNCY
FT                   DIKQGKNNVWGTYFYYGGPGRNVKCP"
FT   5'UTR           complement(2774519..2774784)
FT                   /locus_tag="VIT_17s0000g08870"
FT                   /old_locus_tag="Vv17s0000g08870"
FT   gene            2790969..2792593
FT                   /locus_tag="VIT_17s0000g08860"
FT                   /old_locus_tag="Vv17s0000g08860"
FT   mRNA            join(2790969..2791084,2791085..2791579,2791664..2791840,
FT                   2791916..2792095,2792192..2792419,2792420..2792593)
FT                   /locus_tag="VIT_17s0000g08860"
FT                   /old_locus_tag="Vv17s0000g08860"
FT                   /product="Predicted protein"
FT   5'UTR           2790969..2791084
FT                   /locus_tag="VIT_17s0000g08860"
FT                   /old_locus_tag="Vv17s0000g08860"
FT   CDS_pept        join(2791085..2791579,2791664..2791840,2791916..2792095,
FT                   2792192..2792419)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08860"
FT                   /old_locus_tag="Vv17s0000g08860"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR006577"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSL2"
FT                   /protein_id="CCB42959.1"
FT                   /translation="MVSLPRSIIGGVSRVMGHGIDLMGIGGRRNQHLLQPNFQLPHPQQ
FT                   PEMVPEEWAFLTSFEQQYGSSHPFFYVCRFTDALKMAEDDHKFLFMYLHSPQHPFTYSF
FT                   CSETLCSELVTQFLDANFVSWGALADRGEGLHMAATLRPGSFPFCAVVAPASGDSLAVL
FT                   QQIEGPIYPAELVEILQRTMEEQGLAFGSSSRAVEEEKRRADRRLREEQDAAYLAALQI
FT                   DEEKSRPKDLRSEQVVQKKPVQAAKHNPSKKQTGKKVKEATTVTETPHNETANEEKDSR
FT                   VTQILIRFPNGERREHSFSVMDKVQSVYRYIDSLGLSGVGNYRLISSFPRRVYSVEEMG
FT                   MTLKDACLHPRASLFLELL"
FT   3'UTR           2792420..2792593
FT                   /locus_tag="VIT_17s0000g08860"
FT                   /old_locus_tag="Vv17s0000g08860"
FT   gene            2794223..2798421
FT                   /locus_tag="VIT_17s0000g08850"
FT                   /old_locus_tag="Vv17s0000g08850"
FT   mRNA            join(2794223..2794257,2794258..2794386,2795100..2795252,
FT                   2795986..2796132,2796394..2796546,2797245..2797367,
FT                   2797828..2797905,2797906..2797925,2798188..2798421)
FT                   /locus_tag="VIT_17s0000g08850"
FT                   /old_locus_tag="Vv17s0000g08850"
FT                   /product="unknown predicted protein"
FT   5'UTR           2794223..2794257
FT                   /locus_tag="VIT_17s0000g08850"
FT                   /old_locus_tag="Vv17s0000g08850"
FT   CDS_pept        join(2794258..2794386,2795100..2795252,2795986..2796132,
FT                   2796394..2796546,2797245..2797367,2797828..2797905)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08850"
FT                   /old_locus_tag="Vv17s0000g08850"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR036273"
FT                   /db_xref="InterPro:IPR036865"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHM9"
FT                   /protein_id="CBI14989.3"
FT                   /translation="MAMRLSHPLRPSSLPKFQFRPKSLSTCKFSIQNRISNSDNSRKLV
FT                   MEVKEKLEKDQHSLPVGRNGRDDEDMILWFLKDRKFSVEDAVAKLTKAIKWRQEFGVSE
FT                   LHEESVRIVAETGKAYVHDFLDVNDRPVLIVVASKHFPAMQDPIEDEKLCVFLIEKVLS
FT                   KLPAGKEQILGIIDLRGFGTENADLKFLTFLFDVFYYYYPRRVGQVLFVEAPFVFKPIW
FT                   QLVKPLLKSYASLVRFCSMETVRKEYFTEESFPASFRD"
FT   3'UTR           join(2797906..2797925,2798188..2798421)
FT                   /locus_tag="VIT_17s0000g08850"
FT                   /old_locus_tag="Vv17s0000g08850"
FT   gene            complement(2798864..2801413)
FT                   /locus_tag="VIT_17s0000g08840"
FT                   /old_locus_tag="Vv17s0000g08840"
FT   mRNA            complement(join(2798864..2799135,2799136..2799358,
FT                   2800530..2800713,2801226..2801367,2801368..2801413))
FT                   /locus_tag="VIT_17s0000g08840"
FT                   /old_locus_tag="Vv17s0000g08840"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(2798864..2799135)
FT                   /locus_tag="VIT_17s0000g08840"
FT                   /old_locus_tag="Vv17s0000g08840"
FT   CDS_pept        complement(join(2799136..2799358,2800530..2800713,
FT                   2801226..2801367))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08840"
FT                   /old_locus_tag="Vv17s0000g08840"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHN0"
FT                   /protein_id="CBI14990.3"
FT                   /translation="MQAFRQFLAAGHCSPVLRIGVRVLSTSDSASLKKNVASILDSLSL
FT                   KPGATLVQNCGDSEIGKVVIQLAKERKLQTLSIIDDKPGSADTIEELKALGADIVVPES
FT                   YTKTWYMKRLAGEMSPSAGLNFSDGYQATAVCKAVTSGGTFLTYGKELPKYVAYEGSAR
FT                   KPVEWSTFIKEKKMKVLKM"
FT   5'UTR           complement(2801368..2801413)
FT                   /locus_tag="VIT_17s0000g08840"
FT                   /old_locus_tag="Vv17s0000g08840"
FT   gene            2852985..2860221
FT                   /locus_tag="VIT_17s0000g08830"
FT                   /old_locus_tag="Vv17s0000g08830"
FT   mRNA            join(2852985..2853112,2853234..2853398,2859620..2860073,
FT                   2860074..2860221)
FT                   /locus_tag="VIT_17s0000g08830"
FT                   /old_locus_tag="Vv17s0000g08830"
FT                   /product="Predicted protein"
FT   CDS_pept        join(2852985..2853112,2853234..2853398,2859620..2860073)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08830"
FT                   /old_locus_tag="Vv17s0000g08830"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHN2"
FT                   /db_xref="InterPro:IPR006917"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHN2"
FT                   /protein_id="CBI14992.3"
FT                   /translation="MTHVSDIKLIRTDTTLDLSQKAEKGMLSTATMFLFYIEFLGCPIL
FT                   CCLALCKGIESPEFAVIHAESDFEVRLYPESTWMTASVRDISFEKSTWNGFHRLFQYIQ
FT                   GANLNFSRIAMTAPVLTSIVPGAGPLHSSAYFVRFYLPVKFQATPPLPLPELHLKPDKW
FT                   AIHCIAVRKFSGYARDDNIVKEAEKLAISLSRSPWANFTTSESNYAYSIAQYSSPFQIF
FT                   GRVNEIWVDVKNSGLEGCESSSVSTY"
FT   gap             2857372..2857640
FT                   /estimated_length=269
FT   3'UTR           2860074..2860221
FT                   /locus_tag="VIT_17s0000g08830"
FT                   /old_locus_tag="Vv17s0000g08830"
FT   gene            complement(2860222..2864161)
FT                   /locus_tag="VIT_17s0000g08820"
FT                   /old_locus_tag="Vv17s0000g08820"
FT   mRNA            complement(join(2860222..2860318,2860789..2861004,
FT                   2861122..2861257,2861258..2861796,2862990..2864133,
FT                   2864134..2864161))
FT                   /locus_tag="VIT_17s0000g08820"
FT                   /old_locus_tag="Vv17s0000g08820"
FT                   /product="Predicted protein"
FT   3'UTR           complement(join(2860222..2860318,2860789..2861004,
FT                   2861122..2861257))
FT                   /locus_tag="VIT_17s0000g08820"
FT                   /old_locus_tag="Vv17s0000g08820"
FT   CDS_pept        complement(join(2861258..2861796,2862990..2864133))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08820"
FT                   /old_locus_tag="Vv17s0000g08820"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSL3"
FT                   /db_xref="InterPro:IPR000407"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSL3"
FT                   /protein_id="CCB42960.1"
FT                   /translation="MEPRSPSKFKIPIMGFVQYKRVFNIGIIVLAVVLLLVGVYHVFGP
FT                   GRGGNVLGRPYFTVVVDCGSTGTRVNVYEWVMKGERNWELPMLMHSYPDLSTKSPLWKG
FT                   ACQYHCLQTEPGLDKFVGNYSGVRASLEPLILWAEQQVPPERRGETPVFVLATAGLRRL
FT                   DVVDVKQVLDDAEAVVGKHAFLHRRSWIRVLSGKEEAYYGWIALNYKMGRLGNNSRLPT
FT                   LGLLDLGGSSLQVVMEVGESREDGHLVRSRVGLFEHRILAYSLTEFGINKAFDRTVSML
FT                   SQVQPLREGSGRKLELQHPCLGSDYVNNYTCDGCIFSNATDSNSSQPMRNHHFTSVYLV
FT                   GDLNWEQCKGLARTAAIHSSSSDWSNLTLALNCKAHLPSHSGSNILNSKATTHAAACFH
FT                   ALSGFFVVYTMLNLSQRANMTEIWERGQLLCSRSDAHFGSISGNYARQFCFSVPYLASL
FT                   IEDGLCLGDAEINFGPGDVSWTLGAALVEGEYLWLSTTNSRLSISSLKIKSVLASPFFL
FT                   FILLLGLLLIVYCSQIKLPMPGKRGAGVRSSLPSYIYPKRRPN"
FT   5'UTR           complement(2864134..2864161)
FT                   /locus_tag="VIT_17s0000g08820"
FT                   /old_locus_tag="Vv17s0000g08820"
FT   gene            2881681..2899746
FT                   /locus_tag="VIT_17s0000g08810"
FT                   /old_locus_tag="Vv17s0000g08810"
FT   mRNA            join(2881681..2881741,2881991..2882211,2882617..2882943,
FT                   2888955..2889471,2891706..2892001,2892864..2892888,
FT                   2892889..2892944,2893038..2893082,2893245..2893614,
FT                   2893833..2893935,2894788..2894868,2894969..2896295,
FT                   2896378..2896645,2896726..2899266,2899267..2899359,
FT                   2899453..2899746)
FT                   /locus_tag="VIT_17s0000g08810"
FT                   /old_locus_tag="Vv17s0000g08810"
FT                   /product="Predicted protein"
FT   5'UTR           2881681..2881741
FT                   /locus_tag="VIT_17s0000g08810"
FT                   /old_locus_tag="Vv17s0000g08810"
FT   CDS_pept        join(2892889..2892944,2893038..2893082,2893245..2893614,
FT                   2893833..2893935,2894788..2894868,2894969..2896295,
FT                   2896378..2896645,2896726..2899266)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08810"
FT                   /old_locus_tag="Vv17s0000g08810"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSL4"
FT                   /db_xref="InterPro:IPR038808"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSL4"
FT                   /protein_id="CCB42961.1"
FT                   /translation="MTVLGKVAVPKPINLPSQRLENHGLDPTVEIVPKGTLSWGNRSSA
FT                   SNAWGSSTISPSTDGGSGSPSHLSGRPSSGGSGTRPSTAGSDRASESTASAWGPSSRPS
FT                   SASGPLTSNQSSLASLRPRSAETRPGSSQLSRFAEPLSENPVAWGAAGTAEKLGVASSK
FT                   SDGFSLTSGDFPTLGSEKDNFGKNTELQEHGSHARPGSSSGKVAPVKERTGTSPVGDVS
FT                   VNDVKSGAVNTWKRDNSTYVEDGPRPSVEKWRGESQPYLNASIPPQHFEPWHGTPSPGG
FT                   VWFRGPPGPPYGAPVTPGGFPMEPFPYYRPQIPATALANSQPVPPPGAGPRGHHPKNGD
FT                   MYRPHMPDAYIRPGMPIRPGFYPGPVPYEGYYPPPMGYCNSNERDLPFMGMAAGPPVYE
FT                   RYSNQNARDSNNSHARTGGYGSSGKAMVPEQAESGYHHDNRGPYKVLLKQHNDWDGKDE
FT                   QKWDHTGTTNASDLAKGDQRKTLPWDDDWEGDPKKVEELDSRRIKVVGEAASQTFDNQM
FT                   GSSAPVKVKLTECVSSAKPIDDSSTKKFETAASTFPEAPKPSPPAPKDSTLIQKIEGLN
FT                   AKARASDGRHDAPFVSSREKQKNGLQVDNTKTNQSTKEADSGATYSERIHTNAIPASHE
FT                   VGVSTGLGSKDRSLEQVAASGTVISRRATHGGQGRVDHRGKGRVNAQDVDGWRKKSLVA
FT                   DSSSVTGSGNVELSSNVDVQDCHSSMQVPQKSGLHLQGTEDGESGSMSDPSDSQAQRAK
FT                   MKEIAKQRGRQLQKEEEERLREQKAKAHAKLEELNRRTRTVDGSTQKLENVQSSGAFQH
FT                   KQEELQIVAESNMDASKIGASSSALISGPSVTTQIHESNASRVGGSTDLSRELPIETPR
FT                   SPYQEPIISNNQSLPLQQNANSIDAADNRNSPQINDASISKQKRVGYKQRQNIPKHNIP
FT                   VEKNLTEKLVSTVTIEVPKSLTDVVVSTAASVEHVATEIVTSSESNLPVNANVTTESGH
FT                   QRRKNNRIGRNKLKLEEASLPRETNPGKASVENAEPKASVLELDPSSIESISNSKDAIQ
FT                   SFENRGSLPNEEAHGRPTNQWKPQHPRRMPRNPQVNRSVEKFHNSDSVVWAPVQSQNKS
FT                   EVADEVSQKTVVENTSSRGDHQVQNNLKNKRAEIQRYVPKPVAKELAQQGSIQRPTSPS
FT                   INQTTSDETIGRGESGSQSTDSAQLAGTAIEKSGFAVESRNGDTKPNRQAKSGSWRQRV
FT                   PIESTHVQGLQEESSYNSSVEKNVQKFIEHSETLKPDGQSAKGQSKYSDDWNTPDGWNT
FT                   LESSDSAAPAPSAVVKDQGVTGRGKRHPFKGQKGTGNTHGLDHKNVSSGNTDKMCFQSS
FT                   PLEMGQTDTTVALKENRGAGERSSSHWQPKSQAYPVHNQRGGRHNSSQNVNAEVARTIR
FT                   KESTPHGGAHFPPQHDKETDHPHTDQPASETGTVIEAPNAGHQETKREEKNIASLKGRP
FT                   HSPIQGPVNSVEPLPAGTDIRNEQRLSTGFRKNGNHSNRFSRGGHESHGDWSSGGQDNK
FT                   QHNQPPNRERQRHNSHNEYQPVRPFSNNRSNFEGASDGSHNTSLRFRERGHGHSRRGGG
FT                   NFYSRQSGNVQVDASYD"
FT   3'UTR           join(2899267..2899359,2899453..2899746)
FT                   /locus_tag="VIT_17s0000g08810"
FT                   /old_locus_tag="Vv17s0000g08810"
FT   gene            2899761..2900229
FT                   /locus_tag="VIT_17s0000g08800"
FT                   /old_locus_tag="Vv17s0000g08800"
FT   mRNA            join(2899761..2899900,2899901..2899951,2900179..2900229)
FT                   /locus_tag="VIT_17s0000g08800"
FT                   /old_locus_tag="Vv17s0000g08800"
FT   5'UTR           2899761..2899900
FT                   /locus_tag="VIT_17s0000g08800"
FT                   /old_locus_tag="Vv17s0000g08800"
FT   CDS_pept        join(2899901..2899951,2900179..2900229)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08800"
FT                   /old_locus_tag="Vv17s0000g08800"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSL5"
FT                   /protein_id="CCB42962.1"
FT                   /translation="MEPFRIQVFTWEDREERVLLCRFEKREMCDMQE"
FT   gap             2901937..2902036
FT                   /estimated_length=100
FT   gene            2903462..2907792
FT                   /locus_tag="VIT_17s0000g08790"
FT                   /old_locus_tag="Vv17s0000g08790"
FT   mRNA            join(2903462..2903604,2903605..2903622,2904749..2904784,
FT                   2905072..2905205,2906383..2906838,2907010..2907424,
FT                   2907425..2907792)
FT                   /locus_tag="VIT_17s0000g08790"
FT                   /old_locus_tag="Vv17s0000g08790"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           2903462..2903604
FT                   /locus_tag="VIT_17s0000g08790"
FT                   /old_locus_tag="Vv17s0000g08790"
FT   CDS_pept        join(2903605..2903622,2904749..2904784,2905072..2905205,
FT                   2906383..2906838,2907010..2907424)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08790"
FT                   /old_locus_tag="Vv17s0000g08790"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSL6"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSL6"
FT                   /protein_id="CCB42963.1"
FT                   /translation="MNYCWQVEPMALATHHVPGSYATFPTRSHSWTKGIKLKQYVKTRH
FT                   IVGKPDISFSLKRNLHLSVGTPCVRVPKRRPLKICAFKGSAQNDESGGRASGSKSPKNS
FT                   VRLSYAPQGNEETITESPKSQNVPLPYSSEANGTIGGSLAIQNLFKKWLTMLRTQSPSQ
FT                   EVDEILGEGPAVKEILETQNEIQNKDRGEILKAVWFYFLGMDAVIKIPLLIFIPLYLAV
FT                   NVAYGPEVSKELAPLWVLGPLIVALYIKMLRGICALYVFSFKQTVKLVKNIPTYYLLAY
FT                   TYIAHGKLKEDIQARFWQPVVDIKNLDYRELSRRKLKDLQEWLLERYLDFVESIWPYYC
FT                   RTIRFLKRANLI"
FT   3'UTR           2907425..2907792
FT                   /locus_tag="VIT_17s0000g08790"
FT                   /old_locus_tag="Vv17s0000g08790"
FT   gene            2916906..2921294
FT                   /locus_tag="VIT_17s0000g08780"
FT                   /old_locus_tag="Vv17s0000g08780"
FT   mRNA            join(2916906..2917014,2917309..2917710,2920114..2920457,
FT                   2920581..2920796,2920797..2920815,2920874..2921294)
FT                   /locus_tag="VIT_17s0000g08780"
FT                   /old_locus_tag="Vv17s0000g08780"
FT                   /product="Predicted protein"
FT   CDS_pept        join(2916906..2917014,2917309..2917710,2920114..2920457,
FT                   2920581..2920796)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08780"
FT                   /old_locus_tag="Vv17s0000g08780"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHN7"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHN7"
FT                   /protein_id="CBI14997.3"
FT                   /translation="MLISTPLLLCFDIQLSSSRRSNNRYQDDVQLMRNTEVMEPYHVIH
FT                   GMFNVKRRFPKRQAILFATSEDQSPSDELKPDTSEQEEYHPNAEGIPSASITYFHSEGT
FT                   GGKPGLISFYNRPYKRADEDLISGPPRNQNNLLWFIGPSILVASFIFPSLYLRRILSTV
FT                   FEDSLLTDFLILFFTEALFYCGVAVFLLLIDRLRRSLEPVSDTNSHRIPAPQLGHRIAS
FT                   GAALVLSLIIPMVTMGLVWPWTGPAASATLAPYLVGIVVQFAFEQYARYIKSPSWPVIP
FT                   VVFQVYRLHQLNRAAQLVTALSFTVRGAEMTTHNLAINSSLGTLLNVLQFLGVICIWSL
FT                   SSFLMRFFPSATMTQQ"
FT   3'UTR           join(2920797..2920815,2920874..2921294)
FT                   /locus_tag="VIT_17s0000g08780"
FT                   /old_locus_tag="Vv17s0000g08780"
FT   gene            2923611..2931204
FT                   /locus_tag="VIT_17s0000g08770"
FT                   /old_locus_tag="Vv17s0000g08770"
FT   mRNA            join(2923611..2923993,2923994..2924726,2928099..2928215,
FT                   2928487..2928623,2928720..2928930,2929445..2929679,
FT                   2930355..2930505,2930664..2930990,2930991..2931204)
FT                   /locus_tag="VIT_17s0000g08770"
FT                   /old_locus_tag="Vv17s0000g08770"
FT                   /product="putative uncharacterized protein Sb03g025280"
FT   5'UTR           2923611..2923993
FT                   /locus_tag="VIT_17s0000g08770"
FT                   /old_locus_tag="Vv17s0000g08770"
FT   CDS_pept        join(2923994..2924726,2928099..2928215,2928487..2928623,
FT                   2928720..2928930,2929445..2929679,2930355..2930505,
FT                   2930664..2930990)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08770"
FT                   /old_locus_tag="Vv17s0000g08770"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHN8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002902"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR038408"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHN8"
FT                   /protein_id="CBI14998.3"
FT                   /translation="MRVVFLFLMASGFVSNLMADPRTTVAGFQCNSTEAVSSVLLAQNF
FT                   VPAMANLSTQVNEDGFGTSIVGEAPNAVFGLAQCFKDLSSIDCQLCFSEIRSILPKCYP
FT                   DTGGRIFFDGCFGRYENFSFFDQGMDSVQLKNCSSSKNSSQPGIFKEALERVIESVSLK
FT                   AQKNQGFAVASHSVSNLTLHALAQCWESLDKKTCNSCLQASASSIMSCYPGVDGRSLNA
FT                   GCYMRYSNEVFWNLSRHTGLSAGRKALYIILGLAVGGFLILAGIGLWKKGHLRQSFGKS
FT                   LKDIYGSGLSSALAHSQLNFRYQELRQATNNFDSSNKLGQGSYGSVYKGILLDGREVAV
FT                   KRLFLNTRQWIDQFFNEVHLINQVRHKNLVKLLGYSVDGQESLLVYDYYPNKSLDHFIF
FT                   DENQAQILDWKKRIDIIQGVAEGLSYLHEESEIRIIHRDIKASNILLDDKLKPKITDFG
FT                   LARSFAEDQTHLSTGIAGTLGYMAPEYVVHGHLTEKADVYSFGVLLLEILTGQRCSNGT
FT                   GAKPGQFFLAKIWSHYKAETVDEIMDRHFYDEEVKDEILHAVHVGLLCTQATPSYRPTM
FT                   AKVVELLRSTKNQENVFPTDPPFLDVLSVENLEEGDGIHLLSGASAPGFSGSTGSVLYG
FT                   R"
FT   3'UTR           2930991..2931204
FT                   /locus_tag="VIT_17s0000g08770"
FT                   /old_locus_tag="Vv17s0000g08770"
FT   gene            2934713..2938080
FT                   /locus_tag="VIT_17s0000g08760"
FT                   /old_locus_tag="Vv17s0000g08760"
FT   mRNA            join(2934713..2934951,2934952..2937849,2937850..2938080)
FT                   /locus_tag="VIT_17s0000g08760"
FT                   /old_locus_tag="Vv17s0000g08760"
FT                   /product="Predicted protein"
FT   5'UTR           2934713..2934951
FT                   /locus_tag="VIT_17s0000g08760"
FT                   /old_locus_tag="Vv17s0000g08760"
FT   CDS_pept        2934952..2937849
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08760"
FT                   /old_locus_tag="Vv17s0000g08760"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSL7"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR013210"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSL7"
FT                   /protein_id="CCB42964.1"
FT                   /translation="MLFFAVLSAVLAVTFGDNSTDSYWLLRIKSELVDPVGVLANWSSR
FT                   TNICSWNGLVCSDDQLHIIGLSLSGSGLSGSISPEFSHLTSLQTLDLSLNAFAGSIPHE
FT                   LGLLQNLRELLLYSNYLSGKIPTEICLLKKLQVLRIGDNMLAGEITPSIGNLKELRVLG
FT                   LAYCQLNGSIPAEIGNLKNLKFLDLQKNSLSSVIPEEIQGCVELQNFAASNNKLEGEIP
FT                   ASMGNLKSLQILNLANNSLSGSIPIELGGLSNLKYLNLLGNRLSGMIPSELNQLDQLQK
FT                   LDLSSNNLSGTINFLNTQLKSLEVLALSDNLLTDSIPGNFCTSSSSLRQIFLAQNKLSG
FT                   TFPLELLNCSSIQQLDLSDNRFEGVLPPELEKLENLTDLLLNNNSFSGKLPPEIGNMSS
FT                   LETLYLFDNMITGNIPVELGKLQKLSSIYLYDNQLSGSIPRELTNCSSLSEIDFFGNHF
FT                   MGSIPATIGKLRNLVFLQLRQNDLSGPIPPSLGYCKKLHTLTLADNKLSGSLPPTFRFL
FT                   SELHLFSLYNNSFEGPLPESLFLLKKLGIINFSHNRFSGSILPLLGSDFLTLLDLTNNS
FT                   FSGPIPSRLAMSKNLTRLRLAHNLLTGNISSEFGQLKELKFLDLSFNNFTGEVAPELSN
FT                   CKKLEHVLLNNNQFIGMIPSWLGGLQKLGELDLSFNFFHGTVPAALGNCSILLKLSLND
FT                   NSLSGEIPPEMGNLTSLNVLDLQRNNLSGQIPSTFQQCKKLYELRLSENMLTGSIPSEL
FT                   GTLTELQVILDLSRNLFSGEIPSSLGNLMKLESLNISFNQLQGEVPSSLGKLTSLHLLD
FT                   LSNNHLRGQLPSTFSEFPLSSFMLNDKLCGPPLESCSEYAGQEKRRLSNTAVAGIIVAI
FT                   VFTSTLICLVLLYIMVRIWCTWRKVMILSSDGGGTEHNIEEEKWDYGDEKKRKGEYWKV
FT                   NTMALVPSQEKQNLSSPTCIFQLKMDSETMETTMV"
FT   3'UTR           2937850..2938080
FT                   /locus_tag="VIT_17s0000g08760"
FT                   /old_locus_tag="Vv17s0000g08760"
FT   gene            complement(2942468..2977590)
FT                   /locus_tag="VIT_17s0000g08750"
FT                   /old_locus_tag="Vv17s0000g08750"
FT   mRNA            complement(join(2942468..2942662,2942663..2942761,
FT                   2943270..2943312,2943625..2943704,2945026..2945132,
FT                   2946603..2946862,2947795..2947906,2948010..2948061,
FT                   2949034..2949126,2949589..2949735,2949809..2949910,
FT                   2950000..2950098,2950388..2950522,2952135..2952213,
FT                   2968934..2969009,2969084..2969173,2969344..2969422,
FT                   2976667..2976701,2976856..2976930,2977224..2977590))
FT                   /locus_tag="VIT_17s0000g08750"
FT                   /old_locus_tag="Vv17s0000g08750"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(2942468..2942662)
FT                   /locus_tag="VIT_17s0000g08750"
FT                   /old_locus_tag="Vv17s0000g08750"
FT   CDS_pept        complement(join(2942663..2942761,2943270..2943312,
FT                   2943625..2943704,2945026..2945132,2946603..2946862,
FT                   2947795..2947906,2948010..2948061,2949034..2949126,
FT                   2949589..2949735,2949809..2949910,2950000..2950098,
FT                   2950388..2950522,2952135..2952213,2968934..2969009,
FT                   2969084..2969173,2969344..2969422,2976667..2976701,
FT                   2976856..2976930,2977224..2977590))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08750"
FT                   /old_locus_tag="Vv17s0000g08750"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041006"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHP0"
FT                   /protein_id="CBI15000.3"
FT                   /translation="MSFPDIVDLCSDDEHVEVDVKPVKLEPNIIEREIQLFKCHEILQA
FT                   QYQLSKTHCRTQESEENRDSNALSTAQSSTSILDQGQSPMDDTSLSSTSPICPAPLCRQ
FT                   FWKAGNYDDELGSKVTLQNGKNYLHVHPMFLHSNATSHKWAFGAIAELLDNAVDEIQNG
FT                   ATFVIVDKTSNPRDGSPALLIQDDGGGMGPEAMRCCMSFGFSDKKSKSAIGQYGNGFKT
FT                   SSMRLGADVIVFSRHLDNGKLTQSAGLLSYSFLRQTGHDRIVVPMVDYEFNTSTSNMEP
FT                   LHRYGKKHFTSNLSILLRWSPYSTEQELLKQFDDIGYHGTKVVIYNLWFSDDGNVELDF
FT                   DSDPEDIRIGGDIKQVTTIPAWKTINEQHIANRFHISLRVYLSILYLRIPQNFNIILRG
FT                   KVVEHHNIANDLKFPEFILYRPQTGGLVEGTVVTTIGFLKEAPQVNIHGFNVYHKNRLI
FT                   LPFWQVVNYSDSRGRGVVGVLEANFIEPIHNKQDFERTSLFQKLEGRLKEMTWEYWDYH
FT                   CGLIGYQVKKKPRTLVSPHISSHGSPHIAMEKPIGLNQSSPAIGNIKATPPGGAFQHPA
FT                   ATASHCLAGRPGEPITDSQSRSQQGASLKRTEHDHPVEPEKKKHAGIKEIVTDTHSQET
FT                   QPVDIFANHSKDQEAMTLMQENKKLHAQCLEYEKREKELSVKMIQLRNELREVHNEQAR
FT                   LLAELQHLDAIKDEK"
FT   gene            3013535..3014023
FT                   /locus_tag="VIT_17s0000g08740"
FT                   /old_locus_tag="Vv17s0000g08740"
FT   mRNA            join(3013535..3013569,3013570..3013707,3013790..3014023)
FT                   /locus_tag="VIT_17s0000g08740"
FT                   /old_locus_tag="Vv17s0000g08740"
FT                   /product="Os04g0614000 protein"
FT   5'UTR           3013535..3013569
FT                   /locus_tag="VIT_17s0000g08740"
FT                   /old_locus_tag="Vv17s0000g08740"
FT   CDS_pept        join(3013570..3013707,3013790..3014023)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08740"
FT                   /old_locus_tag="Vv17s0000g08740"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSL8"
FT                   /protein_id="CCB42965.1"
FT                   /translation="MCHEALKYLKKGGPGKSPSTGGIIINISATLHYTATWYQIHVSAT
FT                   KAVVDSITRSLALEWGTDYDIRVNGIAPGPIDDTAGLSKLAPEDVVRKAKEHEPLFKLR
FT                   EKWDIVMAAVYLASKSLSM"
FT   gene            complement(3030882..3064285)
FT                   /locus_tag="VIT_17s0000g08730"
FT                   /old_locus_tag="Vv17s0000g08730"
FT   mRNA            complement(join(3030882..3031111,3031112..3031248,
FT                   3031640..3031716,3032676..3032753,3032888..3032979,
FT                   3036874..3036942,3037528..3037651,3037751..3037874,
FT                   3038335..3038453,3038719..3038810,3038916..3039104,
FT                   3048004..3048123,3048222..3048317,3048528..3048631,
FT                   3064195..3064285))
FT                   /locus_tag="VIT_17s0000g08730"
FT                   /old_locus_tag="Vv17s0000g08730"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(3030882..3031111)
FT                   /locus_tag="VIT_17s0000g08730"
FT                   /old_locus_tag="Vv17s0000g08730"
FT   CDS_pept        complement(join(3031112..3031248,3031640..3031716,
FT                   3032676..3032753,3032888..3032979,3036874..3036942,
FT                   3037528..3037651,3037751..3037874,3038335..3038453,
FT                   3038719..3038810,3038916..3039104,3048004..3048123,
FT                   3048222..3048317,3048528..3048631,3064195..3064285))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08730"
FT                   /old_locus_tag="Vv17s0000g08730"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHP1"
FT                   /db_xref="InterPro:IPR000009"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHP1"
FT                   /protein_id="CBI15001.3"
FT                   /translation="MTLTTDSSSSLQWKFSQAFGERAPGEDVQDIDMISAMEFEKSGDY
FT                   LAVGDRGGRVVVFERKDEKDWHSRNELEQLDFTTIQHPIFHYKTEFQSHEPEFDYLRSL
FT                   EIEEKINKVRWCATPNESLFILSTNDKTIKLWKVKDHKPKKVKELNPNPFVHSENVLLA
FT                   ESSFVSGQDKPSVANGYALEWTEKIDNMSPSQDTHAKRANIGETVSARCRKVYAHAHDY
FT                   NINSISNNSDGETFVSADDLRINLWNLEISDQCFNIIDMKPSNMEDLTEVITAAEFHPI
FT                   HCNLLAYSSSRGFIRLVDLRQSAICDHNARILQHGESSGLKSFFTEIVSSISDIKFASD
FT                   GRHLLSRDYMNLKLWDIRMETSPVAIFKIHEHLRPKLCDLYNNDAIFDKFECCLSGYGL
FT                   HFATGSYSNLLRIFSYGVGSEEGITMEASRNPNRKSHLQAAPKARRSSISNLTRGFSRQ
FT                   ANENLSSGSNELSCNLSSKLLHLAWHPTTKFIACAAGNSLYMYYA"
FT   gap             3041109..3041208
FT                   /estimated_length=100
FT   gene            complement(3087126..3090490)
FT                   /locus_tag="VIT_17s0000g08720"
FT                   /old_locus_tag="Vv17s0000g08720"
FT   mRNA            complement(join(3087126..3087273,3087572..3087954,
FT                   3088299..3088443,3088731..3088965,3089092..3089463,
FT                   3089564..3089677,3089890..3090490))
FT                   /locus_tag="VIT_17s0000g08720"
FT                   /old_locus_tag="Vv17s0000g08720"
FT                   /product="unknown predicted protein"
FT   CDS_pept        complement(join(3087126..3087273,3087572..3087954,
FT                   3088299..3088443,3088731..3088965,3089092..3089463,
FT                   3089564..3089677,3089890..3090490))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08720"
FT                   /old_locus_tag="Vv17s0000g08720"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSL9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002902"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR038408"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSL9"
FT                   /protein_id="CCB42966.1"
FT                   /translation="MEAIAKSMVQQGWGYANITKSPVIFGLSQCYSDLSKDDCLSCFAE
FT                   SRTKLPRCLPAIAARIYLDGCFLRYDNYSFFNESIDPNHDMVRCSEPSGVLKDNYTRSE
FT                   FSKKVDEVINNVTKTAVQKQGFAVAGMKGGAVVAYALAQCWKTVDQKGCRDCLVNAESA
FT                   VRRCLPGSEGRALNAGCYLRYSTEKFYNDGTAKKSGKGLSDTGMIIAFILSVLAVCLLA
FT                   FLGAFVGYILLSKRKRNNNNALARIPTCINRSDLNFKYETLERATNFFDSSRKLGQGGA
FT                   GSVFKGTLPDGRTVAVKRLFFNTRQWVDEFFNEVNLISRIQHKNLVGLLGCSIEGPESL
FT                   LVYEYVPNKSVDQILFGKNPTSCKDGTQGLSWQQRFEIIVGTAEGLAYLHGGSEVKIIH
FT                   RDIKGSNILLDENLNPKIADFGLARCVAPDKSHVSTGIAGTLGYMAPEYLVRGQLSEKA
FT                   DVYAYGVLILEIVCGRKNCIFVQGSDSVLQTVWKHYKSNSVVRSVDPSLKGDFPLNEAR
FT                   NVVQIGLLCTQASFALRPSMSQVVQMLTDQNSVIPEPMQPPFLNASVLDPSNSLKNSIT
FT                   RNLTPSFHTATEPPSTHSSNSSAMASQESYTPSAMDVSGPRGKFIFQLLDFYHHLVTLL
FT                   FLSVSLFFVVLDMNVYLFLFATSSCVQPFV"
FT   gene            complement(3101729..3112318)
FT                   /locus_tag="VIT_17s0000g08710"
FT                   /old_locus_tag="Vv17s0000g08710"
FT   mRNA            complement(join(3101729..3101868,3101869..3102027,
FT                   3102463..3102701,3110890..3111025,3111119..3111238,
FT                   3111926..3112231,3112232..3112318))
FT                   /locus_tag="VIT_17s0000g08710"
FT                   /old_locus_tag="Vv17s0000g08710"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(3101729..3101868)
FT                   /locus_tag="VIT_17s0000g08710"
FT                   /old_locus_tag="Vv17s0000g08710"
FT   CDS_pept        complement(join(3101869..3102027,3102463..3102701,
FT                   3110890..3111025,3111119..3111238,3111926..3112231))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08710"
FT                   /old_locus_tag="Vv17s0000g08710"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHP3"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR005539"
FT                   /db_xref="InterPro:IPR005540"
FT                   /db_xref="InterPro:IPR005541"
FT                   /db_xref="InterPro:IPR008422"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHP3"
FT                   /protein_id="CBI15003.3"
FT                   /translation="MDQLYGLHSPSSSDYHHPPPFPPENLISPSHYPNFNSPAPFPIFG
FT                   SDQLLSASSLVVSDAASMVAEIQGGGSGEEVSSAIRAKIATHPLYPKLLHAYIECQKVG
FT                   APPEVAYLLEEIRRGSELCRRNAVSTCLGADPELDEFMETYCDILVKYKSDLARPFDEA
FT                   TAFLNNIETQLNTLCNGASRSYVSDEAAGSSEEDLSGGEVEVQECLQTTENQELKDKLL
FT                   RKYSGYISTLKHEFSKTKKKGKLPKEARQALLDWWNIHYKWPYPTEEDKIALAESTGLD
FT                   QKQINNWFINQRKRHWKPSENMQFAVMDSIYGPFFMNE"
FT   5'UTR           complement(3112232..3112318)
FT                   /locus_tag="VIT_17s0000g08710"
FT                   /old_locus_tag="Vv17s0000g08710"
FT   gene            3134027..3134561
FT                   /locus_tag="VIT_17s0000g08700"
FT                   /old_locus_tag="Vv17s0000g08700"
FT   mRNA            join(3134027..3134175,3134176..3134358,3134359..3134561)
FT                   /locus_tag="VIT_17s0000g08700"
FT                   /old_locus_tag="Vv17s0000g08700"
FT                   /product="putative uncharacterized protein Sb09g018835"
FT   5'UTR           3134027..3134175
FT                   /locus_tag="VIT_17s0000g08700"
FT                   /old_locus_tag="Vv17s0000g08700"
FT   CDS_pept        3134176..3134358
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08700"
FT                   /old_locus_tag="Vv17s0000g08700"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSM0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSM0"
FT                   /protein_id="CCB42967.1"
FT                   /translation="MKWAMRLRVALYLAQALEYCSIKGRALYHNLNAYRVLFDQDGNPR
FT                   LSYFGLMKNSRDGKS"
FT   3'UTR           3134359..3134561
FT                   /locus_tag="VIT_17s0000g08700"
FT                   /old_locus_tag="Vv17s0000g08700"
FT   gene            3137865..3140915
FT                   /locus_tag="VIT_17s0000g08690"
FT                   /old_locus_tag="Vv17s0000g08690"
FT   mRNA            join(3137865..3137874,3137979..3138308,3139908..3140629,
FT                   3140630..3140915)
FT                   /locus_tag="VIT_17s0000g08690"
FT                   /old_locus_tag="Vv17s0000g08690"
FT                   /product="putative uncharacterized protein"
FT   CDS_pept        join(3137865..3137874,3137979..3138308,3139908..3140629)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08690"
FT                   /old_locus_tag="Vv17s0000g08690"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSM1"
FT                   /protein_id="CCB42968.1"
FT                   /translation="MLYRMDVAHCYLEGNADAVEFCPHDSYHHVLAASTYTLQEGDQPS
FT                   RSGSVSLFNIDAEFGRLELGHRVDTAGIFDIKWSPAGSTAVPSLAQADADGYLRLYGLE
FT                   SGSSGAEALGGSLTEINAEKISSSMCLFLDWNPSATCISVGLSDGSISIISLRESQLDI
FT                   CQEWKAHEFELWSTSFDIHQPQLVYTGSDDCKFSCWDLRDSPSKLAFQNSKVHKMGVCC
FT                   IAKSPSDPNLVLTGSYDEHLRLWDVRSIIKPVNETSICLGGGVWRIKHHPSVPGLVLAA
FT                   CMHNGFAVVKTKGEEPEVIETYSKHESLAYGADWQRGDLCRKGQNNGGSVVATCSFYDR
FT                   LLRIWTTESNLVA"
FT   3'UTR           3140630..3140915
FT                   /locus_tag="VIT_17s0000g08690"
FT                   /old_locus_tag="Vv17s0000g08690"
FT   gene            3142821..3152317
FT                   /locus_tag="VIT_17s0000g08680"
FT                   /old_locus_tag="Vv17s0000g08680"
FT   mRNA            join(3142821..3143070,3143071..3143280,3144018..3144153,
FT                   3144618..3144754,3145511..3145712,3146238..3146476,
FT                   3146573..3146684,3146922..3147102,3147305..3147447,
FT                   3147560..3147729,3148359..3148667,3148758..3148813,
FT                   3149889..3150103,3150685..3151749,3152278..3152315,
FT                   3152316..3152317)
FT                   /locus_tag="VIT_17s0000g08680"
FT                   /old_locus_tag="Vv17s0000g08680"
FT                   /product="Predicted protein"
FT   5'UTR           3142821..3143070
FT                   /locus_tag="VIT_17s0000g08680"
FT                   /old_locus_tag="Vv17s0000g08680"
FT   CDS_pept        join(3143071..3143280,3144018..3144153,3144618..3144754,
FT                   3145511..3145712,3146238..3146476,3146573..3146684,
FT                   3146922..3147102,3147305..3147447,3147560..3147729,
FT                   3148359..3148667,3148758..3148813,3149889..3150103,
FT                   3150685..3151749,3152278..3152315)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08680"
FT                   /old_locus_tag="Vv17s0000g08680"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSM2"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSM2"
FT                   /protein_id="CCB42969.1"
FT                   /translation="MGLSRYSWVVLLCWVFLLLCLRSGCDGSEVSVNFLTAPLAFSRLN
FT                   SATFVFEVLVGGNNDPCNDCIFNCKLDNGTPSDCQAKKVSYTGLLDGNHTFEVCTNGSQ
FT                   GVGCASYGWTVDTVPPTAYVTASTSFTNALNFSVNISFSEPCTVGGSFGCSSVNACNLL
FT                   VYGAGQVIPSTFNVLQPNLKFSVLVGLSYSVPYGRVILVMDKSFCADSARNKFMRTENS
FT                   SLLVHFDIRSVFVNLRTHVPEKLLELNSETRTVQATNNYKNLKVYLYFSEPVLNSSTEV
FT                   LSSLNTSQGVLLPNGGRSLGNRRFGFLVENVSSVAIVTISFDSSAIISRQGTPVSPIAP
FT                   VTFLYDSQRPIVRLSTTSNMRTREHTIPILIKFLKPVFGFNSSHISISGGQLQRQVISC
FT                   SQTQAYIFNAISRSIYTAEIKADHDVVSVNVPENITGDVAGNQNLASNILQVRHYSVPI
FT                   TSCVISTFTTASFVATSLAAGWLTVSTASLQSVGAFLRPRSYLVSDPARNLFRIASHIQ
FT                   VFALSRWLPVTLPVEYYEFARGIQWSIPYFSLPWETGHIHPIMVGSSSPTLSHLYASRI
FT                   HDSGFFETVQPEEDNLDRAASVYGLPLTPMEYRTFFENHNFKPEAEYISDPQNSNGRRD
FT                   FNRSMFWLAVIGGSLILLHALLVLVLKIRKKSSEKQGSYGALVFPRFEIFLIILVLPCI
FT                   CEASASLVKGGTTSAVVVGILLFGVVAFVLLALFLFLSVGISFGKLLLYKEVHREGQQF
FT                   HWYQDIVRVTLGPGKRGQWTWKNQSNSVYLTMFGPLFEDLRGPPKYMLSQIAGGNSRKP
FT                   SDHIIASDDETEDAEAPFIQRVFGILRIYYTLLESMKRVTLGIVAGAYSEQWYSKAPII
FT                   FLLCITSFQLFFLVLKKPFIKKKVQLVEIISVSTEVAIFASCLVLLEMEFPAGAEKKIA
FT                   IFMLLLFLVGYVAQMINEWYALYRQAKRLDPAESSFLSGLKTALIGFLLFFIPLKIIEK
FT                   LGWFPVNQPGDGETGDATSSADRSKSSGSGTVRTSDRPWLKQLRELAKASFSKEGSGVP
FT                   TDPSTSQSRWSILLFILFCLQV"
FT   3'UTR           3152316..3152317
FT                   /locus_tag="VIT_17s0000g08680"
FT                   /old_locus_tag="Vv17s0000g08680"
FT   gene            3159360..3160323
FT                   /locus_tag="VIT_17s0000g08670"
FT                   /old_locus_tag="Vv17s0000g08670"
FT   mRNA            join(3159360..3159455,3159456..3159556,3159669..3159757,
FT                   3159854..3159952,3160056..3160141,3160142..3160323)
FT                   /locus_tag="VIT_17s0000g08670"
FT                   /old_locus_tag="Vv17s0000g08670"
FT                   /product="Glutaredoxin-C1"
FT   5'UTR           3159360..3159455
FT                   /locus_tag="VIT_17s0000g08670"
FT                   /old_locus_tag="Vv17s0000g08670"
FT   CDS_pept        join(3159456..3159556,3159669..3159757,3159854..3159952,
FT                   3160056..3160141)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08670"
FT                   /old_locus_tag="Vv17s0000g08670"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSM3"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011899"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSM3"
FT                   /protein_id="CCB42970.1"
FT                   /translation="MGSVLGKGKSKEEVEMALAKAKEIVSSTPVVVFSKTYCGYCKRVK
FT                   QLLSQLKATHKTIELDQESDGAEIQSALREWTGQSTVPNVFIGGKHMGGCDSVMEKHQE
FT                   GKLVPLLKEAGAIAEVSTQL"
FT   3'UTR           3160142..3160323
FT                   /locus_tag="VIT_17s0000g08670"
FT                   /old_locus_tag="Vv17s0000g08670"
FT   gene            complement(3160664..3165330)
FT                   /locus_tag="VIT_17s0000g08660"
FT                   /old_locus_tag="Vv17s0000g08660"
FT   mRNA            complement(join(3160664..3160798,3160799..3160828,
FT                   3160929..3161063,3161687..3161805,3161916..3161975,
FT                   3162132..3162222,3163419..3163607,3164252..3164335,
FT                   3164439..3164600,3164682..3164825,3164936..3165106,
FT                   3165107..3165330))
FT                   /locus_tag="VIT_17s0000g08660"
FT                   /old_locus_tag="Vv17s0000g08660"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(3160664..3160798)
FT                   /locus_tag="VIT_17s0000g08660"
FT                   /old_locus_tag="Vv17s0000g08660"
FT   CDS_pept        complement(join(3160799..3160828,3160929..3161063,
FT                   3161687..3161805,3161916..3161975,3162132..3162222,
FT                   3163419..3163607,3164252..3164335,3164439..3164600,
FT                   3164682..3164825,3164936..3165106))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08660"
FT                   /old_locus_tag="Vv17s0000g08660"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHP6"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHP6"
FT                   /protein_id="CBI15006.3"
FT                   /translation="MMASLSHHPVYLLSSFTGRYPQKCLFGNPYVRFEQRCVTKTLVAS
FT                   RPISAPPTSFNKLIESLISRVDLTESEAEASLDFLLSEANEALISAFLVLLRAKGETYE
FT                   EVVGLARAMIKCSRKVEGLKDAVDIVGTGGDGANTVNISTGASILAAACGANVAKQGNR
FT                   SSSSACGSADVLEALGIAIELDPQGVTRCVNEAGIGFMMAPIYHPAMKIVGPVRKKLKV
FT                   KTVFNILGPMLNPARVPFAVVGVFTEDLVLKMAKALQRFGMKRALVVHSEGLDEMSPLG
FT                   PGLVLDVTPEKIEKFSFDPLEFGIPRCTLDDLRGGGPDYNAEVLKRVLSGEKGSIADAF
FT                   VLNAAAALLVSGRVNTLADGVSLARETQESGKAIKTLDLWIEISNKAKAAPSSP"
FT   5'UTR           complement(3165107..3165330)
FT                   /locus_tag="VIT_17s0000g08660"
FT                   /old_locus_tag="Vv17s0000g08660"
FT   gene            complement(3177174..3179092)
FT                   /locus_tag="VIT_17s0000g08640"
FT                   /old_locus_tag="Vv17s0000g08640"
FT   mRNA            complement(join(3177174..3177263,3177264..3177310,
FT                   3177477..3177527,3178288..3178918,3178919..3179092))
FT                   /locus_tag="VIT_17s0000g08640"
FT                   /old_locus_tag="Vv17s0000g08640"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(3177174..3177263)
FT                   /locus_tag="VIT_17s0000g08640"
FT                   /old_locus_tag="Vv17s0000g08640"
FT   CDS_pept        complement(join(3177264..3177310,3177477..3177527,
FT                   3178288..3178918))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08640"
FT                   /old_locus_tag="Vv17s0000g08640"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHP7"
FT                   /protein_id="CBI15007.3"
FT                   /translation="MNDVLMFHITSGSYRVLDIDYAYQALTLDDPHMSTCESIVLGGKG
FT                   NGFAIEHWRAPYLNPAADNVFMLLGCSAQSPLFQGFPSKHLPCRNVSGMGCEEYYWCSA
FT                   WGVFGPKKLGSGTGPPECCAVPFEAIKAINLTRLECEGYSSAYSLAPLREIGPGGWSYG
FT                   IRVRYSVQGNEFCRACEATGGACGYGSDGVRELCLCGSSNSTSNCDSVKSSSSKVGRSL
FT                   ANTLAGILGCIVTWRKMHQT"
FT   5'UTR           complement(3178919..3179092)
FT                   /locus_tag="VIT_17s0000g08640"
FT                   /old_locus_tag="Vv17s0000g08640"
FT   gene            3182537..3186130
FT                   /locus_tag="VIT_17s0000g08630"
FT                   /old_locus_tag="Vv17s0000g08630"
FT   mRNA            join(3182537..3182737,3182738..3182776,3183403..3183507,
FT                   3184275..3184530,3184917..3184994,3185666..3185802,
FT                   3185803..3186130)
FT                   /locus_tag="VIT_17s0000g08630"
FT                   /old_locus_tag="Vv17s0000g08630"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           3182537..3182737
FT                   /locus_tag="VIT_17s0000g08630"
FT                   /old_locus_tag="Vv17s0000g08630"
FT   CDS_pept        join(3182738..3182776,3183403..3183507,3184275..3184530,
FT                   3184917..3184994,3185666..3185802)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08630"
FT                   /old_locus_tag="Vv17s0000g08630"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHP8"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHP8"
FT                   /protein_id="CBI15008.3"
FT                   /translation="MEDVEKTEETLSNGTSKIPGTVNWGTATVLGVLAGMLYGGSKEAS
FT                   ASVSKDAEVMLKLGSTPDKREQYRLMRDAMEKRFIRVTRGSIVGGVRLGMFTAAFYTLQ
FT                   NFFAEKRGVHDVFNIAGAGSLTAATFGLIMPGSIRWRARNVLLGSVLGAALGFPLGWAH
FT                   LKLLETANEGRLAAYPDSDQIGQAKGGVGAAIDRLEGKLNK"
FT   3'UTR           3185803..3186130
FT                   /locus_tag="VIT_17s0000g08630"
FT                   /old_locus_tag="Vv17s0000g08630"
FT   gene            complement(3186380..3194478)
FT                   /locus_tag="VIT_17s0000g08620"
FT                   /old_locus_tag="Vv17s0000g08620"
FT   mRNA            complement(join(3186380..3186750,3186751..3186767,
FT                   3186862..3186924,3187679..3187820,3188688..3188741,
FT                   3188848..3188919,3189381..3189449,3189639..3189680,
FT                   3189769..3189837,3192047..3192184,3192318..3192425,
FT                   3192552..3192669,3193313..3193374,3193828..3194475,
FT                   3194476..3194478))
FT                   /locus_tag="VIT_17s0000g08620"
FT                   /old_locus_tag="Vv17s0000g08620"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(3186380..3186750)
FT                   /locus_tag="VIT_17s0000g08620"
FT                   /old_locus_tag="Vv17s0000g08620"
FT   CDS_pept        complement(join(3186751..3186767,3186862..3186924,
FT                   3187679..3187820,3188688..3188741,3188848..3188919,
FT                   3189381..3189449,3189639..3189680,3189769..3189837,
FT                   3192047..3192184,3192318..3192425,3192552..3192669,
FT                   3193313..3193374,3193828..3194475))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08620"
FT                   /old_locus_tag="Vv17s0000g08620"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSM4"
FT                   /db_xref="InterPro:IPR012173"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSM4"
FT                   /protein_id="CCB42971.1"
FT                   /translation="MDTVHRLKSTEPPLWLSPSSELSQTARAASQHLFASLKPFAPKSP
FT                   FDRLLVDGFDAEQIWQQIDIQSQPIISSLRRQINRFEKNPEEISKIFGRKKVRRVEEKV
FT                   REVEQKVPEEEIGGFSEEEDEDLEEFDEDSEEGEDEERESEEDEAEDNEDGGGGGIEDR
FT                   FLKIKGLEEYLEAEEDREYGLKNKKGGSDALKDGEDENEDEEEEEEEEEEDDELGAFDL
FT                   DDGENEGMDELDDIKYEDFFGPKRKVSKKSKLTDGLEDSDRSDEQEDDQATDNKNKVLS
FT                   THEKERENVRAKIEEMERANLESKTWTMQGEVTAAKRPKNSALEVDLDFEHNVRPPPVI
FT                   TEEVTASLEDLIQKRILEGRFDDVQKAPRLPSKAPKEVKEMDENKSKKGLAEIYEEEFV
FT                   QKTNLDSAPLSFSDEQRKEASMLFKKLCLKLDALSHFHFTPKPVIDDMSIQTNVPALAM
FT                   EEIAPLAVSDAAMLAPEEVFEGKGDIKEEAELTQAERKRRRANKKRKFKANTTKRAAKK
FT                   AQDGTLQNNKEGKEEA"
FT   5'UTR           complement(3194476..3194478)
FT                   /locus_tag="VIT_17s0000g08620"
FT                   /old_locus_tag="Vv17s0000g08620"
FT   gene            3197108..3202557
FT                   /locus_tag="VIT_17s0000g08610"
FT                   /old_locus_tag="Vv17s0000g08610"
FT   mRNA            join(3197108..3197404,3198979..3199974,3200710..3200935,
FT                   3201703..3201845,3202055..3202369,3202370..3202557)
FT                   /locus_tag="VIT_17s0000g08610"
FT                   /old_locus_tag="Vv17s0000g08610"
FT                   /product="Predicted protein"
FT   CDS_pept        join(3197108..3197404,3198979..3199974,3200710..3200935,
FT                   3201703..3201845,3202055..3202369)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08610"
FT                   /old_locus_tag="Vv17s0000g08610"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSM5"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR025258"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSM5"
FT                   /protein_id="CCB42972.1"
FT                   /translation="MQREQQHGNTSEVLDLGDRQVSDSPELGKPKVQLDPLSYNTVDQV
FT                   YAPSTEALENRQAGFFKGYKPDPHTSMLENDMWNESKDSPVSSDPFEGHSAPVKMENIE
FT                   LKESYDEVVLDMEEILLESSESPGARFTQGNRTFQSHLPLPLRDGGSTASTSGTDDVYP
FT                   PLRQLQNIDGVEVIGAKQKKGDVSLGERLVGVKEYTVYKIRVWSGNDQWEVERRYRDFF
FT                   TLYRRMKTVFSDQGWNLPSPWSSVERESRKIFGNASPDVVAERSVLIQECLRSILHFRF
FT                   LSSPPNALIWFLSPQNAVPTSFASNTLMPSSTSFNRGVNIENVSALGKTISLVVELQPY
FT                   KSMKQMLEAQHYTCAGCHKHFDDGKTLVREFVQTFGWGKPRLCEYTGQLFCSMCHTNDT
FT                   AVLPARVLHHWDFTEYPISQLAKSYLDSIHDQPMLCVSAVNPFLFSKVPALLHVTGVRK
FT                   KIGAILPYIRCPFRRSVNKGLGSRRYLLESNDFFALRDLIDLSKGAFSALPVMVETVSR
FT                   KILEHITEQCLICCDVGVPCNGRQACNDPSSFIFPFQEGEVDRCKSCELVFHKSCFRKL
FT                   TNCPCGVQLRAEEVTGLTKKASGRGGGKEGEAVDLLGRKLSSTGLGGGFLTGLFARARQ
FT                   EKALDHKESDNVILMGSLPSTSL"
FT   3'UTR           3202370..3202557
FT                   /locus_tag="VIT_17s0000g08610"
FT                   /old_locus_tag="Vv17s0000g08610"
FT   gene            3203538..3208819
FT                   /locus_tag="VIT_17s0000g08600"
FT                   /old_locus_tag="Vv17s0000g08600"
FT   mRNA            join(3203538..3203959,3203996..3204036,3204229..3204354,
FT                   3204355..3204421,3205066..3205148,3206309..3206395,
FT                   3207265..3207413,3207540..3207671,3208307..3208496,
FT                   3208497..3208819)
FT                   /locus_tag="VIT_17s0000g08600"
FT                   /old_locus_tag="Vv17s0000g08600"
FT                   /product="unknown predicted protein"
FT   5'UTR           3203538..3203959
FT                   /locus_tag="VIT_17s0000g08600"
FT                   /old_locus_tag="Vv17s0000g08600"
FT   CDS_pept        join(3204355..3204421,3205066..3205148,3206309..3206395,
FT                   3207265..3207413,3207540..3207671,3208307..3208496)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08600"
FT                   /old_locus_tag="Vv17s0000g08600"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHQ1"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHQ1"
FT                   /protein_id="CBI15011.3"
FT                   /translation="MSSTPLYTTIGVVSLSTIVIFSIRWLKPRKSNTIILAGLSGSGKT
FT                   VLFYQLRDGSSHQGTVTSTDTNEATFVLQTDPFWKGKRRLIHLVDVPGQSHLRSKLDKY
FT                   LPQAAGLIFLVDGLEFLRHCPAIAEYLLDILTNTTVVKRKIPVLIVCNKTDKVTAHTKE
FT                   FIQKLLEREIQKLRASGTAISEADIANEYTLGVTGEAFTFSQCCNMVTVEEASGLVGEI
FT                   SQVEQFITKHLKP"
FT   3'UTR           3208497..3208819
FT                   /locus_tag="VIT_17s0000g08600"
FT                   /old_locus_tag="Vv17s0000g08600"
FT   gene            complement(3210033..3213692)
FT                   /locus_tag="VIT_17s0000g08590"
FT                   /old_locus_tag="Vv17s0000g08590"
FT   mRNA            complement(join(3210033..3210250,3210251..3210362,
FT                   3210520..3210567,3210653..3210744,3210837..3210902,
FT                   3211151..3211240,3211751..3211966,3212089..3212122,
FT                   3212538..3212860,3212861..3212889,3213232..3213492,
FT                   3213640..3213692))
FT                   /locus_tag="VIT_17s0000g08590"
FT                   /old_locus_tag="Vv17s0000g08590"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(3210033..3210250)
FT                   /locus_tag="VIT_17s0000g08590"
FT                   /old_locus_tag="Vv17s0000g08590"
FT   CDS_pept        complement(join(3210251..3210362,3210520..3210567,
FT                   3210653..3210744,3210837..3210902,3211151..3211240,
FT                   3211751..3211966,3212089..3212122,3212538..3212860))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08590"
FT                   /old_locus_tag="Vv17s0000g08590"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHQ2"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHQ2"
FT                   /protein_id="CBI15012.3"
FT                   /translation="MTSDTTTSSYWLNWRVLLCSIWILMSTVFASFLIWKYEGFRNSQH
FT                   ENRESQNDTAGALYEDEVWKPCLKEIHPVWLLAFRVFAFFVLLVLLIINAIVDGGSIFY
FT                   FYTQWTFTLITIYFGLGSLLSMYGCYQYHNKVGGESVDDAGLDAEQGRVHGENFNLSNT
FT                   AKTSHSHDRQHVRKAAGIWAYVFQIIFQMNAGAVMLTDCVFWFIIVPFLTIKDYNLNFL
FT                   IINMHTINAVFLFGDAVLNRLRFPWFRIAYFFLWTIVFVVFQWIVHAIVSLWWPYPFLD
FT                   LSSPFSPLWYSSVALMHIPCYGVFALIMKLKHFLLAKWFPESHHL"
FT   5'UTR           complement(3213640..3213692)
FT                   /locus_tag="VIT_17s0000g08590"
FT                   /old_locus_tag="Vv17s0000g08590"
FT   gene            complement(3216314..3220471)
FT                   /locus_tag="VIT_17s0000g08580"
FT                   /old_locus_tag="Vv17s0000g08580"
FT   mRNA            complement(join(3216314..3216792,3216793..3216909,
FT                   3217714..3217810,3217956..3218128,3218600..3218680,
FT                   3219659..3219772,3220155..3220406,3220407..3220471))
FT                   /locus_tag="VIT_17s0000g08580"
FT                   /old_locus_tag="Vv17s0000g08580"
FT                   /product="Predicted protein"
FT   3'UTR           complement(3216314..3216792)
FT                   /locus_tag="VIT_17s0000g08580"
FT                   /old_locus_tag="Vv17s0000g08580"
FT   CDS_pept        complement(join(3216793..3216909,3217714..3217810,
FT                   3217956..3218128,3218600..3218680,3219659..3219772,
FT                   3220155..3220406))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08580"
FT                   /old_locus_tag="Vv17s0000g08580"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSM6"
FT                   /protein_id="CCB42973.1"
FT                   /translation="MHALSFKGFPDLNVGRERSWPGRLYHCTGTRKDGWNCRDFRRNCR
FT                   IFACSSGANGENQSPSSFLSRSQTYALLKQQLQVAAKSEDYKEAARLRDSLRLFEEEEP
FT                   VLRLRRLIKEAVADERFEDAARYRDELKEIAPHSLLKCSSDATTVGIRVQVRSVYIEGR
FT                   SQPSKGQFFFAYRIRITNNSDRPVQLLRRHWIITDANGKIEHVWGIGVIGEQPVILPRT
FT                   GFEYSSACPLSTPNGRMEGDFEMKHIDKVGSQTFNVAIAPFSLSTLGDESDTFEM"
FT   5'UTR           complement(3220407..3220471)
FT                   /locus_tag="VIT_17s0000g08580"
FT                   /old_locus_tag="Vv17s0000g08580"
FT   gene            3233667..3239141
FT                   /locus_tag="VIT_17s0000g08570"
FT                   /old_locus_tag="Vv17s0000g08570"
FT   mRNA            join(3233667..3233899,3234534..3234585,3234768..3234771,
FT                   3234772..3234877,3236200..3236564,3238277..3238810,
FT                   3238811..3239141)
FT                   /locus_tag="VIT_17s0000g08570"
FT                   /old_locus_tag="Vv17s0000g08570"
FT                   /product="Predicted protein"
FT   5'UTR           3233667..3233899
FT                   /locus_tag="VIT_17s0000g08570"
FT                   /old_locus_tag="Vv17s0000g08570"
FT   CDS_pept        join(3234772..3234877,3236200..3236564,3238277..3238810)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08570"
FT                   /old_locus_tag="Vv17s0000g08570"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHQ4"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017066"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHQ4"
FT                   /protein_id="CBI15014.3"
FT                   /translation="MFGGNNNNPVFPVFLEENRYQYDTNAMPQLQLFGDFPVGCGGNPL
FT                   NYMRNDHANALHGPIKRSREAESFSRHQKLHISLNNNNLCHDEAGQSGSILNPNPVSTG
FT                   LKLSYEEDEHNSSITSASDSMTAALPVISSLGDNLKSEIDRQKEEFDHYIRVQEENIIK
FT                   GVRELKQRQTVSFLSSIEKGVGKKLREKEFEIENMNRKNKELVERVKQVTMEVQSWHYR
FT                   AKYNESLVNVLKSNLKQVLAQGAMQGKEGCGDSEVDDAASYTDHIQLGVVGCSGNPTSM
FT                   KKQVNCRACKVREVSVLLLPCRHLCLCMDCEGFIDVCPVCRVMKTASVQVFMS"
FT   3'UTR           3238811..3239141
FT                   /locus_tag="VIT_17s0000g08570"
FT                   /old_locus_tag="Vv17s0000g08570"
FT   gene            3250102..3254966
FT                   /locus_tag="VIT_17s0000g08560"
FT                   /old_locus_tag="Vv17s0000g08560"
FT   mRNA            join(3250102..3250216,3250217..3250612,3251508..3251630,
FT                   3251715..3251867,3252109..3252194,3252359..3252443,
FT                   3252845..3252964,3253080..3253148,3254460..3254589,
FT                   3254679..3254749,3254750..3254966)
FT                   /locus_tag="VIT_17s0000g08560"
FT                   /old_locus_tag="Vv17s0000g08560"
FT                   /product="unknown predicted protein"
FT   5'UTR           3250102..3250216
FT                   /locus_tag="VIT_17s0000g08560"
FT                   /old_locus_tag="Vv17s0000g08560"
FT   CDS_pept        join(3250217..3250612,3251508..3251630,3251715..3251867,
FT                   3252109..3252194,3252359..3252443,3252845..3252964,
FT                   3253080..3253148,3254460..3254589,3254679..3254749)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08560"
FT                   /old_locus_tag="Vv17s0000g08560"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHQ5"
FT                   /db_xref="InterPro:IPR004696"
FT                   /db_xref="InterPro:IPR004853"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHQ5"
FT                   /protein_id="CBI15015.3"
FT                   /translation="MQSTAFTFSPSISSISLSKPLKPAASLSRFRHISLSSSSSKSPDL
FT                   ASSNGVSASSSVRTPAALSSSRFGAFGSAPYLVEDRRRGDLTVRASSVPESAGESEKSG
FT                   NLVQTLQLGLLFGLWYLFNIYFNIYNKQVLKVYPFPVTVTVVQFAVGTVLVILMWGLNL
FT                   YKRPKISSSQLVAILPLAVVHTLGNLFTNMSLGKVSVSFTHTIKAMEPFFSVVLSAMFL
FT                   GEFPTIWVLSSLLPIVGGVALASATEASFNWSGFWSAMASNLTNQSRNVLSKKFMIKKE
FT                   DSLDNITLFSIITIMSFILLAPVSIFMEGINFTPSYLQSAGLNMGQIYKRSLIAALCFH
FT                   AYQQVSYMILQRVSPVTHSVGNCVKRVVVIVTSVLFFRTPVSPVNSLGTGVALAGVFLY
FT                   SRVKRIKPKTA"
FT   3'UTR           3254750..3254966
FT                   /locus_tag="VIT_17s0000g08560"
FT                   /old_locus_tag="Vv17s0000g08560"
FT   gene            complement(3258713..3260645)
FT                   /locus_tag="VIT_17s0000g08550"
FT                   /old_locus_tag="Vv17s0000g08550"
FT   mRNA            complement(join(3258713..3259291,3259810..3259936,
FT                   3260053..3260645))
FT                   /locus_tag="VIT_17s0000g08550"
FT                   /old_locus_tag="Vv17s0000g08550"
FT                   /product="unknown predicted protein"
FT   CDS_pept        complement(join(3258713..3259291,3259810..3259936,
FT                   3260053..3260645))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08550"
FT                   /old_locus_tag="Vv17s0000g08550"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHQ6"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHQ6"
FT                   /protein_id="CBI15016.3"
FT                   /translation="MDFDRKYKENLGSQPMLLPENYLKSYMGDGAFSLEACSSKAFFQD
FT                   FHHLDHQFPTNASSKTLQFGVQTACLDPFDSFTYGSGMNLDVYELKPYAENVGVMENFQ
FT                   SNNGGGYLLHHHQRAAAADMMGLDRGRVAFNCQEIKPVNFVIPEEVCIAAENSLYKKIS
FT                   MSTAKNGASPAAKKTYKGRKKTHVVKGQWTIEEDRLLIQLVEQYGVRKWSLIAQMLNGR
FT                   IGKQCRERWHNHLRPNIKKDIWSEEEDKILIQAHAEIGNKWAEIAKRLPGRTENSIKNH
FT                   WNATKRRQLSRRKCRSKYPRQSTLLQNYIKSLNLDSRTVDYQKNPTANNPMAANNTVLR
FT                   PPMNRPEISDFCPGDGVVPNFDYEEVPDFSFDANIFQENCSIDSLLNEMSSAPTGDEKG
FT                   IEMENMPLDMASLLQCEVKKEMDLVEIISQVNL"
FT   gene            complement(3262010..3273526)
FT                   /locus_tag="VIT_17s0000g08540"
FT                   /old_locus_tag="Vv17s0000g08540"
FT   mRNA            complement(join(3262010..3262092,3262093..3262261,
FT                   3262748..3262912,3263934..3264010,3264885..3265025,
FT                   3273130..3273207,3273412..3273510,3273511..3273526))
FT                   /locus_tag="VIT_17s0000g08540"
FT                   /old_locus_tag="Vv17s0000g08540"
FT                   /product="Predicted protein"
FT   3'UTR           complement(3262010..3262092)
FT                   /locus_tag="VIT_17s0000g08540"
FT                   /old_locus_tag="Vv17s0000g08540"
FT   CDS_pept        complement(join(3262093..3262261,3262748..3262912,
FT                   3263934..3264010,3264885..3265025,3273130..3273207,
FT                   3273412..3273510))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08540"
FT                   /old_locus_tag="Vv17s0000g08540"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHQ7"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHQ7"
FT                   /protein_id="CBI15017.3"
FT                   /translation="MRPQIVLFGDSITEQSFRSGGWGAALADTYSRKADIVLRGYGGYT
FT                   SRLALFLLQYLFPLGSTKPPVATTVFFGANDAALAGRTSERQHVPVEEYKENLRRIVHH
FT                   LKECSSTMLVVLVTPPPVDEEGRMQYAKSLYGEKAMELPERTNEMAGVYARQCVELARE
FT                   LGLPSINLWSKMQETEGWQKKFLSDGLHLTAEGNAVVYQEVERVLREAWLPASEMPNDF
FT                   PHHSLIDWKHPEKTFQQQCI"
FT   5'UTR           complement(3273511..3273526)
FT                   /locus_tag="VIT_17s0000g08540"
FT                   /old_locus_tag="Vv17s0000g08540"
FT   gene            complement(3289341..3294594)
FT                   /locus_tag="VIT_17s0000g08530"
FT                   /old_locus_tag="Vv17s0000g08530"
FT   mRNA            complement(join(3289341..3289543,3289544..3289855,
FT                   3290395..3290665,3291134..3291453,3291539..3291676,
FT                   3292245..3292340,3292478..3292651,3292756..3292922,
FT                   3293204..3293369,3293636..3293774,3293864..3294056,
FT                   3294152..3294234,3294491..3294594))
FT                   /locus_tag="VIT_17s0000g08530"
FT                   /old_locus_tag="Vv17s0000g08530"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(3289341..3289543)
FT                   /locus_tag="VIT_17s0000g08530"
FT                   /old_locus_tag="Vv17s0000g08530"
FT   CDS_pept        complement(join(3289544..3289855,3290395..3290665,
FT                   3291134..3291453,3291539..3291676,3292245..3292340,
FT                   3292478..3292651,3292756..3292922,3293204..3293369,
FT                   3293636..3293774,3293864..3294056,3294152..3294234,
FT                   3294491..3294594))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08530"
FT                   /old_locus_tag="Vv17s0000g08530"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHQ8"
FT                   /db_xref="InterPro:IPR003020"
FT                   /db_xref="InterPro:IPR011531"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHQ8"
FT                   /protein_id="CBI15018.3"
FT                   /translation="MEETFVPFRGIKNDLKGRILCYKQDWTGGLRAGIGILAPTTYIFF
FT                   ASAIPVISFGEQLERYTNGTLTAVQTLASTALCGIIHSIVGGQPLLILGVAEPTVLMYT
FT                   FMFNFAKDRKDLGQELFLAWTGWVCVWTALLLFLLAILGACSIINRFTRIAGELFGLLI
FT                   AMLFMQQAIRGVVEEFGIPQREDRNQTAFLPSWRFGNGMFALVLSFGLLLTALRSRKAR
FT                   SWRYGTGWLRGLIADYGVPFMVVVWTAVSYIPVNDVPKGIPRRLFSPNPWSPGAYSNWT
FT                   VIKEMLDVPPLYIVGAFIPATMIAVLYYFDHSVASQLAQQKEFNLKKPASYHYDLLLLG
FT                   FLVILCGLIGIPPSNGVIPQSPMHTKSLATLKHQLLRNKLVSTVRKSMRKNANLGQLYS
FT                   SMQEAYNEMQTPLVYQTPPALGLKELKESTIQLASSTGFIDAPVDETVFDVDKDVDDLL
FT                   PVEVKEQRLSNLLQAMMVGACVAAMPVLKKIPTSVLWGYFAFMAIESLPGNQFWERILL
FT                   LFTAPSRRYKVLEECHATFVETVPFKAIATFTLFQTVYLLVCFGITWIPIAGVLFPMMI
FT                   MLLVPVRQYLLPKFFKGVHLQELDAAEYEEAPAMTFNMSCEDQDPQARTTHIDSGEILD
FT                   EMITRSRGEIRNTQSPKVTSSSPASLGDMKPAYSPRLSQRAYSPRLSELRAEQSPRFTG
FT                   KGVELKETPSPRPSILGKSPHGSSSS"
FT   gene            3342560..3370284
FT                   /locus_tag="VIT_17s0000g08520"
FT                   /old_locus_tag="Vv17s0000g08520"
FT   mRNA            join(3342560..3342830,3347490..3347702,3347935..3347993,
FT                   3348604..3348720,3350767..3350886,3350993..3351087,
FT                   3351181..3351274,3351516..3351647,3352553..3352665,
FT                   3352843..3353039,3354274..3354314,3357238..3357446,
FT                   3358837..3358881,3359033..3359081,3364023..3364105,
FT                   3364631..3364747,3365221..3365284,3365661..3365807,
FT                   3365929..3366087,3368238..3368321,3369286..3369480,
FT                   3369626..3369697,3369927..3370016,3370017..3370284)
FT                   /locus_tag="VIT_17s0000g08520"
FT                   /old_locus_tag="Vv17s0000g08520"
FT                   /product="unknown predicted protein"
FT   CDS_pept        join(3342560..3342830,3347490..3347702,3347935..3347993,
FT                   3348604..3348720,3350767..3350886,3350993..3351087,
FT                   3351181..3351274,3351516..3351647,3352553..3352665,
FT                   3352843..3353039,3354274..3354314,3357238..3357446,
FT                   3358837..3358881,3359033..3359081,3364023..3364105,
FT                   3364631..3364747,3365221..3365284,3365661..3365807,
FT                   3365929..3366087,3368238..3368321,3369286..3369480,
FT                   3369626..3369697,3369927..3370016)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08520"
FT                   /old_locus_tag="Vv17s0000g08520"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSM7"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="InterPro:IPR004567"
FT                   /db_xref="InterPro:IPR015844"
FT                   /db_xref="InterPro:IPR035073"
FT                   /db_xref="InterPro:IPR036075"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSM7"
FT                   /protein_id="CCB42974.1"
FT                   /translation="MACLKEDPILRSNDIKEDSEETEPKDKVREEGGVREMVLPAGNSI
FT                   HRSGSRPQLDLSGAAIQGNNFEERHPTILLPNQSDDISHLALDIGGSLIKLVYFSRHED
FT                   RSIDDKRKRSIKERLGVTNGNRRSYPILGGRLHFVKFETSKINECLDFINSKQLHRGGM
FT                   DSRLWLSEAPPSDDVIIKATGGGAHKFADLFKERLGVSIDKEDEMDCLVAGANFLLKAI
FT                   RHEAFTHMEGHKEFVQIDHNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYW
FT                   GLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKTIS
FT                   ENKELEDYRPEDISLSLLRMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTIS
FT                   FAVQFWSNGDAQAMFLRHEGFLGALGAFMSYEKHGLDDLMVHQLVERFPMGAPYIGGRI
FT                   HGPPLGDLNEKAMVQVVGLDFLVFSDISWMEKFVQKGTEITAPVPMAPSGTTGLGGFEV
FT                   PSSKGDTLRSDASALNIGVLHLVPTLEVFPLLADPKMYEPNTIDLADPSELEYWFTVLS
FT                   EHLPDLVDKAVASEGGTDDAKRRGDAFARAFSAHLARLMEEPAAYGKLGLANLLELREE
FT                   CLREFHFVDAYRSIKQRENEASLAVLPDLLMEIDSMNEETRLLTLIEGVLAANIFDWGS
FT                   RACVDLYHKGTIIEIYRMSRKKMQRPWRVDDFDIFEERMLGSEDKKPRPHKRALLFVDN
FT                   SGADVILGMLPLARELLRRGTEVVLVANSLPALNDVTAMELPDIVAEAAKHCDILRRAA
FT                   EAGGLLVDAMVNIQDGSKDSLSSVPLMVVENGCGSPCIDLRQVSSELAAAAKEADLIIL
FT                   EGMGRALHTNFNARFKCDALKLAMVKNQRLAEKLIKGNIYDCVCRYEPAP"
FT   gap             3343521..3344364
FT                   /estimated_length=844
FT   gap             3357701..3357800
FT                   /estimated_length=100
FT   3'UTR           3370017..3370284
FT                   /locus_tag="VIT_17s0000g08520"
FT                   /old_locus_tag="Vv17s0000g08520"
FT   gene            3375162..3379074
FT                   /locus_tag="VIT_17s0000g08510"
FT                   /old_locus_tag="Vv17s0000g08510"
FT   mRNA            join(3375162..3378872,3378873..3379074)
FT                   /locus_tag="VIT_17s0000g08510"
FT                   /old_locus_tag="Vv17s0000g08510"
FT                   /product="putative uncharacterized protein"
FT   CDS_pept        3375162..3378872
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08510"
FT                   /old_locus_tag="Vv17s0000g08510"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR000313"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSM8"
FT                   /protein_id="CCB42975.1"
FT                   /translation="MGEKPNAPKTLAEDPGAKALEEASGSFGFSESPTGSVSVLVEKNG
FT                   GSADVDDKDNGVSNVVVATLAGTEKCLGVGQTEKCCLLNEGVVVETKVHGASDSVESQI
FT                   VLPQNNEVSVEGDTSLSEVGRIGNGDEKSGIEKMVMDEEMKDCPMSPLDGVESPKKIEV
FT                   SGDGISLVVEVSGPPSGVIGDNLDEANCSGLEVDAKKTKESGNKEGEAIDNQDCKFSIG
FT                   DLVWVKTKSESWWPGQICDPMDVSKYVAKCSSGHSFLVGYFGNGKFDWCSPSQLKPLHE
FT                   DFEQMSGQTNSRSFLGAVEKAVNEIGRHVKLEMTCSCILKKSRTELPSLLAGNSGVKEE
FT                   LSVPEHKMCDLVAPFEPAKFLAHLKNLARVVSMSSMLEFAVLKSRLSAFYCSIGHCQLS
FT                   MRQLRGTNDIEDSAGDELTARSNVDDQIREQNQDGFGKTPSTSLQKESENLQDKVSHTK
FT                   KTVGPAKISRQDMDVVQENHRKDVAEEEIISNNPPSKTRKRKKRGGFQVRKECHEAEDV
FT                   GKLASSSEEAGLSRSPTTMENKASNVRDGDSGTGTKSEKGVESRERKKSKYLSPPYINL
FT                   NWGRKGPVLEDSETEDPKVPKVSCAGVGMNEASEQLGAPPPIVKCSGKAQKKRSRKSVS
FT                   EGNTSGDVDSINASSAVMLSELRFAALDCLYPSERKNFVSIERFFHRFRCSMYSEASQC
FT                   KMYENNISGEKEALAAEPSSLEKGPLEIKLPIKPEPKKRKKKEKVTLKHLAELTAGIPD
FT                   ASGNHVKSSLLGKDSAGDELRGVNGHSHNMQEMSCQSSKGKPGRKMMKKKEGTNSKRSK
FT                   TKPTPGLLDVNVGIVTSSSLINDSGEVKPLAPNGKPEPNKRKKEGATSERLHMKFTAGI
FT                   PDLNRNSPVPSPSVEDLQVMSTVALDVNGNNAKPSPSMKDLPGMGLHSLGVIPELNGRE
FT                   GKEGASSNGEFTVSLPEVNGNIAKFSLMVEDSQVTSLLAPGGKLKPRKRKRKEKAMMEC
FT                   PEINCAASIPDLNGNSAEPSSTEKHLLEINCLSSKVKPERKKRRRKGEVGNKIVGGMLD
FT                   INMNYNKVANTAEALGTTLTLTFAQGSPMPSKEALVEAFFKFGPLKESETEVLKDSPGA
FT                   QVVFIRYSDAREAFQSLEKCSPFGPALVNYQLNHSSAASMALEQDRNQPAALASQPVES
FT                   LKTPARSSGSKPPIGEARPLFFIRQNLEMMTSMLEKSGDNLSPEMRAKLEGEIKGLLKK
FT                   VSTMVGSSSSS"
FT   3'UTR           3378873..3379074
FT                   /locus_tag="VIT_17s0000g08510"
FT                   /old_locus_tag="Vv17s0000g08510"
FT   gene            complement(3379955..3380864)
FT                   /locus_tag="VIT_17s0000g08500"
FT                   /old_locus_tag="Vv17s0000g08500"
FT   mRNA            complement(join(3379955..3380155,3380156..3380737,
FT                   3380738..3380864))
FT                   /locus_tag="VIT_17s0000g08500"
FT                   /old_locus_tag="Vv17s0000g08500"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(3379955..3380155)
FT                   /locus_tag="VIT_17s0000g08500"
FT                   /old_locus_tag="Vv17s0000g08500"
FT   CDS_pept        complement(3380156..3380737)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08500"
FT                   /old_locus_tag="Vv17s0000g08500"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSQ3"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSQ3"
FT                   /protein_id="CCB42976.1"
FT                   /translation="MKFTALVKTVRVHPTLPKIIGPLQSRFFQHDFVPREPNAKPKRYK
FT                   YPPFYDPYGPKPPPSEKVVGLAERIAALAPEERLQIGPMLKDRLSLPKTQVISTEGMEL
FT                   GSQGGAAAGAGKVEEKVEKTAFDVKLEKFEAAAKIKVIKEVRAFTSLGLKEAKDLVEKV
FT                   PVVIKQGITKEEANDIIEKIKAAGGVAVME"
FT   5'UTR           complement(3380738..3380864)
FT                   /locus_tag="VIT_17s0000g08500"
FT                   /old_locus_tag="Vv17s0000g08500"
FT   gene            3381532..3388546
FT                   /locus_tag="VIT_17s0000g08490"
FT                   /old_locus_tag="Vv17s0000g08490"
FT   mRNA            join(3381532..3381560,3381561..3381602,3381763..3381837,
FT                   3384413..3384499,3384637..3384693,3386642..3386734,
FT                   3387128..3387200,3387345..3387420,3387575..3387665,
FT                   3387969..3388088,3388089..3388092,3388207..3388546)
FT                   /locus_tag="VIT_17s0000g08490"
FT                   /old_locus_tag="Vv17s0000g08490"
FT                   /product="Predicted protein"
FT   5'UTR           3381532..3381560
FT                   /locus_tag="VIT_17s0000g08490"
FT                   /old_locus_tag="Vv17s0000g08490"
FT   CDS_pept        join(3381561..3381602,3381763..3381837,3384413..3384499,
FT                   3384637..3384693,3386642..3386734,3387128..3387200,
FT                   3387345..3387420,3387575..3387665,3387969..3388088)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08490"
FT                   /old_locus_tag="Vv17s0000g08490"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHR2"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR026699"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="InterPro:IPR037319"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHR2"
FT                   /protein_id="CBI15022.3"
FT                   /translation="MEDNTPASFVDQLVVPGDVVLDLSKMGNQTIKLGGGLHQDCDAIT
FT                   VTKAGRLRFSKPNKYWVESSQKRYVPCVEDTVLGIVVDSKADNFLVDIKGPALAFLPVL
FT                   AFEGGTRRNIPKFEAGTLLYVRVVKANTGMNPELSCTDASGKAAEFGPLKDGYMFESST
FT                   GLSRMLLSSPTCPVLEALGKKLSFEIAVGLNGRVWVNASSPSTVILVANAIMNSESLSV
FT                   VQQKIMVDKLLQRIQ"
FT   3'UTR           join(3388089..3388092,3388207..3388546)
FT                   /locus_tag="VIT_17s0000g08490"
FT                   /old_locus_tag="Vv17s0000g08490"
FT   gene            3397629..3398526
FT                   /locus_tag="VIT_17s0000g08480"
FT                   /old_locus_tag="Vv17s0000g08480"
FT   mRNA            join(3397629..3397746,3397849..3397978,3398072..3398474,
FT                   3398475..3398526)
FT                   /locus_tag="VIT_17s0000g08480"
FT                   /old_locus_tag="Vv17s0000g08480"
FT                   /product="Transcription factor Myb"
FT   CDS_pept        join(3397629..3397746,3397849..3397978,3398072..3398474)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08480"
FT                   /old_locus_tag="Vv17s0000g08480"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHR3"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHR3"
FT                   /protein_id="CBI15023.3"
FT                   /translation="MEGANGYRKGLWTVEEDRILMDYIRVHGKGKWNRIAKVTGLKRCG
FT                   KSCRLRWMNYLSPSVKRGDFSQEEDDLIIRLHNLLGNRWSLIAGRVPGRTDNQVKNHWN
FT                   THLSKKLGIKKHKSKSEGSSQAQSIEAKEAHSMPSNPDSKPPSEDKNGETGPEVREDLP
FT                   RSMTMLANTQDMEMGTEDYESSLWFSTGDLDLNAPSLMQFLDGHVLDFVWDGL"
FT   3'UTR           3398475..3398526
FT                   /locus_tag="VIT_17s0000g08480"
FT                   /old_locus_tag="Vv17s0000g08480"
FT   gene            complement(3401586..3411915)
FT                   /locus_tag="VIT_17s0000g08470"
FT                   /old_locus_tag="Vv17s0000g08470"
FT   mRNA            complement(join(3401586..3401771,3401844..3401949,
FT                   3402118..3402207,3402303..3402351,3411837..3411915))
FT                   /locus_tag="VIT_17s0000g08470"
FT                   /old_locus_tag="Vv17s0000g08470"
FT                   /product="Carbonic anhydrase"
FT   CDS_pept        complement(join(3401586..3401771,3401844..3401949,
FT                   3402118..3402207,3402303..3402351,3411837..3411915))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08470"
FT                   /old_locus_tag="Vv17s0000g08470"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHR4"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHR4"
FT                   /protein_id="CBI15024.3"
FT                   /translation="MFFFFFLVFHEVVVQKVTHFPFKHQTPRIQMNIKNLQKASTPSFW
FT                   CLHARTLEFARLMSSTSSHEKPSWSGTLDFIDDWVKIGLPAKAKVKSEWGDKSFEQHCQ
FT                   YCEKESGNSSLVNLLSDPYARAAVAERDLKLVGGYYNFVHGTFGLWEVDVDIDIVCVNI
FT                   NKWQKK"
FT   gap             3409960..3410059
FT                   /estimated_length=100
FT   gene            complement(3412535..3414293)
FT                   /locus_tag="VIT_17s0000g08460"
FT                   /old_locus_tag="Vv17s0000g08460"
FT   mRNA            complement(join(3412535..3412699,3412937..3413042,
FT                   3413127..3413212,3413294..3413347,3413455..3413571,
FT                   3413672..3413720,3413891..3414040,3414235..3414293))
FT                   /locus_tag="VIT_17s0000g08460"
FT                   /old_locus_tag="Vv17s0000g08460"
FT                   /product="Carbonic anhydrase"
FT   CDS_pept        complement(join(3412535..3412699,3412937..3413042,
FT                   3413127..3413212,3413294..3413347,3413455..3413571,
FT                   3413672..3413720,3413891..3414040,3414235..3414293))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08460"
FT                   /old_locus_tag="Vv17s0000g08460"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHR5"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHR5"
FT                   /protein_id="CBI15025.3"
FT                   /translation="MDMATSSSDVAIEGLRPLLSDKEGLDEIAAAKIEKLTAELQEQEQ
FT                   EQDHECDPVERIKDGFIHFKIHHFDKYPDYYKQLAEGQHPKFLVFACSDSRVSPSHVLN
FT                   FKPGEAFMCRNIANLVPAFNQLRYSGVGAVIEYAVKHLEVENILVIGHSRCGGIEALMS
FT                   LPADGTTSNDFIDDWVKIALPAKAKVESEWSDATFEQQCEYLGRESVNLSLVNLLSYPY
FT                   VQAALANKALKLMGGYYDFVNGTFGLWKADFDIKPPIII"
FT   gene            complement(3437343..3439386)
FT                   /locus_tag="VIT_17s0000g08450"
FT                   /old_locus_tag="Vv17s0000g08450"
FT   mRNA            complement(join(3437343..3437534,3437535..3437699,
FT                   3437980..3438085,3438156..3438241,3438364..3438417,
FT                   3438525..3438641,3438742..3438790,3439007..3439150,
FT                   3439305..3439363,3439364..3439386))
FT                   /locus_tag="VIT_17s0000g08450"
FT                   /old_locus_tag="Vv17s0000g08450"
FT                   /product="Carbonic anhydrase"
FT   3'UTR           complement(3437343..3437534)
FT                   /locus_tag="VIT_17s0000g08450"
FT                   /old_locus_tag="Vv17s0000g08450"
FT   CDS_pept        complement(join(3437535..3437699,3437980..3438085,
FT                   3438156..3438241,3438364..3438417,3438525..3438641,
FT                   3438742..3438790,3439007..3439150,3439305..3439363))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08450"
FT                   /old_locus_tag="Vv17s0000g08450"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHR6"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHR6"
FT                   /protein_id="CBI15026.3"
FT                   /translation="MDMAKSSTEVAIEGLKRLLSDKEGLDEIAAAKIEKLTADLQEQDH
FT                   EEEFDPVRRIKDGFIHFKIHHFDKYPDYYKQLAEGQHPKFLVFACSDSRVSPSHVLNFK
FT                   PGEAFMCRNIANMVPAFNQLRYSGVGAVIEYAVKHLEVENILVIGHSRCGGIQALMSLP
FT                   ADGTTSNDFIDDWVKIGLPAKAKVESEWSDATFEEQCEHCEKESVNLSLVNLLSYPYVR
FT                   AALANRALKLMGGYYDFVNGTFGLWKADFDITPEIII"
FT   5'UTR           complement(3439364..3439386)
FT                   /locus_tag="VIT_17s0000g08450"
FT                   /old_locus_tag="Vv17s0000g08450"
FT   gene            3481909..3483553
FT                   /locus_tag="VIT_17s0000g08440"
FT                   /old_locus_tag="Vv17s0000g08440"
FT   mRNA            join(3481909..3482362,3482363..3482430,3482721..3482805,
FT                   3483485..3483553)
FT                   /locus_tag="VIT_17s0000g08440"
FT                   /old_locus_tag="Vv17s0000g08440"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           3481909..3482362
FT                   /locus_tag="VIT_17s0000g08440"
FT                   /old_locus_tag="Vv17s0000g08440"
FT   CDS_pept        join(3482363..3482430,3482721..3482805,3483485..3483553)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08440"
FT                   /old_locus_tag="Vv17s0000g08440"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHR7"
FT                   /protein_id="CBI15027.3"
FT                   /translation="MDFYCLKGKSHATDLVNSFLSQRYMPAMELGVLSDMPNIRKKACM
FT                   KLLKQQGLHGSKLLSAYKDMVCILNMCY"
FT   gene            3483574..3485094
FT                   /locus_tag="VIT_17s0000g08430"
FT                   /old_locus_tag="Vv17s0000g08430"
FT   mRNA            join(3483574..3483605,3484992..3485034,3485035..3485094)
FT                   /locus_tag="VIT_17s0000g08430"
FT                   /old_locus_tag="Vv17s0000g08430"
FT   CDS_pept        join(3483574..3483605,3484992..3485034)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08430"
FT                   /old_locus_tag="Vv17s0000g08430"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHR8"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHR8"
FT                   /protein_id="CBI15028.3"
FT                   /translation="MLPCRIRAVFIFYLAVFFSILQHI"
FT   3'UTR           3485035..3485094
FT                   /locus_tag="VIT_17s0000g08430"
FT                   /old_locus_tag="Vv17s0000g08430"
FT   gene            3485095..3487111
FT                   /locus_tag="VIT_17s0000g08420"
FT                   /old_locus_tag="Vv17s0000g08420"
FT   mRNA            join(3485095..3485121,3485231..3485445,3486489..3486519,
FT                   3486520..3486535,3486834..3487111)
FT                   /locus_tag="VIT_17s0000g08420"
FT                   /old_locus_tag="Vv17s0000g08420"
FT   CDS_pept        join(3485095..3485121,3485231..3485445,3486489..3486519)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08420"
FT                   /old_locus_tag="Vv17s0000g08420"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHR9"
FT                   /protein_id="CBI15029.3"
FT                   /translation="MFILELNLKRLLVVELLSISCEEASQDDRYCWSDELYPGEFDDLG
FT                   ICSLHSKEIGELIPPKIIGFDLLYVLISSQMMRSYRFTLQLGLQR"
FT   3'UTR           join(3486520..3486535,3486834..3487111)
FT                   /locus_tag="VIT_17s0000g08420"
FT                   /old_locus_tag="Vv17s0000g08420"
FT   gene            3491470..3498687
FT                   /locus_tag="VIT_17s0000g08410"
FT                   /old_locus_tag="Vv17s0000g08410"
FT   mRNA            join(3491470..3491511,3491661..3491674,3491675..3491732,
FT                   3493862..3494100,3494233..3494281,3494399..3494583,
FT                   3494857..3495046,3495195..3495284,3495621..3495688,
FT                   3495791..3495833,3495926..3495993,3496829..3496873,
FT                   3496962..3497030,3497950..3498417,3498418..3498687)
FT                   /locus_tag="VIT_17s0000g08410"
FT                   /old_locus_tag="Vv17s0000g08410"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           3491470..3491511
FT                   /locus_tag="VIT_17s0000g08410"
FT                   /old_locus_tag="Vv17s0000g08410"
FT   CDS_pept        join(3491675..3491732,3493862..3494100,3494233..3494281,
FT                   3494399..3494583,3494857..3495046,3495195..3495284,
FT                   3495621..3495688,3495791..3495833,3495926..3495993,
FT                   3496829..3496873,3496962..3497030,3497950..3498417)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08410"
FT                   /old_locus_tag="Vv17s0000g08410"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHS0"
FT                   /db_xref="InterPro:IPR006785"
FT                   /db_xref="InterPro:IPR025655"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHS0"
FT                   /protein_id="CBI15030.3"
FT                   /translation="MATQSTPPPDSTTEKPQTPASEIVQPRNEDQQDAKAAATISPPSV
FT                   FVNSEPMREEQVQNAVKFLSHPKVRGSPVIYRRSFLEKKGLTKEEIDEAFRRVPDQSPT
FT                   VTGVQAVSANQDGQLKSSNIQQQAQAQTLHPSAATPAGVISKTGTQYRFHWSHAFLAIG
FT                   FLAASGAGTAILFKNAFIPRLKSWIRKIVLEGENDIVQKSNSKPSLAEEATAAAKAAAA
FT                   AAADVAKTSQEILTSKIEENRRLEEFMNLLNVQVQEMKSMSNAIRKLEGPNNSTGRLIQ
FT                   QEDTRGLMTTSKHLNVNGKAEFDSRSVRSSSPPASSEPSVAPHPKSYLEIMAMVQRGEK
FT                   PPNIRDINDLPPNPNQPLSNPRLAPRTKPWEVGQVQYSAGHAYQSQVTGEGFNSRAQDN
FT                   GVGYQLNGDSSTWWQQKNARITEIETEDEPRTASYTASNEQPIQRTWVPPQPPPIAMPE
FT                   AAAAIRQPKSSIQRESLVNDQSVSRPSDEIDELQRITKISESGGVVEIKEESSGLNSSE
FT                   MQQEQE"
FT   3'UTR           3498418..3498687
FT                   /locus_tag="VIT_17s0000g08410"
FT                   /old_locus_tag="Vv17s0000g08410"
FT   gene            complement(3500830..3502716)
FT                   /locus_tag="VIT_17s0000g08400"
FT                   /old_locus_tag="Vv17s0000g08400"
FT   mRNA            complement(join(3500830..3501261,3501262..3501471,
FT                   3502664..3502716))
FT                   /locus_tag="VIT_17s0000g08400"
FT                   /old_locus_tag="Vv17s0000g08400"
FT                   /product="Predicted protein"
FT   CDS_pept        complement(3500830..3501261)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08400"
FT                   /old_locus_tag="Vv17s0000g08400"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSQ4"
FT                   /protein_id="CCB42977.1"
FT                   /translation="MPSVKSKENLQCSVCLDDFEISAEAGEMPCKHKFHSGCILPWLEL
FT                   HSSCPVRMFQIAADESKLDSDASQNVSSNNGHGSSEGGVRFFCSASSLVLRLFNGSDQA
FT                   WKSVTNLPWKLTRQSLFLECFSLLLLWFLLQRTQMTLQF"
FT   5'UTR           complement(3502664..3502716)
FT                   /locus_tag="VIT_17s0000g08400"
FT                   /old_locus_tag="Vv17s0000g08400"
FT   gene            3511619..3518526
FT                   /locus_tag="VIT_17s0000g08390"
FT                   /old_locus_tag="Vv17s0000g08390"
FT   mRNA            join(3511619..3511746,3511747..3511834,3513380..3513558,
FT                   3513922..3514008,3514406..3514531,3514617..3514679,
FT                   3515670..3515819,3516043..3516110,3516587..3516698,
FT                   3516809..3516913,3517036..3517157,3517738..3517884,
FT                   3518227..3518395,3518396..3518526)
FT                   /locus_tag="VIT_17s0000g08390"
FT                   /old_locus_tag="Vv17s0000g08390"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT   5'UTR           3511619..3511746
FT                   /locus_tag="VIT_17s0000g08390"
FT                   /old_locus_tag="Vv17s0000g08390"
FT   CDS_pept        join(3511747..3511834,3513380..3513558,3513922..3514008,
FT                   3514406..3514531,3514617..3514679,3515670..3515819,
FT                   3516043..3516110,3516587..3516698,3516809..3516913,
FT                   3517036..3517157,3517738..3517884,3518227..3518395)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08390"
FT                   /old_locus_tag="Vv17s0000g08390"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHS1"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHS1"
FT                   /protein_id="CBI15031.3"
FT                   /translation="MALNLLPPAEIKLISFLDSTKSTRLPKLPGGFVLKRKDYGATFGR
FT                   RVNCSAQPPPPAWPGRAVPELGRKTWDGPKPLSVVGSTGSIGTQTLDIVAENPDKFRIV
FT                   ALAAGSNVTLLADQVKTFKPQLVAVRNEALVNELKEALADCEHKPEIIPGEQGVIEVAR
FT                   HPEAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPA
FT                   DSEHSAIFQCIQGLPEGALRRILLTASGGAFRDWPVDKLKEAKVSDALKHPNWNMGKKI
FT                   TVDSATLFNKGLEVIEAHYLFGAEYDDIEIIIHPQSIIHSMVETQDSSVLAQLGWPDMR
FT                   LPILYTLSWPDRIYCSEITWPRLDLCKLGSLTFKTPDNVKYPSMDLAYAAGRAGGTMTG
FT                   VLSAANEKAVEMFIDEKIGYLDIFKVVELTCDKHQAELVTSPSLEEIVHYDLWARDYAA
FT                   SLHHSSSLMPVPA"
FT   3'UTR           3518396..3518526
FT                   /locus_tag="VIT_17s0000g08390"
FT                   /old_locus_tag="Vv17s0000g08390"
FT   gene            complement(3525761..3526912)
FT                   /locus_tag="VIT_17s0000g08380"
FT                   /old_locus_tag="Vv17s0000g08380"
FT   mRNA            complement(join(3525761..3525909,3525910..3526821,
FT                   3526822..3526912))
FT                   /locus_tag="VIT_17s0000g08380"
FT                   /old_locus_tag="Vv17s0000g08380"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(3525761..3525909)
FT                   /locus_tag="VIT_17s0000g08380"
FT                   /old_locus_tag="Vv17s0000g08380"
FT   CDS_pept        complement(3525910..3526821)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08380"
FT                   /old_locus_tag="Vv17s0000g08380"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR012442"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSQ5"
FT                   /protein_id="CCB42978.1"
FT                   /translation="MQRSPVLGLSPSFNSYNSGRLAEIAARIIEELGESEFQTEIEAGN
FT                   DLEESIPSLQVKEGDEESALFSEVKSGNDDEEVKEDEVDNDGDDDSEFAFVWREPETSP
FT                   ISADEIFYNGQIRPVFPIFNRDLLLGEGQNQEVSVKPPTPASIRRPLRKLLIEERGTDS
FT                   CSSSEADELEGVPPGTYCVWTPKVAESPPARCRKSNSTGSSKRWKFRDFLHRSNSDGKD
FT                   TFVFLTPNSSVKKKAEKEAPSGAGKPKPKAVAGENATSANRKNNTAAKKEGDRRRSFLP
FT                   YRQDLVGFFANVNGLSRNLHPF"
FT   5'UTR           complement(3526822..3526912)
FT                   /locus_tag="VIT_17s0000g08380"
FT                   /old_locus_tag="Vv17s0000g08380"
FT   gene            complement(3539802..3543447)
FT                   /locus_tag="VIT_17s0000g08370"
FT                   /old_locus_tag="Vv17s0000g08370"
FT   mRNA            complement(join(3539802..3540736,3540737..3540850,
FT                   3541863..3541958,3542066..3542202,3542305..3542546,
FT                   3542690..3543135,3543136..3543447))
FT                   /locus_tag="VIT_17s0000g08370"
FT                   /old_locus_tag="Vv17s0000g08370"
FT                   /product="Predicted protein"
FT   3'UTR           complement(3539802..3540736)
FT                   /locus_tag="VIT_17s0000g08370"
FT                   /old_locus_tag="Vv17s0000g08370"
FT   CDS_pept        complement(join(3540737..3540850,3541863..3541958,
FT                   3542066..3542202,3542305..3542546,3542690..3543135))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08370"
FT                   /old_locus_tag="Vv17s0000g08370"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHS2"
FT                   /db_xref="InterPro:IPR012317"
FT                   /db_xref="InterPro:IPR022003"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHS2"
FT                   /protein_id="CBI15032.3"
FT                   /translation="METMAVEPWDVMYHTANHGDEASVSDCESGTTHNEHIHGLVRLDE
FT                   DEKLHRIIEKALVSGLGPLRQHTSVVDIHRNGYASVISQARLQSFRIFGRAVEKKCEGN
FT                   ANVKFGWYSASKDEIGRIISHGFSHSNGLYGCGVYLYPHHSSIESMKSCVVDEDGLRHL
FT                   LLCRVILGKMEVVHPGSQQYHPSSEDFDSGVDNLPAPKKYIVWSTHMNTHILPEYVVTF
FT                   RAPPCLKGFLNTQGSLKKPTSPWMPFTTLISVLSKFLPPQSVNLIAKHHRDHRENKIPR
FT                   HELIRLVRQIAGDKLLTVVIKSHRAKQLNSTNGSHQRKAQNGARNRMDSIQQPGSSIES
FT                   IYLE"
FT   5'UTR           complement(3543136..3543447)
FT                   /locus_tag="VIT_17s0000g08370"
FT                   /old_locus_tag="Vv17s0000g08370"
FT   gene            complement(3544829..3584141)
FT                   /locus_tag="VIT_17s0000g08360"
FT                   /old_locus_tag="Vv17s0000g08360"
FT   mRNA            complement(join(3544829..3545173,3545174..3545251,
FT                   3546299..3546442,3547111..3547176,3547260..3547394,
FT                   3547511..3547642,3548826..3548925,3549012..3549051,
FT                   3549749..3549831,3549919..3549998,3550899..3550988,
FT                   3551509..3551617,3551725..3551819,3558858..3558917,
FT                   3559085..3559141,3559270..3559410,3561434..3561496,
FT                   3561579..3561668,3561806..3561886,3562121..3562204,
FT                   3562774..3562857,3562980..3563027,3563101..3563302,
FT                   3563403..3563554,3563892..3563990,3565389..3565508,
FT                   3566293..3566367,3566449..3566515,3567860..3567975,
FT                   3568179..3568496,3582479..3582565,3582742..3582846,
FT                   3584076..3584141))
FT                   /locus_tag="VIT_17s0000g08360"
FT                   /old_locus_tag="Vv17s0000g08360"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(3544829..3545173)
FT                   /locus_tag="VIT_17s0000g08360"
FT                   /old_locus_tag="Vv17s0000g08360"
FT   CDS_pept        complement(join(3545174..3545251,3546299..3546442,
FT                   3547111..3547176,3547260..3547394,3547511..3547642,
FT                   3548826..3548925,3549012..3549051,3549749..3549831,
FT                   3549919..3549998,3550899..3550988,3551509..3551617,
FT                   3551725..3551819,3558858..3558917,3559085..3559141,
FT                   3559270..3559410,3561434..3561496,3561579..3561668,
FT                   3561806..3561886,3562121..3562204,3562774..3562857,
FT                   3562980..3563027,3563101..3563302,3563403..3563554,
FT                   3563892..3563990,3565389..3565508,3566293..3566367,
FT                   3566449..3566515,3567860..3567975,3568179..3568496,
FT                   3582479..3582565,3582742..3582846,3584076..3584141))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08360"
FT                   /old_locus_tag="Vv17s0000g08360"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSQ6"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR003152"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014009"
FT                   /db_xref="InterPro:IPR015519"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR036940"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSQ6"
FT                   /protein_id="CCB42979.1"
FT                   /translation="MTITGRRTRLLSCENIRLLLSLICGSYFTSVMYVEHWCEEHFNSL
FT                   TLGKPDFSHCEMLPHHIEILVSAITQINEPDSLYGIIQLHKLTSQIITFEHEGNWSKAL
FT                   EYYDLQVRSEPVAGMDGSSRNLSPEHSQLTVHPSFSKSEDVIRQREPYKGLIRSLQKIG
FT                   CTHVLDLYCQGLTSQNGQFQHDLEFTELQYEAAWRAGNWDFSLLYMGANSPSSSQHIRC
FT                   DHFNENLHSCLRAFQEGDFNEFHSKLKDSKQELVLSVCHASGQSTEYIYSTIIKLQIFY
FT                   HLGMAWGLRWAPPSEKIETSPGMQKVFSEPIIPTMDQGSRFSQAAAALHEFKFLCNRMG
FT                   EQHSASYWLGRLEEAKLLRAQGQHEMAINLAKYISQNSQLNEEASNVYRLVGKWLAETR
FT                   SSNSRTILEKYLKRAVLLAKDNKNTDKKTIERQSQTHFHLAHYADALFRSHEERLASNE
FT                   WQAATRLRKHKTIELEALIKRLRSSSKGEKTDYSVKIQELQKQLAMDAEEAEKLQDDRD
FT                   NFLSLTLEGYKRCLVLGDKYDVRVVFRLVSLWFSLSSRQNVINMMLSTVQEVQSYKFIP
FT                   LVYQIASRMGSSKDGLGPHSFQFALVSLVKKMSIDHPYHTIFQLLALANGDRIKDKQRS
FT                   RNSFVVDMDKKLAAENLLKELSSCHGSIIQQMKQMVEIYIKLAELETKREDTNKRVMLP
FT                   REIRSLRQLELVPVVTSTFPVDRNCQYHEGSFPHFKGLGDSVMIMNGINAPKVVECLGS
FT                   DGQKYRQLAKSGNDDLRQDAVMEQFFSLVNTFLENHRDTWKRRLRVRTYKVVPFTPSAG
FT                   VLEWVNGTLPLGEYLIGSTRNGGAHGRYGMEDWSFSKCREHMTNANKRKAFQEVCKNFR
FT                   PVMHNFFLERFLQPADWFEKRLAYTRSVAASSMVGYIVGLGDRHSMNILIDQATAEVVH
FT                   IDLGVAFEQGLMLKTPERVPFRLTRDIIDGMGVTGVEGVFRRCCEETLSVMRTNKEALL
FT                   TIVEVFIHDPLYKWALSPLKALQRQKETDDDLETSLEDLEEEYEGNKDAARALLRVKQK
FT                   LDGYEEGEMRSVHGQVRQLIQDAIDPDRFCRMFPGWGAWL"
FT   gap             3615767..3615866
FT                   /estimated_length=100
FT   gene            complement(3617158..3633137)
FT                   /locus_tag="VIT_17s0000g08350"
FT                   /old_locus_tag="Vv17s0000g08350"
FT   mRNA            complement(join(3617158..3617228,3617329..3617356,
FT                   3617610..3617852,3618016..3618156,3618251..3618392,
FT                   3626728..3626855,3627057..3627126,3627209..3627330,
FT                   3628264..3628449,3628723..3628842,3629644..3629718,
FT                   3629941..3630004,3630069..3630115,3633123..3633137))
FT                   /locus_tag="VIT_17s0000g08350"
FT                   /old_locus_tag="Vv17s0000g08350"
FT   CDS_pept        complement(join(3617158..3617228,3617329..3617356,
FT                   3617610..3617852,3618016..3618156,3618251..3618392,
FT                   3626728..3626855,3627057..3627126,3627209..3627330,
FT                   3628264..3628449,3628723..3628842,3629644..3629718,
FT                   3629941..3630004,3630069..3630115,3633123..3633137))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08350"
FT                   /old_locus_tag="Vv17s0000g08350"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSQ7"
FT                   /db_xref="InterPro:IPR038980"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSQ7"
FT                   /protein_id="CCB42980.1"
FT                   /translation="MGLLNAVFMMCTVSALDPCQRELVLAALDNLSRKLQYTTRSKYLE
FT                   ELIGSILFCWVTCGVSLVALVEIRDHFVPSVEPTYFMQYCCHWLLPALLLHGDTSNLKW
FT                   VASVAGLPLAVLVKNHFVPIFSVCMALHCSKKSGWEKGAVVLQSSILHVAEISEDERDK
FT                   LIKKYMVSIVSNILSLASCASEPALPFFSRDTIVLAIRNVVDGFLEMEDCPTSVGVVDK
FT                   INIFRSDRVFMFIVEMHYKVTAAVHHRHKCHRLADIEVLIDVLGHRAAVSSTSNYLFNL
FT                   VGQFFGFNALQDQCSRIISMLLESFKSNPSKEIIGVPGEQLQFLVSKLVACCIPSETNA
FT                   ELSGTRSSQVLSLLHQLTIGADPSLYDYIRELEPFPEIDIFDEIREFHQELCRAYSPKD
FT                   HFLKVDCLQHLNNLHHCQNMAFSPNQFLFFMECSLSVCEEIFLPSTKITFVESSSTSQE
FT                   ITFHMCGSDDANSVRALVSDFISRV"
FT   gap             3621712..3623137
FT                   /estimated_length=1426
FT   gap             3629275..3629374
FT                   /estimated_length=100
FT   gene            complement(3649046..3668927)
FT                   /locus_tag="VIT_17s0000g08330"
FT                   /old_locus_tag="Vv17s0000g08330"
FT   mRNA            complement(join(3649046..3649076,3650511..3650638,
FT                   3651028..3651153,3661891..3662055,3662221..3662292,
FT                   3662389..3663001,3664946..3665133,3665229..3665318,
FT                   3665412..3665564,3668202..3668273,3668895..3668927))
FT                   /locus_tag="VIT_17s0000g08330"
FT                   /old_locus_tag="Vv17s0000g08330"
FT   CDS_pept        complement(join(3649046..3649076,3650511..3650638,
FT                   3651028..3651153,3661891..3662055,3662221..3662292,
FT                   3662389..3663001,3664946..3665133,3665229..3665318,
FT                   3665412..3665564,3668202..3668273,3668895..3668927))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08330"
FT                   /old_locus_tag="Vv17s0000g08330"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSQ8"
FT                   /db_xref="InterPro:IPR038980"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSQ8"
FT                   /protein_id="CCB42981.1"
FT                   /translation="MGGCSIMRHLRGDLRDILHLRQNLLRAVLGLLEWKSFILNERMVV
FT                   LLPATVYALCTGCVPFTDCYKGLLISHSFLGVPDRIEDWLKTGEYERESLHEVFECSVE
FT                   VLAEIDLSSSVKVSQPQCHQNVRLPRQLRDPLLNEMETFILATVGEKDSGKMLLSDVFF
FT                   MCALLSNFIYSAFLTRLREELSLFIIKLGKCVVKFLDRAASIVQESHNHIGEHGCLARN
FT                   SIFDGWDLVIASFRSLVCSPLFIKWGDQIALDDALYSTIIQTIERLLKILANLYGKCSD
FT                   CIRNLQSEIVPPDLSASDIPVQNPCPVDGSEVRIMDMELDVSEDSKNVDIIAVSGTIAS
FT                   GISFSTGKWKLDMISLISSFFPVLPAVTWEILFDLMKKETHSKVCENILFSLCQHSHWS
FT                   SSTRLTDMVISMNNMIDMRVNLKLPCYAILAAIRAFLGTLLSMGTAGKDKYVGMSMSRR
FT                   ESEQCLISLGDLVNRVAEFDFLDWFGRIKLVDCIYDFILLNPQIGQTMIERLLTMLRDQ
FT                   DYRVRFFLARRIGVLFQTWDGHDELFQDIWFYSVSILHI"
FT   gap             3679904..3680003
FT                   /estimated_length=100
FT   gene            complement(3690288..3694981)
FT                   /locus_tag="VIT_17s0000g08320"
FT                   /old_locus_tag="Vv17s0000g08320"
FT   mRNA            complement(join(3690288..3690326,3692361..3692438,
FT                   3694090..3694177,3694265..3694404,3694512..3694668,
FT                   3694803..3694981))
FT                   /locus_tag="VIT_17s0000g08320"
FT                   /old_locus_tag="Vv17s0000g08320"
FT   CDS_pept        complement(join(3690288..3690326,3692361..3692438,
FT                   3694090..3694177,3694265..3694404,3694512..3694668,
FT                   3694803..3694981))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08320"
FT                   /old_locus_tag="Vv17s0000g08320"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSQ9"
FT                   /db_xref="InterPro:IPR038980"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSQ9"
FT                   /protein_id="CCB42982.1"
FT                   /translation="MGKVETSFSEKSNSQYNPKEEVFRCVLTLHSLLENPPGDFPDNLR
FT                   EDAVKGFIGIFSFLRDEGKIARKLIECINIFLLKDGPNLGCQCLEIHNAVQQFVLRSWL
FT                   TSHDRGLKDAVISYARLQLNLTRGAADGSPLVEQLLDVVGRELDQTNISSTSVPWSDTT
FT                   KDDRLGTLTSSQCGLVELAALVFYRLRKLSWGGMERLWGKSVKRRGKWPPYNLFDLNNS
FT                   PWER"
FT   gene            complement(3697156..3698057)
FT                   /locus_tag="VIT_17s0000g08310"
FT                   /old_locus_tag="Vv17s0000g08310"
FT   mRNA            complement(join(3697156..3697287,3697983..3698057))
FT                   /locus_tag="VIT_17s0000g08310"
FT                   /old_locus_tag="Vv17s0000g08310"
FT   CDS_pept        complement(join(3697156..3697287,3697983..3698057))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08310"
FT                   /old_locus_tag="Vv17s0000g08310"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSR0"
FT                   /protein_id="CCB42983.1"
FT                   /translation="MATITSRDVEEIVSKLSSDKTKAREEGIKLLNAWLEGEKSIRFCK
FT                   FLGHNTAMLKPNEIPHCKIDVDP"
FT   gene            3739088..3740945
FT                   /locus_tag="VIT_17s0000g08290"
FT                   /old_locus_tag="Vv17s0000g08290"
FT   mRNA            join(3739088..3739203,3739204..3739254,3739755..3740630,
FT                   3740631..3740945)
FT                   /locus_tag="VIT_17s0000g08290"
FT                   /old_locus_tag="Vv17s0000g08290"
FT                   /product="F-box family protein"
FT   5'UTR           3739088..3739203
FT                   /locus_tag="VIT_17s0000g08290"
FT                   /old_locus_tag="Vv17s0000g08290"
FT   CDS_pept        join(3739204..3739254,3739755..3740630)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08290"
FT                   /old_locus_tag="Vv17s0000g08290"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSR1"
FT                   /db_xref="InterPro:IPR003851"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSR1"
FT                   /protein_id="CCB42984.1"
FT                   /translation="MGLTFLPVCMDSSEWLQGTAHEENGMDSSSPSGDMLTCSRPLIER
FT                   RLRPQHDQALKCPRCDSTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGC
FT                   RKNKKVASKKSNDHSINQNPGPSSHNPTDLHLSFPEVQFSHLSNLLGSHGGLGNHSFME
FT                   SKYNGMLENARPIDFMEGKFEAIVGSSRNHDFMGNCELGMGGLGDMSHGGLAPNFHGLC
FT                   SPFGVTLDGNGGNFMDTCQRLMLPYEGNVEQNAMDVKPNTKLLSLDWQDQGCSDAGKDS
FT                   FVYLNSLGSWNGMMSNGYGPSTTNPLV"
FT   3'UTR           3740631..3740945
FT                   /locus_tag="VIT_17s0000g08290"
FT                   /old_locus_tag="Vv17s0000g08290"
FT   gene            3746468..3748891
FT                   /locus_tag="VIT_17s0000g08280"
FT                   /old_locus_tag="Vv17s0000g08280"
FT   mRNA            3746468..3748891
FT                   /locus_tag="VIT_17s0000g08280"
FT                   /old_locus_tag="Vv17s0000g08280"
FT                   /product="Predicted protein"
FT   CDS_pept        3746468..3748891
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08280"
FT                   /old_locus_tag="Vv17s0000g08280"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSR2"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSR2"
FT                   /protein_id="CCB42985.1"
FT                   /translation="MVLVRPLNSPLLPLYPDQFNLQTPSKTPHHISNLVIVTSPVSCSL
FT                   RFQKFNYNPIQKWSSKPLSTKIQTFVSVSFANNVIREYTEDGFFDDAIGVYLKMLDDGV
FT                   KVEEFRYFPCLIKAFGGLCDVYKGRQIHGHVLKLGVLDDVSVVNSLLTMYWKCGVVEDA
FT                   VQMFEKMPEVDLVSWNTMISGFQKSMDYTRSLMFFRSMVWEFGIYPNRVACVSSILSCS
FT                   SLQSLTHGREIHGVVVKSGLDVEEYLVSSLIEMYMKCGSIKNAENIFNSILDKDSVRRN
FT                   AVIWNVMISGYVSNGCFSQALLLFIKMMVWGIKPDYSTMVSLFSLCSESLDIAFGKQIH
FT                   GLIFKFGLKNNIRVETALLDMYLKCGDMGTGLKIFRRSQNHNLIMWSAVISNCAQSGCP
FT                   TKALELFYEFKMEDGLADSGILVAVLRACSSLTLKPEGMQIHGLATKMGFVSDVFVGSA
FT                   LVDLYAKCRDMGYSKKVFLRLSQKDLVSWNALISGYAQDECADEALKAFRDMQLEEIRP
FT                   NTVTIACILSVCAHLSVMTLCKEVHGYLIRQGLGSTVLVSNSLIATYAKCGDINSSLYT
FT                   FEKMPERNDVSWNSIILGMGMHSRTDEMIVLFDKMVASGIKPDHVTFTAILSACSHAGR
FT                   VDEGCKYFKSMVEDFNLKPQLEQYTCMVDLLGRAGHLNQAYDLIMAMPCTPDDRIWGSL
FT                   LGSCKNHGDEILAEIVANHIFKLVPSSVGYRVLLANLYENLGKGREGSKVRSEIKDMGL
FT                   KKKPGCSWIEVDNNFHIFIAGDRSHSQSDEIYAAVESLTTEIKRAGYIPQIYSY"
FT   gene            3751030..3751215
FT                   /locus_tag="VIT_17s0000g08270"
FT                   /old_locus_tag="Vv17s0000g08270"
FT   mRNA            join(3751030..3751074,3751180..3751215)
FT                   /locus_tag="VIT_17s0000g08270"
FT                   /old_locus_tag="Vv17s0000g08270"
FT   CDS_pept        join(3751030..3751074,3751180..3751215)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08270"
FT                   /old_locus_tag="Vv17s0000g08270"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHS5"
FT                   /protein_id="CBI15035.3"
FT                   /translation="MFLKSQRLSLTEENKNFACWLVWMVS"
FT   gene            complement(3752838..3755434)
FT                   /locus_tag="VIT_17s0000g08260"
FT                   /old_locus_tag="Vv17s0000g08260"
FT   mRNA            complement(join(3752838..3752989,3752990..3753200,
FT                   3753381..3755386,3755387..3755434))
FT                   /locus_tag="VIT_17s0000g08260"
FT                   /old_locus_tag="Vv17s0000g08260"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(3752838..3752989)
FT                   /locus_tag="VIT_17s0000g08260"
FT                   /old_locus_tag="Vv17s0000g08260"
FT   CDS_pept        complement(join(3752990..3753200,3753381..3755386))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08260"
FT                   /old_locus_tag="Vv17s0000g08260"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSR3"
FT                   /protein_id="CCB42986.1"
FT                   /translation="MPGVVMEGVNEDGVANELNGSSTAFKENSASNKSPKSNLGLQSPP
FT                   RSAGVEFPMNGVIDTSIEQLYDNVCEMQSSDQSPSRVSFGSEGEESRIDSELRHLVGGE
FT                   MREVEIMEEEVEKPGDNSRSDSGSKKESLSAGKQFGKMDKSELSSKSVSPVHSKKNSQL
FT                   ESEVSSKSNPKSRSPQGKPPSDKRSEKNLRNPNAGVTPLKKQRNSPLGGVKLQNGTDDS
FT                   SEAGLDNPNLGRFLLKQARDLISSGDNPQKALELALRATKSYEKCANGKPSLEQVMCLH
FT                   VTAAIYCNLGQYNEAIPVLEHSIEIPVIEEGQDHALAKFAGHMQLGDTYAMVGQLENSI
FT                   LCYTTGLGVQKQVLGDTDPRVGETCRYLAEAHVQALQFDEAEKLCQMALDIHRENGSPA
FT                   SLEEAADRRLMGLICEMKGDHEAALEHLILASMAMVANGQEIEVASVDCSIGDTYLSLS
FT                   RYDEAIFAYQKALTVFKTTKGENHPSVASVFVRLADLYNKTGKLRESKSYCENALRIYG
FT                   KPIPGIPPEEIASGLTDVSAIYESMDELEQALSLLQKALKIYNDAPGQQSTTAGIEAQM
FT                   GVMYYMLGNYSDSYNSFKNAISKLRASGEKKSAFFGIALNQMGLACVQRYAINEAAELF
FT                   EEARDILEQEYGPYHPDTLGVYSNLAGTYDAVGRLDDAIEILEHVVGMREEKLGTANPD
FT                   VDDEKRRLAELLKEAGKVRNRKARSLETLLDVNSQTVNNDDIKV"
FT   5'UTR           complement(3755387..3755434)
FT                   /locus_tag="VIT_17s0000g08260"
FT                   /old_locus_tag="Vv17s0000g08260"
FT   gene            3758206..3766969
FT                   /locus_tag="VIT_17s0000g08250"
FT                   /old_locus_tag="Vv17s0000g08250"
FT   mRNA            join(3758206..3758272,3766459..3766498,3766918..3766969)
FT                   /locus_tag="VIT_17s0000g08250"
FT                   /old_locus_tag="Vv17s0000g08250"
FT   CDS_pept        join(3758206..3758272,3766459..3766498,3766918..3766969)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08250"
FT                   /old_locus_tag="Vv17s0000g08250"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHS7"
FT                   /protein_id="CBI15037.3"
FT                   /translation="MIAIPLMNIYIYIFLFKQSLKLDFWKSTKMILIKFFTNRQHRRRN
FT                   TTPRNWI"
FT   gene            complement(3787911..3793019)
FT                   /locus_tag="VIT_17s0000g08240"
FT                   /old_locus_tag="Vv17s0000g08240"
FT   mRNA            complement(join(3787911..3788191,3788192..3788443,
FT                   3790150..3790605,3791947..3792315,3792316..3793019))
FT                   /locus_tag="VIT_17s0000g08240"
FT                   /old_locus_tag="Vv17s0000g08240"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(3787911..3788191)
FT                   /locus_tag="VIT_17s0000g08240"
FT                   /old_locus_tag="Vv17s0000g08240"
FT   CDS_pept        complement(join(3788192..3788443,3790150..3790605,
FT                   3791947..3792315))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08240"
FT                   /old_locus_tag="Vv17s0000g08240"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSR4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSR4"
FT                   /protein_id="CCB42987.1"
FT                   /translation="MKNFQWFKKISNNGIIGKSEGRLSLGEYRRAVSWSKYLVSSGAEI
FT                   KEEGEGDWSADMSQLFIGCKFASGRHSRIYRGIYKQRDVAIKLISQPEEDESLANLLEK
FT                   QFTSEVALLFRLRHPNIITFVAACKKPPVFCIITEYLAGGSLRKFLHQQEPYSVPYDLV
FT                   LKFSLDIACGMQYLHSQGILHRDLKSENLLLGEDMCVKVADFGISCLETQCGSAKGFTG
FT                   TYRWMAPEMIKEKHHTKKVDVYSFGIVLWELLTALIPFDNMTPEQAAFAVSQKNARPPL
FT                   DPACPMAFRHLISRCWSSSADKRPHFDEIVSILESYSESFKQDPDFFSSYKPSDDHAFL
FT                   RCLPKCIAARRSSASLEA"
FT   5'UTR           complement(3792316..3793019)
FT                   /locus_tag="VIT_17s0000g08240"
FT                   /old_locus_tag="Vv17s0000g08240"
FT   gene            complement(3795544..3800544)
FT                   /locus_tag="VIT_17s0000g08230"
FT                   /old_locus_tag="Vv17s0000g08230"
FT   mRNA            complement(join(3795544..3795905,3795906..3796100,
FT                   3797444..3797579,3800345..3800406,3800407..3800544))
FT                   /locus_tag="VIT_17s0000g08230"
FT                   /old_locus_tag="Vv17s0000g08230"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(3795544..3795905)
FT                   /locus_tag="VIT_17s0000g08230"
FT                   /old_locus_tag="Vv17s0000g08230"
FT   CDS_pept        complement(join(3795906..3796100,3797444..3797579,
FT                   3800345..3800406))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08230"
FT                   /old_locus_tag="Vv17s0000g08230"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHS9"
FT                   /db_xref="InterPro:IPR006702"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHS9"
FT                   /protein_id="CBI15039.3"
FT                   /translation="MAADKTQGWSGDSFDRYKEYRYCLSMTVIAFVYSGFQACDLAYHL
FT                   VTQKHMFSNHSRYHLNFFMDQVLAYLLMSASSSAATRVDDWQSNWGKDEFTEMASASIG
FT                   MSFLAFVAFAFSSLISGYNLCNRNPA"
FT   5'UTR           complement(3800407..3800544)
FT                   /locus_tag="VIT_17s0000g08230"
FT                   /old_locus_tag="Vv17s0000g08230"
FT   gene            complement(3804309..3820273)
FT                   /locus_tag="VIT_17s0000g08220"
FT                   /old_locus_tag="Vv17s0000g08220"
FT   mRNA            complement(join(3804309..3804675,3804676..3804777,
FT                   3804897..3804989,3806515..3806589,3806738..3806907,
FT                   3806996..3807122,3807645..3808343,3809847..3809928,
FT                   3810004..3810110,3818761..3818826,3818919..3819035,
FT                   3819858..3820190,3820191..3820273))
FT                   /locus_tag="VIT_17s0000g08220"
FT                   /old_locus_tag="Vv17s0000g08220"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(3804309..3804675)
FT                   /locus_tag="VIT_17s0000g08220"
FT                   /old_locus_tag="Vv17s0000g08220"
FT   CDS_pept        complement(join(3804676..3804777,3804897..3804989,
FT                   3806515..3806589,3806738..3806907,3806996..3807122,
FT                   3807645..3808343,3809847..3809928,3810004..3810110,
FT                   3818761..3818826,3818919..3819035,3819858..3820190))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08220"
FT                   /old_locus_tag="Vv17s0000g08220"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHT0"
FT                   /db_xref="InterPro:IPR021894"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHT0"
FT                   /protein_id="CBI15040.3"
FT                   /translation="MALTNAWGMGHIASMTQFRPSKSCSDALLSSKRSSNLKLGFFFGW
FT                   GLGCSVYHKPADFRPRKSPNLCCRCSNNPTIANNGNSSSSSGWDWNQWSRHFSEIEQAE
FT                   SFASVLKFQLEDAIEREDFEEAAKLKMAIAEAMSMDSVTEIMSQLKNAIDEERYHDASK
FT                   LCRHTASGLVGWWVGCSADSDDPFGRLVHITPGVGRFVGRSYSPRQLVTASAGTPLFEI
FT                   FVVKDSDEKYIMQVVYLQRAKGSTANPTSLTSRPTKGSSSSETETASVVDIQGNEGKTE
FT                   KREEKGISIEGATEEGIKSVINFLKDKIPELKVKVMKINVPDEVIEDGDSVKQFMQEDD
FT                   EKTQSSEDSEDEADDLDKIQPDEVALGGGSNTAEDGQNLDMKLFIGGVLHNKEDTSSKD
FT                   DYVRQPAEIRDMERDSFVLHVPVRSQDHDIGENKVSKVKVAAIAAQGISELMPSEVAKA
FT                   FWSADKVSPKVSRDVREIVKLAVSQAQKRNRLSEHTSFSRITTSKGSLDPFDGLYVGAF
FT                   GPYGTEVVQLRCKFGNWNGGDDNDKSSDVEFFEYVEAVKLTGDLNVPAGQVTFRAKIGK
FT                   GSRIPNRGMYPDELGVVASYSGQGRIAEFGFRNPQWVDGELLQLSGKGMGPYVRGADLG
FT                   FLYVVPEQSFLVLFNRLKLPE"
FT   5'UTR           complement(3820191..3820273)
FT                   /locus_tag="VIT_17s0000g08220"
FT                   /old_locus_tag="Vv17s0000g08220"
FT   gene            complement(3821562..3829080)
FT                   /locus_tag="VIT_17s0000g08210"
FT                   /old_locus_tag="Vv17s0000g08210"
FT   mRNA            complement(join(3821562..3821634,3821635..3822039,
FT                   3822403..3822558,3823124..3823237,3823653..3823772,
FT                   3824569..3824634,3824839..3824931,3825044..3825182,
FT                   3827921..3827994,3828107..3828173,3828642..3828680,
FT                   3828878..3828906,3828907..3829080))
FT                   /locus_tag="VIT_17s0000g08210"
FT                   /old_locus_tag="Vv17s0000g08210"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(3821562..3821634)
FT                   /locus_tag="VIT_17s0000g08210"
FT                   /old_locus_tag="Vv17s0000g08210"
FT   CDS_pept        complement(join(3821635..3822039,3822403..3822558,
FT                   3823124..3823237,3823653..3823772,3824569..3824634,
FT                   3824839..3824931,3825044..3825182,3827921..3827994,
FT                   3828107..3828173,3828642..3828680,3828878..3828906))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08210"
FT                   /old_locus_tag="Vv17s0000g08210"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSR5"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSR5"
FT                   /protein_id="CCB42988.1"
FT                   /translation="MAIRGVDFKWYDGFFLSMLATSVIIVAINWKRYDLCTYPLHIWIM
FT                   VDYTTVFVFRLLMFVDNGLAAGMGLDFGWQQRYARFCGRIVVLSILSLLLYPFLWAWTV
FT                   IGTLWFTRARDCLPEEGQKWGFLIWLLFSYCGLLCIACMSMGKWFSRRQAHLLRAQQGI
FT                   PVSEYGVLVDMIRVPDWAFEAAGQEMRGMGQDAAAYHPGLYLTPTQREAVEALIQELPK
FT                   FRLKAVPTDCSECPICLEEFHVGNEVLYWLQPHTNSLMSGMLAERDAAAKVMQVELLKE
FT                   GKLVTQGYVWFSENFRENVRGLPCAHNFHVECIDEWLRLNVKCPRCRCSVFPNLDLSAL
FT                   THFRADSERSSASVVTATRYVRVQPPSQGYMLRLQGFLRPVRTENAGAGNDADNALENA
FT                   ENGGLPVVTDDLTNTEPAPFDNGVLVHHSTPPQS"
FT   5'UTR           complement(3828907..3829080)
FT                   /locus_tag="VIT_17s0000g08210"
FT                   /old_locus_tag="Vv17s0000g08210"
FT   gap             3841794..3841825
FT                   /estimated_length=32
FT   gene            complement(3841833..3844003)
FT                   /locus_tag="VIT_17s0000g08200"
FT                   /old_locus_tag="Vv17s0000g08200"
FT   mRNA            complement(join(3841833..3841914,3841915..3842035,
FT                   3842172..3842386,3842521..3842602,3843112..3843357,
FT                   3843679..3843908,3843909..3844003))
FT                   /locus_tag="VIT_17s0000g08200"
FT                   /old_locus_tag="Vv17s0000g08200"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(3841833..3841914)
FT                   /locus_tag="VIT_17s0000g08200"
FT                   /old_locus_tag="Vv17s0000g08200"
FT   CDS_pept        complement(join(3841915..3842035,3842172..3842386,
FT                   3842521..3842602,3843112..3843357,3843679..3843908))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08200"
FT                   /old_locus_tag="Vv17s0000g08200"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSR6"
FT                   /protein_id="CCB42989.1"
FT                   /translation="MVISSNPLAPELHISSHQQPYPSIPFSTNPNNVILPINRRHLLAS
FT                   LSVAITPFFTSQPPDAGARGLFQMPPARLTNRYYLVRAGESEFESMGIINTNPVAKTSV
FT                   DSGLSERGKKQTVRAAFELKAMKACEGSCWIWPSITQRAYQAAEIIASVNGVTRSFIVP
FT                   EYSFLDARGLGAFEGKNLESVSEVYASDSISPSIKPPPINDGTPNESVEDVFVRVTQLM
FT                   SILETQYSGDTVIIVSPDSDNLTVLQAGLVGLDFRRHRDLSFGPGEVRFVDINSIPTYK
FT                   QPASAVYKCLNPPSCR"
FT   5'UTR           complement(3843909..3844003)
FT                   /locus_tag="VIT_17s0000g08200"
FT                   /old_locus_tag="Vv17s0000g08200"
FT   gene            3845955..3846134
FT                   /locus_tag="VIT_17s0000g08190"
FT                   /old_locus_tag="Vv17s0000g08190"
FT   mRNA            3845955..3846134
FT                   /locus_tag="VIT_17s0000g08190"
FT                   /old_locus_tag="Vv17s0000g08190"
FT   CDS_pept        3845955..3846134
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08190"
FT                   /old_locus_tag="Vv17s0000g08190"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHT3"
FT                   /protein_id="CBI15043.3"
FT                   /translation="MSFTFRTRFSLVSKIGFNLNLQDILWKVLILLCDLCLVRYLCMIW
FT                   KLTFSCSLLSPIRI"
FT   gene            3847158..3848085
FT                   /locus_tag="VIT_17s0000g08180"
FT                   /old_locus_tag="Vv17s0000g08180"
FT   mRNA            join(3847158..3847190,3847191..3847259,3847870..3847890,
FT                   3847891..3847933,3848032..3848085)
FT                   /locus_tag="VIT_17s0000g08180"
FT                   /old_locus_tag="Vv17s0000g08180"
FT   5'UTR           3847158..3847190
FT                   /locus_tag="VIT_17s0000g08180"
FT                   /old_locus_tag="Vv17s0000g08180"
FT   CDS_pept        join(3847191..3847259,3847870..3847890)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08180"
FT                   /old_locus_tag="Vv17s0000g08180"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHT4"
FT                   /protein_id="CBI15044.3"
FT                   /translation="MLKFALNNNFVVHNHVFMVHSYQELLDFV"
FT   3'UTR           join(3847891..3847933,3848032..3848085)
FT                   /locus_tag="VIT_17s0000g08180"
FT                   /old_locus_tag="Vv17s0000g08180"
FT   gene            3862168..3877120
FT                   /locus_tag="VIT_17s0000g08170"
FT                   /old_locus_tag="Vv17s0000g08170"
FT   mRNA            join(3862168..3862297,3862298..3862322,3869746..3869807,
FT                   3871476..3871548,3872602..3872669,3872965..3873034,
FT                   3873506..3873574,3873663..3873734,3874093..3874166,
FT                   3874615..3875277,3875354..3875479,3875661..3875765,
FT                   3876450..3876524,3876638..3876829,3876830..3877120)
FT                   /locus_tag="VIT_17s0000g08170"
FT                   /old_locus_tag="Vv17s0000g08170"
FT                   /product="unknown predicted protein"
FT   5'UTR           3862168..3862297
FT                   /locus_tag="VIT_17s0000g08170"
FT                   /old_locus_tag="Vv17s0000g08170"
FT   CDS_pept        join(3862298..3862322,3869746..3869807,3871476..3871548,
FT                   3872602..3872669,3872965..3873034,3873506..3873574,
FT                   3873663..3873734,3874093..3874166,3874615..3875277,
FT                   3875354..3875479,3875661..3875765,3876450..3876524,
FT                   3876638..3876829)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08170"
FT                   /old_locus_tag="Vv17s0000g08170"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHT5"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012719"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHT5"
FT                   /protein_id="CBI15045.3"
FT                   /translation="MQAPVLVLKDSLTRESGSKVQHANIQASKAVADIIRTTLGPRSML
FT                   KMLLDAGGGIVVTNDGNSILRELDLAHPAAKSMIELSRTQDEEVGDGTTSVIVLAGEML
FT                   HVAEAFIDKNFHPTVICRAYNKALEDAIAVLDKIAAPVDVNDRVAMLGMVKSCIGTKFT
FT                   GQFGDLIADLALDATTTVGVDLGQGLREVDIKKYIKVEKVPGGQLEDSKVLKGVMINKD
FT                   VVAPGKMRRKIINPRIILLDCPLEYKKGENQTNAELVREEDWGILLKMEEEYIENLCMQ
FT                   ILKFKPDLVITEKGLSDLACHYLSKAGVSAIRRLRKTDNNRIAKACGAVVVNRPDELQE
FT                   SDVGTRAGIFEVKKIGDEFFAFIDECTDPKACTVLLRGASKDLLNEVERNLQDAMSVAR
FT                   NMIKNPKLVPGGGATELTVSATLKQKSSSVEGIEKWPYEAAAIAFEAIPRTLAQNCGVN
FT                   VIRTMTALQGKHANGENAWIGIDGSTGAITDMKERKIWDAYNVKAQTFKTAIEAACMLL
FT                   RIDDIVSGIKKKQAPGAGQAPSKPTIEQEGDADNEQMIPE"
FT   3'UTR           3876830..3877120
FT                   /locus_tag="VIT_17s0000g08170"
FT                   /old_locus_tag="Vv17s0000g08170"
FT   gene            3878325..3880329
FT                   /locus_tag="VIT_17s0000g08160"
FT                   /old_locus_tag="Vv17s0000g08160"
FT   mRNA            join(3878325..3878329,3878330..3878410,3878501..3880321,
FT                   3880322..3880329)
FT                   /locus_tag="VIT_17s0000g08160"
FT                   /old_locus_tag="Vv17s0000g08160"
FT                   /product="unknown predicted protein"
FT   5'UTR           3878325..3878329
FT                   /locus_tag="VIT_17s0000g08160"
FT                   /old_locus_tag="Vv17s0000g08160"
FT   CDS_pept        join(3878330..3878410,3878501..3880321)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08160"
FT                   /old_locus_tag="Vv17s0000g08160"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR004873"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSR7"
FT                   /protein_id="CCB42990.1"
FT                   /translation="METMRTPPLLTTILFVFFLYLSFTSFNVCFAEGKSSTGGNPFTAK
FT                   ASLIRYWNKQISNKLPKPSFLLSKASPLNAVDSAVLTKLATQNALSSHLSSFCSSANLF
FT                   CVFDSSPTSEKQVKDANFAFYSNRGFANYGDSRIGGVDSFKNYSDGLNMPSGSFRRYSG
FT                   DSTDHHEEFTSYARDGNVATGSFAGYGSGATGGSGEFTNYDPLVNVPHLEFTTYDPNGN
FT                   NHKLTFAAYTDDTNSGTESFTSYGKNGKNVPAEFTSYGDNSNIIGSTFTAYGQLANSQN
FT                   DSFKAYGHSSNNPHNNFKSYSLGGNAATDTFSNYRDGANVGDDSFQSYARSSNSAEVNF
FT                   ANYGRTFNVGNDTFKEYGKGSTDSSVGFKIYGLNYTFKDYERKGVTFSQYSRASSNTTA
FT                   TATTASGISVNRWVEPGKFFRESMLKEGNVMVMPDIRDRMPERSFLPRVIASKLPFSSS
FT                   RLQELKDIFHARDNSTMEHVIANALEECERAPSRGETKRCVGSVEDMIDFAVSVLGHDV
FT                   VVRTTETTRGSKQRVMVGEVRGINGGKVTRSVSCHQSLYPYLLYYCHSVPKVRVYEVDI
FT                   LDVERKEKMNKGVAICHIDTSAWSQSHGAFVALGSSPGLIEVCHWIFENDMTWTTSD"
FT   3'UTR           3880322..3880329
FT                   /locus_tag="VIT_17s0000g08160"
FT                   /old_locus_tag="Vv17s0000g08160"
FT   gene            3900470..3902535
FT                   /locus_tag="VIT_17s0000g08150"
FT                   /old_locus_tag="Vv17s0000g08150"
FT   mRNA            join(3900470..3900561,3900562..3900693,3901802..3902137,
FT                   3902249..3902317,3902318..3902535)
FT                   /locus_tag="VIT_17s0000g08150"
FT                   /old_locus_tag="Vv17s0000g08150"
FT                   /product="Predicted protein"
FT   5'UTR           3900470..3900561
FT                   /locus_tag="VIT_17s0000g08150"
FT                   /old_locus_tag="Vv17s0000g08150"
FT   CDS_pept        join(3900562..3900693,3901802..3902137,3902249..3902317)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08150"
FT                   /old_locus_tag="Vv17s0000g08150"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHT7"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR015660"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHT7"
FT                   /protein_id="CBI15047.3"
FT                   /translation="MTKMNGPPLKPDRKTTERNRRIHMKSLCFKLSSLIPPNQFKTSKD
FT                   MLSQQDQLEQAANYIKQLKERIEELKGRKELATRVAGTNNNLIDAVMIGLRLPVIDLRD
FT                   LGSSLEVMLISGLNKNFMLYEVISVLEEEGAEVVSASVSTVGDKVFHSLHAQVKISRVG
FT                   VETSRVWQRLQELIY"
FT   3'UTR           3902318..3902535
FT                   /locus_tag="VIT_17s0000g08150"
FT                   /old_locus_tag="Vv17s0000g08150"
FT   gap             3913290..3913389
FT                   /estimated_length=100
FT   gene            3929517..3935421
FT                   /locus_tag="VIT_17s0000g08140"
FT                   /old_locus_tag="Vv17s0000g08140"
FT   mRNA            join(3929517..3929712,3929713..3930022,3930892..3931013,
FT                   3933290..3933486,3933625..3933799,3934581..3934715,
FT                   3934968..3935174,3935175..3935421)
FT                   /locus_tag="VIT_17s0000g08140"
FT                   /old_locus_tag="Vv17s0000g08140"
FT                   /product="unknown predicted protein"
FT   5'UTR           3929517..3929712
FT                   /locus_tag="VIT_17s0000g08140"
FT                   /old_locus_tag="Vv17s0000g08140"
FT   CDS_pept        join(3929713..3930022,3930892..3931013,3933290..3933486,
FT                   3933625..3933799,3934581..3934715,3934968..3935174)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08140"
FT                   /old_locus_tag="Vv17s0000g08140"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSR8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSR8"
FT                   /protein_id="CCB42991.1"
FT                   /translation="MKESSDGFVRADQIDLKSLDEQLEKHLNRVWTMDKNKKKEDDSSS
FT                   AAAAIPTLAPSTTASTTAPTTARQDWEIDPSKLIIKTVIARGTFGTVHRGVYDGQDVAV
FT                   KLLDWGEEGHRTEAEIASLRAAFTQEVAVWHKLDHPNVTKFIGATMGSAELNIQTENGH
FT                   IGMPSNICCVVVEYLPGGALKSYLIKNRRRKLAFKVVIQLALDLARGLSYLHSQKIVHR
FT                   DVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPEVLNGSPYNRKCDV
FT                   YSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPNSLANVMKRCWDANPD
FT                   KRPEMDEVVAMIEAIDTSRGGGMLPVDQPQGCFCFRKYRGP"
FT   3'UTR           3935175..3935421
FT                   /locus_tag="VIT_17s0000g08140"
FT                   /old_locus_tag="Vv17s0000g08140"
FT   gene            complement(3937774..3938693)
FT                   /locus_tag="VIT_17s0000g08130"
FT                   /old_locus_tag="Vv17s0000g08130"
FT   mRNA            complement(join(3937774..3937902,3938180..3938299,
FT                   3938386..3938547,3938640..3938693))
FT                   /locus_tag="VIT_17s0000g08130"
FT                   /old_locus_tag="Vv17s0000g08130"
FT                   /product="Seven-transmembrane-domain protein 1"
FT   CDS_pept        complement(join(3937774..3937902,3938180..3938299,
FT                   3938386..3938547,3938640..3938693))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08130"
FT                   /old_locus_tag="Vv17s0000g08130"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSR9"
FT                   /db_xref="InterPro:IPR004316"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSR9"
FT                   /protein_id="CCB42992.1"
FT                   /translation="MEIIYVSIFFTYSDWAKRKKIVMALLCIVIFVAAVAGITMGAFHT
FT                   HHDRSMFVGILCVVFNVVMYASPLTVMRRVIRTRSVKYMPFFLSLANLMNGIVWLIYAL
FT                   IKIDAYIVIPNALGTISGLVQMVLYAAFYKSTPREEEEVKKTQEVQLSGI"
FT   gap             3950237..3950289
FT                   /estimated_length=53
FT   gene            complement(3967462..3973328)
FT                   /locus_tag="VIT_17s0000g08120"
FT                   /old_locus_tag="Vv17s0000g08120"
FT   mRNA            complement(join(3967462..3967923,3973302..3973328))
FT                   /locus_tag="VIT_17s0000g08120"
FT                   /old_locus_tag="Vv17s0000g08120"
FT   CDS_pept        complement(join(3967462..3967923,3973302..3973328))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08120"
FT                   /old_locus_tag="Vv17s0000g08120"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSS0"
FT                   /protein_id="CCB42993.1"
FT                   /translation="MYTAPPTIMMGEGDGHARDVGEAGTSMGFGEKGAKAIINKPRQRR
FT                   IDSQPELSKNSEKTKDPKLRRWPYLSPPTDSGVLCSPPSPDPSFTVSSVPLLFPAQNST
FT                   RSPLSFLFSFSPSFSSFLLKPPSASQPVPCPLCRPNSASPAASEPPNTALPSCRASGK"
FT   gap             3969804..3969903
FT                   /estimated_length=100
FT   gene            complement(3982854..3984376)
FT                   /locus_tag="VIT_17s0000g08110"
FT                   /old_locus_tag="Vv17s0000g08110"
FT   mRNA            complement(join(3982854..3983009,3983010..3983135,
FT                   3983232..3983351,3983430..3983591,3983709..3983925,
FT                   3984025..3984061,3984193..3984235,3984236..3984376))
FT                   /locus_tag="VIT_17s0000g08110"
FT                   /old_locus_tag="Vv17s0000g08110"
FT                   /product="Seven-transmembrane-domain protein 1"
FT   3'UTR           complement(3982854..3983009)
FT                   /locus_tag="VIT_17s0000g08110"
FT                   /old_locus_tag="Vv17s0000g08110"
FT   CDS_pept        complement(join(3983010..3983135,3983232..3983351,
FT                   3983430..3983591,3983709..3983925,3984025..3984061,
FT                   3984193..3984235))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08110"
FT                   /old_locus_tag="Vv17s0000g08110"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHU1"
FT                   /db_xref="InterPro:IPR004316"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHU1"
FT                   /protein_id="CBI15051.3"
FT                   /translation="MVNPDTIRTIVGIIGNVISFGLFASPIPTFIQIVKKKTVGEFKPD
FT                   PYLATVLNCMMWVLYGLPFVRPDSLLVITINGGGLVIELIYVTIFFVYADSLKRKKIAL
FT                   WLLFEVIFMAIIAAITMLLFHGTKNRSLFVGLLCVVFNVIMYASPLTVMRQVIRTKSVK
FT                   YMPFTLSLANFANGIVWSIYALIKFDPYILIPNGLGSLSGAVQLILYATYYKSTPKDEE
FT                   DKKPPEVQLSGM"
FT   5'UTR           complement(3984236..3984376)
FT                   /locus_tag="VIT_17s0000g08110"
FT                   /old_locus_tag="Vv17s0000g08110"
FT   gene            4003822..4004862
FT                   /locus_tag="VIT_17s0000g08100"
FT                   /old_locus_tag="Vv17s0000g08100"
FT   mRNA            4003822..4004862
FT                   /locus_tag="VIT_17s0000g08100"
FT                   /old_locus_tag="Vv17s0000g08100"
FT                   /product="unknown predicted protein"
FT   CDS_pept        4003822..4004862
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08100"
FT                   /old_locus_tag="Vv17s0000g08100"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:A5C2X2"
FT                   /protein_id="CBI15052.3"
FT                   /translation="MGTVSPRHFVLFPFMSQGHTIPILHLARLLHRRLLSVTVLTTPAN
FT                   SPSIRSSLLDTTISVVDLPFPVNIPGVPPGIESTDKLPSMSFFVPFVTATKLIQPHFEQ
FT                   VIASLPTVHCIISDGFLGWTQQSADKLGIPRVLFYGMSNYAMTLSSIMLREKPHAMVSS
FT                   VDEVFSVPGLPWVNLTTNDFEPPFSELEPKGAHFDFVAETGVAAFKSHGMLVNSFYDLE
FT                   PRFNDYWNQKIGPRAWCVGPLCLAEPPRVQTLQKPTWVQWLDEKLAQGKSVLYVAFGSQ
FT                   AEMAPEQLHEIAMGLERSEVAFLWVLSSKVQEKHEFVKGFEERLKKRKNGWTKGSYWHT
FT                   RASRGL"
FT   gene            complement(4005220..4008683)
FT                   /locus_tag="VIT_17s0000g08090"
FT                   /old_locus_tag="Vv17s0000g08090"
FT   mRNA            complement(join(4005220..4005262,4005263..4005390,
FT                   4008252..4008333,4008334..4008351,4008630..4008683))
FT                   /locus_tag="VIT_17s0000g08090"
FT                   /old_locus_tag="Vv17s0000g08090"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(4005220..4005262)
FT                   /locus_tag="VIT_17s0000g08090"
FT                   /old_locus_tag="Vv17s0000g08090"
FT   CDS_pept        complement(join(4005263..4005390,4008252..4008333))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08090"
FT                   /old_locus_tag="Vv17s0000g08090"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSS1"
FT                   /db_xref="InterPro:IPR007834"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSS1"
FT                   /protein_id="CCB42994.1"
FT                   /translation="MATEPKAAAENVKIDLFEDDDEFEINEEWEDRAEEKVAEQWEDDW
FT                   DDDDVHDDFSQQLRKELENNIKKS"
FT   5'UTR           complement(4008630..4008683)
FT                   /locus_tag="VIT_17s0000g08090"
FT                   /old_locus_tag="Vv17s0000g08090"
FT   gene            complement(4023881..4026154)
FT                   /locus_tag="VIT_17s0000g08080"
FT                   /old_locus_tag="Vv17s0000g08080"
FT   mRNA            complement(join(4023881..4024075,4024076..4026115,
FT                   4026116..4026154))
FT                   /locus_tag="VIT_17s0000g08080"
FT                   /old_locus_tag="Vv17s0000g08080"
FT                   /product="Predicted protein"
FT   3'UTR           complement(4023881..4024075)
FT                   /locus_tag="VIT_17s0000g08080"
FT                   /old_locus_tag="Vv17s0000g08080"
FT   CDS_pept        complement(4024076..4026115)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08080"
FT                   /old_locus_tag="Vv17s0000g08080"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSS2"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSS2"
FT                   /protein_id="CCB42995.1"
FT                   /translation="MFQSFNRSDRRILSFPAVHPCESISPVTLLGSLIALSTSILNYQS
FT                   KSFPTQKRNARETLRQIGILLIFFEEIQDRRSVLPDSVVLCFSELHLAFQKIQFLLEDC
FT                   SREGARLWILMKSQFVATQFRVLIRAFATALEVLPLNCIDLTSEVKELVELVAKQARKA
FT                   RFDLDANDECAAKDVIWILNQFEKRIEPDMSVVKRVLDHLEIRSWSECNKEIRFMEELS
FT                   LECDEREVTLLKSLMGLMSYCRGVMFEEIESSGTDQTEGRCSVEMLSCLNPEDFRCPIS
FT                   LELMTDPVTVSTGQTYDRSSIQKWLRAGNIICPKTGEKLINKELVPNSALRKLIQQFCE
FT                   DHGVSLAKTETQNSNAARTIAVNSPAAAEATRFLSKFLARRLVSGTGEQKNKAAYEIRL
FT                   LAKSSVFNRCCLIEAGTVPPLLNLLSSTDAPTQENAIAALLKLSKHSKGKKVIMDSGGL
FT                   KLILKVLKVGPRLESRQIAAATLFYLASVDKYRSLIGETPEAIPSLVELIKTGTTIGKM
FT                   HAVVAIFGLLLCRENCPRVLAAGTVPLLVHLLASSVKEDLATESLAALAKLSEHIDGSL
FT                   AILRASGLPLITKILQSSPSRTGKEYCVSILLSLCINGSIEVTVDLAKDPTLMTSLYSL
FT                   VTEGTSHGSKKACSLLKIIHKFLETDSSGLRSSQVPQERFLRVR"
FT   5'UTR           complement(4026116..4026154)
FT                   /locus_tag="VIT_17s0000g08080"
FT                   /old_locus_tag="Vv17s0000g08080"
FT   gene            complement(4033565..4038094)
FT                   /locus_tag="VIT_17s0000g08070"
FT                   /old_locus_tag="Vv17s0000g08070"
FT   mRNA            complement(join(4033565..4033768,4033769..4034042,
FT                   4034189..4034250,4034328..4034465,4034836..4034973,
FT                   4035051..4035224,4035574..4035663,4036118..4036347,
FT                   4036467..4036620,4036711..4036853,4036928..4037068,
FT                   4037898..4037970,4037971..4038094))
FT                   /locus_tag="VIT_17s0000g08070"
FT                   /old_locus_tag="Vv17s0000g08070"
FT                   /product="Aldehyde dehydrogenase"
FT   3'UTR           complement(4033565..4033768)
FT                   /locus_tag="VIT_17s0000g08070"
FT                   /old_locus_tag="Vv17s0000g08070"
FT   CDS_pept        complement(join(4033769..4034042,4034189..4034250,
FT                   4034328..4034465,4034836..4034973,4035051..4035224,
FT                   4035574..4035663,4036118..4036347,4036467..4036620,
FT                   4036711..4036853,4036928..4037068,4037898..4037970))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08070"
FT                   /old_locus_tag="Vv17s0000g08070"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHU4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHU4"
FT                   /protein_id="CBI15054.3"
FT                   /translation="MAARRISSLLSRSLSVSSAFSLSLGKNFNRGKSIHRFSTAAAAAV
FT                   EELITPTVQINYTQLLINGQFVDAASGKTFPTFDPRTGEVIANVAEGDAEDINRAVSAA
FT                   RKAFDEGPWPRMSPYERSRILLRFADLAEKHNDELAALETWNNGKPYEQAAKAELPLFV
FT                   RLFRYYAGWADKIHGLTVQADGPHHVQILHEPIGVAGQIIPWNFPLMMFAWKVGPALAC
FT                   GNTIVLKTAEQTPLTALFAAKLFHEAGLPPGILNIVSGYGPTAGAALASHMDVDKIAFT
FT                   GSTDTGKIVQELASKSNLKPVTLELGGKSPFIVCEDADIDQAVELAHFALFFNQGQCCC
FT                   AGSRTFVHESVYDEFIEKAKARALSRTVGDPFKKGIEQGPQIDPEQFAKVLRYIRSGIE
FT                   SNATLECGGGRIGSKGYFVQPTVFSNVQDDMLIAKDEIFGPVQSILKYKDLDEVIRRAN
FT                   STRYGLAAGVFTKNINTANTLTRALRVGTVWVNCFDVFDAAIPFGGYKMSGVGREKGIY
FT                   SLNNYLQVKAVITPLKNPAWL"
FT   5'UTR           complement(4037971..4038094)
FT                   /locus_tag="VIT_17s0000g08070"
FT                   /old_locus_tag="Vv17s0000g08070"
FT   gene            complement(4062683..4069588)
FT                   /locus_tag="VIT_17s0000g08060"
FT                   /old_locus_tag="Vv17s0000g08060"
FT   mRNA            complement(join(4062683..4062749,4062822..4063465,
FT                   4064445..4064681,4065953..4066064,4067147..4067457,
FT                   4067612..4067824,4069187..4069588))
FT                   /locus_tag="VIT_17s0000g08060"
FT                   /old_locus_tag="Vv17s0000g08060"
FT                   /product="unknown predicted protein"
FT   CDS_pept        complement(join(4062683..4062749,4062822..4063465,
FT                   4064445..4064681,4065953..4066064,4067147..4067457,
FT                   4067612..4067824,4069187..4069588))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08060"
FT                   /old_locus_tag="Vv17s0000g08060"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSU0"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSU0"
FT                   /protein_id="CCB42996.1"
FT                   /translation="MNNNIRPFSFRQKSWWTQILDPGGRLVTQWNHIFLISCLLALFLD
FT                   PLYFYLPVIDGPACFRIDLGLGIVVTFFRTVADMFYLTHMIMKFRMAFVAPSSRVFGRG
FT                   ELVMDPQQIALRYLKSDFIIDFAATLPLPQTVIWYIIPAVKDPITDHANHILSLIVLIQ
FT                   YIPRLFLIFPLYRRIVKITGVVARTAWLGAAYNLLLYMLASHVLGASWYLLSIERQHSC
FT                   WSKECQKEANSMHFPTCHSSFLDCSTLEQPDRRVWLNFSHVLTNCRPENSIGFEYGMYS
FT                   DAFINEVASSTFLEKYFYCFWWGLKGLSSYGQSVVTSTFTSETLFCIVICIGGLVLFSH
FT                   LIGNMQTYLQNMGIRLEEWRIRRRDTEEWMRHRQLPLDLQERVRRFVQYKWIATRGVDE
FT                   EAILRALPLDIRREIQRHLCLALVRRVPFFSQMDDQLLDAICERLVSSLSTQDAYIVRE
FT                   GDPVNEMFFIIRGQLESSTTNGGRSGFFNSITLRPGDFCGEELLTWALMPTSSLNLPSS
FT                   TRTVRSTTKVEAFALRAEDLKFVANQFKRLHSKKLQHAFRYYSHQWRTWGACFIQVAWR
FT                   RLKRRKLAKELARQESLYYMQISDQEGYLSEMTDADYQTSSAEISSMENSHGGQQIGAT
FT                   VLASSLKMPKLFKPEEPDFSSDHENS"
FT   gene            complement(4075078..4077469)
FT                   /locus_tag="VIT_17s0000g08050"
FT                   /old_locus_tag="Vv17s0000g08050"
FT   mRNA            complement(join(4075078..4075154,4075155..4075622,
FT                   4077251..4077278,4077423..4077469))
FT                   /locus_tag="VIT_17s0000g08050"
FT                   /old_locus_tag="Vv17s0000g08050"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(4075078..4075154)
FT                   /locus_tag="VIT_17s0000g08050"
FT                   /old_locus_tag="Vv17s0000g08050"
FT   CDS_pept        complement(join(4075155..4075622,4077251..4077278,
FT                   4077423..4077469))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08050"
FT                   /old_locus_tag="Vv17s0000g08050"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSU1"
FT                   /protein_id="CCB42997.1"
FT                   /translation="MGIRLEEWRVRRDIEEHLCLALVHCVPFFSQMDDQLLDAICERLV
FT                   SSLSTQDAYIVREGDPVNEMLFIIRGQRESSTANGGQSSFFNSITLRPGDFCGKELLTW
FT                   ALMPTSSLNLPSSTRTMKMITKVEAFALRAEDLKFVGNQFKRFHSKKLQHAFRYYSHQS
FT                   RTWGACFIQVAWRRLKR"
FT   gene            4091193..4094744
FT                   /locus_tag="VIT_17s0000g08030"
FT                   /old_locus_tag="Vv17s0000g08030"
FT   mRNA            join(4091193..4091478,4093214..4093290,4093397..4093519,
FT                   4093637..4093741,4093844..4093916,4093991..4094062,
FT                   4094154..4094352,4094453..4094582,4094685..4094744)
FT                   /locus_tag="VIT_17s0000g08030"
FT                   /old_locus_tag="Vv17s0000g08030"
FT                   /product="Spermidine synthase 2"
FT   CDS_pept        join(4091193..4091478,4093214..4093290,4093397..4093519,
FT                   4093637..4093741,4093844..4093916,4093991..4094062,
FT                   4094154..4094352,4094453..4094582,4094685..4094744)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08030"
FT                   /old_locus_tag="Vv17s0000g08030"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHU7"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHU7"
FT                   /protein_id="CBI15057.3"
FT                   /translation="MAKVSGVVSAVFMAKANGNGVASAEFKANGNGSPEFHANLHRKET
FT                   VGDGVMAEHGNTIVSSVSLLPPETENSSNGDVCFSSAIPGWYADAPPLWPGEAHVYKVE
FT                   KVLFRGKSEYQELFIFESATSGKIVILDGYLQLSEKDEFVYQEMLTHLALCSIPNPKKV
FT                   LLVGGGDGGILREASRHSSLEQIDICEIDKMVIDVYKQFFPDIAVGFEDPRVSVYIGDG
FT                   VEFLKSVPEATYDAIILDAFQEMGPSAQELADKHILESVARALRPGGVLSTQAESMWNK
FT                   NFILEDIIADCRKIFKGSVNYAWTTVPVYSSGVVGFILCATEGPPVDFKHPINPIDAVP
FT                   NHGVAKGPPKFYNSEVHTAAFCLPSFLKGGSSKN"
FT   gene            complement(4095038..4098002)
FT                   /locus_tag="VIT_17s0000g08020"
FT                   /old_locus_tag="Vv17s0000g08020"
FT   mRNA            complement(join(4095038..4095314,4095315..4095567,
FT                   4095692..4095831,4096707..4096787,4097595..4097909,
FT                   4097910..4098002))
FT                   /locus_tag="VIT_17s0000g08020"
FT                   /old_locus_tag="Vv17s0000g08020"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(4095038..4095314)
FT                   /locus_tag="VIT_17s0000g08020"
FT                   /old_locus_tag="Vv17s0000g08020"
FT   CDS_pept        complement(join(4095315..4095567,4095692..4095831,
FT                   4096707..4096787,4097595..4097909))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08020"
FT                   /old_locus_tag="Vv17s0000g08020"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHU8"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHU8"
FT                   /protein_id="CBI15058.3"
FT                   /translation="MPGPGPHMMYALGSSLGLMSTSNGRFSPHHSLAYAINAFFGPDLG
FT                   SFSEWLTSTLGFGHSFGSALADVIHDPFFYIVILGLPLSFLYSWLSRVLLQRGFLDSVS
FT                   GVPLTRRQCLLLISAGSLSHFFLDHLFEENGHSSMYTWILSTGWWKNRAPVNPDAVVVV
FT                   GFLCASLIGGFMYINRLKPSKSIKKQTSQSVKLIVIIATLYCLWCASQIYWVNPRRAAV
FT                   GEEADLGVLVFLAIYFFLPHTFCIMSMNPKDHFDMEQLPI"
FT   5'UTR           complement(4097910..4098002)
FT                   /locus_tag="VIT_17s0000g08020"
FT                   /old_locus_tag="Vv17s0000g08020"
FT   gene            4105761..4108646
FT                   /locus_tag="VIT_17s0000g08010"
FT                   /old_locus_tag="Vv17s0000g08010"
FT   mRNA            join(4105761..4106254,4106414..4107751,4107937..4108210,
FT                   4108302..4108625,4108626..4108646)
FT                   /locus_tag="VIT_17s0000g08010"
FT                   /old_locus_tag="Vv17s0000g08010"
FT                   /product="unknown predicted protein"
FT   CDS_pept        join(4105761..4106254,4106414..4107751,4107937..4108210,
FT                   4108302..4108625)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08010"
FT                   /old_locus_tag="Vv17s0000g08010"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSU2"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSU2"
FT                   /protein_id="CCB42998.1"
FT                   /translation="MVSRSSYTSFLDAASGDLLNFPQTPRTLPRVMTVPGIISDGDGNG
FT                   SNDEDSDIFSSKCREKKIIVANFLPLLAQKDLNTGRWCFSFDEDALLLQMKDGFSSETD
FT                   VVYVGSLKVDVDTSEQEEVAERLLAEFNCVPTFLPPDLQKKFYHGFCKQYLWPLFHYML
FT                   PIKRFYRVKLGFFLHSPFPSSEIYRTLPVRDDILKALLNADLVGFHTFDYARHFLSCCS
FT                   RMLGLNYESKRGHIGLEYFGRTVYVKILPVGIHMGQLESALNLPSTSIKVKEIQEQFKG
FT                   KKIILGVDDMDIFKGLSLKLLAMEHLLQHYEELRGELVLVQIVNPARSTGKDVQEAKRE
FT                   TYAITERINANFGFPGYEPVVLIDHPVPFYEKTAYYALAECCIVNAVRDGMNLMPYNYI
FT                   VCRQGTPKIDEALGITSGSSRTSTLVVSEFIGCSPSLSGAIRVNPWDIDAVADALNIAI
FT                   TMPGLEKQLRHEKHYRYVSSHDVAYWACSFMQDLERACKDHYSKRCWSIGFGLSFRIVA
FT                   LSPNFRKLSLDHIVKAYKRANRRAIFLDYDGTVVPQSSIVKTPSPEVISILNDLCNDPK
FT                   NTVFIVSGRGKNSLSDWFAQCQNLGIAAEHGYFIRWSQSSNWESRPLLMDFDWKRIADP
FT                   VMQLYTEATDGSYIETKESALVWHHQDADPDFGSCQAMELLDHLENVLANEPVEVKRGH
FT                   HIVEVKPQGVSKGQVTEKILSTMISDGKPPDFVMCIGDDRSDEDMFESISSTIYSPSLP
FT                   APPEIFACTVGQKPSKARYYLDDSADVLKLLQGLARASSMKPKCSTQIQFSFESVA"
FT   3'UTR           4108626..4108646
FT                   /locus_tag="VIT_17s0000g08010"
FT                   /old_locus_tag="Vv17s0000g08010"
FT   gene            4109587..4110860
FT                   /locus_tag="VIT_17s0000g08000"
FT                   /old_locus_tag="Vv17s0000g08000"
FT   mRNA            join(4109587..4109610,4109611..4109667,4109871..4109959,
FT                   4110221..4110626,4110627..4110860)
FT                   /locus_tag="VIT_17s0000g08000"
FT                   /old_locus_tag="Vv17s0000g08000"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           4109587..4109610
FT                   /locus_tag="VIT_17s0000g08000"
FT                   /old_locus_tag="Vv17s0000g08000"
FT   CDS_pept        join(4109611..4109667,4109871..4109959,4110221..4110626)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g08000"
FT                   /old_locus_tag="Vv17s0000g08000"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHV0"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHV0"
FT                   /protein_id="CBI15060.3"
FT                   /translation="MGRFIILTLFLLAKFSAFQAHAGNEVRDPILKPSSPFSLALETLQ
FT                   KQIGYTFQSIGLLRRAMTHSSFSEENNKALSILGASTIETSVSLQYLKKDIEASAKDLN
FT                   RRISEISQVESSCAVDAMRLGLQKVIRVSPKTNASTPAVVCGAFRAIFGAIAMDTGKSD
FT                   DAGKVFWSVHGSEVGGAAAL"
FT   3'UTR           4110627..4110860
FT                   /locus_tag="VIT_17s0000g08000"
FT                   /old_locus_tag="Vv17s0000g08000"
FT   gene            4114022..4115015
FT                   /locus_tag="VIT_17s0000g07990"
FT                   /old_locus_tag="Vv17s0000g07990"
FT   mRNA            join(4114022..4114147,4114148..4114618,4114619..4115015)
FT                   /locus_tag="VIT_17s0000g07990"
FT                   /old_locus_tag="Vv17s0000g07990"
FT                   /product="Predicted protein"
FT   5'UTR           4114022..4114147
FT                   /locus_tag="VIT_17s0000g07990"
FT                   /old_locus_tag="Vv17s0000g07990"
FT   CDS_pept        4114148..4114618
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07990"
FT                   /old_locus_tag="Vv17s0000g07990"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHV1"
FT                   /protein_id="CBI15061.3"
FT                   /translation="MAHKEVEAQAEAESPMDATTGLFSSRSCCFCIPCFGSSRSSTVGL
FT                   AWWEKMRTAQNEDTWWGRSLRSFKKVREWSELAAGPRWKTFIRRFNKTRSGGARHGKFQ
FT                   YDPLSYSLNFDEGAGHNGSSDDDRGYEFTARYASVSLSSKSSMEDKDAITLT"
FT   3'UTR           4114619..4115015
FT                   /locus_tag="VIT_17s0000g07990"
FT                   /old_locus_tag="Vv17s0000g07990"
FT   gene            complement(4115083..4121900)
FT                   /locus_tag="VIT_17s0000g07980"
FT                   /old_locus_tag="Vv17s0000g07980"
FT   mRNA            complement(join(4115083..4115880,4115973..4116123,
FT                   4116873..4118773,4121895..4121900))
FT                   /locus_tag="VIT_17s0000g07980"
FT                   /old_locus_tag="Vv17s0000g07980"
FT                   /product="unknown predicted protein"
FT   CDS_pept        complement(join(4115083..4115880,4115973..4116123,
FT                   4116873..4118773,4121895..4121900))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07980"
FT                   /old_locus_tag="Vv17s0000g07980"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSU3"
FT                   /db_xref="InterPro:IPR007855"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSU3"
FT                   /protein_id="CCB42999.1"
FT                   /translation="MTLKYAPKIFQKFAGPNIASKFSADRYHISKEDAEFLWLRTTDFS
FT                   SIKSLGQSTSFCWEIKEGFPALDIFASFPYYKDLTELTLEQGEGFCSDSGLVPLVKCES
FT                   GPKLAYEILFQLNSLVHAQKISLAAVDTDLIEILSNLPVDTAIMILQKLHKRKSTRYDP
FT                   ISFIKAQAHIINMNIKNLPPSSHSRLTNNNVMSCHRVLVTPSKIYCLGPELESSNYVVK
FT                   HYAAYASDFVRVSFVEEDWSKLPSNALSMSIRKAFFADPFRTEIYHRILSILREGIVIG
FT                   AKRFQFLAFSASQLRSNSVWMFASNDKVRVDDIREWMGCFKKIRSVSKCAARMGQLFSS
FT                   SVQTLPVPVQDVEVIPDIEVTSDGFGYCFSDGIGKISLSFAKQVAQKCGLHQTPSAFQI
FT                   RYGGYKGVIAVDRNSFRKLSLRSSMLKFESQNRMLNVTKWSESTPCYLNREIVSLLSTL
FT                   GVEDENFEALLNEQMHLLDKMLTNRQAALDVLESMGGIDNKNILAKMLLQGYEPNVEPY
FT                   LSMMLQAYRESQLSDIRTRCRIFVPKARVLIGCLDETGILNYGQVYVRVTMTKAEHKCR
FT                   NQSFFQKVDDTTSVVIGKVIVTKNPCLHPGDIRVLDAVYEVELEEKGLVDCILFPQKGE
FT                   RPHPNECSGGDLDGDQFFICWDEGLIPSQTEAPMDYTSRRPRIMDHDVTLEEIQKFFVD
FT                   YMINDTLGVISTAHLVHADREPEKARSKKCLELATLHSMAVDFAKTGAPAEMPRVLKPK
FT                   EFPDFMERVDKPMYISNGALGKLYRATIASRVNEKSSFVWSGTIPGAAYDHDLEVDGFE
FT                   TFLEIAKLHKEMYAEKMATLMNFYGAESEDEMLTGNLRNKLMYLQRDNRRFTEMKDRIL
FT                   ISVKSLQKEAKEWLYGSCKPHQHQKMASAWYHVTYHSTFSSQTPNFLSFPWIVGEVLLV
FT                   IKSANSRKAETSKDNCIQQNM"
FT   gene            complement(4122452..4124053)
FT                   /locus_tag="VIT_17s0000g07970"
FT                   /old_locus_tag="Vv17s0000g07970"
FT   mRNA            complement(join(4122452..4122496,4122497..4122703,
FT                   4123520..4124053))
FT                   /locus_tag="VIT_17s0000g07970"
FT                   /old_locus_tag="Vv17s0000g07970"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(4122452..4122496)
FT                   /locus_tag="VIT_17s0000g07970"
FT                   /old_locus_tag="Vv17s0000g07970"
FT   CDS_pept        complement(join(4122497..4122703,4123520..4124053))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07970"
FT                   /old_locus_tag="Vv17s0000g07970"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSU4"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR007855"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSU4"
FT                   /protein_id="CCB43000.1"
FT                   /translation="MAVGERPTVKVSNIPKTAIAKELWSFLESKLGPNTIYALEIATEH
FT                   KNWKSRGFGRVQFETLQAKRAADLLSLQGDLVFRGSSLSISATFDDIIVRPVEPRNQVD
FT                   SGVLHVGFLVEDDCMLVLESWEGVKTLVMPERNRVEFWVDKDGERYKLEVPFDDVLESS
FT                   ACCLGGGKVNALLLKGRSLSDSRGARLTQIRLALHQHWRHLWKPKKLRMSTPSRSQSSA
FT                   MGGKDYFVWRKRMERRQRENDRQI"
FT   gene            complement(4130700..4149953)
FT                   /locus_tag="VIT_17s0000g07960"
FT                   /old_locus_tag="Vv17s0000g07960"
FT   mRNA            complement(join(4130700..4130886,4130887..4131020,
FT                   4131663..4131791,4132023..4132075,4132403..4132517,
FT                   4139942..4140021,4142662..4142705,4142706..4142732,
FT                   4142861..4142938,4149841..4149953))
FT                   /locus_tag="VIT_17s0000g07960"
FT                   /old_locus_tag="Vv17s0000g07960"
FT                   /product="Ubiquitin carrier protein"
FT   3'UTR           complement(4130700..4130886)
FT                   /locus_tag="VIT_17s0000g07960"
FT                   /old_locus_tag="Vv17s0000g07960"
FT   CDS_pept        complement(join(4130887..4131020,4131663..4131791,
FT                   4132023..4132075,4132403..4132517,4139942..4140021,
FT                   4142662..4142705))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07960"
FT                   /old_locus_tag="Vv17s0000g07960"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHV4"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHV4"
FT                   /protein_id="CBI15064.3"
FT                   /translation="MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVEFHGPKESLYE
FT                   GGVWKIRVELPDAYPYKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFE
FT                   VFLPQLLLYPNASDPLNGDAASMMMKNKDQYEKKVKEYCERYAKKENITNERLEEDSED
FT                   EDFSDGKSASSDEDIAGHADP"
FT   5'UTR           complement(4149841..4149953)
FT                   /locus_tag="VIT_17s0000g07960"
FT                   /old_locus_tag="Vv17s0000g07960"
FT   gene            complement(4177028..4179189)
FT                   /locus_tag="VIT_17s0000g07950"
FT                   /old_locus_tag="Vv17s0000g07950"
FT   mRNA            complement(join(4177028..4177231,4177232..4177642,
FT                   4177757..4177813,4178192..4178233,4178330..4178435,
FT                   4178521..4178685,4178776..4178826,4178953..4179089,
FT                   4179090..4179189))
FT                   /locus_tag="VIT_17s0000g07950"
FT                   /old_locus_tag="Vv17s0000g07950"
FT                   /product="Predicted protein"
FT   3'UTR           complement(4177028..4177231)
FT                   /locus_tag="VIT_17s0000g07950"
FT                   /old_locus_tag="Vv17s0000g07950"
FT   CDS_pept        complement(join(4177232..4177642,4177757..4177813,
FT                   4178192..4178233,4178330..4178435,4178521..4178685,
FT                   4178776..4178826,4178953..4179089))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07950"
FT                   /old_locus_tag="Vv17s0000g07950"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR025610"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSU5"
FT                   /protein_id="CCB43001.1"
FT                   /translation="MEEHFNSIPAIHLLQHTLRSLCIHEDSLWVYAVFWRILPRNYPPP
FT                   NWDFQGAFDRSRGNRRNWILVWEDGFCNFIPSTTEINPGAGSSVHRNSEVRLLELQPEL
FT                   FFKMSHEIYKYGEDLIGKVAADHSHKWIYKEHSDPENNLFSAWQNLGDLHPRTWRAQFQ
FT                   SGIKTIALIAVKEGVLQLGSVKKVTEDLNYVTILQKKFTHLLSIPGFLLPHPASWSSSS
FT                   IPSKTNCGSDNIVSNTCPFQAACPPLTAMNFYDHANQPMVITPSMSSLEALLSKLPSVE
FT                   PTPSTPLSGYHETPPRLISIQKPLELDIEVVAMEINERKEH"
FT   5'UTR           complement(4179090..4179189)
FT                   /locus_tag="VIT_17s0000g07950"
FT                   /old_locus_tag="Vv17s0000g07950"
FT   gene            4191197..4191784
FT                   /locus_tag="VIT_17s0000g07940"
FT                   /old_locus_tag="Vv17s0000g07940"
FT   mRNA            join(4191197..4191228,4191229..4191583,4191765..4191784)
FT                   /locus_tag="VIT_17s0000g07940"
FT                   /old_locus_tag="Vv17s0000g07940"
FT                   /product="unknown predicted protein"
FT   5'UTR           4191197..4191228
FT                   /locus_tag="VIT_17s0000g07940"
FT                   /old_locus_tag="Vv17s0000g07940"
FT   CDS_pept        join(4191229..4191583,4191765..4191784)
FT                   /pseudo
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07940"
FT                   /old_locus_tag="Vv17s0000g07940"
FT                   /product="unknown"
FT   gene            4196704..4198766
FT                   /locus_tag="VIT_17s0000g07930"
FT                   /old_locus_tag="Vv17s0000g07930"
FT   mRNA            join(4196704..4196723,4196724..4196914,4197013..4197075,
FT                   4197179..4197295,4197704..4197753,4197862..4197932,
FT                   4198040..4198201,4198297..4198445,4198553..4198766)
FT                   /locus_tag="VIT_17s0000g07930"
FT                   /old_locus_tag="Vv17s0000g07930"
FT                   /product="Predicted protein"
FT   5'UTR           4196704..4196723
FT                   /locus_tag="VIT_17s0000g07930"
FT                   /old_locus_tag="Vv17s0000g07930"
FT   CDS_pept        join(4196724..4196914,4197013..4197075,4197179..4197295,
FT                   4197704..4197753,4197862..4197932,4198040..4198201,
FT                   4198297..4198445,4198553..4198766)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07930"
FT                   /old_locus_tag="Vv17s0000g07930"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHV7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR030184"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHV7"
FT                   /protein_id="CBI15067.3"
FT                   /translation="MGMKAWLSGIVPIAAMVMMECLDVGLVTLSKAAMSRGMNHFVFVV
FT                   YYNALASLIFFLLSFIFHRTKRPPLTFSHFCKFFLLGLPGITVMQNWVFTGVSYSSPTL
FT                   CYAMSNLIPAFTFLLAVAIRLEDLDLRSSRSQIKLLDNWVIGGLFFAAACLSLSAWNTC
FT                   QAPILSSCYPSNITVISFITLFGAIQSTAVSLIAVRDSNAWKLRPDIELISIIYSAIIG
FT                   VVAFFVQNWCIRRKGPVFASMFKPLGMGIAAIIGVIFLGETLHIGSVIGAIIIATGCYV
FT                   VAWLQYREEEESKVCEVVMLPSTFEKAPMLDEPEGSMSQFDGFHCGYKEYNPVYSVT"
FT   gene            complement(4200585..4203054)
FT                   /locus_tag="VIT_17s0000g07920"
FT                   /old_locus_tag="Vv17s0000g07920"
FT   mRNA            complement(join(4200585..4200900,4200901..4201061,
FT                   4202952..4203006,4203007..4203054))
FT                   /locus_tag="VIT_17s0000g07920"
FT                   /old_locus_tag="Vv17s0000g07920"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(4200585..4200900)
FT                   /locus_tag="VIT_17s0000g07920"
FT                   /old_locus_tag="Vv17s0000g07920"
FT   CDS_pept        complement(join(4200901..4201061,4202952..4203006))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07920"
FT                   /old_locus_tag="Vv17s0000g07920"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHV8"
FT                   /db_xref="InterPro:IPR007667"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHV8"
FT                   /protein_id="CBI15068.3"
FT                   /translation="MENLLNQKKRIKNPLVPVGALMTAGVLTAGLVSFRQGNSRLGQLL
FT                   MRARVVVQGATVALMVGTAYYYGEKM"
FT   5'UTR           complement(4203007..4203054)
FT                   /locus_tag="VIT_17s0000g07920"
FT                   /old_locus_tag="Vv17s0000g07920"
FT   gene            4218855..4221741
FT                   /locus_tag="VIT_17s0000g07910"
FT                   /old_locus_tag="Vv17s0000g07910"
FT   mRNA            join(4218855..4219532,4219533..4219612,4219741..4219803,
FT                   4219903..4220019,4220388..4220628,4220728..4220886,
FT                   4220979..4221130,4221251..4221416,4221417..4221741)
FT                   /locus_tag="VIT_17s0000g07910"
FT                   /old_locus_tag="Vv17s0000g07910"
FT                   /product="Predicted protein"
FT   5'UTR           4218855..4219532
FT                   /locus_tag="VIT_17s0000g07910"
FT                   /old_locus_tag="Vv17s0000g07910"
FT   CDS_pept        join(4219533..4219612,4219741..4219803,4219903..4220019,
FT                   4220388..4220628,4220728..4220886,4220979..4221130,
FT                   4221251..4221416)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07910"
FT                   /old_locus_tag="Vv17s0000g07910"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHV9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR030184"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHV9"
FT                   /protein_id="CBI15069.3"
FT                   /translation="MDRFVFVVYSNAFASLILFSISFIFLRTKRPPLSFSLLCKFFLLS
FT                   LAGITVMQNCVFTGVSYGSPTLGSAMSNLIPAFTFLLAVAFRLENLDLRSSRSLIKILG
FT                   TLVSISGALIVTLYKGPPIGAGLIKSPSISSNDHLQKTANNWVIGGLFFAMAGLSISVW
FT                   NIFQAPILRRYPSEITIVSFFTLFGAIQCAAVALIAVKDSNAWKLRPDFELITIIYSAV
FT                   FGGVVSFCVQTWCIKRKGPVFVAIFKPLGIGIAAIMGVIFLGDTLYIGSVIGAIIIVTG
FT                   FYGVMWAQTKEGEKGEAQEVDGLPSTSEKAPLLQSRRDEQKWLD"
FT   3'UTR           4221417..4221741
FT                   /locus_tag="VIT_17s0000g07910"
FT                   /old_locus_tag="Vv17s0000g07910"
FT   gene            complement(4222031..4228053)
FT                   /locus_tag="VIT_17s0000g07900"
FT                   /old_locus_tag="Vv17s0000g07900"
FT   mRNA            complement(join(4222031..4222617,4222618..4222716,
FT                   4222806..4222910,4223002..4223052,4223271..4223372,
FT                   4224691..4224923,4225973..4226164,4226421..4226601,
FT                   4226695..4226894,4227822..4228053))
FT                   /locus_tag="VIT_17s0000g07900"
FT                   /old_locus_tag="Vv17s0000g07900"
FT                   /product="Predicted protein"
FT   3'UTR           complement(4222031..4222617)
FT                   /locus_tag="VIT_17s0000g07900"
FT                   /old_locus_tag="Vv17s0000g07900"
FT   CDS_pept        complement(join(4222618..4222716,4222806..4222910,
FT                   4223002..4223052,4223271..4223372,4224691..4224923,
FT                   4225973..4226164,4226421..4226601,4226695..4226894,
FT                   4227822..4228053))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07900"
FT                   /old_locus_tag="Vv17s0000g07900"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHW0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041517"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHW0"
FT                   /protein_id="CBI15070.3"
FT                   /translation="MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAH
FT                   SVEHYTQVKLKKRGSDVKYLATVLAIGTECDIAMLTVNDDEFWEGVSPVEFGNLPTLQD
FT                   AVTVVGYPIGGDTISVTSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNEKG
FT                   NCVGIAFQSLKHEDAENIGYVIPTPVIKHFIQDYEKNGAYTGFPILCLEWQKMENPDLR
FT                   MAMGMKPDQKGVRVRRIDPTAPESKVLKPSDIILSFDGVDIANDGTVPFRHGERIGFSY
FT                   LVSQKYTGDNATITVLRDSKMLKFNIKLATHRRIIPAHNKGKPPSYYIIAGFVFSTVSV
FT                   PYLRSEYGKDYEYEAPVKLLDKLLHSMPQSEDEQLVVVSQVLVADINIGYEDIVNTQVL
FT                   ALNGKPVKNLKSLANMVESCDDEFLKFDLEYQQIVVLRTKTAKAATLDILTTHCIPSKM
FT                   SDDLKT"
FT   gap             4247875..4247974
FT                   /estimated_length=100
FT   gene            4248356..4256746
FT                   /locus_tag="VIT_17s0000g07890"
FT                   /old_locus_tag="Vv17s0000g07890"
FT   mRNA            join(4248356..4248359,4248360..4248464,4248825..4248912,
FT                   4249090..4249199,4249285..4249348,4254527..4254591,
FT                   4254682..4254747,4255554..4255648,4256328..4256367,
FT                   4256368..4256746)
FT                   /locus_tag="VIT_17s0000g07890"
FT                   /old_locus_tag="Vv17s0000g07890"
FT                   /product="Predicted protein"
FT   5'UTR           4248356..4248359
FT                   /locus_tag="VIT_17s0000g07890"
FT                   /old_locus_tag="Vv17s0000g07890"
FT   CDS_pept        join(4248360..4248464,4248825..4248912,4249090..4249199,
FT                   4249285..4249348,4254527..4254591,4254682..4254747,
FT                   4255554..4255648,4256328..4256367)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07890"
FT                   /old_locus_tag="Vv17s0000g07890"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHW1"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHW1"
FT                   /protein_id="CBI15071.3"
FT                   /translation="MASSASKFIKCVTVGDGAVGKTCMLICYTSNKFPSDYIPTVFDNF
FT                   SANVVAEGTTVNLGLWDTAGQEDYNRLRPLSYQGADVFILAFSLVSRASYENVLKKWIP
FT                   ELQHFAPGIPIVLVGTKLDLREDKHYLADHPGLVPVTTAQGEELRKQIGAAYYIECSSK
FT                   TQQNVKAVFDAAIKVVIKPQQKQKEKKKKRHRGWLNVFVGRSLMCFK"
FT   3'UTR           4256368..4256746
FT                   /locus_tag="VIT_17s0000g07890"
FT                   /old_locus_tag="Vv17s0000g07890"
FT   gene            complement(4258902..4269588)
FT                   /locus_tag="VIT_17s0000g07880"
FT                   /old_locus_tag="Vv17s0000g07880"
FT   mRNA            complement(join(4258902..4259530,4260265..4260303,
FT                   4260304..4264749,4264843..4265211,4269305..4269424,
FT                   4269425..4269588))
FT                   /locus_tag="VIT_17s0000g07880"
FT                   /old_locus_tag="Vv17s0000g07880"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(join(4258902..4259530,4260265..4260303))
FT                   /locus_tag="VIT_17s0000g07880"
FT                   /old_locus_tag="Vv17s0000g07880"
FT   CDS_pept        complement(join(4260304..4264749,4264843..4265211,
FT                   4269305..4269424))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07880"
FT                   /old_locus_tag="Vv17s0000g07880"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSU6"
FT                   /db_xref="InterPro:IPR001025"
FT                   /db_xref="InterPro:IPR003617"
FT                   /db_xref="InterPro:IPR017923"
FT                   /db_xref="InterPro:IPR035441"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSU6"
FT                   /protein_id="CCB43003.1"
FT                   /translation="MHGREGEDRKRSRHMWSVPTRGTASVADDSSTSTANSFLKDGRNI
FT                   SVGDCALFKPSQDSPPFIGIIRWLTSSKNNIRLGVNWLYRPSEVKLGKGILLEAAPNEV
FT                   FYTFHKDEIPAASLLHPCKVAFLPKGDELPSGISSFVCRRVFDVANKCLWWLTDQDYIN
FT                   ERQEEVDKLLYKTRIEMHATVQPGGRSPKPMSGPTSTSQIKPGSDSSTQNCATSLPSQV
FT                   KGKKRERGDQGSEPIKRERPSKTDDGDSGHSRPESVWKSEIAKITERGGLVDSEGVERL
FT                   VQLMQPERAEKKIDLIGRSILAGVIAATEKYDCLGRFVQLRGLPVLDEWLQEAHKGKIG
FT                   DGSSPKDSDKSVEEFLLVLLRALDKLPVNLQALQMCNIGKSVNHLRSHKNLEIQKKARS
FT                   LVDTWKKRVEAEMNINDAKSGSSQAVAWSSRPRLSEVSHGGNRHSGGSSEIAMKSSVTQ
FT                   LSSSKTAPVKLVQGEIAKSGSASQGFTKSATSPASVSTSLKDGQTRVAGAGNASDPPLT
FT                   TVRDEKSSSSSQSHNNSQSCSSDHAKTVGFSGKEDARSSTAMSMSVSKTSGGASRHRKS
FT                   VNGYPGPAVSGVQRETGSSRSSSFQRNPASEKVSQSGLTCDKAFDVPTVEGNSHKLIVK
FT                   IPNRGRSPAQSASGGSFEDPSMVNSQASSPVLSGKHDQSDRNLKEKSDVYRANNTSDVN
FT                   TESWQSNDFKDAMTGSDEGDGSPATLPDEERSRTGDDTRKIKTASSSSGIEPKSGKLVE
FT                   ASFTSMNALIESCVKCEANASVSVVDDVGMNLLASVAAGEMAKRESVSPADSPLRNTAV
FT                   IEDSSAGNDAKSKPTGDDILREQSQSNYGPTGDTEKQGFWAKDGLHHLPKHALTNRENN
FT                   EHINSTSIDLVRTSELCSEINRKSDETVVGASVTASPVSTTEKGSDDEQGKQLHEKKAA
FT                   VDGVNVDGIPDTKPKVSSSSLAEDKVNDVLPCVELKEEQSSYASLEPDGEKNNVNEGLN
FT                   TEQKPPASMIPSDFVKGTEKEVPLPSGSGKDLVPENVDQMKAEKADEICVSNHANQMEE
FT                   QRIEPKNHASTAAEDRVVAGLYSVATDHKRELMEENLGNKEVLENCSSGQAPYKQSPTF
FT                   PVLEVEQLVRPRGSKLPGDEADETEECASTTADASSFSATGGSDVDGKLEFDLNEGFNA
FT                   DDGKFGEPVNVGTPGCSAAVHLISPLPFPVSSMSSGLPASITVTAAAKGPFVPPDDLLR
FT                   SKGELGWKGSAATSAFRPAEPRKTLEMPLNALNVPSDATSGKQNRPLLDFDLNMPDERI
FT                   LEDMTSRSSAQETSSTCDLVSSRDLAHDRPMGSAPIRCSGGLDLDLNQSDEVTDMGQHS
FT                   ASNSHRLVVPLLPVKSSSSVGFPNGEVVVRRDFDLNNGPVLDEVSAEPSSFSQHARSSM
FT                   ASQPPVACLRMNNTDIGNFSSWFPPANNYSAVTIPSIMPDREQPFPIVATNGPQRIMGL
FT                   STGGTPFNPDVYRGPVLSSSPAVPFPSTPFQYPVFPFGTNFPLPPATFSGSSTSFTDSS
FT                   SAGRLCFPAVNSQLIGPAGTVPSHYPRPYVVNLSDGSNSGGLESNRRWGRQGLDLNAGP
FT                   GGPEIDGREESVVSLASRQLSVASSQALAGEQARMYHAAGGVLKRKEPEGGWDTERFSY
FT                   KQSSWQ"
FT   5'UTR           complement(4269425..4269588)
FT                   /locus_tag="VIT_17s0000g07880"
FT                   /old_locus_tag="Vv17s0000g07880"
FT   gene            complement(4271215..4282851)
FT                   /locus_tag="VIT_17s0000g07870"
FT                   /old_locus_tag="Vv17s0000g07870"
FT   mRNA            complement(join(4271215..4271424,4271425..4271532,
FT                   4276164..4276321,4282215..4282371,4282372..4282388,
FT                   4282725..4282779,4282839..4282851))
FT                   /locus_tag="VIT_17s0000g07870"
FT                   /old_locus_tag="Vv17s0000g07870"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(4271215..4271424)
FT                   /locus_tag="VIT_17s0000g07870"
FT                   /old_locus_tag="Vv17s0000g07870"
FT   CDS_pept        complement(join(4271425..4271532,4276164..4276321,
FT                   4282215..4282371))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07870"
FT                   /old_locus_tag="Vv17s0000g07870"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHW3"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR010729"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="InterPro:IPR038340"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHW3"
FT                   /protein_id="CBI15073.3"
FT                   /translation="MFVRRVFGRALLAAAKSEPSAAGAATARAGYNPLEEFFEADRSPD
FT                   EDKPVVYGRGWKASELRLKSWDDLHKLWYILLKEKNMLMTQRQMLQSQNLRFPNPERIP
FT                   KVRKSMCRIKHVLTERAIEEPDPRRSVEMKRMINAL"
FT   5'UTR           complement(4282839..4282851)
FT                   /locus_tag="VIT_17s0000g07870"
FT                   /old_locus_tag="Vv17s0000g07870"
FT   gene            4295711..4302240
FT                   /locus_tag="VIT_17s0000g07850"
FT                   /old_locus_tag="Vv17s0000g07850"
FT   mRNA            join(4295711..4295907,4295908..4296013,4296849..4296946,
FT                   4297052..4297228,4297643..4297743,4298231..4298306,
FT                   4298421..4298480,4298632..4298816,4299564..4299660,
FT                   4300020..4300106,4300972..4301030,4301169..4301260,
FT                   4301349..4301426,4301533..4301693,4301784..4302002,
FT                   4302003..4302240)
FT                   /locus_tag="VIT_17s0000g07850"
FT                   /old_locus_tag="Vv17s0000g07850"
FT                   /product="Nucleobase ascorbate transporter"
FT   5'UTR           4295711..4295907
FT                   /locus_tag="VIT_17s0000g07850"
FT                   /old_locus_tag="Vv17s0000g07850"
FT   CDS_pept        join(4295908..4296013,4296849..4296946,4297052..4297228,
FT                   4297643..4297743,4298231..4298306,4298421..4298480,
FT                   4298632..4298816,4299564..4299660,4300020..4300106,
FT                   4300972..4301030,4301169..4301260,4301349..4301426,
FT                   4301533..4301693,4301784..4302002)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07850"
FT                   /old_locus_tag="Vv17s0000g07850"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHW5"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHW5"
FT                   /protein_id="CBI15075.3"
FT                   /translation="MAGGGGGGKAEEPQPHPPKEQLPGVHFCITSPPSWPEAIILGFQH
FT                   YIVMLGTTVLIPTALVPQMGGGNEEKAKVIQTLLFVAGLNTFTQTLFGSRLPAVIGGSY
FT                   TFVAATISIILAGRFSDDGDPIQKFKRTMRAIQGAMIVASTLQIVLGFSGLWRNVTRFL
FT                   SPLSAVPLVSLAGFGLYEFGFPGVAKCVEIGLPQLIILILVSQYMPHVIHSGKNIFDRF
FT                   AVIFTVVIVWIYAHLLTVGGAYNGAAPKTQASCRTDRAGLIDAAPWIRIPYPFQWGAPT
FT                   FDAGEAFAMMVTSFVALVESTGAFIAVSRFASATHLPSSILSRGVGWQGIGILLSGLFG
FT                   TVNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYC
FT                   LFFAYVGSGGLSFLQFCNLNSFRTKFILGFSIFMGFSVPQYFNEFTAIRGYGPVHTSGR
FT                   WFNDMINVPFSSEAFVAGCLAFLLDITLHRKDGSVRKDRGKHWWDKFRSFKTDTRSEEF
FT                   YSLPFNLNKYFPSV"
FT   3'UTR           4302003..4302240
FT                   /locus_tag="VIT_17s0000g07850"
FT                   /old_locus_tag="Vv17s0000g07850"
FT   gene            4308052..4309393
FT                   /locus_tag="VIT_17s0000g07840"
FT                   /old_locus_tag="Vv17s0000g07840"
FT   mRNA            join(4308052..4308108,4308109..4308379,4308463..4308611,
FT                   4308974..4309108,4309109..4309393)
FT                   /locus_tag="VIT_17s0000g07840"
FT                   /old_locus_tag="Vv17s0000g07840"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           4308052..4308108
FT                   /locus_tag="VIT_17s0000g07840"
FT                   /old_locus_tag="Vv17s0000g07840"
FT   CDS_pept        join(4308109..4308379,4308463..4308611,4308974..4309108)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07840"
FT                   /old_locus_tag="Vv17s0000g07840"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR025322"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHW6"
FT                   /protein_id="CBI15076.3"
FT                   /translation="MGNCQAIDAATLVIQYPCGKADKLYWPVSASEVMKMNPGHYVALL
FT                   ITTTLCPTTATTTTAPSSVRITRVKLLRPTDTLVLGQVYRLITAEEVMKALWAKKYAKM
FT                   KKTQAASADMAGRVNEKLGGGLEFTVRRSEMEKNHQMARHERGHERGRGRTAAASAGAN
FT                   SATARPRTWQPSLHSILEGGS"
FT   3'UTR           4309109..4309393
FT                   /locus_tag="VIT_17s0000g07840"
FT                   /old_locus_tag="Vv17s0000g07840"
FT   gene            complement(4310547..4314965)
FT                   /locus_tag="VIT_17s0000g07830"
FT                   /old_locus_tag="Vv17s0000g07830"
FT   mRNA            complement(join(4310547..4311311,4311408..4311721,
FT                   4311812..4312009,4313738..4314162,4314253..4314965))
FT                   /locus_tag="VIT_17s0000g07830"
FT                   /old_locus_tag="Vv17s0000g07830"
FT                   /product="putative uncharacterized protein"
FT   CDS_pept        complement(join(4310547..4311311,4311408..4311721,
FT                   4311812..4312009,4313738..4314162,4314253..4314965))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07830"
FT                   /old_locus_tag="Vv17s0000g07830"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHW7"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR032867"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHW7"
FT                   /protein_id="CBI15077.3"
FT                   /translation="MRFTPLPKLSLLFSTKIPRLQEPFYVQSPLVYISSNTSSAIWEPS
FT                   GTSSFSLPSHSTFVQLLKKRPSLTQIKQIHAQVVTHGLAQNTSLLGPLIHSYIGCRNLS
FT                   FARIVFDQFPSLPPTIIWNLMIQAYSKTPSSQESLYLFHQMLAHGRPTSADKYTFTFVF
FT                   TACSRHPTLRGYGENVHGMVVKDGYESDIFVGNSLVNMYSIFSRMVDAKRVFDEMPQRD
FT                   VITWTSVVKGYAMRGEFYNEALQCFNDMLCHDEVKPNEAVLVSILSACAHLGALDQGKW
FT                   IHVYIDKNRILLSSNISTALIDMYAKCGRIDCARRVFDGLHKRDLLTWTSMISGLSMHG
FT                   LGAECLWTFSEMLAEGFKPDDITLLGVLNGCSHSGLVEEEIVHGMVVKSGFESNLYVGN
FT                   SVINMCSVFARMEDARKVFNQMSERDVFSWTSLLGGYAKHGEMDRASLTFFCNMLCDDR
FT                   VNPNEAVLVCVLSACAHLGALDQGNWIHLYIDKIGIRQSSNISTALIDMYAKCGRIDCA
FT                   SRVFNGICKRDVLSFTSMISGLSYHGLGKDALRGSSILANMESLWGIAPKIEHYGCYID
FT                   LLGRAGYLERALEVVKTMPMEPDIVIWRALLSASRIHHNVNLGEQIISHIGQLKSSDHN
FT                   GGEVLLSNLYASLGRWERVTEMRKLMVDRRSESSPGCSWIEVNGLVHEFRVADQLHPQI
FT                   VEIRNKLNEILKRLSQIGYSANTMQVSFDLNEEEKEQAVAWHSEKLAIAFGLMSTEPGT
FT                   LIRIVKNLRTCEDCHSALKTISQVYGREIVVRDRSRFHTFIEGDCSCKDFW"
FT   gene            complement(4315440..4318470)
FT                   /locus_tag="VIT_17s0000g07820"
FT                   /old_locus_tag="Vv17s0000g07820"
FT   mRNA            complement(join(4315440..4315752,4315753..4315944,
FT                   4316334..4316423,4316535..4316566,4316672..4316768,
FT                   4318242..4318379,4318380..4318470))
FT                   /locus_tag="VIT_17s0000g07820"
FT                   /old_locus_tag="Vv17s0000g07820"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(4315440..4315752)
FT                   /locus_tag="VIT_17s0000g07820"
FT                   /old_locus_tag="Vv17s0000g07820"
FT   CDS_pept        complement(join(4315753..4315944,4316334..4316423,
FT                   4316535..4316566,4316672..4316768,4318242..4318379))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07820"
FT                   /old_locus_tag="Vv17s0000g07820"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHW8"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHW8"
FT                   /protein_id="CBI15078.3"
FT                   /translation="MATFAGTTQKCKACEKTVYLVDELTADNKVYHKACFRCHHCKGTL
FT                   KLSNYSSFEGVLYCKPHFDQLFKMTGSLDKSFEGAPKTVRSVDQGQTNSKVSSMFAGTQ
FT                   EKCVACKKTVYPIEKVGVDGTSYHKACFRCTHGGCTISPSNYIAHEHRLYCRHHHSQLF
FT                   KEKGNFSQLDKQEQVKGGD"
FT   5'UTR           complement(4318380..4318470)
FT                   /locus_tag="VIT_17s0000g07820"
FT                   /old_locus_tag="Vv17s0000g07820"
FT   gene            complement(4319900..4326111)
FT                   /locus_tag="VIT_17s0000g07810"
FT                   /old_locus_tag="Vv17s0000g07810"
FT   mRNA            complement(join(4319900..4320269,4320270..4320349,
FT                   4321964..4322066,4325852..4325920,4325996..4326052,
FT                   4326053..4326111))
FT                   /locus_tag="VIT_17s0000g07810"
FT                   /old_locus_tag="Vv17s0000g07810"
FT                   /product="Predicted protein"
FT   3'UTR           complement(4319900..4320269)
FT                   /locus_tag="VIT_17s0000g07810"
FT                   /old_locus_tag="Vv17s0000g07810"
FT   CDS_pept        complement(join(4320270..4320349,4321964..4322066,
FT                   4325852..4325920,4325996..4326052))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07810"
FT                   /old_locus_tag="Vv17s0000g07810"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHW9"
FT                   /db_xref="InterPro:IPR034573"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHW9"
FT                   /protein_id="CBI15079.3"
FT                   /translation="MAFLLNKATALSHFRSHSQKTEDSFSLSRRGFHVEPGPREKALLA
FT                   DNPSLKRFKSHKRNVWRLKRVGDVLTIVVVAGCCYEIYVKAVMREEARKQAAANEIA"
FT   5'UTR           complement(4326053..4326111)
FT                   /locus_tag="VIT_17s0000g07810"
FT                   /old_locus_tag="Vv17s0000g07810"
FT   gene            4326343..4331018
FT                   /locus_tag="VIT_17s0000g07800"
FT                   /old_locus_tag="Vv17s0000g07800"
FT   mRNA            join(4326343..4326380,4326381..4326504,4326598..4326743,
FT                   4326860..4326967,4327632..4327688,4328803..4328868,
FT                   4328951..4329011,4329507..4329553,4330693..4330731,
FT                   4330732..4331018)
FT                   /locus_tag="VIT_17s0000g07800"
FT                   /old_locus_tag="Vv17s0000g07800"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           4326343..4326380
FT                   /locus_tag="VIT_17s0000g07800"
FT                   /old_locus_tag="Vv17s0000g07800"
FT   CDS_pept        join(4326381..4326504,4326598..4326743,4326860..4326967,
FT                   4327632..4327688,4328803..4328868,4328951..4329011,
FT                   4329507..4329553,4330693..4330731)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07800"
FT                   /old_locus_tag="Vv17s0000g07800"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHX0"
FT                   /db_xref="InterPro:IPR007263"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHX0"
FT                   /protein_id="CBI15080.3"
FT                   /translation="MASRLTTAASVCIGKHGSPSLRTRFHGSASNPLHKFISYPTVAGL
FT                   RYPIRAIHGATAEAVAPKKAGEEKSYQDWKIKMLYDGECPLCMREVNMLRERNKQYGAI
FT                   KFVDISSDDYSPEENQGLDYKTVMGRIHAIQSDGTVVTDVEAFRRLYEEVGLGWVYAIT
FT                   KYKPIATIADAVYGVWAKYRLQITGRPPLEEVLELRKKNKVEVCSDSKTCKM"
FT   3'UTR           4330732..4331018
FT                   /locus_tag="VIT_17s0000g07800"
FT                   /old_locus_tag="Vv17s0000g07800"
FT   gene            complement(4331440..4333259)
FT                   /locus_tag="VIT_17s0000g07790"
FT                   /old_locus_tag="Vv17s0000g07790"
FT   mRNA            complement(join(4331440..4331546,4331547..4332284,
FT                   4332609..4333244,4333245..4333259))
FT                   /locus_tag="VIT_17s0000g07790"
FT                   /old_locus_tag="Vv17s0000g07790"
FT                   /product="Predicted protein"
FT   3'UTR           complement(4331440..4331546)
FT                   /locus_tag="VIT_17s0000g07790"
FT                   /old_locus_tag="Vv17s0000g07790"
FT   CDS_pept        complement(join(4331547..4332284,4332609..4333244))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07790"
FT                   /old_locus_tag="Vv17s0000g07790"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSU7"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="InterPro:IPR035595"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSU7"
FT                   /protein_id="CCB43004.1"
FT                   /translation="MEKQGGHVMVLTYPAQGHINPLLQFSKRLASKGLKATLATTHYTV
FT                   NFIQSDAVGVEAISDGFDEGGFMQAPSLEAYLESFQAVGSRTVGELILKFNESASPVDC
FT                   LVYDSILPWGLSVARQFGIYGAAFWTTSASVCSMYWQLRQGVLSLPVKQEPVPVSMPGL
FT                   PPLRLSDLPDFLAQPGHLSAYMSAVMEQISTLEQNDWVFMNSFDALESELVKAMSGLWS
FT                   VAMIGPMVPSAYLDQQIEGDTVYGASLWKPTNDECLGWLETKPPKSVVYISFGSMAEIP
FT                   VKQVEEIAWGLKESDYHFIWVVKESESGKLPINFLNSMNETGLVVTWCNQLEVLAHKAV
FT                   GCFVTHCGWNSILEGLSLGVPMVGMPQRVDQPTNAKFVEDVWRAGVRAQKDEEGIVTRK
FT                   ELEKCIKEIMVGERSEEIKRNACMWRQSAKSAVSKGGSSDKNTDEFVGVLLKRGKKKT"
FT   5'UTR           complement(4333245..4333259)
FT                   /locus_tag="VIT_17s0000g07790"
FT                   /old_locus_tag="Vv17s0000g07790"
FT   gene            complement(4333651..4341009)
FT                   /locus_tag="VIT_17s0000g07780"
FT                   /old_locus_tag="Vv17s0000g07780"
FT   mRNA            complement(join(4333651..4334462,4334463..4334473,
FT                   4334487..4334622,4334717..4334923,4335559..4335719,
FT                   4337326..4337816,4337931..4337983,4339523..4339604,
FT                   4340609..4340700,4340701..4341009))
FT                   /locus_tag="VIT_17s0000g07780"
FT                   /old_locus_tag="Vv17s0000g07780"
FT                   /product="Predicted protein"
FT   3'UTR           complement(4333651..4334462)
FT                   /locus_tag="VIT_17s0000g07780"
FT                   /old_locus_tag="Vv17s0000g07780"
FT   CDS_pept        complement(join(4334463..4334473,4334487..4334622,
FT                   4334717..4334923,4335559..4335719,4337326..4337816,
FT                   4337931..4337983,4339523..4339604,4340609..4340700))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07780"
FT                   /old_locus_tag="Vv17s0000g07780"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSU8"
FT                   /db_xref="InterPro:IPR012416"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSU8"
FT                   /protein_id="CCB43005.1"
FT                   /translation="MSQKRHAEDGKARSEGGCPEDKKRKVPSLKNAILEVMKMQSSVQH
FT                   LMEPILEPLIRKVVKEEVETALRKHLSNMKRNFEKELHPFESRSLQLQFSNALSLPVFT
FT                   GTRIEGEDCSSIQVALVDGLTGEVVKSGPESSARVEIVVLEGDFDGDEGDNWTLEEFKN
FT                   NIVREREGKKPLLTGDAFLNLKDGVGFVSEISFTDNSSWTRSRKFRLGARVVDNSDGTR
FT                   IREAKTESFIVRDHRGELYKKHHPPSLMDEVWRLEKIGKDGAFHKRLSRESITTVKDFL
FT                   TLLYLDSPRLRNILGTGMSTKMWEVTVEHARTCVIDKRIFMYCPPGPQQKSGVVFNTVG
FT                   QLMGLLSECQYIPIDKLSETEKVDAHNLIGTAFKRWGEVVSFEDESSLTGGSSHLTDVH
FT                   HPSSPRTETNF"
FT   5'UTR           complement(4340701..4341009)
FT                   /locus_tag="VIT_17s0000g07780"
FT                   /old_locus_tag="Vv17s0000g07780"
FT   gene            complement(4359962..4360366)
FT                   /locus_tag="VIT_17s0000g07770"
FT                   /old_locus_tag="Vv17s0000g07770"
FT   mRNA            complement(join(4359962..4360054,4360170..4360220,
FT                   4360302..4360358,4360359..4360366))
FT                   /locus_tag="VIT_17s0000g07770"
FT                   /old_locus_tag="Vv17s0000g07770"
FT                   /product="Predicted protein"
FT   CDS_pept        complement(join(4359962..4360054,4360170..4360220,
FT                   4360302..4360358))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07770"
FT                   /old_locus_tag="Vv17s0000g07770"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSU9"
FT                   /protein_id="CCB43006.1"
FT                   /translation="MATLRLLLVFVALLVFLAQISSDFNIEGEEMPFVSQVVVRGGNRR
FT                   LMQDIGGDSFFPFCFHRNDVA"
FT   5'UTR           complement(4360359..4360366)
FT                   /locus_tag="VIT_17s0000g07770"
FT                   /old_locus_tag="Vv17s0000g07770"
FT   gene            complement(4362328..4369151)
FT                   /locus_tag="VIT_17s0000g07760"
FT                   /old_locus_tag="Vv17s0000g07760"
FT   mRNA            complement(join(4362328..4362684,4362685..4362915,
FT                   4363078..4363228,4363336..4363477,4364256..4364356,
FT                   4364515..4364600,4364692..4364773,4365705..4365825,
FT                   4366050..4366229,4366318..4366366,4367115..4367297,
FT                   4367510..4367609,4367786..4367847,4367927..4367992,
FT                   4368081..4368123,4368990..4369114,4369115..4369151))
FT                   /locus_tag="VIT_17s0000g07760"
FT                   /old_locus_tag="Vv17s0000g07760"
FT                   /product="Predicted protein"
FT   3'UTR           complement(4362328..4362684)
FT                   /locus_tag="VIT_17s0000g07760"
FT                   /old_locus_tag="Vv17s0000g07760"
FT   CDS_pept        complement(join(4362685..4362915,4363078..4363228,
FT                   4363336..4363477,4364256..4364356,4364515..4364600,
FT                   4364692..4364773,4365705..4365825,4366050..4366229,
FT                   4366318..4366366,4367115..4367297,4367510..4367609,
FT                   4367786..4367847,4367927..4367992,4368081..4368123,
FT                   4368990..4369114))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07760"
FT                   /old_locus_tag="Vv17s0000g07760"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHX4"
FT                   /db_xref="InterPro:IPR001382"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR036026"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHX4"
FT                   /protein_id="CBI15084.3"
FT                   /translation="MFSPNFGTWVLMFLLVSSTFVHSSMSEIDAKKRYMREKVRKMFYH
FT                   AYDNYMAHAFPHDELKPLSKTFTDSLSELGNLNLEHLSEHYNGSALTLIESLSSLVILG
FT                   NNTEFERAVRWLSENLSFDVDVRTNLFECNIRVLGGLVSAHILATDSRNRLVQGTYKNE
FT                   LLILAEDLGRRFLPAFDTPTGLPYAWINLKYGVMENETTETSTSGCGSLILEMGALSRL
FT                   TGDPRYESAALRALRKLWSMRSSLNLLGTTLDVATGEWIEYSSGIGAGVDSFYEYLIKA
FT                   HILFGKEELWRMFQSAYLAVQKYFRHGPWYHEADMRTGKATYWQLTSLQAFWPGVQVLI
FT                   GDIAAANSSHREFVYVWEKFGVLPERYLLDHQMLHPTEKYYPLRPELAESTFYLYQATK
FT                   DPWYIEVGKSMVDSLNLYAKVEGGFASIKDVTTMQLEDHQHSFFLAETCKYLYLLFDDS
FT                   FLVDRNYVFTTEGHPLPVISAWHDRLPENYIPTNGTSIKSEKQAARRSSAMSLQVCPAT
FT                   TLNSGRSSQQVESACHIPDAQSDHRCLTEDECGVDATTCRRRSCSMAGYCGLWLFI"
FT   5'UTR           complement(4369115..4369151)
FT                   /locus_tag="VIT_17s0000g07760"
FT                   /old_locus_tag="Vv17s0000g07760"
FT   gene            4370047..4371214
FT                   /locus_tag="VIT_17s0000g07750"
FT                   /old_locus_tag="Vv17s0000g07750"
FT   mRNA            join(4370047..4371030,4371031..4371214)
FT                   /locus_tag="VIT_17s0000g07750"
FT                   /old_locus_tag="Vv17s0000g07750"
FT                   /product="Predicted protein"
FT   CDS_pept        4370047..4371030
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07750"
FT                   /old_locus_tag="Vv17s0000g07750"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5BQ28"
FT                   /db_xref="InterPro:IPR000823"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="InterPro:IPR033905"
FT                   /db_xref="UniProtKB/TrEMBL:A5BQ28"
FT                   /protein_id="CCB43007.1"
FT                   /translation="MAFSFLVLLLFLSGISSSESKLNVNYYQKSCPNFERIMQDAITSK
FT                   QINSPTTAAGTLRLFFHDCMVDGCDASVLISSNAFNTAERDADINLSLPGDAFDLIVRA
FT                   KTSLELTCPGIVSCADILALATRDLVTMVGGPYYDVQLGRKDGLVSQASRVEGNLPRAN
FT                   MTMDQLIAIFAAKGFSIQEMVALSGGHTIGFSHCKEFSNRIFNYSSTSDIDPAFHPKFA
FT                   QALRNVCANYQRDTAMSAFNDVMTPNKFDNMYYQNLPRGLGLLSSDNVLVTDPRTKPFV
FT                   ELYATNQKAFFNDFAHAMEKLSVRGIKTGRKGEVRRRCDAFNHIKT"
FT   3'UTR           4371031..4371214
FT                   /locus_tag="VIT_17s0000g07750"
FT                   /old_locus_tag="Vv17s0000g07750"
FT   gene            complement(4373032..4397343)
FT                   /locus_tag="VIT_17s0000g07740"
FT                   /old_locus_tag="Vv17s0000g07740"
FT   mRNA            complement(join(4373032..4373331,4373332..4373583,
FT                   4373650..4373706,4396347..4396547,4396900..4397322,
FT                   4397323..4397343))
FT                   /locus_tag="VIT_17s0000g07740"
FT                   /old_locus_tag="Vv17s0000g07740"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(4373032..4373331)
FT                   /locus_tag="VIT_17s0000g07740"
FT                   /old_locus_tag="Vv17s0000g07740"
FT   CDS_pept        complement(join(4373332..4373583,4373650..4373706,
FT                   4396347..4396547,4396900..4397322))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07740"
FT                   /old_locus_tag="Vv17s0000g07740"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSV1"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSV1"
FT                   /protein_id="CCB43008.1"
FT                   /translation="MQRSRKRKQEESSSCSKESATKSARNDVVVDPYPSHPRPTPVECR
FT                   AVRDDLLALHGFPQRFEKYRKLRLPPLPHTSSPGLDGGGGTPVKLDPSDGDDVNGSSQK
FT                   ESVLDGLVSIILSQNTTDVNSQRAFASLKSAFPTWQDVLAADSKSIENAIRCGGLAVTK
FT                   ASCIKKMLSCLLERKGKLCLEYLRDLTVDEIKTELSHFKGIGPKTVACVLMFHLQRDDF
FT                   PVDTHVIQIGKAIGWVPAVADRKKAYLHLNRRIPDELKFDLNCLLFTHGKLCHECTQKG
FT                   ANQKRKESHESSCPLLTYCGDMFKSSSPN"
FT   gap             4382404..4382503
FT                   /estimated_length=100
FT   gap             4384070..4384386
FT                   /estimated_length=317
FT   5'UTR           complement(4397323..4397343)
FT                   /locus_tag="VIT_17s0000g07740"
FT                   /old_locus_tag="Vv17s0000g07740"
FT   gene            complement(4397562..4399641)
FT                   /locus_tag="VIT_17s0000g07730"
FT                   /old_locus_tag="Vv17s0000g07730"
FT   mRNA            complement(join(4397562..4397930,4397931..4399502,
FT                   4399503..4399641))
FT                   /locus_tag="VIT_17s0000g07730"
FT                   /old_locus_tag="Vv17s0000g07730"
FT                   /product="Predicted protein"
FT   3'UTR           complement(4397562..4397930)
FT                   /locus_tag="VIT_17s0000g07730"
FT                   /old_locus_tag="Vv17s0000g07730"
FT   CDS_pept        complement(4397931..4399502)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07730"
FT                   /old_locus_tag="Vv17s0000g07730"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSV2"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSV2"
FT                   /protein_id="CCB43009.1"
FT                   /translation="MGGNGKHRWKISFRSSSSMPKQSPKEFMCPISGSLMADPVVVASG
FT                   QTFERISVQVCRNLAFVPVLGDGSRPDFTVVIPNLAMKSAILNWCAASRVDRPTEPEYG
FT                   SVETLVRAAMGSDGDDRFETSEKELLRAVPGNPPVMFSHAATEVNHRPNHFYSSSSEES
FT                   VIAAVPATPLPLTTRPSCYSSFSSSSDEALSLAVTLDPISSEEEEILGKLKSSEVHEQE
FT                   EGLILLRTITRTKEDLRVSLCTPGVLSALRLLLNSRYGVVQTNAVASVVNLSLEKPNKA
FT                   KIVRSGIVPPLIDLLKGGLPESQEHAAGALFSLAIEDNNKTAIGVMGALPPLLHSLRSE
FT                   SERTRHDSALALYHLSLDQSNRVKLVKLGAIPTLLAMVKSGDLASRALLILCNMAASGD
FT                   GRSAMLDANAVDCLVGLLRGKELDSESTQENCVAVLYLLSHGSMRFKGLAREARAVEVL
FT                   REVEERGSGRAREKAKRMLQMMRGRDEEEEVDWEGVLESGALSQPRYRVGGAGKQHIHG
FT                   AYSTEF"
FT   5'UTR           complement(4399503..4399641)
FT                   /locus_tag="VIT_17s0000g07730"
FT                   /old_locus_tag="Vv17s0000g07730"
FT   gene            4403994..4410118
FT                   /locus_tag="VIT_17s0000g07720"
FT                   /old_locus_tag="Vv17s0000g07720"
FT   mRNA            join(4403994..4404121,4404122..4404166,4404543..4404682,
FT                   4405418..4405452,4405556..4405960,4406036..4406097,
FT                   4407484..4407564,4409031..4409093,4409732..4409785,
FT                   4409786..4410118)
FT                   /locus_tag="VIT_17s0000g07720"
FT                   /old_locus_tag="Vv17s0000g07720"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           4403994..4404121
FT                   /locus_tag="VIT_17s0000g07720"
FT                   /old_locus_tag="Vv17s0000g07720"
FT   CDS_pept        join(4404122..4404166,4404543..4404682,4405418..4405452,
FT                   4405556..4405960,4406036..4406097,4407484..4407564,
FT                   4409031..4409093,4409732..4409785)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07720"
FT                   /old_locus_tag="Vv17s0000g07720"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHX6"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHX6"
FT                   /protein_id="CBI15086.3"
FT                   /translation="MSRPQVTITLGRTGQVVKRAGNVPDGSRFDSLPSAGSKRSTRDGA
FT                   GGNAESSLYETQSKTKRHRGDRSVWSSNDARVGRNDLRFKLMQKNKFRRTRGDYEGRNH
FT                   TGLKRQLPRAVYPPVNMYTLQRMPESKVNGLLRRIPPTRSADDLLQLNSSRKSYSTWTH
FT                   NGLRCRSPDRILSASRGFSPPGNINDQQQVLTFRPIDSSRAAAYMATKQVSRLPPPNSI
FT                   AQKNSYLGVEPLTVASFLHSLGLGKYIILFQAEEIDMTALKQMRDNDLKELGIPMGPRK
FT                   KILLALSPHSKQV"
FT   3'UTR           4409786..4410118
FT                   /locus_tag="VIT_17s0000g07720"
FT                   /old_locus_tag="Vv17s0000g07720"
FT   gap             4411134..4411233
FT                   /estimated_length=100
FT   gene            complement(4413233..4413822)
FT                   /locus_tag="VIT_17s0000g07710"
FT                   /old_locus_tag="Vv17s0000g07710"
FT   mRNA            complement(join(4413233..4413262,4413263..4413540,
FT                   4413582..4413822))
FT                   /locus_tag="VIT_17s0000g07710"
FT                   /old_locus_tag="Vv17s0000g07710"
FT   3'UTR           complement(4413233..4413262)
FT                   /locus_tag="VIT_17s0000g07710"
FT                   /old_locus_tag="Vv17s0000g07710"
FT   CDS_pept        complement(join(4413263..4413540,4413582..4413822))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07710"
FT                   /old_locus_tag="Vv17s0000g07710"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHX7"
FT                   /protein_id="CBI15087.3"
FT                   /translation="MARNTLDFTLFFQPQHPTAIIMPSSSSLLLHLTLHHRHHYSLTIH
FT                   NLHYHHHHHHLYIEEEEEQEPPTPSATHPNKKRKERFTYEKINPSLFLSTEESSSPPPS
FT                   SEAPSTLSFLFSPGESSVSVRLFARSKQITACLRSFSAIGFLHFSLIKRNSLLNLVCLF
FT                   YLNFGVLSP"
FT   gene            4418730..4427276
FT                   /locus_tag="VIT_17s0000g07700"
FT                   /old_locus_tag="Vv17s0000g07700"
FT   mRNA            join(4418730..4418738,4418739..4418966,4419149..4419341,
FT                   4419751..4419860,4424349..4424427,4424529..4424596,
FT                   4426263..4426329,4426917..4427029,4427030..4427276)
FT                   /locus_tag="VIT_17s0000g07700"
FT                   /old_locus_tag="Vv17s0000g07700"
FT                   /product="Predicted protein"
FT   5'UTR           4418730..4418738
FT                   /locus_tag="VIT_17s0000g07700"
FT                   /old_locus_tag="Vv17s0000g07700"
FT   CDS_pept        join(4418739..4418966,4419149..4419341,4419751..4419860,
FT                   4424349..4424427,4424529..4424596,4426263..4426329,
FT                   4426917..4427029)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07700"
FT                   /old_locus_tag="Vv17s0000g07700"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHX8"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHX8"
FT                   /protein_id="CBI15088.3"
FT                   /translation="MLVWRGKVPGVSSPLSVGTFVKQVTTSISTRFRPHRIATKTLTTT
FT                   KVLNSSYFETLNPLQKQQISLYVDALLQWNQKMNLTAVTKADEVMERHVGDSLAMIPPI
FT                   QSSYIAHCDSSCNNISLVDVGSGPGLPGLILAIACPSWKITLLESMNKRCIFLEHAVSL
FT                   TGLSNVQVVRGRAENLGQNIGFREVFDVAVARAVAEMRILAEYCLPLVRVGGLFLAAKG
FT                   HDPQEEVRNAERAIQLMGASVLQLCSVESHSPFGQRTAIVCLKDCPTPRKYPRDPGTPV
FT                   KSPL"
FT   3'UTR           4427030..4427276
FT                   /locus_tag="VIT_17s0000g07700"
FT                   /old_locus_tag="Vv17s0000g07700"
FT   gene            complement(4429627..4430938)
FT                   /locus_tag="VIT_17s0000g07690"
FT                   /old_locus_tag="Vv17s0000g07690"
FT   mRNA            complement(join(4429627..4429717,4429718..4430938))
FT                   /locus_tag="VIT_17s0000g07690"
FT                   /old_locus_tag="Vv17s0000g07690"
FT                   /product="Predicted protein"
FT   3'UTR           complement(4429627..4429717)
FT                   /locus_tag="VIT_17s0000g07690"
FT                   /old_locus_tag="Vv17s0000g07690"
FT   CDS_pept        complement(4429718..4430938)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07690"
FT                   /old_locus_tag="Vv17s0000g07690"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSV3"
FT                   /protein_id="CCB43010.1"
FT                   /translation="MSAHQPSHSGDYSASQFFHVQSELISLSSQPSLPSVPSLTSQTQQ
FT                   QQLYLPSTTTTHHCVTTFKGHTSYVSSLALAGNFLFSGSSDKEIRLWEQNLNSELDHEN
FT                   ISNNVVAVGKGAVKSMVVLGDKLFSAHQDHKIRVWKINDQDPHHQKCTRLATLPTLGDR
FT                   AIKLLTPNNHVQIRRHKKCTWVHHVDTVSVLALSEDNSLLYSVSWDRSLKIWRTTDFKC
FT                   LESVGNAHDDAINALALSHDGYIYTGSADKTIKVWRKAPEDKKHSQVATLEKHNSGINA
FT                   LALSTDGSVLYSGASDRSIVVWEKDYSGNMVVVGALRGHSKSILCLAVVSDVVFSGSAD
FT                   NTIRIWRGIHKSYSCLAILEGHTGPVKCLTAATDCYNPSNTSTSYLVYSGSLDCDIKVW
FT                   QIFIPLL"
FT   gene            4440921..4455348
FT                   /locus_tag="VIT_17s0000g07680"
FT                   /old_locus_tag="Vv17s0000g07680"
FT   mRNA            join(4440921..4441138,4441139..4441360,4441709..4441785,
FT                   4442699..4442910,4443056..4443177,4443270..4443355,
FT                   4444084..4444178,4444766..4444847,4445511..4445617,
FT                   4445750..4445780,4448052..4448169,4448423..4448470,
FT                   4450206..4450325,4450893..4450947,4451079..4451109,
FT                   4451307..4451376,4452294..4452392,4453158..4453268,
FT                   4453489..4453733,4453892..4454129,4454206..4454284,
FT                   4455005..4455261,4455262..4455348)
FT                   /locus_tag="VIT_17s0000g07680"
FT                   /old_locus_tag="Vv17s0000g07680"
FT                   /product="Predicted protein"
FT   5'UTR           4440921..4441138
FT                   /locus_tag="VIT_17s0000g07680"
FT                   /old_locus_tag="Vv17s0000g07680"
FT   CDS_pept        join(4441139..4441360,4441709..4441785,4442699..4442910,
FT                   4443056..4443177,4443270..4443355,4444084..4444178,
FT                   4444766..4444847,4445511..4445617,4445750..4445780,
FT                   4448052..4448169,4448423..4448470,4450206..4450325,
FT                   4450893..4450947,4451079..4451109,4451307..4451376,
FT                   4452294..4452392,4453158..4453268,4453489..4453733,
FT                   4453892..4454129,4454206..4454284,4455005..4455261)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07680"
FT                   /old_locus_tag="Vv17s0000g07680"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR007781"
FT                   /db_xref="InterPro:IPR024240"
FT                   /db_xref="InterPro:IPR024732"
FT                   /db_xref="InterPro:IPR024733"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSV4"
FT                   /protein_id="CCB43011.1"
FT                   /translation="MASPFAAVSLSFFLFSFLSFAQSSTIGVTYISRLLEIQDRERAPP
FT                   SVQIAAAYGVLHRLLPSHSSSFEFGIVSKEQCGGDSCFMISNHPSSSGHGAPEILITGV
FT                   TGVEIMAGLHWYLKYWCGSHISWDKTGGAQLLSVPDSGSFPRVQEAGILIQRPIPWNYY
FT                   QNAVTSSYTFAWWDWKRWEKEIDWMALQGINLPLAFTGQEAIWQKVFRNFNISHLDLKD
FT                   FFGGPAFLSWSRMGNLHGWGGPLPQSWLDQQLLLQKKILARMYELGMTPVLPAFSGNVP
FT                   AALKYIFPSAKITRLGNWFTVGGNPRWCCTYLLDATDPLFIEIGKAFIQQQLKEYGRTG
FT                   HIYNCDTFDENTPPVDDPEYISSLGAAIFRGMQSGDSNAIWLMQGWLFSYDPFWRPPQM
FT                   KALLHSVPMGRLVVLDLFAEVKPIWITSEQFYGVPYIWKVTKSGRQQSLKFTNEKCCSF
FT                   FRSHSPDSEVLCMLHNFAGNIEMYGILDAVASGPVGVGMSMEGIEQNPVVYDLMSEMAF
FT                   QHSKVDVKVWIALYSTRRYGKSVPEIQDAWNILYHTVYNCTDGSYDKNRDVIVAFPDID
FT                   PSFIPTPKLSMPGGYHRYGKSVSRRTVLKEITNSFEQPHLWYSTSEVKDALGLFIASGG
FT                   QLLGSNTYRYDLVDLTRQALAKYANQLFLEVIEAYQLNDVRGAACHSQKFLELVEDMDT
FT                   LLACHDGFLLGPWLESAKQLAQDEQQEIQFEWNARTQITMWFDNTEDEASLLRDYGNKY
FT                   WSGLLRDYYGPRAAIYFKYLLESLETGNEFALKDWRREWIKLTNDWQNSRNAYPVRSSG
FT                   NAIDTSRRLYNKYLQDPEIYDL"
FT   3'UTR           4455262..4455348
FT                   /locus_tag="VIT_17s0000g07680"
FT                   /old_locus_tag="Vv17s0000g07680"
FT   gene            4455796..4472972
FT                   /locus_tag="VIT_17s0000g07670"
FT                   /old_locus_tag="Vv17s0000g07670"
FT   mRNA            join(4455796..4456242,4456243..4456252,4464960..4465102,
FT                   4465279..4465359,4465438..4465443,4465552..4465586,
FT                   4472520..4472612,4472697..4472745,4472746..4472801,
FT                   4472934..4472972)
FT                   /locus_tag="VIT_17s0000g07670"
FT                   /old_locus_tag="Vv17s0000g07670"
FT                   /product="putative betaine-aldehyde dehydrogenase"
FT   5'UTR           4455796..4456242
FT                   /locus_tag="VIT_17s0000g07670"
FT                   /old_locus_tag="Vv17s0000g07670"
FT   CDS_pept        join(4456243..4456252,4464960..4465102,4465279..4465359,
FT                   4465438..4465443,4465552..4465586,4472520..4472612,
FT                   4472697..4472745)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07670"
FT                   /old_locus_tag="Vv17s0000g07670"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSV5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSV5"
FT                   /protein_id="CCB43012.1"
FT                   /translation="MILWDIPAATGEDVELAVDAARRAFARNKEANWVNAPGVVRAKYL
FT                   RAIAAKIRERKSELAKLEAIDSGKPLDETTWDIDDEPVGVVGLITPWNYPLLLATWKVA
FT                   PALAAGCAAILKPSELASVTCLELADVCIEVGLP"
FT   3'UTR           join(4472746..4472801,4472934..4472972)
FT                   /locus_tag="VIT_17s0000g07670"
FT                   /old_locus_tag="Vv17s0000g07670"
FT   gene            4472973..4479921
FT                   /locus_tag="VIT_17s0000g07660"
FT                   /old_locus_tag="Vv17s0000g07660"
FT   mRNA            join(4472973..4472999,4473127..4473193,4473372..4473448,
FT                   4474223..4474336,4475059..4475136,4475219..4475370,
FT                   4475483..4475543,4479349..4479455,4479824..4479890,
FT                   4479891..4479921)
FT                   /locus_tag="VIT_17s0000g07660"
FT                   /old_locus_tag="Vv17s0000g07660"
FT                   /product="Betaine aldehyde dehydrogenase"
FT   CDS_pept        join(4472973..4472999,4473127..4473193,4473372..4473448,
FT                   4474223..4474336,4475059..4475136,4475219..4475370,
FT                   4475483..4475543,4479349..4479455,4479824..4479890)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07660"
FT                   /old_locus_tag="Vv17s0000g07660"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHY2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHY2"
FT                   /protein_id="CBI15092.3"
FT                   /translation="MTAAAQLVKPVSLELGGKSSILVFEDVDLDKAAEWTAFGCFWTNG
FT                   QICSATSRLLVQESTAAEFLDKLVKWTKNIKISDPLEEGCKLGPVVSRGQYEKLSEFIS
FT                   TATSEDGTVLCGGGCPQHLKRGFFIEPTIISDVTTSMQIWREEVFGPVLCVKTLSTEDE
FT                   AIELANDSSYALAGAVISDDLERCDRVSKALNAGIVWVNCSQPCFYQAPWGGNKRSGFG
FT                   RELGPWGLDNYLNVKQVTQYISSEPWG"
FT   3'UTR           4479891..4479921
FT                   /locus_tag="VIT_17s0000g07660"
FT                   /old_locus_tag="Vv17s0000g07660"
FT   gene            4481352..4487644
FT                   /locus_tag="VIT_17s0000g07650"
FT                   /old_locus_tag="Vv17s0000g07650"
FT   mRNA            join(4481352..4481371,4481372..4481480,4481956..4482098,
FT                   4482311..4482391,4482475..4482623,4483458..4483550,
FT                   4483636..4483759,4483869..4483934,4484111..4484177,
FT                   4484340..4484416,4485398..4485511,4486240..4486317,
FT                   4486401..4486552,4486664..4486724,4486853..4486959,
FT                   4487335..4487425,4487426..4487644)
FT                   /locus_tag="VIT_17s0000g07650"
FT                   /old_locus_tag="Vv17s0000g07650"
FT                   /product="Betaine-aldehyde dehydrogenase"
FT   5'UTR           4481352..4481371
FT                   /locus_tag="VIT_17s0000g07650"
FT                   /old_locus_tag="Vv17s0000g07650"
FT   CDS_pept        join(4481372..4481480,4481956..4482098,4482311..4482391,
FT                   4482475..4482623,4483458..4483550,4483636..4483759,
FT                   4483869..4483934,4484111..4484177,4484340..4484416,
FT                   4485398..4485511,4486240..4486317,4486401..4486552,
FT                   4486664..4486724,4486853..4486959,4487335..4487425)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07650"
FT                   /old_locus_tag="Vv17s0000g07650"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHY3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHY3"
FT                   /protein_id="CBI15093.3"
FT                   /translation="METKIPCRQLFIDGKWVEPITKRRIPVINPATEQTIGLIPAATGE
FT                   DVELAVDAARRAFARNKGADWAKAPGAVRAKYLRAIAAKITERKTELAKLEALDCGKPL
FT                   DEAAWDIDDVASCFEYFADHAEALDAQQKAPLSLPMETFKCHILKEPVGVVGLITPWNY
FT                   PLLMATWKVAPALAAGCTAILKPSELASVTCLELADVCIEVGLPPGVLNILTGLGSEAG
FT                   APLSSHPHVDKIAFTGSTVTGSKIMTAAAQLVKPVSLELGGKSPILVFEDVDLDKAAEW
FT                   TAFGCFWTNGQICSATSRLLVHESIAAEFLDKLVKWTKNIKISDPFEEGCRLGPVVSRE
FT                   QYEKILKLVSTAKSEGATILCGGGRPQHLKMGFYIEPTIISDVTTSMQIWREEVFGPVL
FT                   CVKTFSSEDEAIELANDTQYGLAGAVISNDLERCERVSKALNAGIVWINCSQPCFCQAP
FT                   WGGNKRSGFGRELGPRGLDNYLSVKQVTQYLSNEPWGWYQSPSKL"
FT   3'UTR           4487426..4487644
FT                   /locus_tag="VIT_17s0000g07650"
FT                   /old_locus_tag="Vv17s0000g07650"
FT   gene            4492704..4497509
FT                   /locus_tag="VIT_17s0000g07640"
FT                   /old_locus_tag="Vv17s0000g07640"
FT   mRNA            join(4492704..4492826,4492827..4492884,4493326..4493423,
FT                   4493509..4493609,4493723..4493801,4494008..4494068,
FT                   4494275..4494321,4494415..4494507,4494622..4494712,
FT                   4495402..4495450,4496249..4496365,4496464..4496611,
FT                   4496748..4496840,4496920..4496988,4497124..4497166,
FT                   4497282..4497382,4497383..4497509)
FT                   /locus_tag="VIT_17s0000g07640"
FT                   /old_locus_tag="Vv17s0000g07640"
FT                   /product="unknown predicted protein"
FT   5'UTR           4492704..4492826
FT                   /locus_tag="VIT_17s0000g07640"
FT                   /old_locus_tag="Vv17s0000g07640"
FT   CDS_pept        join(4492827..4492884,4493326..4493423,4493509..4493609,
FT                   4493723..4493801,4494008..4494068,4494275..4494321,
FT                   4494415..4494507,4494622..4494712,4495402..4495450,
FT                   4496249..4496365,4496464..4496611,4496748..4496840,
FT                   4496920..4496988,4497124..4497166,4497282..4497382)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07640"
FT                   /old_locus_tag="Vv17s0000g07640"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHY4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHY4"
FT                   /protein_id="CBI15094.3"
FT                   /translation="MGSSEERVVAVIMVGGPTKGTRFRPLSLNTPKPLFPLAGQPMVHH
FT                   PISGCKRIPNLAQIYLVGFYEEREFALYVSSISSELRVPVRYLKEDKPHGSAGGLYNFR
FT                   DLIMEDNPSHIVLLNCDVCCSFPLPEMLEAHIRYGGMGTILVIKVSAESASQFGELVAD
FT                   PVTNELLHYTEKPETFVSDLINCGVYIFTPDIFTAIQGVSTQRKERADLRRLSSFEALQ
FT                   SATRSLPKDFVRLDQDILSPLAGKKQLYTYETMGFWEQIKTPGMSLKCSALYLSQYQFT
FT                   FPNLLASGDGTKSATIIGNVYIHPSAKVHPTAKIGPNVSISANARIGAGVRLISCVILD
FT                   DVEIKENAVVIHAIVGWKSSVGKWSRVQAGGDYNAKLGITILGEAVAVEDEVVVVNSIV
FT                   LPNKTLNVSVQEEIIL"
FT   3'UTR           4497383..4497509
FT                   /locus_tag="VIT_17s0000g07640"
FT                   /old_locus_tag="Vv17s0000g07640"
FT   gene            complement(4498741..4502149)
FT                   /locus_tag="VIT_17s0000g07630"
FT                   /old_locus_tag="Vv17s0000g07630"
FT   mRNA            complement(join(4498741..4498829,4499806..4500199,
FT                   4500393..4500454,4500543..4500615,4500708..4500803,
FT                   4501078..4501145,4501255..4501312,4501393..4501470,
FT                   4501721..4501773,4501853..4501920,4502058..4502149))
FT                   /locus_tag="VIT_17s0000g07630"
FT                   /old_locus_tag="Vv17s0000g07630"
FT                   /product="unknown predicted protein"
FT   CDS_pept        complement(join(4498741..4498829,4499806..4500199,
FT                   4500393..4500454,4500543..4500615,4500708..4500803,
FT                   4501078..4501145,4501255..4501312,4501393..4501470,
FT                   4501721..4501773,4501853..4501920,4502058..4502149))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07630"
FT                   /old_locus_tag="Vv17s0000g07630"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSX2"
FT                   /db_xref="InterPro:IPR003316"
FT                   /db_xref="InterPro:IPR015633"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSX2"
FT                   /protein_id="CCB43013.1"
FT                   /translation="MTLSSSTIQESASHHRTYSRKQKSLGLLCSNFLSLYNRDGVEPIG
FT                   LDDAASRLGVERRRIYDIVNVLESVGVLARKAKNQYSWKGFGAIPKALEELREEGLREN
FT                   FHTFDSNNSAKVDDEDERFSNPNTGSQQDKSNPSSKLNLNVFFTDNRREKSLGLLTQNF
FT                   VKLFLCSNVDLISLEEAARILLGDGQNSSIMRTKVRRLYDIANVLSSMNLIEKTNQTEN
FT                   RKPAFRWLGMRGKSENGSLSVLNLNESKKRTFGTEITNISFKRNKMASSVEGNSNQNTK
FT                   MQWQMQVKHENLENGIERSDFEKGPKQSSKSYQFGPFAPVSVQDTVRQVRDWESLASTY
FT                   RPQYHSQALRDLFAHYMEAWKTWYSEVAGKEPIQIS"
FT   gene            complement(4504164..4505982)
FT                   /locus_tag="VIT_17s0000g07620"
FT                   /old_locus_tag="Vv17s0000g07620"
FT   mRNA            complement(join(4504164..4504526,4504527..4505257,
FT                   4505385..4505982))
FT                   /locus_tag="VIT_17s0000g07620"
FT                   /old_locus_tag="Vv17s0000g07620"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(4504164..4504526)
FT                   /locus_tag="VIT_17s0000g07620"
FT                   /old_locus_tag="Vv17s0000g07620"
FT   CDS_pept        complement(join(4504527..4505257,4505385..4505982))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07620"
FT                   /old_locus_tag="Vv17s0000g07620"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSX3"
FT                   /protein_id="CCB43014.1"
FT                   /translation="MLILANRLSSLRPTEPLLKPISYNYNLTTTTSPPSPPQDATIVNL
FT                   VLKTDSQTLTRTLEKYPVEWTPNLVDRVLKLLWNHGPKALQFFKSLDYHPTYAHVSSSF
FT                   DHAIDIAGRLRDYKTLWTLVDRMRTRRLGPNPKTFAIITERYVSAGKPDRAIKIFFSMH
FT                   EHGCVQDLNSFNTILDVLCKSKRVEMADNKLFKVFRGFFRAGQLKEAWEFFLQMKKRKC
FT                   EIDVVTYTTVVHGFGVAGEVRKAQRVFNEMIGEGVLPSVATYNAFIQVLCKKDNVENAI
FT                   SVFEEMLRKGYMPNSTTYNVVIRGLCHVGRMEKAMEFMARMKDDECEPNVQIYNVVIRY
FT                   FCDAEEIEKGLNVFEKMGDADCLPNLDTYNILISAMFVRKKSDYLLTAGKLLIEMVERG
FT                   FLPRKFTFNRVLDGLLLTGNQDFAKEILRLQSRCGRLPRRLKL"
FT   gap             4505271..4505370
FT                   /estimated_length=100
FT   gene            complement(4509458..4512140)
FT                   /locus_tag="VIT_17s0000g07610"
FT                   /old_locus_tag="Vv17s0000g07610"
FT   mRNA            complement(join(4509458..4509903,4509904..4510057,
FT                   4511833..4511921,4512053..4512076,4512077..4512140))
FT                   /locus_tag="VIT_17s0000g07610"
FT                   /old_locus_tag="Vv17s0000g07610"
FT                   /product="B12D-like protein"
FT   3'UTR           complement(4509458..4509903)
FT                   /locus_tag="VIT_17s0000g07610"
FT                   /old_locus_tag="Vv17s0000g07610"
FT   CDS_pept        complement(join(4509904..4510057,4511833..4511921,
FT                   4512053..4512076))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07610"
FT                   /old_locus_tag="Vv17s0000g07610"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHY6"
FT                   /db_xref="InterPro:IPR010530"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHY6"
FT                   /protein_id="CBI15096.3"
FT                   /translation="MNRWLRPEVYPLFAAMGVAVGICGFQLVRNICINPDVRVSKENRA
FT                   AGVLENFTEGQKYSEHFLRKYVRNKSPEIMPSINSFFSDPEKN"
FT   5'UTR           complement(4512077..4512140)
FT                   /locus_tag="VIT_17s0000g07610"
FT                   /old_locus_tag="Vv17s0000g07610"
FT   gene            complement(4513621..4518442)
FT                   /locus_tag="VIT_17s0000g07600"
FT                   /old_locus_tag="Vv17s0000g07600"
FT   mRNA            complement(join(4513621..4513995,4513996..4514046,
FT                   4514120..4514278,4514410..4514474,4516092..4516181,
FT                   4516462..4516513,4517788..4518435,4518436..4518442))
FT                   /locus_tag="VIT_17s0000g07600"
FT                   /old_locus_tag="Vv17s0000g07600"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(4513621..4513995)
FT                   /locus_tag="VIT_17s0000g07600"
FT                   /old_locus_tag="Vv17s0000g07600"
FT   CDS_pept        complement(join(4513996..4514046,4514120..4514278,
FT                   4514410..4514474,4516092..4516181,4516462..4516513,
FT                   4517788..4518435))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07600"
FT                   /old_locus_tag="Vv17s0000g07600"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSX4"
FT                   /db_xref="InterPro:IPR034604"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSX4"
FT                   /protein_id="CCB43015.1"
FT                   /translation="MEEEKAAAYYDELTRKGEGAARFKQGLGFSSQSSTSTAPSKTRSF
FT                   LSNFVRASSPTKASQLEKQAQLESIQNKLKKKPKSCEENSSKFSDRSERDSRVSDRNDK
FT                   VSRDRDRHSSRRSRSRERRSRSRDRRSRSRDRRSRYRSSSRDRKRRSRDGDRDSDGDRQ
FT                   RRRRGGSDEVGGRRRDRGRSRSSSPRERRLVKVGKEKNGGVDYARLIDGYDKMTPAERV
FT                   KAKMKLQLSETAEKDATKGMGSGWERFEFNKDAPLDDEEIEAAEDDAMLVKHVGQSFRF
FT                   SAVETRREEQIKAAHDEAIFGGSTIPPSNFSDNEPEVENDTKESNESSLGTSLISEKVL
FT                   AKQQGSWRDRARRV"
FT   5'UTR           complement(4518436..4518442)
FT                   /locus_tag="VIT_17s0000g07600"
FT                   /old_locus_tag="Vv17s0000g07600"
FT   gene            4535886..4538560
FT                   /locus_tag="VIT_17s0000g07580"
FT                   /old_locus_tag="Vv17s0000g07580"
FT   mRNA            join(4535886..4536043,4536044..4536314,4536421..4536497,
FT                   4536727..4536804,4537114..4537184,4538076..4538355,
FT                   4538356..4538560)
FT                   /locus_tag="VIT_17s0000g07580"
FT                   /old_locus_tag="Vv17s0000g07580"
FT                   /product="unknown predicted protein"
FT   5'UTR           4535886..4536043
FT                   /locus_tag="VIT_17s0000g07580"
FT                   /old_locus_tag="Vv17s0000g07580"
FT   CDS_pept        join(4536044..4536314,4536421..4536497,4536727..4536804,
FT                   4537114..4537184,4538076..4538355)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07580"
FT                   /old_locus_tag="Vv17s0000g07580"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSX5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSX5"
FT                   /protein_id="CCB43016.1"
FT                   /translation="MFSSIAHNLHYKSLPLHSVPPPLYKYWKQIPRTFLVMGSAAGEFL
FT                   RHVLPEKVGVSDHSAAGSELHVLAVDDSHVDRKVIERLLKISSCKVTAVESGTRALQFL
FT                   GLDGEENSVGFDGLKVNLIMTDYSMPGMTGYELLKKIKESKAFRKIPVVIMSSENILTR
FT                   IDRCLEEGAEEFIVKPVKLADVRRLRDFIMRGEEEGEENRKKGNHKRKLQDDYSISPPL
FT                   SPAPSLDCEISSLLLPSSSSSSPECPSKRPRLWVED"
FT   3'UTR           4538356..4538560
FT                   /locus_tag="VIT_17s0000g07580"
FT                   /old_locus_tag="Vv17s0000g07580"
FT   gene            4540219..4542910
FT                   /locus_tag="VIT_17s0000g07570"
FT                   /old_locus_tag="Vv17s0000g07570"
FT   mRNA            join(4540219..4541447,4541548..4542289,4542332..4542910)
FT                   /locus_tag="VIT_17s0000g07570"
FT                   /old_locus_tag="Vv17s0000g07570"
FT                   /product="Predicted protein"
FT   CDS_pept        join(4540219..4541447,4541548..4542289,4542332..4542910)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07570"
FT                   /old_locus_tag="Vv17s0000g07570"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR015425"
FT                   /db_xref="InterPro:IPR042201"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSX6"
FT                   /protein_id="CCB43017.1"
FT                   /translation="MNGRKALGELDNPNQPQPPSLKRSATKIQNTEGRRILLPLQPKPT
FT                   NFFYSLCDSIFSEFMGVKGHPWILPSLLCFSLLCLPCFSQPSSSPASSIPSSPNNSPIS
FT                   PQIPGAASHGKVGEVAGATAASAVVVAGVFFCFRKFVARQRQRDKNESSFRREEAEVMH
FT                   EEFKHRGTLKGLIVDDNGVEVLYLRKLEGGQLRNSFSKVLNNPNEEERGKIVESMVDRP
FT                   RKSKRIQEIPFLHESSDVIILEKEAKPVLKVPTLQPQVSVPSPPPPPPPVPSQPLPPPP
FT                   QVIPIKKTPNPHSPPLPPNKKIPGPPPPPPPPPERKIPGPPPLPPIPTRRKPAAPPPPP
FT                   KAGGLVSALKPPPVPRGKMNSNNRAEASTEGSSKGTDFGQMKLKPLHWDKVIANVDHSI
FT                   VWDEINDGSFRFDDELMESLFGYTANQKPPEMNNKPVTSSSSNSALPTQIFILEPRKSQ
FT                   NTAIVLRSLAVSRREILDALLEGQGLTTDTLEKLTKISPTQEEESKILQFNGNPTKLAD
FT                   AESFLYHILKVVPSAFMRFNAMLFRTNYDPEILHLKESLQTLELACKELRSRGLFLKLL
FT                   EAILKAGNRMNAGTARGNAQGFNLSALRRLSDVKSIDGKTTLLHFVVEQVVRSEGRRCA
FT                   INQNDSLDRSNSQRGKNSDPNSNEKEKENKKEKEYLMLGLPVLGGLSTEFYNVKKAAVI
FT                   DHDTFINMCSTLTARVAEIQLLVASCSNGEKGRFVQEMKGFLEECEEELKVVRVEQTRV
FT                   MELVKRTTEYYQAGASKDKGGQPLQLFLIVKDFLDMVDQACQDIYRRLQKKNVTKTVGS
FT                   SPPLSPTRQAVRFTNLQLQFMSDMCRTTSSSDSEDDF"
FT   gene            4545707..4547886
FT                   /locus_tag="VIT_17s0000g07560"
FT                   /old_locus_tag="Vv17s0000g07560"
FT   mRNA            join(4545707..4545740,4545741..4546058,4546136..4546882,
FT                   4546993..4547718,4547719..4547886)
FT                   /locus_tag="VIT_17s0000g07560"
FT                   /old_locus_tag="Vv17s0000g07560"
FT                   /product="EDS1"
FT   5'UTR           4545707..4545740
FT                   /locus_tag="VIT_17s0000g07560"
FT                   /old_locus_tag="Vv17s0000g07560"
FT   CDS_pept        join(4545741..4546058,4546136..4546882,4546993..4547718)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07560"
FT                   /old_locus_tag="Vv17s0000g07560"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSX7"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR041266"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSX7"
FT                   /protein_id="CCB43018.1"
FT                   /translation="MGETLGNRIRLSEEIVNRAASQAMRAHNSAGRPFLLDKTRGFAIF
FT                   AFAGSWLPDDWFTHPPFGETKMDASTFPSLRSVGNDEVAVVNASFLRRFKAILDQLPLE
FT                   REVQKVIADRRQVVFTGHSWGGAMAILATLYFLEKAGPNQNPPRCITFGSPLVGDRIFG
FT                   HAVRREKWSDHFIHFVMRFDVIPRIMLGPASTEHQQILNFFNPRSQFYREPLDPPLGFY
FT                   LNVMRSASSVAIHDACILMGCTNPLLETLRNFTELSPYRPFGTYIFCTGNGKLVVLKNP
FT                   DAVLQILFYCAQLSQEEAAEIAQRSLHEHLAYENELQESLGMQNVVYLDSLEDLPLSSN
FT                   GGPATVNIALNDLGLSPQARLCLRAAGGFENRRLRNQVKIDDNKQKINDELRKLKDYQE
FT                   KAETRKLGYYDAFKHQEEKADFDANVSRLVLAGIWDEIIEMLRRYELPDEFENRKELIE
FT                   LATIYRRIVEPLDIANYYRHLKNEDTGTYVTRGRPKRYRYTQRWLEHAENKPSGSRSES
FT                   CFWAELEELCIQTSGNGSLQDTKQKIQQLQKNVIEWIHEGSLGKDVLLEDSTFVKWWKT
FT                   LPFEYKSDPESSRIANLIHG"
FT   3'UTR           4547719..4547886
FT                   /locus_tag="VIT_17s0000g07560"
FT                   /old_locus_tag="Vv17s0000g07560"
FT   gene            complement(4558347..4560160)
FT                   /locus_tag="VIT_17s0000g07550"
FT                   /old_locus_tag="Vv17s0000g07550"
FT   mRNA            complement(join(4558347..4558689,4558690..4559603,
FT                   4559717..4559783,4559946..4560011,4560012..4560160))
FT                   /locus_tag="VIT_17s0000g07550"
FT                   /old_locus_tag="Vv17s0000g07550"
FT                   /product="putative anti-virus transcriptional factor"
FT   3'UTR           complement(4558347..4558689)
FT                   /locus_tag="VIT_17s0000g07550"
FT                   /old_locus_tag="Vv17s0000g07550"
FT   CDS_pept        complement(join(4558690..4559603,4559717..4559783,
FT                   4559946..4560011))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07550"
FT                   /old_locus_tag="Vv17s0000g07550"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSX8"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR039515"
FT                   /db_xref="InterPro:IPR039780"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSX8"
FT                   /protein_id="CCB43019.1"
FT                   /translation="MITDSITSAAASISKEFGKKKRTNRTAKLKQCKLDARREQWLSKV
FT                   KNNGCRGESEGIPESSMHKRNESNESNRSLENLEVRPRGGENDGSVHHDSDSESPANSP
FT                   TSHISSILGSTDSGTNYHASSSSSSSSGGCCSGSITEEEEEEGNDECLDDWEAVADALA
FT                   AVDKQKIPVQEGHVEQESHVEQKPVVRSGSPGGISKDTGLGIEIHKPEHVGMVPRAPAN
FT                   GQAWRADDAFRPQSLPNLSKQHSFPMNSDRHYGHGGVPWARSSVAAIPISCPICYEDLD
FT                   FTDSSFLPCSCGFRLCLFCHKRILEEDGRCPGCRKPYDCDPVEAEAIVNGGSLTFRLGR
FT                   SYSMIARS"
FT   5'UTR           complement(4560012..4560160)
FT                   /locus_tag="VIT_17s0000g07550"
FT                   /old_locus_tag="Vv17s0000g07550"
FT   gene            complement(4565370..4573089)
FT                   /locus_tag="VIT_17s0000g07540"
FT                   /old_locus_tag="Vv17s0000g07540"
FT   mRNA            complement(join(4565370..4565471,4565906..4565998,
FT                   4566077..4566260,4572725..4572871,4572975..4573009,
FT                   4573010..4573089))
FT                   /locus_tag="VIT_17s0000g07540"
FT                   /old_locus_tag="Vv17s0000g07540"
FT                   /product="Paired amphipathic helix repeat-containing
FT                   protein"
FT   CDS_pept        complement(join(4565370..4565471,4565906..4565998,
FT                   4566077..4566260,4572725..4572871,4572975..4573009))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07540"
FT                   /old_locus_tag="Vv17s0000g07540"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHZ1"
FT                   /db_xref="InterPro:IPR003822"
FT                   /db_xref="InterPro:IPR036600"
FT                   /db_xref="InterPro:IPR039774"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHZ1"
FT                   /protein_id="CBI15101.3"
FT                   /translation="MADPYQPSPSSQSVSRARPEGKRTIEQGVEYLKFVRDTFGSRNDS
FT                   RYRGFLRVMKDYKGGIFDTLEVISLVKEMFEGHHELLTGFNILLPRGYSINSVAPTKDP
FT                   PTALEARVEAVNLVNKIRTRLQDDKLYRSLVDVMCKYGRNPRVNILLKEGLLGTCCGCH
FT                   HLNLFTSQKCRNLWNLENKTREQ"
FT   5'UTR           complement(4573010..4573089)
FT                   /locus_tag="VIT_17s0000g07540"
FT                   /old_locus_tag="Vv17s0000g07540"
FT   gene            4584405..4635654
FT                   /locus_tag="VIT_17s0000g07530"
FT                   /old_locus_tag="Vv17s0000g07530"
FT   mRNA            join(4584405..4584407,4584408..4584530,4594940..4595017,
FT                   4595254..4595316,4597102..4597149,4597251..4597397,
FT                   4607133..4607264,4610502..4610542,4611501..4611592,
FT                   4613963..4614090,4615764..4615839,4616033..4616153,
FT                   4616235..4616334,4616673..4616754,4618968..4619050,
FT                   4622699..4622818,4623430..4623481,4623777..4623932,
FT                   4632507..4632630,4632735..4632816,4632897..4632985,
FT                   4633069..4633143,4633242..4633296,4633826..4633945,
FT                   4634030..4634122,4634216..4634361,4635041..4635218,
FT                   4635332..4635610,4635611..4635654)
FT                   /locus_tag="VIT_17s0000g07530"
FT                   /old_locus_tag="Vv17s0000g07530"
FT                   /product="unknown predicted protein"
FT   5'UTR           4584405..4584407
FT                   /locus_tag="VIT_17s0000g07530"
FT                   /old_locus_tag="Vv17s0000g07530"
FT   CDS_pept        join(4584408..4584530,4594940..4595017,4595254..4595316,
FT                   4597102..4597149,4597251..4597397,4607133..4607264,
FT                   4610502..4610542,4611501..4611592,4613963..4614090,
FT                   4615764..4615839,4616033..4616153,4616235..4616334,
FT                   4616673..4616754,4618968..4619050,4622699..4622818,
FT                   4623430..4623481,4623777..4623932,4632507..4632630,
FT                   4632735..4632816,4632897..4632985,4633069..4633143,
FT                   4633242..4633296,4633826..4633945,4634030..4634122,
FT                   4634216..4634361,4635041..4635218,4635332..4635610)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07530"
FT                   /old_locus_tag="Vv17s0000g07530"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHZ2"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013598"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHZ2"
FT                   /protein_id="CBI15102.3"
FT                   /translation="MELQNTVKEALNALYHHPDDSVRMQADRWLQDFQRTIDAWQVSDN
FT                   LLHDATSNLETLIFCSQTLRSKVQRDFEELPSEAFRPLRDSLNTLLKKFHKGPPKVRTQ
FT                   ISIAVAALAVHVPAEDWGDGGIVKWLRDEMNSHPEFIPGFLELLMVLPEEVFNYKIAAR
FT                   PERRRQFEKELTSEMEVALNILTACLNINELKEQVLEAFASWLRLRHGIPGAVLASHPL
FT                   VLTALSSLNSELLSEASVNVVSELIHYTTAGSSGGASVQIPLIQVIVPQVMNLKVQLRD
FT                   SSKDEEDVKAIGRLFADMGDSYVELIATGSDESMLIVHALLEVASHPEYDIASMTFNFW
FT                   HNLQVNLTKRDAYLSFGNEASIEAERNRRLQVFRSSYESLVSLVSSRVRYPEDYQDLSY
FT                   EDLKDFKQTRYAVADVLIDAASVLGGEATLKILYMKLVEAVASCGNEEHNEWRPAEAAL
FT                   YCIRAISNYVSVVEAEVMPQVMNMLPKLPHQPQLLQTVCLTIGAYSKWLDAAPGGLSIF
FT                   PSVIDILMSGMSISEDSAAAAALAFKHICDDCRKKLCGSLDGLFHIYHRAVNGEGNFKV
FT                   PAEDSLHLVEALSMVITELPPDHAKKALEALCLPVVTSLQEVVNQGPEILDKKVAREFT
FT                   VHIDRFAYIFRYVNHPEAVADAIQRLWPIFKAIFDVRAWDMRTMESLCRACKYAVRTSG
FT                   RFMGITIGAMLEEIQGLYQLHHQPCFLYLSSEVIKIFGSDPSCANYLKNLIEALFSHTT
FT                   CLLKNIREFTARPDIADDCFLLASRCIRYCPQLFIPSAVFPSLVDCSMIGVTVQHREAS
FT                   NSILTFLSDIFDLAKTSPGEQYQSIRDTVIIPRGASITRILIACLTGALPSSRLETVTY
FT                   ALLALTRAYGMKAVEWAKDCISLVPLTAVTEVERTRFLQTLSNVATGADINTLTVSMEE
FT                   LSDVCRRNRTVQEIVQGALRPHELNLAPVS"
FT   gap             4630262..4630361
FT                   /estimated_length=100
FT   3'UTR           4635611..4635654
FT                   /locus_tag="VIT_17s0000g07530"
FT                   /old_locus_tag="Vv17s0000g07530"
FT   gene            4637984..4642702
FT                   /locus_tag="VIT_17s0000g07520"
FT                   /old_locus_tag="Vv17s0000g07520"
FT   mRNA            join(4637984..4638099,4638100..4638690,4640359..4640441,
FT                   4640532..4640652,4640772..4640945,4642130..4642237,
FT                   4642323..4642604,4642605..4642702)
FT                   /locus_tag="VIT_17s0000g07520"
FT                   /old_locus_tag="Vv17s0000g07520"
FT                   /product="Predicted protein"
FT   5'UTR           4637984..4638099
FT                   /locus_tag="VIT_17s0000g07520"
FT                   /old_locus_tag="Vv17s0000g07520"
FT   CDS_pept        join(4638100..4638690,4640359..4640441,4640532..4640652,
FT                   4640772..4640945,4642130..4642237,4642323..4642604)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07520"
FT                   /old_locus_tag="Vv17s0000g07520"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSX9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSX9"
FT                   /protein_id="CCB43020.1"
FT                   /translation="MIPSTPHKKTLHSILASKLKLTIPSPSSPDSLDFSDVFGPLTPHH
FT                   HKASPSSSSPSSSSPCVALGDPQVIHNRSHSLLGPSPRFAVTAPLLPFKEDMVFQSEGS
FT                   DKEGGDEVGEGRVGPGDFEIMRVVGKGAFGKVFQVRKKGGPEISGDSDGIFAMKVMRKD
FT                   TIISKNHMDYMKAERDILIKVEHPFIVSLRCSFQTNSKLYLIMDFVNGGHLFFHLYRQG
FT                   IFSEDQARVYIAEIVSAVSHLHKSGIVHRDLKPENILMDADGHVMLTDFGLAKEIDESS
FT                   RSNSMCGTTEYMAPEILLSKGHNKDADWWSIGILLYEMLTGQPPFTHANRQKLQQRIIK
FT                   EKVKLPSYLSSEAHSLLKGLLQKEPSRRLGSGPTGGDEIQNHKWFRSINWKKLEARELQ
FT                   PKFKPDVSGKDCTANFDQCWTAMPLDDSPAPTPTAGGHFQGYTYVAPNPWLSS"
FT   3'UTR           4642605..4642702
FT                   /locus_tag="VIT_17s0000g07520"
FT                   /old_locus_tag="Vv17s0000g07520"
FT   gene            complement(4645824..4647536)
FT                   /locus_tag="VIT_17s0000g07510"
FT                   /old_locus_tag="Vv17s0000g07510"
FT   mRNA            complement(join(4645824..4646046,4646047..4646472,
FT                   4646658..4646866,4647202..4647484,4647485..4647536))
FT                   /locus_tag="VIT_17s0000g07510"
FT                   /old_locus_tag="Vv17s0000g07510"
FT                   /product="MYB transcription factor 2"
FT   3'UTR           complement(4645824..4646046)
FT                   /locus_tag="VIT_17s0000g07510"
FT                   /old_locus_tag="Vv17s0000g07510"
FT   CDS_pept        complement(join(4646047..4646472,4646658..4646866,
FT                   4647202..4647484))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07510"
FT                   /old_locus_tag="Vv17s0000g07510"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5C7A7"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:A5C7A7"
FT                   /protein_id="CCB43021.1"
FT                   /translation="MSRCCSQCGHNGHNSRTCAESGGGGGGGDGGSEGIMLFGVRVTVD
FT                   SMRKSVSLNNLSQYEQPHESSNADATPAAGYVSADDVAHHSSGNRERKRGVPWTEEEHK
FT                   LFLVGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRNNLNRRRRRSSLFDITTE
FT                   SVTAVPMEEEQVLHHQENTSQSQQSPKTFSETGSGGGFPVVPAFPMPINPVVVPVPIQN
FT                   PMENLTLGQNDVNTRLVRPIPVLPIPPESTDLNLNLKSSVDPSPLSLKLSLSSNQNHPN
FT                   QPSRHSAFQAMSSFNNGDSIISVA"
FT   5'UTR           complement(4647485..4647536)
FT                   /locus_tag="VIT_17s0000g07510"
FT                   /old_locus_tag="Vv17s0000g07510"
FT   gene            complement(4654556..4661196)
FT                   /locus_tag="VIT_17s0000g07500"
FT                   /old_locus_tag="Vv17s0000g07500"
FT   mRNA            complement(join(4654556..4654970,4654971..4655307,
FT                   4655981..4656088,4656164..4656478,4659347..4661196))
FT                   /locus_tag="VIT_17s0000g07500"
FT                   /old_locus_tag="Vv17s0000g07500"
FT                   /product="Predicted protein"
FT   3'UTR           complement(4654556..4654970)
FT                   /locus_tag="VIT_17s0000g07500"
FT                   /old_locus_tag="Vv17s0000g07500"
FT   CDS_pept        complement(join(4654971..4655307,4655981..4656088,
FT                   4656164..4656478,4659347..4661196))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07500"
FT                   /old_locus_tag="Vv17s0000g07500"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSY1"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSY1"
FT                   /protein_id="CCB43022.1"
FT                   /translation="MNLSPSLLISSSTSATLLRPSHVNLRPNPNLNRHLFPAKATDFFG
FT                   YQRILASAARIRAKPKELVLGNPSVTVEKGKYSYDVETLINKLSSLPPRGSIARCLDVF
FT                   KNKLSLNDFALVFKEFAQRGDWQRSLRLFKYMQRQIWCKPNEHIYTIMIGVLGREGLLE
FT                   KCQEIFDEMPSHGVAPSVFSFTALINAYGRNGQYKSSLELLDRMKKERVSPSILTYNTV
FT                   INSCARGGLDWEELLGLFAQMRHEGIQADIVTYNTLLSACARRGLGDEAEMVFRTMNEG
FT                   GILPDITTYSYLVETFGKLNRLEKVSELLKEMESGGSFPDITSYNVLLEAHAQSGSIKE
FT                   AMGVFRQMQGAGCVPNAATYSILLNLYGRHGRYDDVRDLFLEMKVSNTEPNAATYNILI
FT                   NVFGEGGYFKEVVTLFHDMVEENVEPNMETYEGLIFACGKGGLHEDAKKILLHMNEKGV
FT                   VPSSKAYTGVIEAYGQAALYEEALVAFNTMNEVGSKPTVETYNSLIQMFAKGGLYKESE
FT                   AILLKMGQSGVARNRDTFNGVIEAFRQGGQFEEAIKAYVEMEKARCDPDEQTLEAVLSV
FT                   YCFAGLVEESEEQFGEIKALGILPSVMCYCMMLAVYAKADRWDDAHQLLDEMFTNRVSN
FT                   IHQVIGQMIRGDYDDDSNWQMVEYVFEKLKSEGCSLGVRFYNTLLEALWWLGQKERATR
FT                   VLNEATKRGLFPELFRKNKLVWSVDVHRMWEGAACTAISVWLNNMHEMFISGDDLPQLA
FT                   SAVVVRGHMEKSSITRDFPVAKSAYAFLNEVSSSFCFPGWNKGRIVCQRSQLKRILSVT
FT                   EQHSDEYKKDRIITLSNSPFPLPGTNTSMSNVKRDQLSNADAERSIMTRTELMTSTV"
FT   gene            4663228..4678297
FT                   /locus_tag="VIT_17s0000g07490"
FT                   /old_locus_tag="Vv17s0000g07490"
FT   mRNA            join(4663228..4663269,4663270..4663284,4663528..4663704,
FT                   4667936..4669303,4677975..4678010,4678011..4678297)
FT                   /locus_tag="VIT_17s0000g07490"
FT                   /old_locus_tag="Vv17s0000g07490"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           4663228..4663269
FT                   /locus_tag="VIT_17s0000g07490"
FT                   /old_locus_tag="Vv17s0000g07490"
FT   CDS_pept        join(4663270..4663284,4663528..4663704,4667936..4669303,
FT                   4677975..4678010)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07490"
FT                   /old_locus_tag="Vv17s0000g07490"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSY2"
FT                   /protein_id="CCB43023.1"
FT                   /translation="MEDSEKLTALKKAYAETILNTAKEAAARIMVSERKALSSQQDLFM
FT                   AKEEALRMLVRLKQMMDSKIGEAKMISLSQQKKIEELEAQLEEAEDIVRELREELREVQ
FT                   NALEKMTKKQLQALDEKSFKGNAGTEVEAPQEYKLSASASLILPRTGSRPEPVTTSDLK
FT                   NSTFNKRNEGNKCYGANDSYMENCFVANRDFASIVTRSKEPELYRNGCTQRIRAFESSL
FT                   LEGKLSLSGQVDGAMNETTIGEEEEGGEGIYMTSIPKDDNVCRMERNPDEAKEIRQEDG
FT                   NLYPVQAIKSFRRKRKRAVRYSNKAPSSTCLLDQVTETHQASDLSFSKTYHYAITNDLQ
FT                   SGETPSNRTANESQKDPESPAALKLPSDATETSKQSECIEVAENDAEFVKACSARSTLN
FT                   KNKVLIDDTVLSRQESGSLEISEAHNCTMDLETANVSVVNSDLKVSVKTDVVLSQPVLK
FT                   YTFRRKRKKETLGHADGNISLEKNTLKRSTDETQNGPSEPQQASLIPESSRDSRQVAQV
FT                   ARQLISLSEKKWWQ"
FT   3'UTR           4678011..4678297
FT                   /locus_tag="VIT_17s0000g07490"
FT                   /old_locus_tag="Vv17s0000g07490"
FT   gene            complement(4689905..4693849)
FT                   /locus_tag="VIT_17s0000g07470"
FT                   /old_locus_tag="Vv17s0000g07470"
FT   mRNA            complement(join(4689905..4690486,4690487..4690924,
FT                   4691633..4692207,4692728..4692836,4692918..4693712,
FT                   4693713..4693849))
FT                   /locus_tag="VIT_17s0000g07470"
FT                   /old_locus_tag="Vv17s0000g07470"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(4689905..4690486)
FT                   /locus_tag="VIT_17s0000g07470"
FT                   /old_locus_tag="Vv17s0000g07470"
FT   CDS_pept        complement(join(4690487..4690924,4691633..4692207,
FT                   4692728..4692836,4692918..4693712))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07470"
FT                   /old_locus_tag="Vv17s0000g07470"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSY3"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033337"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSY3"
FT                   /protein_id="CCB43024.1"
FT                   /translation="MDQPKQSSPQNLKHRVFTCLTKLSDRDTQSIAATELESIARTLTQ
FT                   DLLPPFLSCIHQTDPSDKSPVRKQCVRLLGILSETHGDALSPFLSKMLSNLIRRLRDPD
FT                   SAVRSTCINAISAMSSHITKPPFSSIVKPLAETLFTEQDHNAQIGASLCLASAIDAAPD
FT                   PDPALLRRLLPRIEKLLKCDSFKAKPAVLTLIGSIVEAGGATSYNVVKNLVPCAVGFLS
FT                   SEDWAARKAAAEVLVKLAVMERDMLSEFKSSCLKTFEARRFDKVKAVRDTMNQMLGAWK
FT                   EIPDVSNDVSPPPQSQSSSKENASDGRYPLESRNSCTGGSEVPLMRKKSIPTSISPQLN
FT                   SSSATTVRRRGPVDKSGSAMFRKLERKKASDLKVEVTAPHAPSVMRIHEDGLKKKDEKA
FT                   PERGENEKNRFTKPETRRVLFTKNSDDKMNKFGGFRSGSRVVPCQEENSETTVEVSNTT
FT                   EVPHRNHKECEDLSLIRKQLVQIENQQSSLLNLLEKFMGSSQNGLRSLETRVHGLELAL
FT                   DEISFDLAVSNRRMSSTDTAGATCCMLPGADFLSSKFWRKTEGRGSTSRFSPSHATQSG
FT                   TAMRYIAGKNDNAGTFKSENLRFRLQGGGGFVVNPLAEIPSDSRDISEVSSNRISKNAH
FT                   ETA"
FT   5'UTR           complement(4693713..4693849)
FT                   /locus_tag="VIT_17s0000g07470"
FT                   /old_locus_tag="Vv17s0000g07470"
FT   gene            complement(4700612..4706493)
FT                   /locus_tag="VIT_17s0000g07460"
FT                   /old_locus_tag="Vv17s0000g07460"
FT   mRNA            complement(join(4700612..4700701,4706027..4706236,
FT                   4706237..4706493))
FT                   /locus_tag="VIT_17s0000g07460"
FT                   /old_locus_tag="Vv17s0000g07460"
FT   CDS_pept        complement(join(4700612..4700701,4706027..4706236))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07460"
FT                   /old_locus_tag="Vv17s0000g07460"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSY4"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSY4"
FT                   /protein_id="CCB43025.1"
FT                   /translation="MTMISGYSKCGDVDSACELFDQVGGKDLLLFNAVIACYAQNSKLK
FT                   EALKLFNMMLHPNVNVQPDEMTLASMTCGSPDSLNMIMIYQPMKSDPKRIEKEA"
FT   5'UTR           complement(4706237..4706493)
FT                   /locus_tag="VIT_17s0000g07460"
FT                   /old_locus_tag="Vv17s0000g07460"
FT   gene            4707485..4713278
FT                   /locus_tag="VIT_17s0000g07450"
FT                   /old_locus_tag="Vv17s0000g07450"
FT   mRNA            join(4707485..4707546,4707547..4707559,4709002..4709180,
FT                   4710148..4710331,4710582..4710656,4710884..4710993,
FT                   4711437..4711655,4711916..4712071,4712879..4713130,
FT                   4713131..4713278)
FT                   /locus_tag="VIT_17s0000g07450"
FT                   /old_locus_tag="Vv17s0000g07450"
FT                   /product="Predicted protein"
FT   5'UTR           4707485..4707546
FT                   /locus_tag="VIT_17s0000g07450"
FT                   /old_locus_tag="Vv17s0000g07450"
FT   CDS_pept        join(4707547..4707559,4709002..4709180,4710148..4710331,
FT                   4710582..4710656,4710884..4710993,4711437..4711655,
FT                   4711916..4712071,4712879..4713130)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07450"
FT                   /old_locus_tag="Vv17s0000g07450"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SHZ8"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D7SHZ8"
FT                   /protein_id="CBI15108.3"
FT                   /translation="MGSFWFGPSVFLLLIVGCAARPFYPLPSKVDARDRLPLQTSRPYN
FT                   VAHRGSNGELPEETAAAYMRAIEEGADFIETDILASKDGALICFHDVTLDDTTDIAEHK
FT                   EFADRRTTYEVQGLNTTGWFSVDFTLEELKTLRVNQRYKFRDQQYNGKFTIITFEEFIS
FT                   IALDAPRVVGIYPEIKNPVFINQRVKWPDGKRFEDHFVATLKKYGYKGSYMSEDWLKQP
FT                   VFIQSFAPTSLIYISNQTNLPKIFLIDDVTVPTQDTNQSYWEITSDSYLSFIKQYVVGI
FT                   GPWKDTVVPVVDNYLQTPTDLVAKAHAHDLQVHPYTYRNENQFLHFNFHQDPYAEYDYW
FT                   INKIGVDGLFTDFTGSLYNFQEWTSPLSQDDGDDDGNAAKLLHKIATLVSPYRKG"
FT   3'UTR           4713131..4713278
FT                   /locus_tag="VIT_17s0000g07450"
FT                   /old_locus_tag="Vv17s0000g07450"
FT   gene            complement(4714184..4718897)
FT                   /locus_tag="VIT_17s0000g07440"
FT                   /old_locus_tag="Vv17s0000g07440"
FT   mRNA            complement(join(4714184..4714403,4714404..4714604,
FT                   4714801..4714921,4715033..4715193,4715303..4715447,
FT                   4715525..4715603,4715720..4715844,4715927..4716029,
FT                   4716122..4716392,4716531..4716708,4717141..4717359,
FT                   4717455..4717601,4718694..4718821,4718822..4718897))
FT                   /locus_tag="VIT_17s0000g07440"
FT                   /old_locus_tag="Vv17s0000g07440"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(4714184..4714403)
FT                   /locus_tag="VIT_17s0000g07440"
FT                   /old_locus_tag="Vv17s0000g07440"
FT   CDS_pept        complement(join(4714404..4714604,4714801..4714921,
FT                   4715033..4715193,4715303..4715447,4715525..4715603,
FT                   4715720..4715844,4715927..4716029,4716122..4716392,
FT                   4716531..4716708,4717141..4717359,4717455..4717601,
FT                   4718694..4718821))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07440"
FT                   /old_locus_tag="Vv17s0000g07440"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSY5"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004591"
FT                   /db_xref="InterPro:IPR007199"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013955"
FT                   /db_xref="InterPro:IPR031657"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSY5"
FT                   /protein_id="CCB43026.1"
FT                   /translation="MAKSITPNGISTILSNPSPDSSTELPEIIVQVIDLTPIGNRYKFT
FT                   ANDGKMKLKAMFPSSFSSEINSGNIQNLGLIQVIDYTLNDIPSKQEKYLIVTKCEAVSP
FT                   ALEVEFKTEVKSEETGILLRPKQVVEIQREVKTEGTGIFLKPKQEIVAKSAAQIVNEQH
FT                   GNMAPAARMAMTRRVHPLVSLNPYQGNWTIKVRLTNKGTMRTYKNARGEGCVFNVELTD
FT                   EDGTQIQATMFNEAARKFYEKFQLGKVYYISKGALKVANKQFKTVQNDYEMTLNENSEV
FT                   EEASNEETFIPEAKFKFVEIEELGPYVNGKELVDVIGVVQSVSPTMSIRRKSNNDIVPK
FT                   RDITIADKTKKTVVVSLWNDHATNVGQELLDNADKFPIVAIKSLKVGDFQGVSLSTLSK
FT                   SIVLVNPDTPESKKLRSWYDSEGKGASMASIGSDISPSSKGGVKSMYYDRVSLSHVTSN
FT                   PSLGEDKPSFFSIRAYISFIKPDQTMWYRACKTCNKKVTDAIGSGYWCEGCQKNDDECS
FT                   LRYIMVVKVSDASGEAWLSLFNEQAERMFGCSADELDKLKSQEGEENLFQQKLKEAIWV
FT                   PHLFRISVAQHEYMNEKRQRITARAVVPVDFAAESRLLLEEISKMKTSQ"
FT   5'UTR           complement(4718822..4718897)
FT                   /locus_tag="VIT_17s0000g07440"
FT                   /old_locus_tag="Vv17s0000g07440"
FT   gene            complement(4720927..4726116)
FT                   /locus_tag="VIT_17s0000g07430"
FT                   /old_locus_tag="Vv17s0000g07430"
FT   mRNA            complement(join(4720927..4721101,4723185..4724008,
FT                   4724009..4724074,4726092..4726116))
FT                   /locus_tag="VIT_17s0000g07430"
FT                   /old_locus_tag="Vv17s0000g07430"
FT                   /product="Predicted protein"
FT   CDS_pept        complement(join(4720927..4721101,4723185..4724008))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07430"
FT                   /old_locus_tag="Vv17s0000g07430"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI00"
FT                   /protein_id="CBI15110.3"
FT                   /translation="MEFQHGNNTVSDLRIQPANTKERDDLSSPSKNFSFVSSSSSKSDS
FT                   SEDHSEPDADKTSTTDITGTHKLDKDTGLASEHDERDVPNTSNMRQEQSNHMLSGSTSL
FT                   PPVSSNSPELSLDNGSTTQSPPVQTMEQTVSYRIPSSAFARNKSTTPMEWSVASNESLF
FT                   SIHGNMSFTRDQSFLLGRSGELGIPEEPTMTGLSFRYSNGQIPAVDEKSAKLEEGSGVT
FT                   EAAAGTKKEVLKENAEDNSKEKLSLPDGPLNDSRLSHQSDESRSSVQSFAFPILTSEGG
FT                   RSGSLKVSVAEEQTQQQQQPQSQLQPQTSAATPEAAQTSWFSCFSCCSSKS"
FT   5'UTR           complement(4726092..4726116)
FT                   /locus_tag="VIT_17s0000g07430"
FT                   /old_locus_tag="Vv17s0000g07430"
FT   gene            complement(4732509..4734768)
FT                   /locus_tag="VIT_17s0000g07420"
FT                   /old_locus_tag="Vv17s0000g07420"
FT   mRNA            complement(join(4732509..4732581,4732746..4733425,
FT                   4733525..4734271,4734355..4734768))
FT                   /locus_tag="VIT_17s0000g07420"
FT                   /old_locus_tag="Vv17s0000g07420"
FT                   /product="putative uncharacterized protein"
FT   CDS_pept        complement(join(4732509..4732581,4732746..4733425,
FT                   4733525..4734271,4734355..4734768))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07420"
FT                   /old_locus_tag="Vv17s0000g07420"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SI01"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR041266"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI01"
FT                   /protein_id="CBI15111.3"
FT                   /translation="MANKPLTLLPTGYKSSCSVTASNHTQREKICTENMGETLGDRIGL
FT                   SDEVINAAASLAMKAHDCTGKPFLRKKGLPVTVFAFAGSWLPDDWCAQPPFGETKMDTS
FT                   NFPSLKSLGDDGVALVNGSFLRRFNAIQSSLAKKVKKVIGEKKQVVFTGYSSGAPVAIL
FT                   ATLYLLEKSEPNQSPPRCVTFGSPLVGDRIFCHAVRREKWSDHFIHFVMRYDVIPRIML
FT                   GPSSTEHKQILDLFNPGSESFRKHTDSSLGLYSSVMRNASMVANYDACNFMGCKIPALE
FT                   TLRNFIELSPYRPFGTYIFFSGSGKPVVVRNPNAVLQMLFYYAQWSQEEDAEAAKKGLN
FT                   EHLAYQLKKLQSLGKQNVVYLDHLEELPVSSDGSPATVNTTLNDLGLSTQAMLCLQATG
FT                   ELEKRKSRNQDKIINDYKQKIEGELRKLSKYKEKAETCGLGYYDSFKLQEKEDDFQANV
FT                   SRLVLAGYWDEMMEMLKAYELPDEFEKSHDFIRLGTDYRRTVEPLDIANFYRHAKDEET
FT                   GFYVNKGTRPKRYRYIQNWLEHAEKKPSGSRSESCFWAEVEDLRIKTRSNGSSPEIKQK
FT                   VQQLGQNLIKWIDDESLGKDVLLENSTFVKWWKPLPPEPLFTSKMIFFLSVCKILFPVL
FT                   NM"
FT   gene            4735257..4742492
FT                   /locus_tag="VIT_17s0000g07410"
FT                   /old_locus_tag="Vv17s0000g07410"
FT   mRNA            join(4735257..4735330,4742179..4742293,4742403..4742492)
FT                   /locus_tag="VIT_17s0000g07410"
FT                   /old_locus_tag="Vv17s0000g07410"
FT                   /product="Os11g0167200 protein"
FT   CDS_pept        join(4735257..4735330,4742179..4742293,4742403..4742492)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07410"
FT                   /old_locus_tag="Vv17s0000g07410"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI02"
FT                   /protein_id="CBI15112.3"
FT                   /translation="MTWFLSKFGFIYNYFTFENRHPFIIIFIVDFRPIRGVTYMQQNNL
FT                   KMCLRNTNSAIDTSEVANAYGGGDSPSSSFFIIRMDEYNQWISMNSS"
FT   gene            complement(4767338..4789016)
FT                   /locus_tag="VIT_17s0000g07400"
FT                   /old_locus_tag="Vv17s0000g07400"
FT   mRNA            complement(join(4767338..4767426,4767427..4767666,
FT                   4767771..4768517,4768601..4768945,4787406..4787972,
FT                   4788903..4789016))
FT                   /locus_tag="VIT_17s0000g07400"
FT                   /old_locus_tag="Vv17s0000g07400"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(4767338..4767426)
FT                   /locus_tag="VIT_17s0000g07400"
FT                   /old_locus_tag="Vv17s0000g07400"
FT   CDS_pept        complement(join(4767427..4767666,4767771..4768517,
FT                   4768601..4768945,4787406..4787972,4788903..4789016))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07400"
FT                   /old_locus_tag="Vv17s0000g07400"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSY6"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR041266"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSY6"
FT                   /protein_id="CCB43027.1"
FT                   /translation="MGTCNFPSLKSLGDDGVALVNGSFLQRFNAIHSSLAKKSTQAMLC
FT                   LQATGELEKLKSRNQDKIINDYKQKIEGELRKLSKYKEKAETCGLGYYDSFKLQEKEDG
FT                   FQANVSRLVLAGYWDEMMEMLKAYKLPDEFEKSHDCIRLGTDYRRTVEPLDIANFYRHA
FT                   KDEETGFYVKKGTRPKRYRYIQNWLEHAEKKPSGSRSESCFWAEVEDLRIKTRSNGSSP
FT                   EIKQKRENLHRENMGETLDRIGLSGEVINAAASLAMKAHDSTREPFLLKKPRGLSVAVV
FT                   AFAGSWLPDDWCAETPFGETTIDAGTFPSLKSLGDDGVALVNGSFLRRFKAILGQSSLA
FT                   EKVKKVIGEKKRVVFTGYSSGAPVAILATLCLLEKPEPNQSPPRCVTFGSPLVGDRIFG
FT                   HAVRREKWSDHFVHFVMRYDVIPRIMLAPSSTEHKQILDFFNPRSEFFRKPIDSPLGFY
FT                   SSVMRNASLVANYDACNLMGCRIPALETLRNFIELSPYRPFGTYIFCTGNGKLVVVRNS
FT                   NAVLQMLFYCAQWTQEEAAGVAQRSLSEHLAYKDEIQESLGMQNVVYLDRLEEIPVSSD
FT                   GSPATVNTALNDLGLSPQGRLCLQAAGELEKRKSRNQDKIINDYKQKIEGELRELRKYK
FT                   EKAETCGLGYYDSFKLNKYEEDFRANVSRLVLAGF"
FT   gene            complement(4817357..4827064)
FT                   /locus_tag="VIT_17s0000g07380"
FT                   /old_locus_tag="Vv17s0000g07380"
FT   mRNA            complement(join(4817357..4817376,4827055..4827064))
FT                   /locus_tag="VIT_17s0000g07380"
FT                   /old_locus_tag="Vv17s0000g07380"
FT   CDS_pept        complement(join(4817357..4817376,4827055..4827064))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07380"
FT                   /old_locus_tag="Vv17s0000g07380"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSY7"
FT                   /protein_id="CCB43028.1"
FT                   /translation="MDSGKKNKK"
FT   gap             4846252..4850501
FT                   /estimated_length=4250
FT   gap             4853114..4853562
FT                   /estimated_length=449
FT   gene            complement(4860278..4862289)
FT                   /locus_tag="VIT_17s0000g07370"
FT                   /old_locus_tag="Vv17s0000g07370"
FT   mRNA            complement(join(4860278..4861015,4861113..4861856,
FT                   4861940..4862260,4862261..4862289))
FT                   /locus_tag="VIT_17s0000g07370"
FT                   /old_locus_tag="Vv17s0000g07370"
FT                   /product="putative uncharacterized protein"
FT   CDS_pept        complement(join(4860278..4861015,4861113..4861856,
FT                   4861940..4862260))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07370"
FT                   /old_locus_tag="Vv17s0000g07370"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SI06"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR041266"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI06"
FT                   /protein_id="CBI15116.3"
FT                   /translation="MGETLDRIGLSGAVINAAASLAMKAHDSTREPFLLKKPRGLSVAV
FT                   VAFAGSWLPDDWCAETPFGETTIDAGTFPSLKSLGDDGVALVNGSFLRRFKAILGQSSL
FT                   AEKVKKVIGEKKRVIFTGYSSGAPVAILATLYLLEKSEPNQSPPRCVTFGSPLVGDRIF
FT                   GHAVRREKWSDHFIHFVMRYDVIPRIMLGPSSTEHKQILDFFNPGSESFRKHTDSSLGL
FT                   YSSVMRNASMVANYDACNFMGCRIPALETLRNFIELSPYRPFGTYIFCSGSGKLVVVRN
FT                   PNAVLQILFYCAQWSQEEDAEAAKKGLNEHLDYQKELQSLGKQNVVYLDHLEELPVSSD
FT                   GSPATVNTTLNDLGLSTQAMLCLQATGELEKRKSRNQDKIINDYKQKIEGELRKLSEYK
FT                   EKAETCGQSYYDSFKLQEKPDAFHANVSRLVLAGYWDEMMEMLKAYELPDEFEKRQDLI
FT                   QLGTNYLRMVEPLDIANFYRHAKDEETGFYVKKGTRPKRYRYIQSWLEYAEKKPSGSHS
FT                   ESCFWAEVEDLRIKTRSNGSSPEIKQKVQQLGQNLIKWIDDESLGKDVLLENSTFVKWW
FT                   KSLPPEYKSEPESSRIMKLIHEKD"
FT   5'UTR           complement(4862261..4862289)
FT                   /locus_tag="VIT_17s0000g07370"
FT                   /old_locus_tag="Vv17s0000g07370"
FT   gene            complement(4872173..4877569)
FT                   /locus_tag="VIT_17s0000g07360"
FT                   /old_locus_tag="Vv17s0000g07360"
FT   mRNA            complement(join(4872173..4872241,4873409..4874174,
FT                   4877257..4877498,4877499..4877569))
FT                   /locus_tag="VIT_17s0000g07360"
FT                   /old_locus_tag="Vv17s0000g07360"
FT                   /product="putative uncharacterized protein Sb02g010935"
FT   CDS_pept        complement(join(4872173..4872241,4873409..4874174,
FT                   4877257..4877498))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07360"
FT                   /old_locus_tag="Vv17s0000g07360"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR004332"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSY8"
FT                   /protein_id="CCB43029.1"
FT                   /translation="MGGKTRLVLVDRSVSFDELRSKLSQLTCACPFSIEIKYQLPDESL
FT                   ESRLVSVECEDDVVAMMSEFEASQRIQVYIFASDHRVGEGISQASVDSHTSPALSELVN
FT                   GRESDTLTVGQEFPDARCFRDALVASAIASKFELTFIRSDRSRVTARCAADDCQWRIHA
FT                   SKLPDGETFQIKTLKGKHSCVWPERSSHRQANMKWILSCIMDRVRENINYKPKEIMRDI
FT                   EQEYGVIIPYLKAHRAKERALESIFGMPIKDIVLNQAEVHNLENDLHTILDQRKKKPLK
FT                   GSSVHCNLCRKAGHNRRSCLKLSHNESQASSLKEKNFHCMLCKQSGHNRRTCQCKGAFE
FT                   CGNRKGNMMGMKVNHDTM"
FT   5'UTR           complement(4877499..4877569)
FT                   /locus_tag="VIT_17s0000g07360"
FT                   /old_locus_tag="Vv17s0000g07360"
FT   gene            4886046..4888196
FT                   /locus_tag="VIT_17s0000g07350"
FT                   /old_locus_tag="Vv17s0000g07350"
FT   mRNA            join(4886046..4887977,4887978..4888196)
FT                   /locus_tag="VIT_17s0000g07350"
FT                   /old_locus_tag="Vv17s0000g07350"
FT                   /product="Predicted protein"
FT   CDS_pept        4886046..4887977
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07350"
FT                   /old_locus_tag="Vv17s0000g07350"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSY9"
FT                   /db_xref="InterPro:IPR004140"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSY9"
FT                   /protein_id="CCB43030.1"
FT                   /translation="MEECRAIIPTYEGEEHVVAAAHHMVKALMASKNLTGDFKKILVDL
FT                   DTHLSTMTILNERKGDELSEVELRLKCAEKKIMNRESKQLMIWDSGSKQVLEYLQAVEE
FT                   VQTLKESLESLSLNGGEKQKRLLRQAESILQIAMVRLEEELLHILRHKKQSFEPEFASF
FT                   HSCEEVVVYEESIVSVEDDISEDSSRRDSNGDESKEYTIGLINPEVIPHLKSIANVMFA
FT                   SNYDQEFCQAFIGARKDALDEYLGILELEKLSIEDVLRMDWGNLNYEIKKWIRAMKIII
FT                   RVYLASEKRLCDHILGDFGSINPICFVETSKVSMLRLLNFGEAVAIGQHLPEKLFSLLN
FT                   MYEALADLLLHIDALFSEEAGASIRIDFHKLQRELGDAAGATFMEFETAIASYTSTSPF
FT                   PGGGILHLTRYVMNYIKILTEYSNTLNLLLKDQNGEDPEPLIEAENAQGVPSQVVCPVA
FT                   HHLRSIASLLESNLESRSKLYKDVSLQHIFLMNNIHYMVQKVKGSELRGFFGDEWIRKH
FT                   MVKVQQRVTSYERTTWSSVLSLLREDGNSGSSSPWKMILKERCRGFSIAFEEVYKNQTA
FT                   WFIPDPQLRDNLRILTSQKIIQAYRGFIGRNSENLSDKHIKYSADDLENYVHNLFEGSP
FT                   KSLNNRRK"
FT   3'UTR           4887978..4888196
FT                   /locus_tag="VIT_17s0000g07350"
FT                   /old_locus_tag="Vv17s0000g07350"
FT   gene            complement(4892627..4894058)
FT                   /locus_tag="VIT_17s0000g07340"
FT                   /old_locus_tag="Vv17s0000g07340"
FT   mRNA            complement(join(4892627..4892637,4892638..4893951,
FT                   4893952..4894058))
FT                   /locus_tag="VIT_17s0000g07340"
FT                   /old_locus_tag="Vv17s0000g07340"
FT                   /product="Predicted protein"
FT   3'UTR           complement(4892627..4892637)
FT                   /locus_tag="VIT_17s0000g07340"
FT                   /old_locus_tag="Vv17s0000g07340"
FT   CDS_pept        complement(4892638..4893951)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07340"
FT                   /old_locus_tag="Vv17s0000g07340"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSZ0"
FT                   /db_xref="InterPro:IPR001108"
FT                   /db_xref="InterPro:IPR006639"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSZ0"
FT                   /protein_id="CCB43031.1"
FT                   /translation="MAQNRRPRSIIESLGEEIIRIISPVSICMFLVVLLVTILNSDTSS
FT                   SSSSVSTIATIAYSEDSSDSTWDKFKGALLNSLVFVGVVTVVTFLLVLLFYLRCTKFLK
FT                   YYMGFSSFIVLGFMGGEITLFLIQDFSFPIDCITFLVVLFNFTVVGVLAVFMSKMAILV
FT                   TQGYLVVIGMLVAYWFTLLPEWTTWVLLVAMALYDLAAVLLPGGPLRLLVELAISRDED
FT                   IPALVYEARPVTYQDSCPGGGVAQRRAWRERRGVGSNLSENSNNLATSDVNVNPDVASN
FT                   STLGTCLSVGSGEQETSLVNAEEGRVSEGNSELVVPLIDHRINVGEHGQEDSVSTENLP
FT                   FEGIGLGSSGAIKLGLGDFIFYSVLVGRAAMYDFMTVYACYLAIIAGLGVTLMLLAIYQ
FT                   KALPALPVSILLGVLFYFFTRFLLEAFIVQCSLNLLMF"
FT   5'UTR           complement(4893952..4894058)
FT                   /locus_tag="VIT_17s0000g07340"
FT                   /old_locus_tag="Vv17s0000g07340"
FT   gene            4900842..4905881
FT                   /locus_tag="VIT_17s0000g07330"
FT                   /old_locus_tag="Vv17s0000g07330"
FT   mRNA            join(4900842..4900858,4902859..4902869,4902870..4903005,
FT                   4903088..4903156,4904168..4904274,4905121..4905642,
FT                   4905643..4905881)
FT                   /locus_tag="VIT_17s0000g07330"
FT                   /old_locus_tag="Vv17s0000g07330"
FT                   /product="RNA-binding protein"
FT   5'UTR           4900842..4900858
FT                   /locus_tag="VIT_17s0000g07330"
FT                   /old_locus_tag="Vv17s0000g07330"
FT   CDS_pept        join(4902870..4903005,4903088..4903156,4904168..4904274,
FT                   4905121..4905642)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07330"
FT                   /old_locus_tag="Vv17s0000g07330"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSZ1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSZ1"
FT                   /protein_id="CCB43032.1"
FT                   /translation="MAFFGKVGNILRQTVSKQVNSQFSVSNPSIYQAIRCMSSSKLFIG
FT                   GLSYSTDDTSLREAFHKYGEVIEARVIVDRETGRSRGFGFVTFTSSEEASSAIQALDGQ
FT                   DLHGRRVRVNYATDRARSGGFGGGGGYGGGGGGYGGGGYGGGGYGGSGGYGGGGYGGGS
FT                   GGYGGGGDSYGSGGGNYGSGGGGYGGSSGGYGSGGNFSVAGGSDNYVGGAAGSSSGFPS
FT                   GGGSSFASGGADQLGTNESSSVGDGAGEFSPDEPATEGNYRDDDDEPDDYANRRA"
FT   gap             4903491..4903590
FT                   /estimated_length=100
FT   3'UTR           4905643..4905881
FT                   /locus_tag="VIT_17s0000g07330"
FT                   /old_locus_tag="Vv17s0000g07330"
FT   gene            complement(4906547..4913451)
FT                   /locus_tag="VIT_17s0000g07320"
FT                   /old_locus_tag="Vv17s0000g07320"
FT   mRNA            complement(join(4906547..4906709,4906710..4907576,
FT                   4908815..4908930,4909036..4909260,4912515..4913451))
FT                   /locus_tag="VIT_17s0000g07320"
FT                   /old_locus_tag="Vv17s0000g07320"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(4906547..4906709)
FT                   /locus_tag="VIT_17s0000g07320"
FT                   /old_locus_tag="Vv17s0000g07320"
FT   CDS_pept        complement(join(4906710..4907576,4908815..4908930,
FT                   4909036..4909260,4912515..4913451))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07320"
FT                   /old_locus_tag="Vv17s0000g07320"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSZ2"
FT                   /db_xref="InterPro:IPR040348"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSZ2"
FT                   /protein_id="CCB43033.1"
FT                   /translation="MDIWIVVAAASAVYLSKQWQKILRHRENSSESFCGTSDFEKPNPA
FT                   STWWLPDKKSCPLRSLAWRKKLDEDISIEKENISKGEVSEMTQLDGTPAAEVASACGAD
FT                   GENLVSLGNHKDCNVLFISSLANGFSRNDNLQENEDGIRMTGDIDSSGDSVHEPSTVNV
FT                   GPFLGLLRKGRALRTKRLHARFARPISSLESCLMAQLYNEHAEMEEYVLSSLQSPPAPT
FT                   VRPLFTSDGSRIINKASGDSPSMWIGTGDDNLHKEAYLEGKETAIGVPSLPKLRSMEQP
FT                   RKMKLKTGRGQRQRFGSSSKMINRKHFHSQGGSPDGMVLFCLGISIGMIFSQISNKREV
FT                   DEMKELLQRTENLVQDLQEELEMKDSLTVKELANEDYESQYTHDHAFEENSELMSKIEA
FT                   ELEAELERLELSMNSSCLERKLSNLVELDPDIVADVAQGELKVEMVGRQTGGQDDSYQD
FT                   VSSTSTTHSANYAVSPRELSLRLHEVIQSRLEERVKELETELQNSNRKLQFMESERLTC
FT                   YEEFADSILGSSTQRTPIALPVEESNPIAQLSVVNLPEDAYNEVEDFMKETQSESEDFP
FT                   STAYRNNHQDGLHQFDGSVLWDHEDLLKVNQSEEEDQESSHQVDGIAEWGQNGRVGDSM
FT                   GYRPTINKERQRRTFIPQEVRTLEEHILMDRELSGDENNDEADDEMKLLIQQIVEKSRQ
FT                   GSPIVLNVQRALFSVDENEH"
FT   gene            complement(4917794..4926948)
FT                   /locus_tag="VIT_17s0000g07310"
FT                   /old_locus_tag="Vv17s0000g07310"
FT   mRNA            complement(join(4917794..4918043,4918044..4918169,
FT                   4918627..4918680,4918753..4918902,4919591..4919684,
FT                   4925550..4925657,4925750..4925882,4926191..4926281,
FT                   4926282..4926450,4926905..4926948))
FT                   /locus_tag="VIT_17s0000g07310"
FT                   /old_locus_tag="Vv17s0000g07310"
FT                   /product="Predicted protein"
FT   3'UTR           complement(4917794..4918043)
FT                   /locus_tag="VIT_17s0000g07310"
FT                   /old_locus_tag="Vv17s0000g07310"
FT   CDS_pept        complement(join(4918044..4918169,4918627..4918680,
FT                   4918753..4918902,4919591..4919684,4925550..4925657,
FT                   4925750..4925882,4926191..4926281))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07310"
FT                   /old_locus_tag="Vv17s0000g07310"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSZ3"
FT                   /db_xref="InterPro:IPR023190"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSZ3"
FT                   /protein_id="CCB43034.1"
FT                   /translation="MKHPKSFNSVVASVQPLEASTRFDNTLPSKEILELWQDADAVCFD
FT                   VDSTVCVDEGIDELAEFCGAGKAVAEWTARAMGGSVPFEEALAARLSLFKPSLSQVQDF
FT                   LEKRPPRISPGIDVLVKKLKARNTNVYLISGGFRQMINPVASILEIPPENIFANQLLFG
FT                   SSGEFLGFDANEPTSRSGGKATAVMQIRKVHGYKRLVMIGDGATDLEARKPGGADLFIC
FT                   YAGVQLREAVASKSDWLVFNFKDLINTLE"
FT   5'UTR           complement(4926905..4926948)
FT                   /locus_tag="VIT_17s0000g07310"
FT                   /old_locus_tag="Vv17s0000g07310"
FT   gene            complement(4927929..4935758)
FT                   /locus_tag="VIT_17s0000g07300"
FT                   /old_locus_tag="Vv17s0000g07300"
FT   mRNA            complement(join(4927929..4928181,4928182..4928251,
FT                   4928517..4928638,4928923..4929042,4929135..4929257,
FT                   4930850..4930977,4931071..4931184,4932628..4932780,
FT                   4932898..4932941,4935580..4935674,4935675..4935758))
FT                   /locus_tag="VIT_17s0000g07300"
FT                   /old_locus_tag="Vv17s0000g07300"
FT                   /product="ATP synthase gamma chain"
FT   3'UTR           complement(4927929..4928181)
FT                   /locus_tag="VIT_17s0000g07300"
FT                   /old_locus_tag="Vv17s0000g07300"
FT   CDS_pept        complement(join(4928182..4928251,4928517..4928638,
FT                   4928923..4929042,4929135..4929257,4930850..4930977,
FT                   4931071..4931184,4932628..4932780,4932898..4932941,
FT                   4935580..4935674))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07300"
FT                   /old_locus_tag="Vv17s0000g07300"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SI12"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI12"
FT                   /protein_id="CBI15122.3"
FT                   /translation="MAMAAFRREGRRFAPLITPRPIAAVRSSPIPEEQAPLGVRSISTQ
FT                   IVRNRMKSVKNIQKITKAMKMVAASKLRAIQTRAENSRGLWQPFTVLLGDSPSVDVKKN
FT                   VIVTISSDKGLCGGINSTSVKISKALHKFTSGPEKGTKYVVLGEKAKAQLMRDSKKDIE
FT                   LCITELQKNPLNYTQVSVLADEILKNVEYDALRIVFNKFRSIISFVPTTSTVLSPEVVE
FT                   REAEAGGKLGDLDSYEIEGGETKGEILQNLAEFQFSCVLFNAVLENACSEQGARMSAMD
FT                   SSSRNAGDMLDRLTLTYNRTRQAAITTELTEIISGASALEG"
FT   5'UTR           complement(4935675..4935758)
FT                   /locus_tag="VIT_17s0000g07300"
FT                   /old_locus_tag="Vv17s0000g07300"
FT   gene            4938445..4943831
FT                   /locus_tag="VIT_17s0000g07290"
FT                   /old_locus_tag="Vv17s0000g07290"
FT   mRNA            join(4938445..4938478,4938479..4938568,4938779..4938836,
FT                   4939206..4939355,4940384..4940594,4941370..4941415,
FT                   4942646..4942766,4942886..4942958,4943597..4943831)
FT                   /locus_tag="VIT_17s0000g07290"
FT                   /old_locus_tag="Vv17s0000g07290"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           4938445..4938478
FT                   /locus_tag="VIT_17s0000g07290"
FT                   /old_locus_tag="Vv17s0000g07290"
FT   CDS_pept        join(4938479..4938568,4938779..4938836,4939206..4939355,
FT                   4940384..4940594,4941370..4941415,4942646..4942766,
FT                   4942886..4942958,4943597..4943831)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07290"
FT                   /old_locus_tag="Vv17s0000g07290"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SI13"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI13"
FT                   /protein_id="CBI15123.3"
FT                   /translation="MAGAFGEGMMHPIDTVKTRIQSQAILRGGQNQKTIIQMVHTIWAA
FT                   DGLRGFYRGITPGLTGSLATGATYFGVIESTKKWIEESHPSLEGHWAHFIAGSVGDTLG
FT                   SFVYVPCEVMKQRMQVQGTKTTWSSVIINGTARTRPGPQMYGYYAGMFQAGCSIWKEQG
FT                   LKGLYAGYWSTLARDVPFSGLMVTSYEALKDLAEHGKQKWIPNSDYNVNSSVEGLVLGG
FT                   LAGGFSAYLTTPLDVIKTRLQVQGSNSSYNGWLDAIHRIWMTEGVKGMFRGSIPRIVWY
FT                   IPASALTFMAVEFLRDHFNGGLNNNSMQEVSSLSIDKKGSSLQEVA"
FT   gene            complement(4945999..4956976)
FT                   /locus_tag="VIT_17s0000g07280"
FT                   /old_locus_tag="Vv17s0000g07280"
FT   mRNA            complement(join(4945999..4946202,4946203..4946368,
FT                   4946530..4946594,4947570..4947696,4947926..4948119,
FT                   4949025..4949134,4949218..4949341,4951658..4951744,
FT                   4951880..4952050,4952380..4952444,4954062..4954273,
FT                   4955019..4955125,4955278..4955424,4956093..4956294,
FT                   4956802..4956965,4956966..4956976))
FT                   /locus_tag="VIT_17s0000g07280"
FT                   /old_locus_tag="Vv17s0000g07280"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(4945999..4946202)
FT                   /locus_tag="VIT_17s0000g07280"
FT                   /old_locus_tag="Vv17s0000g07280"
FT   CDS_pept        complement(join(4946203..4946368,4946530..4946594,
FT                   4947570..4947696,4947926..4948119,4949025..4949134,
FT                   4949218..4949341,4951658..4951744,4951880..4952050,
FT                   4952380..4952444,4954062..4954273,4955019..4955125,
FT                   4955278..4955424,4956093..4956294,4956802..4956965))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07280"
FT                   /old_locus_tag="Vv17s0000g07280"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SI14"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI14"
FT                   /protein_id="CBI15124.3"
FT                   /translation="MEVNSEKGDRRRRVGLVYDDRMCEHATADGDPHPENPDRIRAIWK
FT                   KLESAGIPQRCVVFNAKEAEDKHILSVHSNNHVNLIKNISSKQFDSRRNRIASKFNSIY
FT                   MNEGSSEAAYLAAGSVIEVAERVAKGELSSAFAIVRPPGHHAEQNEPMGFCLYNNVAIA
FT                   TSFLLNERPDIKKILIVDWDVHHGNGTQKMFWKDPRVLFFSVHRHEFGSFYPANDEGFY
FT                   AMTGEGPGAGYNINVPWENGRCGDADYLAVWDHILIPVAKDFNPDIVIISAGFDAAIGD
FT                   PLGGCHVTPYGYSVMLKKLMEFSEGKIIMALEGGYNLVSLANSVLACVEVLLEDKPIAG
FT                   SSEAYPFESTWRVIQAVRQELSAFWPTLADELPKKLTSCKASPLQLLVASSDSEDESDI
FT                   DLHIRAENLEAVVQDGLSKLKVDEDSHDLVATWRSELSKIDVWYASFGSNMWKSRFLCY
FT                   IEGGQLEGMEKRCSGSVDRNPPKEIMWKTVPHRLFFGRDHSSTWGPGGVAFLNPEENNQ
FT                   DRAYICLYRITLEQFNDVLLQENASSYDISSPLFDLVALNSIADKQSISVEFKSGWYRS
FT                   VLYLGKECDIPILTLTCPLSDVEAFKSGDLPMSAPSKEYANTIIRGLTEGKQLSEEEAI
FT                   AYIQEASTKPL"
FT   5'UTR           complement(4956966..4956976)
FT                   /locus_tag="VIT_17s0000g07280"
FT                   /old_locus_tag="Vv17s0000g07280"
FT   gene            complement(4957850..4970124)
FT                   /locus_tag="VIT_17s0000g07270"
FT                   /old_locus_tag="Vv17s0000g07270"
FT   mRNA            complement(join(4957850..4958358,4958359..4958541,
FT                   4958655..4958738,4970089..4970124))
FT                   /locus_tag="VIT_17s0000g07270"
FT                   /old_locus_tag="Vv17s0000g07270"
FT   3'UTR           complement(4957850..4958358)
FT                   /locus_tag="VIT_17s0000g07270"
FT                   /old_locus_tag="Vv17s0000g07270"
FT   CDS_pept        complement(join(4958359..4958541,4958655..4958738,
FT                   4970089..4970124))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07270"
FT                   /old_locus_tag="Vv17s0000g07270"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSZ4"
FT                   /protein_id="CCB43035.1"
FT                   /translation="MMLPGDTGNTHSDTSTEKFPVGDMVSHSLQFQTGLWKQFKVPARQ
FT                   LPAYPMDNNPLRFSEMDKKYRSTGKERKLETTSERRCPEVDERKKGFPTTSSKRP"
FT   gap             4975072..4979497
FT                   /estimated_length=4426
FT   gene            complement(4986092..4990794)
FT                   /locus_tag="VIT_17s0000g07260"
FT                   /old_locus_tag="Vv17s0000g07260"
FT   mRNA            complement(join(4986092..4986483,4986484..4986781,
FT                   4989840..4989873,4989982..4990221,4990599..4990650,
FT                   4990651..4990794))
FT                   /locus_tag="VIT_17s0000g07260"
FT                   /old_locus_tag="Vv17s0000g07260"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(4986092..4986483)
FT                   /locus_tag="VIT_17s0000g07260"
FT                   /old_locus_tag="Vv17s0000g07260"
FT   CDS_pept        complement(join(4986484..4986781,4989840..4989873,
FT                   4989982..4990221,4990599..4990650))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07260"
FT                   /old_locus_tag="Vv17s0000g07260"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SI17"
FT                   /db_xref="InterPro:IPR012946"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI17"
FT                   /protein_id="CBI15127.3"
FT                   /translation="MAALVYMVLILAMAGHSSANWCVCKDGLSDAVLQKTLDYACGAGA
FT                   DCGPIHQNGGCYNPNTVRAHCSYAVNSYFQKKGQAQGTCDFAGTASVATSDPSASGCVY
FT                   PSSISSAGTSTTPSTTTPSTTPSTTTPSTTPSTTTPSTTTPSTTSPYTGTPSTGVYGGI
FT                   NSGVGPSGAGINTDISHGGFMLQNTCMFSFFITLWFSGLMLLWG"
FT   5'UTR           complement(4990651..4990794)
FT                   /locus_tag="VIT_17s0000g07260"
FT                   /old_locus_tag="Vv17s0000g07260"
FT   gene            complement(4995622..4997755)
FT                   /locus_tag="VIT_17s0000g07250"
FT                   /old_locus_tag="Vv17s0000g07250"
FT   mRNA            complement(join(4995622..4995650,4995651..4996521,
FT                   4997285..4997670,4997671..4997755))
FT                   /locus_tag="VIT_17s0000g07250"
FT                   /old_locus_tag="Vv17s0000g07250"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(4995622..4995650)
FT                   /locus_tag="VIT_17s0000g07250"
FT                   /old_locus_tag="Vv17s0000g07250"
FT   CDS_pept        complement(join(4995651..4996521,4997285..4997670))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07250"
FT                   /old_locus_tag="Vv17s0000g07250"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SI18"
FT                   /db_xref="InterPro:IPR023342"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI18"
FT                   /protein_id="CBI15128.3"
FT                   /translation="MQRRIISQFSYSKRVHCQLSPIFFFASRRTLTLGGEGVDDPLYAD
FT                   VPRPCRRKSERKPYPTPMKILIRRAKEEKEARKAQPSRVLEDPPDNGLLVPELIGVAHQ
FT                   VYQAQQSLLLGLRKLIDVIPVQRCRFCFEVHIGHMGHEIRTCTGPKSGFRSSKHVWRKG
FT                   RVEDAVYFPKCFHLCDRVGKPRVVHDERFNIKRIPAILELCIQAGVDLEKYPTKRRARP
FT                   VYCIEGRIVDFEPETEKDEMRRNVEASDLGTKTEEMERNSNSHNPSHFLTHSNNGEEKS
FT                   LKELSTTTLESWFEMISGAKKIMEKYSVKTCGYCPEVQVGPKGHKVRMCKASKHQSRNG
FT                   LHAWQEATIDDLVGPNYVWHVQDQNRPALDNSLKRYYGKAPAVVELCVQGGASIPDQYR
FT                   SMMRLDVVPPDRDEVDLVA"
FT   5'UTR           complement(4997671..4997755)
FT                   /locus_tag="VIT_17s0000g07250"
FT                   /old_locus_tag="Vv17s0000g07250"
FT   gene            4998129..5006921
FT                   /locus_tag="VIT_17s0000g07240"
FT                   /old_locus_tag="Vv17s0000g07240"
FT   mRNA            join(4998129..4998131,4998132..4998238,4998510..4998571,
FT                   4999314..4999482,5000117..5000567,5000680..5000745,
FT                   5001147..5001251,5002053..5002355,5003029..5003145,
FT                   5003224..5003283,5004204..5004275,5004351..5004467,
FT                   5004563..5004724,5006178..5006243,5006358..5006510,
FT                   5006592..5006675,5006880..5006921)
FT                   /locus_tag="VIT_17s0000g07240"
FT                   /old_locus_tag="Vv17s0000g07240"
FT   5'UTR           4998129..4998131
FT                   /locus_tag="VIT_17s0000g07240"
FT                   /old_locus_tag="Vv17s0000g07240"
FT   CDS_pept        join(4998132..4998238,4998510..4998571,4999314..4999482,
FT                   5000117..5000567,5000680..5000745,5001147..5001251,
FT                   5002053..5002355,5003029..5003145,5003224..5003283,
FT                   5004204..5004275,5004351..5004467,5004563..5004724,
FT                   5006178..5006243,5006358..5006510,5006592..5006675,
FT                   5006880..5006921)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07240"
FT                   /old_locus_tag="Vv17s0000g07240"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GSZ5"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F6GSZ5"
FT                   /protein_id="CCB43036.1"
FT                   /translation="MLVQLPRLTNSLRDPFDVDHAYLQRKLILQNHNPRSDANSVEESE
FT                   LARKIVHGWDEASIEVCQAYKHFIAAVVELIDGEVASEYFREVALLVYNLFTGPRDEYE
FT                   DDTRIAEKKLELQKLLGYVVSDANLQKVASLAQRLFNLQPNNLVTGLVHERQVHGSSDD
FT                   VEFGANLAFQAPSRFLVDASLEDEEFLGEESAPPSAGRDRWYDHTASTHDHSAVDRRNF
FT                   TLRWLRDACDGIVRGSTSQLSQDELAMAICRVLDSDKPGEEIAGDLLDLVGDNAFEMVQ
FT                   DIISHRKDLTDAIHHGLLVLKSEKAASNSQSRMPSYGTQVTVQTESERQIDKLRRKEEK
FT                   RHRRGSEYGVGDNLLAANFSSLLEASENKSPFDGLIGSGEGPHSLPVTALPQGTLRKHY
FT                   KGYEEVIVPPTPTAQLKPGEKLIDIKELDDFAQAAFHGYKSLNRIQSRIFQTVYYTNEN
FT                   VLVCAPTGAGKTNIAMIAILHEIGQHFKDGYLHKNEFKIVYVAPMKALAAEVTSTFSHR
FT                   LSPLNISVRELTGDMQLSKYELEETQMIVTTPEKWDVITRKSSDMSLSMLVKLLIIDEV
FT                   HLLNDDRGAVIEALVARTLRQVESTQTMIRIVGLSATLPNYLEVAQFLRVNPEAGLFYF
FT                   DSSYRPVPLAQQYIGISEQNFLARTELLNEICYNKVVDSLRQGHQAMVFVHSRKDTAKT
FT                   AEKLDILKHSLCKYEQS"
FT   gene            5006922..5054819
FT                   /locus_tag="VIT_17s0000g07230"
FT                   /old_locus_tag="Vv17s0000g07230"
FT   mRNA            join(5006922..5006974,5011554..5011622,5011717..5011848,
FT                   5011934..5011999,5013311..5013376,5013480..5013602,
FT                   5014572..5014721,5015104..5015316,5016342..5016497,
FT                   5016588..5016812,5016911..5017012,5017111..5017191,
FT                   5017307..5017387,5023848..5024051,5024164..5024280,
FT                   5024391..5024513,5026541..5026630,5026707..5026832,
FT                   5026952..5027014,5027806..5027894,5030358..5030448,
FT                   5033968..5034117,5034206..5034397,5034514..5034579,
FT                   5035624..5035779,5035889..5036032,5036253..5036320,
FT                   5036418..5036583,5036683..5036745,5048434..5048529,
FT                   5048646..5048813,5051021..5051191,5053126..5053275,
FT                   5053340..5053474,5054343..5054432,5054433..5054819)
FT                   /locus_tag="VIT_17s0000g07230"
FT                   /old_locus_tag="Vv17s0000g07230"
FT                   /product="unknown predicted protein"
FT   5'UTR           5006922..5006974
FT                   /locus_tag="VIT_17s0000g07230"
FT                   /old_locus_tag="Vv17s0000g07230"
FT   CDS_pept        join(5011717..5011848,5011934..5011999,5013311..5013376,
FT                   5013480..5013602,5014572..5014721,5015104..5015316,
FT                   5016342..5016497,5016588..5016812,5016911..5017012,
FT                   5017111..5017191,5017307..5017387,5023848..5024051,
FT                   5024164..5024280,5024391..5024513,5026541..5026630,
FT                   5026707..5026832,5026952..5027014,5027806..5027894,
FT                   5030358..5030448,5033968..5034117,5034206..5034397,
FT                   5034514..5034579,5035624..5035779,5035889..5036032,
FT                   5036253..5036320,5036418..5036583,5036683..5036745,
FT                   5048434..5048529,5048646..5048813,5051021..5051191,
FT                   5053126..5053275,5053340..5053474,5054343..5054432)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07230"
FT                   /old_locus_tag="Vv17s0000g07230"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT13"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004179"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT13"
FT                   /protein_id="CCB43037.1"
FT                   /translation="MEVMKSRNKDLVEYFGSGVGIHHAGMLRADRGLTERLFSDGLLKV
FT                   LVCTATLAWGVNLPAHTVVIKGTQLYDPKAGGWRDLGMLDVMQIFGRAGRPQFDKSGEG
FT                   IIITSHEKLAYYLRLLTSQLPIESQFISSLKDNLNAEVALGTVTNVKEACAWLGYTYLF
FT                   IRMRLNPLAYGIGWDEVIADPSLSLKQRAFVTDAARALDKAKMMRFDEKSGNFYCTELG
FT                   RIASHFYIQYSSVETYNEMLRRHMNDSEVIDMVAHSSEFENIVVREEEQNELEMLARTS
FT                   CPLEIKGGPSNKHGKISILIQLYISRGSIDSFSLISDAAYISASLARIMRALFEICLRR
FT                   GWCEMCSFMLDYCKAVDRQVWPHQHPLRQFDKDLSSDILRKLEDRGADLDRLYDMQEKD
FT                   IGALIRYASGGKLVKQYLGYFPSIQLSATVSPITRTVLKIDLLIASDFVWKDRFHGAAQ
FT                   RWWILVEDSDNDHIYHSENFTLTKRMARGEPQKLSFTVPIFEPHPPQYYIRAVSDSWLQ
FT                   AEAFYTISFHNLALPEARTSHTELLDLKPLPVTSLGNRTYELLYKFSHFNPIQTQTFHV
FT                   LYHTDNNVLLGAPTGSGKTISAELAMLHLFNTQPDMKVIYIAPLKAIVRERMIDWKKRI
FT                   VSQLGKEMVEMTGDYTPDLMALMSADIIISTPEKWDGISRNWHNRGYVKKVGLMILDEI
FT                   HLLGADRGPILEVIVSRMRYISSQTERTVRFVGLSTALANAGDLADWLGVGEIGLFNFK
FT                   PSVRPVPLEVHIQGYPGKFYCPRMNSMNKPAYAAICTHSPMKPVLIFVSSRRQTRLTAL
FT                   DLIQFAASDEHPRQFLSMPEEALQMVLSQVTDQNLRHTLQFGIGLHHAGLNDKDRSLVE
FT                   ELFSNNKIQVLVCTSTLAWGVNLPAHLVIIKGTEFYDGKAKRYVDFPITDILQMMGRAG
FT                   RPQYDQHGKAVILVHEPKKSFYKKFLYEPFPVESSLREHFHDHINAEIVSGTICHKEDA
FT                   MHYLTWTYLFRRLMVNPAYYGLDDTDPEILSSYLSRLVQNTFEDLEDSGCIQMNEDNVE
FT                   PMMLGSIASQYYLSYMTVSMFGSNIGPDTSLEVFLHILSGASEYDELPVRHNEENYNEA
FT                   LSAKVPCMVDKNRLDDPHVKANLLFQAHFSQLELPISDYVTDLKSVLDQSIRIVQAMID
FT                   ICANSGWLSSTITCMHLLQMIMQGLWFSETSCLWMLPCMTNELEGSLTRRGISKVQQLL
FT                   DLPKATLQALINNFPASRLYQDLQYFPHVRVILKLQRKDANGGKSPTLNIRLERMNSKR
FT                   KSLRAFAPRFPKVKNEAWWLVLGNTSTSELFALKRVSFADRLVTHMKLPSSTPTNLQGM
FT                   KLILVSDCYIGFEQEHSIEELDGSQQL"
FT   gap             5019373..5019898
FT                   /estimated_length=526
FT   gap             5021024..5021122
FT                   /estimated_length=99
FT   3'UTR           5054433..5054819
FT                   /locus_tag="VIT_17s0000g07230"
FT                   /old_locus_tag="Vv17s0000g07230"
FT   gene            complement(5056519..5061861)
FT                   /locus_tag="VIT_17s0000g07220"
FT                   /old_locus_tag="Vv17s0000g07220"
FT   mRNA            complement(join(5056519..5056689,5056690..5056786,
FT                   5061577..5061657,5061779..5061861))
FT                   /locus_tag="VIT_17s0000g07220"
FT                   /old_locus_tag="Vv17s0000g07220"
FT   3'UTR           complement(5056519..5056689)
FT                   /locus_tag="VIT_17s0000g07220"
FT                   /old_locus_tag="Vv17s0000g07220"
FT   CDS_pept        complement(join(5056690..5056786,5061577..5061657,
FT                   5061779..5061861))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07220"
FT                   /old_locus_tag="Vv17s0000g07220"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI20"
FT                   /protein_id="CBI15130.3"
FT                   /translation="MKIIEKYLKFLISKDSFLHRISYKIFSKYYTLFYLCVGRLEGQIA
FT                   EKLNMDKAYGADLTTSRPTNGAPTAKAVTPRFREVNEVVFP"
FT   gene            complement(5064286..5066639)
FT                   /locus_tag="VIT_17s0000g07210"
FT                   /old_locus_tag="Vv17s0000g07210"
FT   mRNA            complement(join(5064286..5064461,5064462..5065103,
FT                   5065199..5065651,5066132..5066566,5066567..5066639))
FT                   /locus_tag="VIT_17s0000g07210"
FT                   /old_locus_tag="Vv17s0000g07210"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(5064286..5064461)
FT                   /locus_tag="VIT_17s0000g07210"
FT                   /old_locus_tag="Vv17s0000g07210"
FT   CDS_pept        complement(join(5064462..5065103,5065199..5065651,
FT                   5066132..5066566))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07210"
FT                   /old_locus_tag="Vv17s0000g07210"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5C6P2"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A5C6P2"
FT                   /protein_id="CCB43038.1"
FT                   /translation="MNPLALIFCTALFCILLYHFLTRRSVRLPPGPKPWPIVGNLPHLG
FT                   PVPHHSIAALAKTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHI
FT                   AYNYQDLVFAPYGPRWRMLRKICSVHLFSGQALDDFRHIRQEEVLALMRALARAGQTPV
FT                   KLGQLLNVCTTNALGRVMLGRRVFGDGSGGEDPKADEFKEMVVELMVLAGVFNIGDFVP
FT                   ALEWLDLQGVASKMKKLHARFDAFLGAIVEEHKISGSAGSERHVDLLSTLISLKDNADG
FT                   EGGKLTDVEIKALLLNLFTAGTDTSSSTVEWAIAELIRHPEMMAQAQQELDAVVGRGRL
FT                   VTDLDLPKLTYLQAIVKETFRLHPSTPLSLPRMAAESCEINGYHIPKNATLLVNVWAIA
FT                   RDPEVWEEPLEFRPNRFLPGGERPNADVRGNDFEVIPFGAGRRICAGMSLGLRMVHLLT
FT                   ATLVHAFNWELPEGQVAEKLNMDEAYGLTLQRAAPLMVHPRPRLSPQVFGK"
FT   5'UTR           complement(5066567..5066639)
FT                   /locus_tag="VIT_17s0000g07210"
FT                   /old_locus_tag="Vv17s0000g07210"
FT   gene            complement(5067210..5090083)
FT                   /locus_tag="VIT_17s0000g07200"
FT                   /old_locus_tag="Vv17s0000g07200"
FT   mRNA            complement(join(5067210..5067402,5087820..5088457,
FT                   5088706..5089158,5089594..5089665,5089666..5090083))
FT                   /locus_tag="VIT_17s0000g07200"
FT                   /old_locus_tag="Vv17s0000g07200"
FT                   /product="unknown predicted protein"
FT   CDS_pept        complement(join(5067210..5067402,5087820..5088457,
FT                   5088706..5089158,5089594..5089665))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07200"
FT                   /old_locus_tag="Vv17s0000g07200"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SI22"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI22"
FT                   /protein_id="CBI15132.3"
FT                   /translation="MLRKICSVHLFSGKALDDFRHIRQEEVAVLTRALARAGQTPVNLG
FT                   QLLNVCTTNALGRVMLGRRVFGDGSGGEDPKADEFKEMVVELMVLAGVFNIGDFVPALE
FT                   WLDLQGVAAKMKKLHARFDAFLGAIVEEHKISGSAGSERHVDLLSTLISVRDNADGEGG
FT                   KLTDVEIKALLLNLFTAGTDTSSSTVEWAIAELIRHPEMMAQAQQELDAVVGRSRLVTD
FT                   LDLPQLTYVQAIIKETFRLHPSTPLSLPRMAAESCEINGYHIPKNATLLVNVWAIARDP
FT                   EVWEEPLEFRPNRFLPGGERPNADVRGNDFEVIPFGAGRRICAGMSLGLRMVHLLTATL
FT                   VHAFNWELPEGQVAEKLNMDEAYGLTLQRAAPLMVHPRPRLSPQVFGKHHNLKSRAMRR
FT                   VNMTNKSTKTERESLHLSCIHLHSLPHWLRIRPVLGKFFPSFRMSSHLNMKF"
FT   gap             5082328..5082432
FT                   /estimated_length=105
FT   5'UTR           complement(5089666..5090083)
FT                   /locus_tag="VIT_17s0000g07200"
FT                   /old_locus_tag="Vv17s0000g07200"
FT   gene            complement(5103257..5106772)
FT                   /locus_tag="VIT_17s0000g07190"
FT                   /old_locus_tag="Vv17s0000g07190"
FT   mRNA            complement(join(5103257..5103457,5103458..5103757,
FT                   5103846..5104043,5104139..5104418,5104529..5105151,
FT                   5105263..5105444,5105620..5106772))
FT                   /locus_tag="VIT_17s0000g07190"
FT                   /old_locus_tag="Vv17s0000g07190"
FT                   /product="Heat shock protein"
FT   3'UTR           complement(5103257..5103457)
FT                   /locus_tag="VIT_17s0000g07190"
FT                   /old_locus_tag="Vv17s0000g07190"
FT   CDS_pept        complement(join(5103458..5103757,5103846..5104043,
FT                   5104139..5104418,5104529..5105151,5105263..5105444,
FT                   5105620..5106772))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07190"
FT                   /old_locus_tag="Vv17s0000g07190"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT15"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT15"
FT                   /protein_id="CCB43039.1"
FT                   /translation="MNPEKFTHKTNETLAGAHELAMNSGHAQLTPLHVAVALITDPNGI
FT                   LRQAIIGAGGNEEAANSVERVFNKALKKLPSQSPPPDEIPVSTTLIKVVRRAQSSQKSR
FT                   GDTHLAVDQLILGLLEDSQIGDLLKEAGVSTSRVKSEVEKLRGKEGKKVESASGDTTFQ
FT                   ALKTYGRDLVEQAGKLDPVIGRDEEIRRVIRILSRRTKNNPVLIGEPGVGKTAVVEGLA
FT                   QRIVRGDVPSNLAEVRLIALDMGALVAGAKYRGEFEERLKSVLKEVEEAEGKVILFIDE
FT                   IHLVLGAGRTEGSMDAANLFKPMLARGQLRCIGATTLEEYRKYVEKDAAFERRFQQVYV
FT                   AEPSVPDTISILRGLKERYEGHHGVRIQDRALVVAAQLSSRYITGRHLPDKAIDLVDEA
FT                   CANVRVQLDSQPEEIDNLERKRMQLEVELHALEKEKDKASKARLVEVRRELDDLRDKLQ
FT                   PLMMKYKKEKERIDELRRLKQKREELLFALQEAERRYDLARAADLRYGAIQEVEAAIAN
FT                   LEGTTDENMMLTETVGPEQIAEVVSRWTGIPVTRLGQNDKERLIGLAERLHQRVVGQDQ
FT                   AVSAVAEAVLRSRAGLGRPQQPTGSFLFLGPTGVGKTELAKALAEQLFDDENLLVRIDM
FT                   SEYMEQHSVSRLIGAPPGYVGHDEGGQLTEAVRRRPYSVVLFDEVEKAHIAVFNTLLQV
FT                   LDDGRLTDGQGRTVDFTNTVIIMTSNLGAEHLLSGLVGKCTMQDARDRVMQEVRRHFRP
FT                   ELLNRLDEIVVFDPLSHDQLRKVARLQMKDVASRLAERGIALAVTDAALDVVLAESYDP
FT                   VYGARPIRRWLEKKVVTELSKMLIREEIDENSTVYIDAGVSGKGLAYRVENNGGLVNAS
FT                   TGQKSDVLIRIPNGPRSDAAQAVKKMKIEEIEDEEDEMDL"
FT   gap             5114848..5114947
FT                   /estimated_length=100
FT   gene            5121321..5121848
FT                   /locus_tag="VIT_17s0000g07170"
FT                   /old_locus_tag="Vv17s0000g07170"
FT   mRNA            5121321..5121848
FT                   /locus_tag="VIT_17s0000g07170"
FT                   /old_locus_tag="Vv17s0000g07170"
FT                   /product="PB1 domain-containing protein"
FT   CDS_pept        5121321..5121848
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07170"
FT                   /old_locus_tag="Vv17s0000g07170"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI24"
FT                   /protein_id="CBI15134.3"
FT                   /translation="MPVAESYKDGWTRVRRRVENRTWIGIDLEGFVRTLPWTSGEVCLK
FT                   YQLPGEDLDALISVTNDEDLEHMMLEYNRLCHPSNKQARLRLFLFPLTPPASTSFGSNE
FT                   TKSERQWFVDALNSMQIQPLEGSSPQAAASETNPDFLFRLDKGLAPPPPVKLLPKNYSM
FT                   RSDPGSEIPYKL"
FT   gene            complement(5129490..5140014)
FT                   /locus_tag="VIT_17s0000g07160"
FT                   /old_locus_tag="Vv17s0000g07160"
FT   mRNA            complement(join(5129490..5129523,5129837..5129958,
FT                   5131297..5131542,5131646..5131750,5132119..5132250,
FT                   5132338..5132517,5134170..5134301,5135773..5135949,
FT                   5136814..5136999,5137120..5137252,5137858..5138192,
FT                   5139880..5139996,5139997..5140014))
FT                   /locus_tag="VIT_17s0000g07160"
FT                   /old_locus_tag="Vv17s0000g07160"
FT                   /product="PAF1 complex component"
FT   CDS_pept        complement(join(5129490..5129523,5129837..5129958,
FT                   5131297..5131542,5131646..5131750,5132119..5132250,
FT                   5132338..5132517,5134170..5134301,5135773..5135949,
FT                   5136814..5136999,5137120..5137252,5137858..5138192,
FT                   5139880..5139996))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07160"
FT                   /old_locus_tag="Vv17s0000g07160"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT16"
FT                   /db_xref="InterPro:IPR007149"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT16"
FT                   /protein_id="CCB43040.1"
FT                   /translation="MGEHKRHQMMQNLFGDQSEEEEEEIDSEHESNPQPGYISDEGEGG
FT                   PEPEGEGEIEGQGEAEVESEGELRDVDPDPGESEAERDQSSEDVEVGDQREESEGRETG
FT                   SDEKEGYGQRVVTSRRRDVIESGSERSEENHYADHEDEEVDQARSPRSPGEEKDQTHNS
FT                   HSVAEIRDVFGESDDEEAAEYAVDNDIEQNSIRSPMEEEGSYEKNLRPEDILPDEDAQY
FT                   GSEEENVEIKSKEKPVGPPLVLEVPLRRPPAHPDKMNMIKVSNIMGIEPKPFDPKTYVE
FT                   EDTFVTDESGSKKRIRLENNIVRWRNVKNPDGTTSYESNARFVRWSDGSLQLLIGNEVL
FT                   DISVQDAQHDQSHLFLRHGKGILQSQGRILRKMRFMPSSLSSNSHRLLTALVDSRHKKV
FT                   YKVKNCITDIDPEREKEEKEKAVSQTIRANQLLNRKREKVNRKYTQTVDRGRQLSPGFL
FT                   EEALDEDDEPDYHDSRRHRRRFEDDLEMDTRAEKRIFNVKKGHKDIPRKSSLSAIKSSR
FT                   RPVDFSDSEREESEYESDGEEDERSFSRKRAEEPEEEYAEEDEEEDERDEEEAEANEES
FT                   EEEVEEPKQKGKEYAKRKGIESDEDSPPRKTASHRRMAFVYESDEDLKEYLVTNFE"
FT   5'UTR           complement(5139997..5140014)
FT                   /locus_tag="VIT_17s0000g07160"
FT                   /old_locus_tag="Vv17s0000g07160"
FT   gene            5161425..5165148
FT                   /locus_tag="VIT_17s0000g07150"
FT                   /old_locus_tag="Vv17s0000g07150"
FT   mRNA            join(5161425..5161817,5161848..5161966,5161970..5162121,
FT                   5162122..5162453,5162753..5162801,5162913..5163160,
FT                   5163286..5163393,5164630..5164864,5164865..5165148)
FT                   /locus_tag="VIT_17s0000g07150"
FT                   /old_locus_tag="Vv17s0000g07150"
FT                   /product="Predicted protein"
FT   5'UTR           5161425..5161817
FT                   /locus_tag="VIT_17s0000g07150"
FT                   /old_locus_tag="Vv17s0000g07150"
FT   CDS_pept        join(5162122..5162453,5162753..5162801,5162913..5163160,
FT                   5163286..5163393,5164630..5164864)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07150"
FT                   /old_locus_tag="Vv17s0000g07150"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT17"
FT                   /protein_id="CCB43041.1"
FT                   /translation="MFPMYDAHKTTTMRTVEQPFFVGKSSDSLHTRNSMDQVNGAFDTS
FT                   QVANVQHSSTPISMASDHLSAPLSLPPNVTDQSLVVVRPKKRKSATCELLPWHKEVTQF
FT                   RRLQRNSMAELDWAQATNRLIDRVEDEAEIFEDGFPFLRPKRRLILTTQLMQQLLRPPP
FT                   AAILSVDASSNCESVVYSVARLTLGDVCSFLSVSGSDSSMSLESGNLLAEKHKTSEKIG
FT                   DQYFTKVMEDFISRARKLENDLFRLDNRASVLDLRVDCQDLEKFSVINRFAKFHSRGQA
FT                   DGPETSSSSDATANAQKTCPQRYVTALPMPRNLPDRVQCLSL"
FT   3'UTR           5164865..5165148
FT                   /locus_tag="VIT_17s0000g07150"
FT                   /old_locus_tag="Vv17s0000g07150"
FT   gene            complement(5185543..5192105)
FT                   /locus_tag="VIT_17s0000g07140"
FT                   /old_locus_tag="Vv17s0000g07140"
FT   mRNA            complement(join(5185543..5185764,5185765..5185819,
FT                   5186103..5186149,5187696..5187920,5188034..5188086,
FT                   5189224..5189392,5190801..5190842,5191492..5191576,
FT                   5191870..5192105))
FT                   /locus_tag="VIT_17s0000g07140"
FT                   /old_locus_tag="Vv17s0000g07140"
FT                   /product="Predicted protein"
FT   3'UTR           complement(5185543..5185764)
FT                   /locus_tag="VIT_17s0000g07140"
FT                   /old_locus_tag="Vv17s0000g07140"
FT   CDS_pept        complement(join(5185765..5185819,5186103..5186149,
FT                   5187696..5187920,5188034..5188086,5189224..5189392,
FT                   5190801..5190842,5191492..5191576,5191870..5192105))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07140"
FT                   /old_locus_tag="Vv17s0000g07140"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI27"
FT                   /protein_id="CBI15137.3"
FT                   /translation="METLDATSSCSSSSSNLQSPSSKTPTRPPSVICLWRPAAQRNLRN
FT                   QWSKLASYRQQWTSTASKGRSHATDLVNSYLSQRYMPAMELGVLSDMPNIRKKACMKLL
FT                   KQQGLHGSKLLSAYKDMVAVVTHMVNTSRSMRCFLKGTSSSPLVQFSSLSEDTNDLGDG
FT                   GGTPAFLFWPISSFEKLAEELVQMFILELNLKRLLVVELHSISCEEAPQKDRYCWSDEL
FT                   YPGEFDDWGICSLHSKEIGELIPPKIIGFESHSLVIRSNQQPDHEILQVYLTTWLAEVN
FT                   IDTHRVDEIFAVIGEEMHVGLS"
FT   gene            complement(5194622..5200417)
FT                   /locus_tag="VIT_17s0000g07130"
FT                   /old_locus_tag="Vv17s0000g07130"
FT   mRNA            complement(join(5194622..5194676,5195002..5195048,
FT                   5196098..5196322,5196436..5196488,5197461..5197629,
FT                   5199018..5199059,5199740..5199824,5200118..5200353,
FT                   5200354..5200417))
FT                   /locus_tag="VIT_17s0000g07130"
FT                   /old_locus_tag="Vv17s0000g07130"
FT                   /product="Predicted protein"
FT   CDS_pept        complement(join(5194622..5194676,5195002..5195048,
FT                   5196098..5196322,5196436..5196488,5197461..5197629,
FT                   5199018..5199059,5199740..5199824,5200118..5200353))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07130"
FT                   /old_locus_tag="Vv17s0000g07130"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI28"
FT                   /protein_id="CBI15138.3"
FT                   /translation="METLDSTSSCSSSASNLQSPSSKTPQPPPSVIRLWRPAAQRNLRN
FT                   QWSKLASYRQQWTSTASKGRSHATDLVNAYLSLRYMPAMELGVLSDMPNIRKKACMKLL
FT                   KQQGLHGSKLLSAYKDMVAVVTHMVNTSRSMRCFLKGTSSSPLVQFSSLSEDTNDLGDG
FT                   GGTPAFLFWPISSFEKLAEELVQMFILELNLKRLLVVELLSISCEEAPQDDRYCWSDEL
FT                   YPGEFDDLGICSLHSKEIGELIPPKIIGFESHSPVIRSNQQPDHEILQVYLTTWLAEVN
FT                   IDTHRVDEIFAVIGEEMHVGLP"
FT   5'UTR           complement(5200354..5200417)
FT                   /locus_tag="VIT_17s0000g07130"
FT                   /old_locus_tag="Vv17s0000g07130"
FT   gene            5200663..5204828
FT                   /locus_tag="VIT_17s0000g07120"
FT                   /old_locus_tag="Vv17s0000g07120"
FT   mRNA            join(5200663..5200730,5200731..5200889,5201733..5201833,
FT                   5204560..5204629,5204630..5204828)
FT                   /locus_tag="VIT_17s0000g07120"
FT                   /old_locus_tag="Vv17s0000g07120"
FT                   /product="Predicted protein"
FT   5'UTR           5200663..5200730
FT                   /locus_tag="VIT_17s0000g07120"
FT                   /old_locus_tag="Vv17s0000g07120"
FT   CDS_pept        join(5200731..5200889,5201733..5201833,5204560..5204629)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07120"
FT                   /old_locus_tag="Vv17s0000g07120"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SI29"
FT                   /db_xref="InterPro:IPR005351"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI29"
FT                   /protein_id="CBI15139.3"
FT                   /translation="MSSHNNSSPAVNDPRQPSTANPYVAPMVRPEDLPVDYSGFIAVIF
FT                   AIVGLMFRYKLCSWLAIIFCAQSLSNMRNFENDLKQISMAMMFAIMGLMTNYLGLGPTR
FT                   PSTQG"
FT   3'UTR           5204630..5204828
FT                   /locus_tag="VIT_17s0000g07120"
FT                   /old_locus_tag="Vv17s0000g07120"
FT   gap             5211900..5212077
FT                   /estimated_length=178
FT   gap             5215627..5221509
FT                   /estimated_length=5883
FT   gap             5224665..5231594
FT                   /estimated_length=6930
FT   gap             5243286..5243385
FT                   /estimated_length=100
FT   gene            5244200..5245492
FT                   /locus_tag="VIT_17s0000g07100"
FT                   /old_locus_tag="Vv17s0000g07100"
FT   mRNA            join(5244200..5244545,5244609..5245492)
FT                   /locus_tag="VIT_17s0000g07100"
FT                   /old_locus_tag="Vv17s0000g07100"
FT                   /product="unknown predicted protein"
FT   CDS_pept        join(5244200..5244545,5244609..5245492)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07100"
FT                   /old_locus_tag="Vv17s0000g07100"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT18"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT18"
FT                   /protein_id="CCB43042.1"
FT                   /translation="MASMPDKDGKQSRIELVSVPDGLNPEANRNDAVMLTESILTVMPG
FT                   HVKDLIEKINRTNDDEKITCVIADTTVGWALEVAEKMGIKRAAVWPGGPGDLALALHIP
FT                   KLIEARIIDTDGAPMKNELIHLAEDIPAFSITGLSWNLSDDPKIRDVIFGYAFRVSQTV
FT                   KLSNWLLCNSFYELHSSACNLISDILPIGPLLASNHPAHSAGNFWAEDSTCLRWLDKQP
FT                   AGSVIYVAFGSLAILSQHQFNELALGIELVGRPFLWVARSDFTNGSAVEYPDGFMQRVS
FT                   EYGKIVEWADQEKVLAHPSVACFLSHCGWNSTMEGVSMGVPFLCWPQFADQFCNRNFIC
FT                   DIWKVGLGLDPDGNGIISRHEIKIKIEKLLSDDGIKANALKLKEMARESVSEDGSSSKN
FT                   FKAFIEAVKH"
FT   gene            5277554..5291088
FT                   /locus_tag="VIT_17s0000g07090"
FT                   /old_locus_tag="Vv17s0000g07090"
FT   mRNA            join(5277554..5278048,5284120..5285117,5285305..5285414,
FT                   5285415..5285549,5290699..5290710,5290711..5290967,
FT                   5291016..5291088)
FT                   /locus_tag="VIT_17s0000g07090"
FT                   /old_locus_tag="Vv17s0000g07090"
FT   5'UTR           5277554..5278048
FT                   /locus_tag="VIT_17s0000g07090"
FT                   /old_locus_tag="Vv17s0000g07090"
FT   CDS_pept        join(5285415..5285549,5290699..5290710)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07090"
FT                   /old_locus_tag="Vv17s0000g07090"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT19"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT19"
FT                   /protein_id="CCB43043.1"
FT                   /translation="MGCFGNPIIVSGSILCNILYCIVELFSLIRGRRHGWPNHVKTSCT
FT                   MGL"
FT   gap             5285798..5285897
FT                   /estimated_length=100
FT   gap             5288551..5288650
FT                   /estimated_length=100
FT   gap             5289718..5289817
FT                   /estimated_length=100
FT   3'UTR           join(5290711..5290967,5291016..5291088)
FT                   /locus_tag="VIT_17s0000g07090"
FT                   /old_locus_tag="Vv17s0000g07090"
FT   gene            5297600..5299513
FT                   /locus_tag="VIT_17s0000g07080"
FT                   /old_locus_tag="Vv17s0000g07080"
FT   mRNA            join(5297600..5297882,5297883..5298375,5298479..5299039,
FT                   5299419..5299513)
FT                   /locus_tag="VIT_17s0000g07080"
FT                   /old_locus_tag="Vv17s0000g07080"
FT                   /product="unknown predicted protein"
FT   5'UTR           5297600..5297882
FT                   /locus_tag="VIT_17s0000g07080"
FT                   /old_locus_tag="Vv17s0000g07080"
FT   CDS_pept        join(5297883..5298375,5298479..5299039,5299419..5299513)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07080"
FT                   /old_locus_tag="Vv17s0000g07080"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT20"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT20"
FT                   /protein_id="CCB43044.1"
FT                   /translation="MGRRPHVLIIPLPAQGHVAPLMKLAHRISDHGIKVTFVNSDFIHA
FT                   KLLAALPHEAEARSGIGLASIPDGLDPGDDRKNMLKLTESISRVMPGHLKDLIEKVNHS
FT                   NDDEQITCVIADITLERWPMEVAEKMGIEGVPFCPMGAGIWALALHIPKLIEAGIVNST
FT                   DGSPLNDELICVSKGIPVLSSNSLPWQWPIDLKIQESVFRLYLTSIQIMDSSKWLLCNC
FT                   VYELDSSACDLIPNLLPIGPLLASSDPGHYAANFWPEDSTCIGWLDKQPAGSVIYVAFG
FT                   SFTILTQHQFNELALGIELVGRPFLWVVRSDFTDESAAEYPDGFIERVADHGKIVSWAP
FT                   QEEVLAHPSVASMCMHVQGLVCDLSVQKSWQLLHKICVVRVN"
FT   gene            5316844..5324942
FT                   /locus_tag="VIT_17s0000g07070"
FT                   /old_locus_tag="Vv17s0000g07070"
FT   mRNA            join(5316844..5317611,5317612..5317687,5317791..5318564,
FT                   5323341..5323844,5324052..5324935,5324936..5324942)
FT                   /locus_tag="VIT_17s0000g07070"
FT                   /old_locus_tag="Vv17s0000g07070"
FT                   /product="unknown predicted protein"
FT   5'UTR           5316844..5317611
FT                   /locus_tag="VIT_17s0000g07070"
FT                   /old_locus_tag="Vv17s0000g07070"
FT   CDS_pept        join(5317612..5317687,5317791..5318564,5323341..5323844,
FT                   5324052..5324935)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07070"
FT                   /old_locus_tag="Vv17s0000g07070"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SI32"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI32"
FT                   /protein_id="CBI15142.3"
FT                   /translation="MGAGIWALALHIPKLIEAGIVNSTDGTPLKDELICVSKGIPVLSC
FT                   NGLPWKWPIDLKVQEWVFRIYLTSIQFMNSSKRLLCNCVYELDSSACDLIPNLLPIGPL
FT                   PASRDPGHYAANFWPEDSTCIGWLDKQPAGSVIYVAFGSTGNLTQHQFNELALGIELVG
FT                   RPFLWVVRSDFTDGSAAEYPDGFIERVADHGKIVSWAPQEEVLAHPSVACFFSHCGWNS
FT                   TMDSIIMGVPFLCWPYVGDQFLDQNYICDKWKVGLGLNPDENGLISRHEIKMKIEKLVS
FT                   DDVLAATMGRRPHVLIIPFPAQGHVAPLMKFAYQISDHGIKVTFVNSDFIHEKLVAALP
FT                   DEDEARSRIGLASIPDGLGPGEDRKDSLKLTDSIFRVMPGHLKEFMEKVNNSNDDEKIT
FT                   CVIADSAFGWALEVADKMGIKRVAFCPFGPGSLALAFHIPRLIEAGLLNSTDGSLLNDE
FT                   LICLAKDIPAFSSNRLPWSCPSDPTLQEVIFRLAFKDISAINLSNWLICNSVYELDSSA
FT                   CDLIPNILPIGPLIANNHLGHYPGNFWPEDSTCISWLDKQPAGSVIYVAFGSLAILSQH
FT                   QFNELALGIELVGRPFLWVVRSDFTNGSDAEYPDGFIERVAENGKIVSWAPQEKVLAHP
FT                   SVACFLSHCGWNSTMDGIGMGVPFLCWPYVVDQFHNQSYICDKWKVGLGLNPDENGFIS
FT                   RHEIKKKIEMLVSDDVIKANAEKLKEMTRKSVSEGGSSYKNFQTFVEVMKQ"
FT   3'UTR           5324936..5324942
FT                   /locus_tag="VIT_17s0000g07070"
FT                   /old_locus_tag="Vv17s0000g07070"
FT   gene            5334247..5342123
FT                   /locus_tag="VIT_17s0000g07060"
FT                   /old_locus_tag="Vv17s0000g07060"
FT   mRNA            join(5334247..5334561,5335059..5335642,5340223..5340612,
FT                   5340613..5340835,5341024..5341907,5341908..5342123)
FT                   /locus_tag="VIT_17s0000g07060"
FT                   /old_locus_tag="Vv17s0000g07060"
FT                   /product="unknown predicted protein"
FT   5'UTR           5334247..5334561
FT                   /locus_tag="VIT_17s0000g07060"
FT                   /old_locus_tag="Vv17s0000g07060"
FT   CDS_pept        join(5340613..5340835,5341024..5341907)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07060"
FT                   /old_locus_tag="Vv17s0000g07060"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT21"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT21"
FT                   /protein_id="CCB43045.1"
FT                   /translation="MPGHLKELIEKVNNSNDDEKITCVIADTTVGWALEVAEKMGIKSV
FT                   AFCPCGPGSLALLFHIPRLIEAGHVNGIDGSLLNDELISLAKDIPAFSSNKLPWSCPSD
FT                   PNLQKVIFQFAFKDISAMNLSNWLLCNSVYELDSSACDLIPNILPIGPLLASNHLGHYT
FT                   GNFWPEDSTCISWLDKQPAGSVIYVAFGSVAILSQNQFNELALGIELVGRPFLWVVRSD
FT                   FTNGSAAEYPDGFIERVAEHGKIVSWAPQEKVLAHPSVACFLSHCGWNSTMDGIGMGVP
FT                   FLCWPYFADQFHNQSYICDKWKVGLGLNPDENGFISRHEIKKKIEMLVSDDGIKANAEK
FT                   LKEMARKSVIEGGSSYKNFQTFVEALKQ"
FT   3'UTR           5341908..5342123
FT                   /locus_tag="VIT_17s0000g07060"
FT                   /old_locus_tag="Vv17s0000g07060"
FT   gap             5348792..5348891
FT                   /estimated_length=100
FT   gene            5369365..5370209
FT                   /locus_tag="VIT_17s0000g07030"
FT                   /old_locus_tag="Vv17s0000g07030"
FT   mRNA            join(5369365..5370108,5370109..5370209)
FT                   /locus_tag="VIT_17s0000g07030"
FT                   /old_locus_tag="Vv17s0000g07030"
FT                   /product="unknown predicted protein"
FT   CDS_pept        5369365..5370108
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07030"
FT                   /old_locus_tag="Vv17s0000g07030"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT22"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT22"
FT                   /protein_id="CCB43046.1"
FT                   /translation="MDSSKRLPCNCVYELDSSACDLIPNLLPIGPLPASSDPGHYAANF
FT                   WPEDSTCIGWLDKQPAGSVIYVAFGSTGNLTQHQFNELALGIELVGRPFLWVVRSDFTD
FT                   GSAAEYPDGFIERVADHGKIVSWAPQEEVLAHPSVACFFSHCGWNSTMDSISMGVPFLC
FT                   WPYVVDQFLDQNYICDKWKVGLGLNPDENGLISRHEIKMKIEKLVSDDGIKANAEKLKE
FT                   MTRKSVSEGGSSYKNFKTFIEAMKH"
FT   3'UTR           5370109..5370209
FT                   /locus_tag="VIT_17s0000g07030"
FT                   /old_locus_tag="Vv17s0000g07030"
FT   gene            5373658..5376110
FT                   /locus_tag="VIT_17s0000g07020"
FT                   /old_locus_tag="Vv17s0000g07020"
FT   mRNA            join(5373658..5374779,5374780..5374885,5375070..5375953,
FT                   5375954..5376110)
FT                   /locus_tag="VIT_17s0000g07020"
FT                   /old_locus_tag="Vv17s0000g07020"
FT                   /product="unknown predicted protein"
FT   5'UTR           5373658..5374779
FT                   /locus_tag="VIT_17s0000g07020"
FT                   /old_locus_tag="Vv17s0000g07020"
FT   CDS_pept        join(5374780..5374885,5375070..5375953)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07020"
FT                   /old_locus_tag="Vv17s0000g07020"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT23"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT23"
FT                   /protein_id="CCB43047.1"
FT                   /translation="MGIESVAFCPCGPGTLALVFDIPRLIEAGHVNGIDGSLLNEELIC
FT                   LAKDIPAFSSNRLPWGCPSDLTVQEILFRLALQCIPAKNLSNWLLCNSVYELDSSACDL
FT                   IPNILPIGPLLASNHLGHYTGNFWPEDSTCIGWLDKQPAGSVIYVAFGSLAILSQNQFN
FT                   ELALGIELVGRPFLWVVRSDFTNGSAAEYPDGFIERVAEHGKIVSWAPQEKVLAHPSVA
FT                   CFLSHCGWNSTMDGIGIGVPFLCWPYFADQFHNQSYICDKWKVGLGLNPDENGFISRHE
FT                   IKKKIEMLVSDDGIKANAEKLKEMARKSVIEGGSSYKNFQTFVEALKQ"
FT   3'UTR           5375954..5376110
FT                   /locus_tag="VIT_17s0000g07020"
FT                   /old_locus_tag="Vv17s0000g07020"
FT   gene            5386570..5388543
FT                   /locus_tag="VIT_17s0000g07010"
FT                   /old_locus_tag="Vv17s0000g07010"
FT   mRNA            join(5386570..5386663,5387497..5387503,5387504..5387764,
FT                   5387859..5387993,5388069..5388362,5388363..5388543)
FT                   /locus_tag="VIT_17s0000g07010"
FT                   /old_locus_tag="Vv17s0000g07010"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           5386570..5386663
FT                   /locus_tag="VIT_17s0000g07010"
FT                   /old_locus_tag="Vv17s0000g07010"
FT   CDS_pept        join(5387504..5387764,5387859..5387993,5388069..5388362)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07010"
FT                   /old_locus_tag="Vv17s0000g07010"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR039123"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI36"
FT                   /protein_id="CBI15146.3"
FT                   /translation="MISGSKFISSKDGKNPKTKRDVHVKVGQTFVIAHGSCQFVTDLVN
FT                   NCFHIANKIKGFINPIDLLNHAYLETKVPGSSTACIITLNEWCLHAVNMGDNGFILLRN
FT                   EEILYESPVQQHTYKTPYQLGKANDSPEEIKLTELEPGDIIIAGSAGLFNNLFTHEIKD
FT                   LVINEIRKDPAPSPDMIAAEIAKNATERSIDKCRFTPYSKAAWLAGKRHKGGKIGEVTA
FT                   IFAFILP"
FT   3'UTR           5388363..5388543
FT                   /locus_tag="VIT_17s0000g07010"
FT                   /old_locus_tag="Vv17s0000g07010"
FT   gap             5390540..5390639
FT                   /estimated_length=100
FT   gene            5393809..5400036
FT                   /locus_tag="VIT_17s0000g07000"
FT                   /old_locus_tag="Vv17s0000g07000"
FT   mRNA            join(5393809..5393810,5393811..5393987,5395465..5395596,
FT                   5397196..5397375,5397479..5397610,5397979..5398083,
FT                   5398187..5398429,5399766..5399891,5399892..5400036)
FT                   /locus_tag="VIT_17s0000g07000"
FT                   /old_locus_tag="Vv17s0000g07000"
FT                   /product="PAF1 complex component"
FT   5'UTR           5393809..5393810
FT                   /locus_tag="VIT_17s0000g07000"
FT                   /old_locus_tag="Vv17s0000g07000"
FT   CDS_pept        join(5393811..5393987,5395465..5395596,5397196..5397375,
FT                   5397479..5397610,5397979..5398083,5398187..5398429,
FT                   5399766..5399891)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g07000"
FT                   /old_locus_tag="Vv17s0000g07000"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SI37"
FT                   /db_xref="InterPro:IPR007149"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI37"
FT                   /protein_id="CBI15147.3"
FT                   /translation="MNMIKVSNTMGIEPKPFDPKMYVEEDTFVTDESGSKKRMRLENNI
FT                   VRWRNVKNPDGTTSYESNARFVRWSDGSLQLLIGNEVLDISVQDAQHDQSHLFLRHGKG
FT                   ILQSQGRILRKMRFMPSSLSSNSHRLLTALVDSRHKKVYKIKNCITDIDPEREKEEKEK
FT                   AVSQTIRANQLLNRKREKVNRKYTQTVDRGRQLSPGFLEEALDEDDEPDYHDSHRHRRR
FT                   FEDDLEMDTQAEKRIFNVKKGHKDIPHKSSLSAIKSSRRPVDFSDSEREESEYESDGEE
FT                   DERSFSRKRAEEPEEEYAEEEEEEDEHDEEEAEANEESEEVEEPKQKGKEYAKRKGIES
FT                   DEDSPPRKSASHRRMAFVYDSDEE"
FT   3'UTR           5399892..5400036
FT                   /locus_tag="VIT_17s0000g07000"
FT                   /old_locus_tag="Vv17s0000g07000"
FT   gene            complement(5409584..5410980)
FT                   /locus_tag="VIT_17s0000g06990"
FT                   /old_locus_tag="Vv17s0000g06990"
FT   mRNA            complement(join(5409584..5409698,5409699..5409871,
FT                   5409892..5409908,5409932..5409954,5409972..5410043,
FT                   5410709..5410737,5410788..5410980))
FT                   /locus_tag="VIT_17s0000g06990"
FT                   /old_locus_tag="Vv17s0000g06990"
FT                   /product="Ribosomal protein L2"
FT   3'UTR           complement(5409584..5409698)
FT                   /locus_tag="VIT_17s0000g06990"
FT                   /old_locus_tag="Vv17s0000g06990"
FT   CDS_pept        complement(join(5409699..5409871,5409892..5409908,
FT                   5409932..5409954,5409972..5410043,5410709..5410737,
FT                   5410788..5410980))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06990"
FT                   /old_locus_tag="Vv17s0000g06990"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT24"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR003441"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR036093"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT24"
FT                   /protein_id="CCB43048.1"
FT                   /translation="MEVAEGDKARFSLKKLPMGYRFLPTDEELVVYYLINKAFYRPLPA
FT                   EVIPDIREREFYSSPPSDLDLLILDMVDKKLTTLKLPSGEVRLISKNCSTVGQSDMWEM
FT                   LGADLSVVRGVVMNPVDHPHRSGEGRAPIGRKKPTTPWGYPALGRRSRKRNKYSDNLIL
FT                   HRRSK"
FT   gene            5416384..5419452
FT                   /locus_tag="VIT_17s0000g06980"
FT                   /old_locus_tag="Vv17s0000g06980"
FT   mRNA            join(5416384..5416432,5416433..5416516,5418677..5418767,
FT                   5418849..5419032,5419192..5419264,5419265..5419452)
FT                   /locus_tag="VIT_17s0000g06980"
FT                   /old_locus_tag="Vv17s0000g06980"
FT                   /product="Predicted protein"
FT   5'UTR           5416384..5416432
FT                   /locus_tag="VIT_17s0000g06980"
FT                   /old_locus_tag="Vv17s0000g06980"
FT   CDS_pept        join(5416433..5416516,5418677..5418767,5418849..5419032,
FT                   5419192..5419264)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06980"
FT                   /old_locus_tag="Vv17s0000g06980"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5C4J2"
FT                   /db_xref="InterPro:IPR001266"
FT                   /db_xref="InterPro:IPR018277"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038111"
FT                   /db_xref="UniProtKB/TrEMBL:A5C4J2"
FT                   /protein_id="CBI15148.3"
FT                   /translation="MATARTVKDVSPHEFVNAYAAHLKRSGKIELPHWTDIVKTATFKE
FT                   LAPYDPDWYYIRAASMARKIYLRGGIGVGAFRRIYGGSKRNGSRPPHFCKSSGSIARHI
FT                   LQQLQTMNIIELDSKGGRRITSSGQRDLDQVAGRIAVAH"
FT   3'UTR           5419265..5419452
FT                   /locus_tag="VIT_17s0000g06980"
FT                   /old_locus_tag="Vv17s0000g06980"
FT   gene            5425057..5433701
FT                   /locus_tag="VIT_17s0000g06970"
FT                   /old_locus_tag="Vv17s0000g06970"
FT   mRNA            join(5425057..5425414,5426120..5426371,5427112..5427558,
FT                   5427559..5428737,5429602..5429965,5430776..5430852,
FT                   5431694..5431813,5432361..5432525,5433018..5433158,
FT                   5433375..5433524,5433525..5433701)
FT                   /locus_tag="VIT_17s0000g06970"
FT                   /old_locus_tag="Vv17s0000g06970"
FT                   /product="unknown predicted protein"
FT   5'UTR           5425057..5425414
FT                   /locus_tag="VIT_17s0000g06970"
FT                   /old_locus_tag="Vv17s0000g06970"
FT   CDS_pept        join(5427559..5428737,5429602..5429965,5430776..5430852,
FT                   5431694..5431813,5432361..5432525,5433018..5433158,
FT                   5433375..5433524)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06970"
FT                   /old_locus_tag="Vv17s0000g06970"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SI39"
FT                   /db_xref="InterPro:IPR000756"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR002219"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR037607"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI39"
FT                   /protein_id="CBI15149.3"
FT                   /translation="MDYYREPDVLLAWNNMSPSEMAESRLFIFSSLIAALVGILTIAYT
FT                   AFQWRRNINLSWMKAMARSKKNPKTRDKVPVAPHTWILESVSRGKSLNCCVCLKSMSPS
FT                   QTLGPMVASDSFIHRCSICGAAAHLSCSSQAQKDCKCVSMKGYEHVIHQWAVQWTEITD
FT                   QLDETSFCSYCEEPCSGSFLGGSPIWCCMWCQRLVHVDCHGIMSIETGDICDLGSFRRL
FT                   ILSPLFVKEVNRTSSGGFLSSITHGANEIASSVRASIRNQGKKYKQGNEPSVDTTNSCD
FT                   NGDISTESTAETHQTVNGSHAMDEGCNGSTNIESPRQDSDVGKKLDSGSSFKRSASINQ
FT                   KDESQVLQMKQRYELSDLPSDARPLLVFINKKSGSQRGGSLRQRLNILLNPVQVFELSS
FT                   AQGPEVGLYLFKKVPHFRVLVCGGDGTVGWVLNAIDKQNFVSPPPVAILPAGTGNDMAR
FT                   VLNWGGGLGSVERQGGLCTVLHHIEHAAVTMLDRWKITILQQGKQLQAPKFMNNYLGIG
FT                   CDAKVALDIHNLREENPEKFYNQFMNKVLYAREGAKNIMDRTFADFPWQVRVEVDGVEV
FT                   EVPEDAEGVLVANIGSYMGGVDLWQNEDENYDNFDPQSMHDKMLEVVSISGTWHLGKLQ
FT                   VGLSRARRLAQGQSIKIHLFAPFPIQIDGEPWFQEQLCTLTISHHGQAFMLKRVSEEPL
FT                   GHAAAIITDVLENAETNHIISASQKRTLLQEMALKLS"
FT   3'UTR           5433525..5433701
FT                   /locus_tag="VIT_17s0000g06970"
FT                   /old_locus_tag="Vv17s0000g06970"
FT   gene            5438387..5442304
FT                   /locus_tag="VIT_17s0000g06960"
FT                   /old_locus_tag="Vv17s0000g06960"
FT   mRNA            join(5438387..5438439,5439675..5439741,5440710..5442173,
FT                   5442174..5442304)
FT                   /locus_tag="VIT_17s0000g06960"
FT                   /old_locus_tag="Vv17s0000g06960"
FT                   /product="UDP-glucose dehydrogenase"
FT   CDS_pept        join(5438387..5438439,5439675..5439741,5440710..5442173)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06960"
FT                   /old_locus_tag="Vv17s0000g06960"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT25"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028356"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT25"
FT                   /protein_id="CCB43049.1"
FT                   /translation="MQCNPIERYPLQCKTLFLSFSLSYSSEVRLFLVGFIALFKVFHNT
FT                   TKMVKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISISRITAWNSDQLPIYEPGLEEV
FT                   VKQCRGRNLFFSTNVEKHISEADIIFVSVNTPTKTRGLGAGKAADLTYWESAARMIADV
FT                   SKSNKIVVEKSTVPVKTAEAIEKILSHNSKGISYQILSNPEFLAEGTAIQDLLNPDRVL
FT                   IGGRETPGGQKAIKALKDVYAHWVPEDRIISTNLWSAELSKLAANAFLAQRISSVNAMS
FT                   ALCEATGADVSEVSHAIGKDSRIGPKFLNASVGFGGSCFQKDILNLIYICECNGLPEVA
FT                   NYWKQVIKVNDYQKNRFVNRVVASMFNTVSGKKIAILGFAFKKDTGDTRETPAIDVCKG
FT                   LLGDKASLSIYDPQVTGDQIQREISMNKFDWDHPVHLQPMSPTSVKQVNVVWDPYEATR
FT                   DAHGICILTEWDEFKTLDYQRIFNNMQKPAFVFDGRNIVNIEKLREIGFIVYSIGKPLD
FT                   PWLKDMPAIA"
FT   3'UTR           5442174..5442304
FT                   /locus_tag="VIT_17s0000g06960"
FT                   /old_locus_tag="Vv17s0000g06960"
FT   gene            complement(5443161..5465073)
FT                   /locus_tag="VIT_17s0000g06950"
FT                   /old_locus_tag="Vv17s0000g06950"
FT   mRNA            complement(join(5443161..5443617,5443618..5443667,
FT                   5444590..5444662,5444750..5444812,5445780..5445880,
FT                   5445974..5446097,5446657..5446719,5447108..5448148,
FT                   5448552..5448612,5448694..5448809,5449317..5449403,
FT                   5449802..5449891,5450084..5450152,5450725..5450793,
FT                   5450880..5450937,5451146..5451203,5451299..5451366,
FT                   5451568..5451647,5459104..5459167,5461663..5461734,
FT                   5461892..5461951,5462869..5462923,5463024..5463057,
FT                   5463835..5463921,5464218..5464289,5464396..5464614,
FT                   5464717..5464847,5464974..5465073))
FT                   /locus_tag="VIT_17s0000g06950"
FT                   /old_locus_tag="Vv17s0000g06950"
FT                   /product="putative RNA helicase"
FT   3'UTR           complement(5443161..5443617)
FT                   /locus_tag="VIT_17s0000g06950"
FT                   /old_locus_tag="Vv17s0000g06950"
FT   CDS_pept        complement(join(5443618..5443667,5444590..5444662,
FT                   5444750..5444812,5445780..5445880,5445974..5446097,
FT                   5446657..5446719,5447108..5448148,5448552..5448612,
FT                   5448694..5448809,5449317..5449403,5449802..5449891,
FT                   5450084..5450152,5450725..5450793,5450880..5450937,
FT                   5451146..5451203,5451299..5451366,5451568..5451647,
FT                   5459104..5459167,5461663..5461734,5461892..5461951,
FT                   5462869..5462923,5463024..5463057,5463835..5463921,
FT                   5464218..5464289,5464396..5464614,5464717..5464847,
FT                   5464974..5465073))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06950"
FT                   /old_locus_tag="Vv17s0000g06950"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT26"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT26"
FT                   /protein_id="CCB43050.1"
FT                   /translation="MGSESNLKVWVSDKLMSLLGYSQPTLVQYVVGLAKQASSPADVVG
FT                   KLVEFGLSASSETRSFAEEIFSKVPHKASGLNVYQKQEREAAMLVRKQKTYAILDADDS
FT                   DEDGGGIVDNRSSTAAPAASQSEKADTHKKRFRKKTENVEDDADDEVIARAEESRQVKR
FT                   RTSQDEDDDSELEEESLRDRREREQLEQNIRQRDAAGTRKLTEQKLSRKEEEEAIRRSN
FT                   AMEEDDISALRKVSRQEYLKKREQKKLEELRDDIEDEQYLFDGVKLTEAEQRELRYKRE
FT                   IYDLVKKRSEETDDINEYRMPDAYDQEGGVNQEKRFSVALQRYRDSSANDKMNPFAEQE
FT                   AWEEHQIGKATLKFGSKDKNQKSDDYQLVFEDQIEFIKASVMDGDKFEDGLFAESHDDS
FT                   VAKSELEKLQEDRKMLPIYPYRDELLKAVDDHQILVIVGETGSGKTTQIPQYLHESGYT
FT                   KRGKVGCTQPRRVAAMSVAARVSQEMGVKLGHEVGYSIRFEDCTSEKTVLKYMTDGMLL
FT                   REFLGEPDLASYSVVMVDEAHERTLSTDILFGLDIARFRPDLKLLISSATLDAEKFSDY
FT                   FDSAPIFKIPGRRYPVEIHYTKAPEADYLDAAIVTALQIHVTQPPGDILVFLTGQEEIE
FT                   TAEEIMKHRTRGLGTKIAELIICPIYANLPTELQANIFEPTPEGARKVVLATNIAETSL
FT                   TIDGIKYVIDPGFCKMKSYNPRTGMESLLVNPISKASAMQRAGRSGRTGPGKCFRLYTA
FT                   YNYYNDLEDNTVPEIQRTNLANVVLSLKSLGIHDLLNFDFMDPPPAEALLKALELLYAL
FT                   SALNRLGELTKVGRRMAEFPLDPMLSKMIVAADNYKCSDEIISIAAMLSVGNSIFYRPK
FT                   DKQVHADNARMNFHTGNVGDHIALLKVYSSWKETNYSTQWCYENYIQVRSMKRARDVRD
FT                   QLEGLLERVEIELASNPNDLDAIKKSITAGFFPHSARLQKNGSYRTVKHPQTVHIHPSS
FT                   GLAQVLPRWVIYHELVLTTKEYMRQVTELKPEWLVEIAPHFYQLKDVEDPGSKKMPRTE
FT                   GRAVKD"
FT   gene            5469605..5485993
FT                   /locus_tag="VIT_17s0000g06940"
FT                   /old_locus_tag="Vv17s0000g06940"
FT   mRNA            join(5469605..5469671,5469672..5469770,5471971..5472040,
FT                   5473338..5473384,5474737..5474845,5474970..5475055,
FT                   5475742..5475832,5476754..5476839,5484379..5484465,
FT                   5484574..5484684,5484685..5484712,5485723..5485993)
FT                   /locus_tag="VIT_17s0000g06940"
FT                   /old_locus_tag="Vv17s0000g06940"
FT                   /product="Predicted protein"
FT   5'UTR           5469605..5469671
FT                   /locus_tag="VIT_17s0000g06940"
FT                   /old_locus_tag="Vv17s0000g06940"
FT   CDS_pept        join(5469672..5469770,5471971..5472040,5473338..5473384,
FT                   5474737..5474845,5474970..5475055,5475742..5475832,
FT                   5476754..5476839,5484379..5484465,5484574..5484684)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06940"
FT                   /old_locus_tag="Vv17s0000g06940"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SI42"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI42"
FT                   /protein_id="CBI15152.3"
FT                   /translation="MGCCLSKNGDSKASRIGRWKSTGIVALRDSKLKAFPDEVLDLDTS
FT                   VRTLDLTHNRLVDIPMEISKLINMQRLILADNLIERLPMNLGKLQSLKVMTLDGNQVTT
FT                   LPDELGMLVRLERLSISGNLLTCLPETIGSLRNLLLLNVSNNKLKCLPESVGSCFSLEE
FT                   LQANDNSIEDIPASFCNLIHLKSLCLNNNNINQIPPNLLKDCKALQNISLHDNPISMDQ
FT                   FQQMEGFQAFETRRKKKFDKQIDSNVMISSKGLDEGVDQ"
FT   3'UTR           join(5484685..5484712,5485723..5485993)
FT                   /locus_tag="VIT_17s0000g06940"
FT                   /old_locus_tag="Vv17s0000g06940"
FT   gene            complement(5488816..5492397)
FT                   /locus_tag="VIT_17s0000g06930"
FT                   /old_locus_tag="Vv17s0000g06930"
FT   mRNA            complement(join(5488816..5488985,5488986..5489099,
FT                   5489309..5489701,5489820..5489885,5489999..5490097,
FT                   5490856..5491324,5492234..5492364,5492365..5492397))
FT                   /locus_tag="VIT_17s0000g06930"
FT                   /old_locus_tag="Vv17s0000g06930"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(5488816..5488985)
FT                   /locus_tag="VIT_17s0000g06930"
FT                   /old_locus_tag="Vv17s0000g06930"
FT   CDS_pept        complement(join(5488986..5489099,5489309..5489701,
FT                   5489820..5489885,5489999..5490097,5490856..5491324,
FT                   5492234..5492364))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06930"
FT                   /old_locus_tag="Vv17s0000g06930"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT27"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT27"
FT                   /protein_id="CCB43051.1"
FT                   /translation="MSSQCIVPNWNLRHQRQEQVEGEEGNRSSHVHTHQKNSSHIVPMS
FT                   NYEVAELTWENGQLAMHGLGGLLPTAPTKPTWGRAGDTLESIVHQATCHNQNSNFIHHA
FT                   QNLANMKSTVGSSAHVQTGNQGLMKKRTRSDSAHCGRNFSTNVHEAERADRSACASASA
FT                   TFCRDNETTMMTWPSSESPRSLKAKTTDEDSACHGGSENQDEDRETKTQTGRSHSTRRS
FT                   RAAAIHNQSERRRRDRINQKMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQMMSV
FT                   RNMPQMMMPMGMQQQLQMSLLARMGMGVGLGMGMGMLDMSAVPRAAPQTLPSLLHANPV
FT                   VAATPTFVPPPFVVPPMMPSSSQPKSDAGANAAVPLQDPYCAFLAQSMNMDLYHKMAAL
FT                   YRQHVNHKAQPTSSPPHSNHDLGD"
FT   5'UTR           complement(5492365..5492397)
FT                   /locus_tag="VIT_17s0000g06930"
FT                   /old_locus_tag="Vv17s0000g06930"
FT   gene            complement(5498949..5500046)
FT                   /locus_tag="VIT_17s0000g06920"
FT                   /old_locus_tag="Vv17s0000g06920"
FT   mRNA            complement(join(5498949..5499037,5499038..5499229,
FT                   5499314..5499395,5499487..5499697,5499769..5499967,
FT                   5499968..5500046))
FT                   /locus_tag="VIT_17s0000g06920"
FT                   /old_locus_tag="Vv17s0000g06920"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(5498949..5499037)
FT                   /locus_tag="VIT_17s0000g06920"
FT                   /old_locus_tag="Vv17s0000g06920"
FT   CDS_pept        complement(join(5499038..5499229,5499314..5499395,
FT                   5499487..5499697,5499769..5499967))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06920"
FT                   /old_locus_tag="Vv17s0000g06920"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR005516"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI44"
FT                   /protein_id="CBI15154.3"
FT                   /translation="MSKDYDSDDEEFATAVAAAAFAIYTLEEPNLQYQKRTRDGLETSM
FT                   SRLKSRKEDTTGFFGKETQTPGEASIRRQMTNNGNSMENAFPSSRPSKASPVRSVSAAP
FT                   RDQRQQGYSTSNRSVETKADAWEKAQITKIKKRNDNISSRILAWENEKKMRAKLIMERK
FT                   KSELEQRKALNLQHYQIKIERIDQIAGGARAQLQEKRRNEESEVKHKAEMIRKTGKVPV
FT                   RCFCF"
FT   5'UTR           complement(5499968..5500046)
FT                   /locus_tag="VIT_17s0000g06920"
FT                   /old_locus_tag="Vv17s0000g06920"
FT   gene            5544000..5545696
FT                   /locus_tag="VIT_17s0000g06900"
FT                   /old_locus_tag="Vv17s0000g06900"
FT   mRNA            join(5544000..5544034,5544434..5544513,5544826..5545001,
FT                   5545517..5545696)
FT                   /locus_tag="VIT_17s0000g06900"
FT                   /old_locus_tag="Vv17s0000g06900"
FT                   /product="putative uncharacterized protein"
FT   CDS_pept        join(5544000..5544034,5544434..5544513,5544826..5545001,
FT                   5545517..5545696)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06900"
FT                   /old_locus_tag="Vv17s0000g06900"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT28"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT28"
FT                   /protein_id="CCB43052.1"
FT                   /translation="MDVNNYKHEKRRLDKLVNDPTEGNAWHADHIVPVYQGGGECRLEN
FT                   MRTLCVGCHSDVTAAQCAERRSVRIKAKKQLKVIMNSLKDDAKMKHTCGNSKNQGHLEI
FT                   HEDILEDELLIKVPGSAYSGQKSTTTGGELEELSPSKLNNSETHCEASTGSI"
FT   gene            complement(5546146..5557272)
FT                   /locus_tag="VIT_17s0000g06890"
FT                   /old_locus_tag="Vv17s0000g06890"
FT   mRNA            complement(join(5546146..5546556,5546557..5547099,
FT                   5547178..5547288,5548986..5549075,5549272..5549376,
FT                   5551751..5552866,5553230..5555002,5556085..5557272))
FT                   /locus_tag="VIT_17s0000g06890"
FT                   /old_locus_tag="Vv17s0000g06890"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(5546146..5546556)
FT                   /locus_tag="VIT_17s0000g06890"
FT                   /old_locus_tag="Vv17s0000g06890"
FT   CDS_pept        complement(join(5546557..5547099,5547178..5547288,
FT                   5548986..5549075,5549272..5549376,5551751..5552866,
FT                   5553230..5555002,5556085..5557272))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06890"
FT                   /old_locus_tag="Vv17s0000g06890"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR032446"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT29"
FT                   /protein_id="CCB43053.1"
FT                   /translation="MHSQGSAGNPIPVSNEDEKGVSYLDKCVVNQDSGCSKSSQSGTTL
FT                   PTNSNSRTGNVQEVPQKDKPDVVHKIKWGDLEEDTFVQNQESSVGPEIKFGAISDNNLP
FT                   VCRNSEISNDLVSCVSSCTDPLGNHLEIISGNADVVANENSLSLGNESIEGKSTKVNEI
FT                   SLKDMEVLVEDGGTGPKNDVSYCKEVHHECVKLINDCTLSSSCPTGGDAEMTVKLQVPI
FT                   IMSQDSHSEISELPVRNGDSTTLMVVQDSMSYPPENSGPEVSVESTITDSVEVSGVAQD
FT                   SKIHHDASKLEIMSSSGEGDAGESKERFRQRLWCFLFENLNRAVDELYLLCELECDLEQ
FT                   MKEAILVLEEAASDFKELNSRVKEFEKVKKSSSQLTDSTPMTMKTDHRRPHALSWEVRR
FT                   MTTSPHRAEILSSSLEAFKKIQQERASMRQVNDPKIPGPEFPIQYCEDSILKPRKQGGV
FT                   SDLIQGNLNAEKRNVEPVKSSKLNSVQNGRVSSQNCSTSDPNSCRLPVKDGSAFSGKGK
FT                   REHLGFTSESDKLLPKKDTMLTESNIEKNPKPMDHLKRQIPIAEKDKDKEKEKRNAPSW
FT                   KSMDAWKEKRNWEDILASPFRVSSRVSHSPGMSRRSVERARILHDKLMTPEKRKKTALD
FT                   LKKEAEEKHARAMRIRSELENERVQKLQRTSEKLNRVNEWQAVRSMKLREGMYARHQRS
FT                   ESRHEAFLAQVVRRAGDESSKVNEVRFITSLNEENKKLMLRQKLHDSEVRRAEKLQVIK
FT                   TKQKEDMAREEAVLERRKLIEAEKLQRLAETQRKKEEALFRREEERKASSAAREAKAIE
FT                   QLRRREVRAKAQQEEAELLAQKLAEKLSESEQRRKFYLEQIRERASMDFRDQSSPLLRR
FT                   SLNKDSQGRSTPTNNNEDYQATSISGLGSATIPTGNVGLQQSMRRRIKRIRQKLMALKY
FT                   EFLEPPVGNENAGIGYRTAMGTARAKIGRWLQELQKLRQARKEGAASIGLITAEMIKFL
FT                   EGKDPELNASRQAGLVDFIASALPASHTSKPEACQVTIYLLRLLRVVLSVPATRSYFLA
FT                   QNLLPPIIPMLSAALENYIKIAASLNIPGSTSLSSSKASVENFESISEVLDGFLWTVTT
FT                   IIGHISSDERQLQMQDGLLELVIAYQVIHRLRDLFALYDRPQVEGAPFPSSILLSINLL
FT                   TVLTSRPRTISLIDWKSFPVETITGNEIQEAKLTESADFGHSYVNNSSGDPRPPLSTLN
FT                   GSTILPLPDVPEDRPLDEPCKINRNIESVSIGKDCEKRLADISIELNNVDSNMTDASDS
FT                   SQTNLSEDISKSCIPQKGEQNSKNICAEQKTENISSLKQPMAFLLSAISDTGLVSLPSL
FT                   LTAVLLQANNRLSSEQGSYVLPSNFEEVATGVLKVLNNLALIDITFMQRMLARPDLKME
FT                   FFHLMSFLLSHCTSKWKVAYDQVGLLLLESLLLLSYFSLFHPGNQAVLRWGKSPTIIHK
FT                   VCDLPFVFFSDPELMPILAGTLVAACYGCEQNKGVVQQEVSMDMLLSLLRSCRNALPGV
FT                   RSNSILDSTRMDDSSECNTVGPESRKLLMDVSLRPSRHNARSTRGILGKGVASGNSLRL
FT                   GKMRNQRDSKGLKTCEEMALKHNMQAPETPSALMLHFRFPSSFMDRAEQFFSAGTASVG
FT                   DEV"
FT   gene            5563251..5569954
FT                   /locus_tag="VIT_17s0000g06880"
FT                   /old_locus_tag="Vv17s0000g06880"
FT   mRNA            join(5563251..5563350,5564863..5564912,5564913..5565122,
FT                   5565245..5565281,5565465..5565648,5566366..5566514,
FT                   5566604..5566837,5568428..5568617,5568771..5568896,
FT                   5569019..5569118,5569360..5569749,5569750..5569954)
FT                   /locus_tag="VIT_17s0000g06880"
FT                   /old_locus_tag="Vv17s0000g06880"
FT                   /product="unknown predicted protein"
FT   5'UTR           5563251..5563350
FT                   /locus_tag="VIT_17s0000g06880"
FT                   /old_locus_tag="Vv17s0000g06880"
FT   CDS_pept        join(5564913..5565122,5565245..5565281,5565465..5565648,
FT                   5566366..5566514,5566604..5566837,5568428..5568617,
FT                   5568771..5568896,5569019..5569118,5569360..5569749)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06880"
FT                   /old_locus_tag="Vv17s0000g06880"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT30"
FT                   /db_xref="InterPro:IPR005199"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT30"
FT                   /protein_id="CCB43054.1"
FT                   /translation="MGFRFFLFLFLATLPAFLAQEFEDAIIKVDGATTVAETDANFICA
FT                   TLDWWPHDKCNYNHCPWGYSSVINMDLSHPLFAKAIEAFKHLRIRIGGSLQDQVLYDIG
FT                   SLRSPCHPFRKMNDGLFGFSKGCLRMSRWDELNRLFSQTGVILTFGLNALYGRYQIRKG
FT                   AWAGVWDSSNTQNFIKYTISKGYQIDSWEFGNELSGSGVGASVNAEQYGKDLINLKAII
FT                   NKLYNNSNVKPLLVAPGGFYEQDWYAKLLQVSGSSTVNVVTHHIYNLGAGVDPNLVSKI
FT                   LNPHYLSRVEETFKSLDKTLQTWGPWASAWVGESGGAYNSGGHLVSNTFVNSFWYLDQL
FT                   GMASKYHTKVYCRQTLIGGNYGLLNTTTLVPNPDYYSALLWHRLMGKGVLAVDSTASPF
FT                   LRSYAHCSKGKAGITLLLINLSNQTTFQINVENSMNLNLFVKKTTMYRGSAFMRGLKKS
FT                   ASWIGSKADEQLFREEYHLTPKDGYLRSQTMVLNGMPLELTDDGNIPSLNPVRLNLNAP
FT                   IFINPLSIAFIAFPNFDAPACA"
FT   3'UTR           5569750..5569954
FT                   /locus_tag="VIT_17s0000g06880"
FT                   /old_locus_tag="Vv17s0000g06880"
FT   gene            5571023..5573991
FT                   /locus_tag="VIT_17s0000g06870"
FT                   /old_locus_tag="Vv17s0000g06870"
FT   mRNA            join(5571023..5571089,5571090..5571362,5571363..5571377,
FT                   5573781..5573991)
FT                   /locus_tag="VIT_17s0000g06870"
FT                   /old_locus_tag="Vv17s0000g06870"
FT                   /product="unknown predicted protein"
FT   5'UTR           5571023..5571089
FT                   /locus_tag="VIT_17s0000g06870"
FT                   /old_locus_tag="Vv17s0000g06870"
FT   CDS_pept        5571090..5571362
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06870"
FT                   /old_locus_tag="Vv17s0000g06870"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT31"
FT                   /protein_id="CCB43055.1"
FT                   /translation="MASTPSKSQILSLFRSLLRTARDFSDYNIREYTKRRTIDGFRHNR
FT                   HVSDPSSIAAAYSDAESQLQIARRQVIVYSLYVPKLKSVMEIKHA"
FT   3'UTR           join(5571363..5571377,5573781..5573991)
FT                   /locus_tag="VIT_17s0000g06870"
FT                   /old_locus_tag="Vv17s0000g06870"
FT   gene            complement(5577494..5581136)
FT                   /locus_tag="VIT_17s0000g06860"
FT                   /old_locus_tag="Vv17s0000g06860"
FT   mRNA            complement(join(5577494..5577666,5577667..5577766,
FT                   5577884..5577981,5578319..5578449,5578614..5578707,
FT                   5580575..5581069,5581070..5581136))
FT                   /locus_tag="VIT_17s0000g06860"
FT                   /old_locus_tag="Vv17s0000g06860"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(5577494..5577666)
FT                   /locus_tag="VIT_17s0000g06860"
FT                   /old_locus_tag="Vv17s0000g06860"
FT   CDS_pept        complement(join(5577667..5577766,5577884..5577981,
FT                   5578319..5578449,5578614..5578707,5580575..5581069))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06860"
FT                   /old_locus_tag="Vv17s0000g06860"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT32"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT32"
FT                   /protein_id="CCB43056.1"
FT                   /translation="MFGLKKSPLHKFAKHNSVDPGYPHSSSTNPFDSHDDLDGKKALKP
FT                   SRRTSSEPMLTTQPNPNPFDDDVGKGSSSSSSNFLLSSERNKYKNDFHDSGGIENQSVQ
FT                   ELENYAVYKAEENTKMVNNCLKIAEDIREDATKTLVTLHQQGQQITRTHMNAADIDHDL
FT                   SRGEKLLGSLGGIFSKTWKPIKTRPITGPITTRDDLSYRKGSHMEQREKLGLAPAPKGR
FT                   LATRTPPPEPTNALQKVEVEHAKQDDTLSDLSNLLDELKYMAVDMGTEIESHNRALAPM
FT                   EDDVDVLSIRIKDGNQRARRLLGK"
FT   5'UTR           complement(5581070..5581136)
FT                   /locus_tag="VIT_17s0000g06860"
FT                   /old_locus_tag="Vv17s0000g06860"
FT   gene            complement(5581137..5584556)
FT                   /locus_tag="VIT_17s0000g06850"
FT                   /old_locus_tag="Vv17s0000g06850"
FT   mRNA            complement(join(5581137..5581163,5581269..5581324,
FT                   5582259..5582311,5584510..5584556))
FT                   /locus_tag="VIT_17s0000g06850"
FT                   /old_locus_tag="Vv17s0000g06850"
FT   CDS_pept        complement(join(5581137..5581163,5581269..5581324,
FT                   5582259..5582311,5584510..5584556))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06850"
FT                   /old_locus_tag="Vv17s0000g06850"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT33"
FT                   /protein_id="CCB43057.1"
FT                   /translation="MNSTTTLTLSISLLYNVALEFIQDRLHFFVGIADGHLNSFLNHTF
FT                   ILLKMISEHCPSLIL"
FT   gene            complement(5586532..5593275)
FT                   /locus_tag="VIT_17s0000g06840"
FT                   /old_locus_tag="Vv17s0000g06840"
FT   mRNA            complement(join(5586532..5586910,5587589..5587641,
FT                   5587642..5587698,5587794..5587961,5588286..5588421,
FT                   5589343..5589952,5590506..5590608,5590928..5590987,
FT                   5591626..5591706,5593156..5593203,5593204..5593275))
FT                   /locus_tag="VIT_17s0000g06840"
FT                   /old_locus_tag="Vv17s0000g06840"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(join(5586532..5586910,5587589..5587641))
FT                   /locus_tag="VIT_17s0000g06840"
FT                   /old_locus_tag="Vv17s0000g06840"
FT   CDS_pept        complement(join(5587642..5587698,5587794..5587961,
FT                   5588286..5588421,5589343..5589952,5590506..5590608,
FT                   5590928..5590987,5591626..5591706,5593156..5593203))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06840"
FT                   /old_locus_tag="Vv17s0000g06840"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI51"
FT                   /protein_id="CBI15161.3"
FT                   /translation="MGAIASNSSSPQNPTKMFSSSKSESDSSYDIEDLLQIETRCKQLK
FT                   RETNMLRESQSESFELIRRLELHVRTLSEARSEDEKHIQELERELRNCSQEIDYLQDQL
FT                   NARDAEVKCLGEHVHSLELKLADKDNLEDMVGRLMQELKRSNSECMLLMQELENKEVEL
FT                   QMSSLCIDKLEESISSVTLEFQCEMESMKLEMITLEQSCFEAKKLQDEASEEKTKMNGL
FT                   IQEFQVQLQDAQKMIECLDKENKELRGKLKTSEMDAILLRQKIKEHSEEWLENKDESEL
FT                   KTQSSSGELESKFNLSTEMSTSAEVLVPLFPKLAVSATSDVGLKEKMEKMSHQIHGYEL
FT                   LVKQLKEELREEKLKAKEEAEDLAQEMAELRYQITGMLEEECKRRACIEQASLQRIAEL
FT                   EAQIQKEQTKSYAAIRRFREA"
FT   5'UTR           complement(5593204..5593275)
FT                   /locus_tag="VIT_17s0000g06840"
FT                   /old_locus_tag="Vv17s0000g06840"
FT   gene            complement(5594312..5595787)
FT                   /locus_tag="VIT_17s0000g06830"
FT                   /old_locus_tag="Vv17s0000g06830"
FT   mRNA            complement(join(5594312..5594530,5594531..5595052,
FT                   5595245..5595736,5595779..5595787))
FT                   /locus_tag="VIT_17s0000g06830"
FT                   /old_locus_tag="Vv17s0000g06830"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(5594312..5594530)
FT                   /locus_tag="VIT_17s0000g06830"
FT                   /old_locus_tag="Vv17s0000g06830"
FT   CDS_pept        complement(join(5594531..5595052,5595245..5595736,
FT                   5595779..5595787))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06830"
FT                   /old_locus_tag="Vv17s0000g06830"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT34"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT34"
FT                   /protein_id="CCB43058.1"
FT                   /translation="MSNAVKPSNEKAVVSTSLNSLWSNNQPLVNDMTIRIPEQTKVILS
FT                   LRCEVCNIDCNSKDVLEKHISGKKHNRNLQIHTNQVSTTISTKDSIGMNTGSLVGQIGS
FT                   ISHQRILGSAGAAAGQSLVAKRLKLVEGGAVADSVRTCTICNVACNSQVVFQKHLTGKK
FT                   HAAQVGLRPQHLVVQPHSNGIWSKAPKKPKFVQSAWCEVCKINCNSSDVFTKHILGKKH
FT                   LKNLEKLAEPKKDTSTSASTAAQVTTNPIIGPMERLDASKGKSTAAVEPGKRPAQLQTQ
FT                   QKDLDIKKQKIVEGGAAAGAVRACTICNVVCNSQTVFNIHLSGQKHASMVKKLGESTAA
FT                   "
FT   gap             5616801..5617833
FT                   /estimated_length=1033
FT   gene            complement(5624494..5626724)
FT                   /locus_tag="VIT_17s0000g06820"
FT                   /old_locus_tag="Vv17s0000g06820"
FT   mRNA            complement(join(5624494..5624865,5624946..5624968,
FT                   5625072..5625105,5625256..5625432,5625547..5625791,
FT                   5625999..5626178,5626700..5626724))
FT                   /locus_tag="VIT_17s0000g06820"
FT                   /old_locus_tag="Vv17s0000g06820"
FT                   /product="ZPT4-4"
FT   CDS_pept        complement(join(5624494..5624865,5624946..5624968,
FT                   5625072..5625105,5625256..5625432,5625547..5625791,
FT                   5625999..5626178,5626700..5626724))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06820"
FT                   /old_locus_tag="Vv17s0000g06820"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SI53"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI53"
FT                   /protein_id="CBI15163.3"
FT                   /translation="MDFSSPNQKQGHELVEFKHVCKFCKKSFPCGRSLGGHMRSHMINS
FT                   SFETDEKLSKTKLSSLHKAATNPDSWTSANQKLVMDSQSDTETAVPNRKKRSRRRTRYM
FT                   ATATSSSFSFANASSSVSEIEQEQEEVAISLMMLSRDSGNWGGLNSVVKLKKLIKDEKF
FT                   NPSALDSEDFQFYCKQSEFGASGNSRNDSKLNKSEVLETNKSNKLKVNCSKKTTNNDEL
FT                   ATKRSKLTKPCNNHSPSRSPGPIHGHTASASAVKAETILGSKKSKGHECPICLKVFSSG
FT                   QALGGHKRSHLVGGSDTRGSQTIVIPKPLPEIRDLLDLNLPAPAEEEGGFKAWWVGSSH
FT                   KHEPLVGMISN"
FT   gene            complement(5633279..5638241)
FT                   /locus_tag="VIT_17s0000g06810"
FT                   /old_locus_tag="Vv17s0000g06810"
FT   mRNA            complement(join(5633279..5633671,5633672..5635092,
FT                   5635956..5636100,5636101..5636106,5637909..5638241))
FT                   /locus_tag="VIT_17s0000g06810"
FT                   /old_locus_tag="Vv17s0000g06810"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(5633279..5633671)
FT                   /locus_tag="VIT_17s0000g06810"
FT                   /old_locus_tag="Vv17s0000g06810"
FT   CDS_pept        complement(join(5633672..5635092,5635956..5636100))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06810"
FT                   /old_locus_tag="Vv17s0000g06810"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT35"
FT                   /protein_id="CCB43059.1"
FT                   /translation="MVQKRSFDDEELYEISSKHPRQLEHNHHLISFLEFVPFDDPLQKP
FT                   RVQGEGELLKCKTEGDEKLLSGFCTDFPISAKDTETFMRGCISTSSWATSSTSEDDARS
FT                   EAPIDVSLFPEYFSSDSPVRASNDSDDYYLSLLDYPPRKSVPIGSDHQVDVPAWSQGIM
FT                   DSLDYLETSEQVIFSPQASGLELSVGNIDEKRLIGTCVMPMPKSEPFCNDAVVGNGRTD
FT                   CSCHDRGSYRCVRQHIAEAREKLRGTLGEERFVKLGFHDMGEEVAEKWNEEEEQLFHEV
FT                   VFSNPVSLGKNFWDNLSLVFPSRTTREIVSYYFNVFMLRKRAEQNRYDPENIDSDNDEW
FT                   PETDDYCNDEHEMTEEDEDSVVESPIYQEDPSYNPCHADDKRKYEDIGDGTHGDNENVN
FT                   YGSGMDILDISESCTDKLLNNSGSDSICQLSDVPWDGKGDHGIKDGSCTSSNTGADSQR
FT                   TQAKAGNGDHWYALEPCDAKVWDAGYVTCSKTKVDLLSTCSMIEEVFGAGTGTYKGADG
FT                   QGLI"
FT   5'UTR           complement(5637909..5638241)
FT                   /locus_tag="VIT_17s0000g06810"
FT                   /old_locus_tag="Vv17s0000g06810"
FT   gap             5660598..5660697
FT                   /estimated_length=100
FT   gene            complement(5672451..5677407)
FT                   /locus_tag="VIT_17s0000g06800"
FT                   /old_locus_tag="Vv17s0000g06800"
FT   mRNA            complement(join(5672451..5672932,5672933..5673739,
FT                   5673740..5673849,5673984..5674126,5677387..5677407))
FT                   /locus_tag="VIT_17s0000g06800"
FT                   /old_locus_tag="Vv17s0000g06800"
FT                   /product="Predicted protein"
FT   3'UTR           complement(5672451..5672932)
FT                   /locus_tag="VIT_17s0000g06800"
FT                   /old_locus_tag="Vv17s0000g06800"
FT   CDS_pept        complement(5672933..5673739)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06800"
FT                   /old_locus_tag="Vv17s0000g06800"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT36"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR027370"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT36"
FT                   /protein_id="CCB43060.1"
FT                   /translation="MWNFASNALSGTNGLKNDLLKPNQAPSECSDDEISTNTSREEGLE
FT                   CPICWESFNIVENVPYVLWCGHTLCKNCVLGLQWAVVKFPTLPIQLPFFISCPWCNLLS
FT                   FRLVYKGNLTFPRKNFFLLWMVESMNGDRGKSHSSFCDHQPGWSSNRNLIIGNQGSHVN
FT                   HRRPPYSHLPEQSESNHDGGHLINRFLNIERLHLSVRKSLVFFVHLTAKFPLVIIFLLI
FT                   VLYAIPASAAILALYILITVLFALPSFLILYFAYPSLDWLVREIIT"
FT   5'UTR           complement(5677387..5677407)
FT                   /locus_tag="VIT_17s0000g06800"
FT                   /old_locus_tag="Vv17s0000g06800"
FT   gene            5684873..5687077
FT                   /locus_tag="VIT_17s0000g06790"
FT                   /old_locus_tag="Vv17s0000g06790"
FT   mRNA            join(5684873..5684912,5684913..5685465,5685572..5685642,
FT                   5685925..5686083,5686160..5686242,5686315..5686450,
FT                   5686539..5686712,5686861..5687049,5687050..5687077)
FT                   /locus_tag="VIT_17s0000g06790"
FT                   /old_locus_tag="Vv17s0000g06790"
FT                   /product="Predicted protein"
FT   5'UTR           5684873..5684912
FT                   /locus_tag="VIT_17s0000g06790"
FT                   /old_locus_tag="Vv17s0000g06790"
FT   CDS_pept        join(5684913..5685465,5685572..5685642,5685925..5686083,
FT                   5686160..5686242,5686315..5686450,5686539..5686712,
FT                   5686861..5687049)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06790"
FT                   /old_locus_tag="Vv17s0000g06790"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5B761"
FT                   /db_xref="InterPro:IPR000960"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5B761"
FT                   /protein_id="CBI15167.3"
FT                   /translation="MVSERNQSKHVCVIGAGPSGLVAARELRKEGHSVVVIEQNHDIGG
FT                   QWLYEPKVEGEEALGKSTFLKVHSSIYDSLRLFSPREIMGFSDFPFVVKKGRDMRRFPG
FT                   HRELLLYLQDFCEWFGLREMIRFKTRVEYVGMLDSDQVGRDLKWVVKSRDMESEKVVEE
FT                   VFDAVVVATGHYSKPRLPSIKGMDVWKRNQMHSHIYRDPEPFRKEVVVVVGNSLSGQDI
FT                   SMELVDVAKEIHLSAKSLEISEGLAKVISKHDSLHLHLEIESLHEDGRVVFVDGSWVMA
FT                   DTIIYCTGYSYAFPFLDTKGIVGVDDDRVGPLYEHTFPPSLAPSLSFVGIPRKLIGFPF
FT                   FESQAIWIAQLLSGKRTLPSFHDMMQSIKDFYHSREIAGVPKHNTHDLANFEYCDKYGD
FT                   NVGFPHLEEWRKELCISAIVKAEVDLEGYRDAWDDVELLQVALQSPHFTQFPRST"
FT   3'UTR           5687050..5687077
FT                   /locus_tag="VIT_17s0000g06790"
FT                   /old_locus_tag="Vv17s0000g06790"
FT   gene            5690259..5714529
FT                   /locus_tag="VIT_17s0000g06780"
FT                   /old_locus_tag="Vv17s0000g06780"
FT   mRNA            join(5690259..5690811,5690963..5691033,5691218..5691376,
FT                   5692018..5692100,5692225..5692360,5692447..5692620,
FT                   5692772..5692956,5704449..5704816,5705166..5705236,
FT                   5705517..5705675,5705752..5705834,5705912..5706047,
FT                   5706117..5706290,5706414..5706614,5708592..5708642,
FT                   5713660..5713742,5713815..5713950,5714026..5714199,
FT                   5714326..5714529)
FT                   /locus_tag="VIT_17s0000g06780"
FT                   /old_locus_tag="Vv17s0000g06780"
FT                   /product="Predicted protein"
FT   CDS_pept        join(5690259..5690811,5690963..5691033,5691218..5691376,
FT                   5692018..5692100,5692225..5692360,5692447..5692620,
FT                   5692772..5692956,5704449..5704816,5705166..5705236,
FT                   5705517..5705675,5705752..5705834,5705912..5706047,
FT                   5706117..5706290,5706414..5706614,5708592..5708642,
FT                   5713660..5713742,5713815..5713950,5714026..5714199,
FT                   5714326..5714529)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06780"
FT                   /old_locus_tag="Vv17s0000g06780"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT52"
FT                   /db_xref="InterPro:IPR000960"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT52"
FT                   /protein_id="CCB43061.1"
FT                   /translation="MVSERIQSKHVCVIGAGPSGLVAARELRKEGHSVVVMEQNHDIGG
FT                   QWLYEPKVEGEDALGKSTFLKVHSSVYDSLRLFSPREIMGFSDFPFVVKKGRDMRRFPG
FT                   HRELLLYLQDFCEWFGLREMMRFKTRVEYVGMLDSDQVGRDLKWVVESRDMESEKVSEE
FT                   VFDAVVVATGHYSKPRLPSIKGMDVWKRKQMHSHMYRVPEPFRHEVVVIVGNSHSGEDV
FT                   SIGLVEVAKEIHLSFKSLDLSEGLSKFISKHHNLHLHLQIESLHEDGRVVFVDGSWVMA
FT                   DTIIYCTGYSYSFPFLDTKGIVVVDDNRVGPLYEHTFPPLLAPSLSFVGIPRKIIAFPF
FT                   FESQAIWIAQLLSGKKTLPSFHDMMHSIEDFYRSREIAGIPKRYTHELADFEYCDKYGD
FT                   NVGFPHLEEWRKGLCVSAVLKAMANLETFRDSGDEDELLQVALQSPHFTQFPQSPKFLK
FT                   VHSSIYASLRLASPREIVGFSDFPFVVKKGRDTRRFPGHRELLWYLEDFCEWFGLRETI
FT                   RFNTKVEYVGMLDSDEVGGGLKWVVRSRDVKSEKVVEELFDAVVVATGQYSHPRLPSIK
FT                   GMEAWKRKQMHSHIYRVPHPFHNEVVVVVGNAASGQDISIELVDVAKEIHLSAKSLDIS
FT                   EGLSRIISKHHNLHLHLQIESLHEDGRVVFVDGSWVVADTIIYCTGYSYSFPFLDTKGI
FT                   VAVDDDRVGPLYEHTFPPSLAPSLSFVGIPRKILGFPFFESQAMWIAQLLSGRKTLPSF
FT                   HDMMRSIEDFYQSRDAAGIPKHQTHDIADFEYFDKYGDNVGFPHTEEWRKKLLLSTVGN
FT                   AQVNLETYRDSWYDHELLQVVLQSPLFTQSLQSPSQHLTGLSKVISKLHNLHLHLQIES
FT                   LHEDGRVVFVDGSWVLADTIIYCTGYSYAFPFLDTKGIVAVDDDRVGPLYEHTFPPSLA
FT                   PSLSFVGIPRKIIGFPFFESQAIWIAQLLSGRKTLPSFHEMMQSIEDFYQSRDAAGIPK
FT                   HHTHDIADFEYRDKYLDNVGFPHLEEWRKELILSGIGNAQVNLETYRDAWDDHELLQVA
FT                   LQSPHFTQSLQSPSQHFP"
FT   gap             5721941..5727290
FT                   /estimated_length=5350
FT   gene            complement(5756770..5758617)
FT                   /locus_tag="VIT_17s0000g06770"
FT                   /old_locus_tag="Vv17s0000g06770"
FT   mRNA            complement(5756770..5758617)
FT                   /locus_tag="VIT_17s0000g06770"
FT                   /old_locus_tag="Vv17s0000g06770"
FT                   /product="Predicted protein"
FT   CDS_pept        complement(5756770..5758617)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06770"
FT                   /old_locus_tag="Vv17s0000g06770"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SI59"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR032867"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI59"
FT                   /protein_id="CBI15169.3"
FT                   /translation="MKRSVKSFLQARSNLSQWTHNLTIRPSSTSALTLCENPPQITESK
FT                   HSHLTKSISNHAHMNQMLSQMIMNYIPIDHLNLMKLIDFSVSSHGFAASALLFTQFYGF
FT                   IDSDLCNSMIRCYTDSNKHLHSVFIYTQMWKNGIFPDSSTFPTVLKSVAQLCRQELGKA
FT                   IHCCIIQMGFESNVYVSTALVNMYGTCSSVSDARQVFDEIPDRNIVSWNALITGYNHNR
FT                   MFRKVIDVFREMQIAGAKPVEVTMVGVLLACAHLGALNQGRWIDDYIDHNRLRLNVFVG
FT                   TALIDMYAKCGVVDEAEKIFKAMRVKNVYTWNVLISGYAMNGRGESALQAFSRMIMEKF
FT                   KPDEVTFLGVLCACCHQGLVNEGRTYFTSMKEEFGLRPRIEHYGCMVDLLGRAGFLDEA
FT                   QQLIQAMSMQPDPIIWRELLGACRIHGNIQLGEFAIKKLLELEPNNGENYVLLANLYAR
FT                   DQRWDKVGEVREMMDCRRVRKVPGCSSIEIDNVVYEFVVSNYIKPGFEEVYKLLADMNK
FT                   KLKLAGYVADTGMASYDIEEEEKEHSLMYHSEKLALAFGLLKSPSGLTLRIVKNLRICQ
FT                   DCHGFFKIVSKVYRRDISVRDRNRFHHFVGGACSCKDYW"
FT   gene            complement(5759674..5762756)
FT                   /locus_tag="VIT_17s0000g06760"
FT                   /old_locus_tag="Vv17s0000g06760"
FT   mRNA            complement(join(5759674..5759917,5759918..5760759,
FT                   5760913..5761371,5761483..5761861,5762526..5762756))
FT                   /locus_tag="VIT_17s0000g06760"
FT                   /old_locus_tag="Vv17s0000g06760"
FT   3'UTR           complement(5759674..5759917)
FT                   /locus_tag="VIT_17s0000g06760"
FT                   /old_locus_tag="Vv17s0000g06760"
FT   CDS_pept        complement(join(5759918..5760759,5760913..5761371,
FT                   5761483..5761861,5762526..5762756))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06760"
FT                   /old_locus_tag="Vv17s0000g06760"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR008581"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI60"
FT                   /protein_id="CBI15170.3"
FT                   /translation="MGTNLLYESFPGNYSTRDLNMEAVGSRCLPCKDDKTLKSELHYNG
FT                   VLPPPALPRQLGSDKEELRQTILKQEVMFNDQVQELHRLYRRQMELMNEIEKKQLHKQS
FT                   DYAVKMSQEPRDLDSISTRPNSLIDLNQPYQGEEAGTSTSVYSLDPGINQGEIPGRDPS
FT                   AKTNSGFGVSSMESFGNSETKKNVDACSRPQEHPPFTNEAGHNRSTLVDFQFPSVSTRG
FT                   RPRHHLERSPIVVLALPAFNGPAPLNKFSRRSIARPRHTGNKLHVGRSSRCSPQHGHVR
FT                   SKITSHDSHFESMTSSTDHDFSPGHPAHKEHLKGSDIMDVKSERDMDLNSIPPARSADV
FT                   VSQQQICTMDKGDKSEESWPALSVPGASVVAPISPENQECPRPRGESEETPLDLSQGKG
FT                   TGPLEKPDKIAAEESLFTSSTGIEACLESAACDPSNTSPLYWFVTICLDPDTESKLAFS
FT                   GNNGAEQEGLSCDEVDYFEAMTLKLVELKSEEHLCKNNSQKEEGTCSTIFLSQPKKGRR
FT                   WRRQKDFQKEILPSLASLARHEVAEDLQTIGGLVKAAGSPPGTKLARDAGKNKEARGRK
FT                   RMRASVSNVVESTGSMPLQQPAATAEPGSQDRWLTGWGSVRRRGQRHRTSNPSLLLTQF
FT                   S"
FT   gene            complement(5778193..5779024)
FT                   /locus_tag="VIT_17s0000g06750"
FT                   /old_locus_tag="Vv17s0000g06750"
FT   mRNA            complement(join(5778193..5778508,5778509..5778754,
FT                   5778883..5779017,5779018..5779024))
FT                   /locus_tag="VIT_17s0000g06750"
FT                   /old_locus_tag="Vv17s0000g06750"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(5778193..5778508)
FT                   /locus_tag="VIT_17s0000g06750"
FT                   /old_locus_tag="Vv17s0000g06750"
FT   CDS_pept        complement(join(5778509..5778754,5778883..5779017))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06750"
FT                   /old_locus_tag="Vv17s0000g06750"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT53"
FT                   /db_xref="InterPro:IPR025984"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT53"
FT                   /protein_id="CCB43062.1"
FT                   /translation="MESSDEFSRKTKDVSLQELRDRLAEFARVRGWEQYHSPRNLLLAL
FT                   VGEVGELSEIFQWKGEVARGLPNWTAADKTHLEEELSDVLLYLVQLADVCGLDLGQAAL
FT                   SKIIKNAQKYPVVNQTISTTFN"
FT   5'UTR           complement(5779018..5779024)
FT                   /locus_tag="VIT_17s0000g06750"
FT                   /old_locus_tag="Vv17s0000g06750"
FT   gene            complement(5782009..5784553)
FT                   /locus_tag="VIT_17s0000g06740"
FT                   /old_locus_tag="Vv17s0000g06740"
FT   mRNA            complement(join(5782009..5782167,5783037..5783159,
FT                   5783160..5783179,5784475..5784553))
FT                   /locus_tag="VIT_17s0000g06740"
FT                   /old_locus_tag="Vv17s0000g06740"
FT   CDS_pept        complement(join(5782009..5782167,5783037..5783159))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06740"
FT                   /old_locus_tag="Vv17s0000g06740"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI62"
FT                   /protein_id="CBI15172.3"
FT                   /translation="MDGGRGEVMPLELAMKRELAYRKKVDRLLLQLHGGVSRENPMLIS
FT                   EQAQSYNQLAMSCINKPCRQLTMVVVSVMSHSFLMTKIYSTTQLLLLQ"
FT   5'UTR           complement(5784475..5784553)
FT                   /locus_tag="VIT_17s0000g06740"
FT                   /old_locus_tag="Vv17s0000g06740"
FT   gene            complement(5786117..5788039)
FT                   /locus_tag="VIT_17s0000g06730"
FT                   /old_locus_tag="Vv17s0000g06730"
FT   mRNA            complement(join(5786117..5786695,5787902..5788039))
FT                   /locus_tag="VIT_17s0000g06730"
FT                   /old_locus_tag="Vv17s0000g06730"
FT   CDS_pept        complement(join(5786117..5786695,5787902..5788039))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06730"
FT                   /old_locus_tag="Vv17s0000g06730"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SI63"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI63"
FT                   /protein_id="CBI15173.3"
FT                   /translation="MDDGRRGDVMPLELAMKRESAYRKKVEMMLSQLYGGESREDPFSS
FT                   QVPSSSPSSGPSLSGPKRKTPTRTSQCLPPQQLQLLYSSHTLGNRKDDLFCKVCQVACP
FT                   SSFHLKQHLIGQKHKDTLDLKSGRNIREEDANTRKWCDLCKIWCINKYSLEQHFKGKKH
FT                   QDNVQELELGGKEGQRKTNQVKLYCELCKLWCMDEYAFNQHLKGKKHILNLHTFEEKRT
FT                   AKGKGLAVDQSSTRKN"
FT   gene            5789881..5790483
FT                   /locus_tag="VIT_17s0000g06720"
FT                   /old_locus_tag="Vv17s0000g06720"
FT   mRNA            join(5789881..5789997,5789998..5790113,5790205..5790253,
FT                   5790254..5790483)
FT                   /locus_tag="VIT_17s0000g06720"
FT                   /old_locus_tag="Vv17s0000g06720"
FT   5'UTR           5789881..5789997
FT                   /locus_tag="VIT_17s0000g06720"
FT                   /old_locus_tag="Vv17s0000g06720"
FT   CDS_pept        join(5789998..5790113,5790205..5790253)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06720"
FT                   /old_locus_tag="Vv17s0000g06720"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI64"
FT                   /protein_id="CBI15174.3"
FT                   /translation="MAVGTKVFLVNRMGLQGHYCHFDWPILLSGNHGTGAVIRVGFFSL
FT                   VLVPCATGN"
FT   3'UTR           5790254..5790483
FT                   /locus_tag="VIT_17s0000g06720"
FT                   /old_locus_tag="Vv17s0000g06720"
FT   gene            complement(5791011..5794570)
FT                   /locus_tag="VIT_17s0000g06710"
FT                   /old_locus_tag="Vv17s0000g06710"
FT   mRNA            complement(join(5791011..5791157,5791158..5794399,
FT                   5794507..5794570))
FT                   /locus_tag="VIT_17s0000g06710"
FT                   /old_locus_tag="Vv17s0000g06710"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(5791011..5791157)
FT                   /locus_tag="VIT_17s0000g06710"
FT                   /old_locus_tag="Vv17s0000g06710"
FT   CDS_pept        complement(join(5791158..5794399,5794507..5794570))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06710"
FT                   /old_locus_tag="Vv17s0000g06710"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT54"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013210"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT54"
FT                   /protein_id="CCB43063.1"
FT                   /translation="MRDEETDIRVVGLMISLVLITGRIVAGDSLETDREVLLSLKKFLE
FT                   DNNQVNRGRYQEWNLSSWNPCDWPGILCSNDGRVISVNLSDNSISGEIFHNFSALTKLS
FT                   HLDLSKNTLGGRIPADLRRCESLVYLNLSHNIINDELNLTGLKSLEVLDLSINRIGGEI
FT                   QLTFPAVCDRLVLANISENNFTGSIDNCFDECKSLKYLDLSSNNFSGEIWQGFARLQQF
FT                   SASENRFGGVVSPSIFGGVCALGLLELSKNSFGGEVPGEIANCTSLRILNLWGNHFTGP
FT                   IPPELGSLSSLEGLFLGNNNFSRQVPESLLNLSSLAFLDLSKNNFGGEIQEIFGKFKQV
FT                   RFLVLHTNSYTGGIYSSGILKLSNISRLDLSFNNFSGPLPVELSEMPSLEFLILAHNQF
FT                   SGSIPPEFGNIRRLQALDLSFNSLNGSIPSTIGKLNSLLWLMLANNRFSGEIPPEIGNC
FT                   TSLLWLNLANNQFSGKIPPELTTIGRNPFPTFEMNRKNRGIPAGSGECQVMMRWIPANY
FT                   PPFSFAYTLLTRRSCRSLWDNLLKGHGLFPMCLTGSKVRTLQISGYVQISGNQFSGEVP
FT                   PEIRNMQNFSLIQMAANKFYGKLPPAIGQLPVVVLNLSENNFSGEIPMEIGNLGCLQNL
FT                   DLSSNNFSGTFPTSLNNLSELNKFNISYNPLISGVIPSTGQLATFEKESFLGDPLLVLP
FT                   PFIGNPSNHPPPTAKSDGKPKQKFTSAFVFLTLTVAFIMCGLVSLLVCVLLKNPVDSSG
FT                   YLLDDSKYRHDFASSSEVSSPWLSGAVKVIRLDKTAFTYADILMATCNFSDSRIIGKGG
FT                   FGTVYRGVLPDGREVAVKKLQRDGIEGEKEFRAEMEVLSGNGLGWPHPNLVTLYGWCLN
FT                   GSEKLLVYEYMEGGSLEDLISDRMRLTWRRRLDVAIDVARALVFLHHECFTAIVHRDVK
FT                   ASNVLLDRNGKARVTDFGLARVVDDGNSHVSTMVAGTVGYVAPEYGQTGQATTKGDVYS
FT                   FGVLSMELATGRHALDGGEECLVEWARRVMGNGRQGLSRAVIPVVMLGSGLAEGAEEMR
FT                   ELLRIGIKCTAESPQARPNMKEVLAMLITILSTQQDFSYGSSPPSSEMSGLET"
FT   gap             5823068..5823167
FT                   /estimated_length=100
FT   gap             5827572..5827695
FT                   /estimated_length=124
FT   gap             5841363..5841462
FT                   /estimated_length=100
FT   gene            5855591..5858207
FT                   /locus_tag="VIT_17s0000g06700"
FT                   /old_locus_tag="Vv17s0000g06700"
FT   mRNA            join(5855591..5855718,5855719..5855963,5857863..5857896,
FT                   5857897..5858207)
FT                   /locus_tag="VIT_17s0000g06700"
FT                   /old_locus_tag="Vv17s0000g06700"
FT   5'UTR           5855591..5855718
FT                   /locus_tag="VIT_17s0000g06700"
FT                   /old_locus_tag="Vv17s0000g06700"
FT   CDS_pept        join(5855719..5855963,5857863..5857896)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06700"
FT                   /old_locus_tag="Vv17s0000g06700"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI68"
FT                   /protein_id="CBI15178.3"
FT                   /translation="MCAMFPCHGNHNHRFLVYIFIFQVSKPSSTEQQHPTKRAKGPKIC
FT                   PESIPEDFISITCLHKGLYNLDEFGYGLPCTTAAFYISEALVHRAQF"
FT   3'UTR           5857897..5858207
FT                   /locus_tag="VIT_17s0000g06700"
FT                   /old_locus_tag="Vv17s0000g06700"
FT   gene            complement(5858823..5862781)
FT                   /locus_tag="VIT_17s0000g06690"
FT                   /old_locus_tag="Vv17s0000g06690"
FT   mRNA            complement(join(5858823..5858919,5860453..5861882,
FT                   5861883..5862119,5862638..5862781))
FT                   /locus_tag="VIT_17s0000g06690"
FT                   /old_locus_tag="Vv17s0000g06690"
FT                   /product="Predicted protein"
FT   CDS_pept        complement(join(5858823..5858919,5860453..5861882))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06690"
FT                   /old_locus_tag="Vv17s0000g06690"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SI69"
FT                   /db_xref="InterPro:IPR008545"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI69"
FT                   /protein_id="CBI15179.3"
FT                   /translation="MADQLLETAKVREQLSHVLSKLKSAQEELLRVETELADARESEFK
FT                   AMTQAELMQTAVNMERGKTAELLKHVSELNEAILHSKLAAIEAEKENSAVLSEKEAELQ
FT                   LVTATLAQAQKQLEELRKQTEIVQFLENELLAKSVFIETLQFELKESNELHSLSAKAAS
FT                   EAINNLNQLKSDFERQERENSEQAVSINSLEMELNQLKIKLKNANEEVGCSKCDVEMLR
FT                   GELEKTKIEVDEIRGRENEAQVEIALLKSELHKGRSRIAAAEAAEARAESVKSGLYLAV
FT                   QQLAVEAGEAKKESQRLKQGADEAKEITRETVSVNPQFEVSSQDLELSQKDEYNKEAKA
FT                   RKDDHITISVIEYESLVSKAKKADQIPVLVSENLSQSATFENRDEAEVLKELEFAMVRI
FT                   AEFRTRAEQAVSRAEMAEKAKAAIEEQLRQWREQRQRKRAALAALHEESVRKENNILKF
FT                   EQTPTTYQPLGKVLNMKFYSSLCLLSLINSCEIVFMRSFLYKLIQYSFSL"
FT   5'UTR           complement(5862638..5862781)
FT                   /locus_tag="VIT_17s0000g06690"
FT                   /old_locus_tag="Vv17s0000g06690"
FT   gene            5867066..5870408
FT                   /locus_tag="VIT_17s0000g06680"
FT                   /old_locus_tag="Vv17s0000g06680"
FT   mRNA            join(5867066..5867128,5867129..5867215,5869125..5869179,
FT                   5869891..5870270,5870271..5870408)
FT                   /locus_tag="VIT_17s0000g06680"
FT                   /old_locus_tag="Vv17s0000g06680"
FT                   /product="Predicted protein"
FT   5'UTR           5867066..5867128
FT                   /locus_tag="VIT_17s0000g06680"
FT                   /old_locus_tag="Vv17s0000g06680"
FT   CDS_pept        join(5867129..5867215,5869125..5869179,5869891..5870270)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06680"
FT                   /old_locus_tag="Vv17s0000g06680"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR007493"
FT                   /db_xref="InterPro:IPR036758"
FT                   /db_xref="UniProtKB/TrEMBL:A5B606"
FT                   /protein_id="CBI15180.3"
FT                   /translation="MEKALTKVGSFWISKKAKEEISNITEDLSTFSNTVEEKARWVFNK
FT                   LKGKPAKALPDLLREHNLPPGLFPRNITCYEFDESRSKLIVYLPSACEVSFKDSSIIRY
FT                   ATRVKGTLARGKLTGIEGMKTKVLVWVKVTVVSVETYKSDKVWFTAGVKKSRPKDAYEM
FT                   TRDAVKIEEF"
FT   3'UTR           5870271..5870408
FT                   /locus_tag="VIT_17s0000g06680"
FT                   /old_locus_tag="Vv17s0000g06680"
FT   gene            5871266..5873945
FT                   /locus_tag="VIT_17s0000g06670"
FT                   /old_locus_tag="Vv17s0000g06670"
FT   mRNA            join(5871266..5871280,5871281..5871403,5872502..5872624,
FT                   5872727..5872783,5872854..5872928,5873621..5873722,
FT                   5873723..5873945)
FT                   /locus_tag="VIT_17s0000g06670"
FT                   /old_locus_tag="Vv17s0000g06670"
FT                   /product="EIF5A"
FT   5'UTR           5871266..5871280
FT                   /locus_tag="VIT_17s0000g06670"
FT                   /old_locus_tag="Vv17s0000g06670"
FT   CDS_pept        join(5871281..5871403,5872502..5872624,5872727..5872783,
FT                   5872854..5872928,5873621..5873722)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06670"
FT                   /old_locus_tag="Vv17s0000g06670"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5B605"
FT                   /db_xref="InterPro:IPR001884"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR019769"
FT                   /db_xref="InterPro:IPR020189"
FT                   /db_xref="UniProtKB/TrEMBL:A5B605"
FT                   /protein_id="CBI15181.3"
FT                   /translation="MSDEEHHFESKGDAGASKTYPQQAGTIRKNGYIVIKSRPCKVVEV
FT                   STSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSL
FT                   LTENGNTKDDLRLPTDDNLLTQIKDGFAEGKDLVVSVMSAMGEEQICALKDIGPK"
FT   3'UTR           5873723..5873945
FT                   /locus_tag="VIT_17s0000g06670"
FT                   /old_locus_tag="Vv17s0000g06670"
FT   gene            5875132..5878071
FT                   /locus_tag="VIT_17s0000g06660"
FT                   /old_locus_tag="Vv17s0000g06660"
FT   mRNA            join(5875132..5875152,5875153..5875375,5875477..5875599,
FT                   5877779..5877936,5877937..5878071)
FT                   /locus_tag="VIT_17s0000g06660"
FT                   /old_locus_tag="Vv17s0000g06660"
FT                   /product="unknown predicted protein"
FT   5'UTR           5875132..5875152
FT                   /locus_tag="VIT_17s0000g06660"
FT                   /old_locus_tag="Vv17s0000g06660"
FT   CDS_pept        join(5875153..5875375,5875477..5875599,5877779..5877936)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06660"
FT                   /old_locus_tag="Vv17s0000g06660"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SI72"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI72"
FT                   /protein_id="CBI15182.3"
FT                   /translation="MSSSSPHRSRDKEERPRFFDPKAKSLCWAKADAVPGRHPDRWRKD
FT                   AAGNIVCKRFCNCQGCLCFEYDHIIPFSKGGESVPENCQILQTRVNRFKSDKDNVDKTQ
FT                   LQGYSCDVKFTDKELDIIEMAVYGDVIRPGNQCRCRTVAEMLGQYKPKDRMAACKLPFN
FT                   DESL"
FT   3'UTR           5877937..5878071
FT                   /locus_tag="VIT_17s0000g06660"
FT                   /old_locus_tag="Vv17s0000g06660"
FT   gene            5884210..5891380
FT                   /locus_tag="VIT_17s0000g06650"
FT                   /old_locus_tag="Vv17s0000g06650"
FT   mRNA            join(5884210..5884575,5885636..5885920,5886231..5886548,
FT                   5887913..5888140,5888495..5888592,5889326..5889407,
FT                   5889547..5890077,5890454..5890586,5890800..5890819,
FT                   5890820..5891380)
FT                   /locus_tag="VIT_17s0000g06650"
FT                   /old_locus_tag="Vv17s0000g06650"
FT                   /product="unknown predicted protein"
FT   CDS_pept        join(5884210..5884575,5885636..5885920,5886231..5886548,
FT                   5887913..5888140,5888495..5888592,5889326..5889407,
FT                   5889547..5890077,5890454..5890586,5890800..5890819)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06650"
FT                   /old_locus_tag="Vv17s0000g06650"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SI73"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI73"
FT                   /protein_id="CBI15183.3"
FT                   /translation="MGCVSSKQAVSVTPAFDVSVAFRDNAGSGRSRGGRVVAAEFEKKK
FT                   KSGGGESGLSGSELGESGRVSSNGGGDSLSFRLGNLHKYVEGEQVAAGWPAWLSAVAGE
FT                   AIQGWVPLRADSYQTLEKIGQGTYSTVFRARELETGRVVALKKVRFDNFEPESVRFMAR
FT                   EITILRRLDHPNIVKLDGLITSRLSCSIYLVFEYMEHDLSGLMSCPDIKFSESQVKCYT
FT                   KQLLSGLEHCHSRGVMHRDIKGANLLVNNEGILKIADFGLANFCSSVYRQPLTSRVVTL
FT                   WYRPPELLLGSTDYGASVDLWSVGCVFAELLVGRPILKGRTEVEQLHKIFKLCGSPPDE
FT                   YWKKSKLPHATLFKPQQPYESCLRESFKDLPTISVDLIETLLSVEPYKRGTASSALASE
FT                   YFKTKPYACDPSSLPKYSPNKEIDAKNREESRRKKVGGRVRGSEKPTRKPNGINKLVPA
FT                   ENFTAQTQGPHKLNGNGFHIFKEGDGKLGGEPPKPSIDVLTEASHMKNASQGDIPFSGP
FT                   LQVSTSSGFAWAKRRKDDASTRSHSRSSSRGLGCNALEPNAALHARNNSNRLENSDVSN
FT                   GGRTDSRGYDSSEIAKRVMLKQWGQFERPDSFDASDMYHSQELSLPMYRREEMAAKRNH
FT                   LSYQDQGEKVEFSGPLLSQSHRVDELLERHERHIRQAVRRSWFQRGKKNGK"
FT   3'UTR           5890820..5891380
FT                   /locus_tag="VIT_17s0000g06650"
FT                   /old_locus_tag="Vv17s0000g06650"
FT   gap             5911644..5913471
FT                   /estimated_length=1828
FT   gene            5919060..5938533
FT                   /locus_tag="VIT_17s0000g06640"
FT                   /old_locus_tag="Vv17s0000g06640"
FT   mRNA            join(5919060..5919099,5919100..5919172,5920449..5921152,
FT                   5921219..5921440,5921519..5922712,5923259..5923820,
FT                   5923917..5924019,5924341..5924473,5924788..5924859,
FT                   5926186..5926284,5926444..5926485,5928070..5928150,
FT                   5928255..5928305,5928387..5928468,5929687..5929781,
FT                   5931539..5931610,5931693..5931809,5935431..5935499,
FT                   5935601..5935667,5937280..5937431,5937432..5938246,
FT                   5938369..5938533)
FT                   /locus_tag="VIT_17s0000g06640"
FT                   /old_locus_tag="Vv17s0000g06640"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           5919060..5919099
FT                   /locus_tag="VIT_17s0000g06640"
FT                   /old_locus_tag="Vv17s0000g06640"
FT   CDS_pept        join(5919100..5919172,5920449..5921152,5921219..5921440,
FT                   5921519..5922712,5923259..5923820,5923917..5924019,
FT                   5924341..5924473,5924788..5924859,5926186..5926284,
FT                   5926444..5926485,5928070..5928150,5928255..5928305,
FT                   5928387..5928468,5929687..5929781,5931539..5931610,
FT                   5931693..5931809,5935431..5935499,5935601..5935667,
FT                   5937280..5937431)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06640"
FT                   /old_locus_tag="Vv17s0000g06640"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR014020"
FT                   /db_xref="InterPro:IPR015425"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR029023"
FT                   /db_xref="InterPro:IPR042201"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT55"
FT                   /protein_id="CCB43064.1"
FT                   /translation="MALFRRFFYRKPPDRLLEISERVYVFDCCFSTDVLEEDEYKVYMG
FT                   GIVAQLQDYFTDASFMVFNFREGDRRSQISDILSQYDMTVMDYPRQYEGCPLLPLEMIH
FT                   HFLRSSESWLSLEGQQNVLLMHCERGGWPVLAFMLAGLLLYRKQYNGEQRTLEMVYKQA
FT                   PRELLHLLSPLNPQPSQLRYLQYISRRNFGSDWPPSDTPLKLDYLILRILPLFNGGRGC
FT                   RPVVRVYGQDASAMANRSSKLLFSTSKTKKHVRHYQQAECTVVKIGIHCRVQGDVVLEC
FT                   IHLDEDLVREEMMFRVMFHTAFVRSNILILNRDEIDVLWDVKDQFPKDFKAEVLFSDAN
FT                   AIGSICTTEIAGEDVNENESASPEEFFEVEEIFSNAADAQEVKGDYDIHAVQDIMMDDG
FT                   NHKEVWKEDLDPQAFQDCASDDGNHKLDGRVDSNLPSAKAIALGNRDDKLKSMVVVSAV
FT                   LRNRETKEVTADVCLDDGDKILDSPVVVADELKNIGTKVVAADLSSKSGEMEDNREDTA
FT                   DGIRNIETNVVIADVSRKLELENKCDREDITDGIKVIETNLVTADVSSKLEDIENKFDR
FT                   EGIADGAKNIETNLVAADISSKSEEVENNRDREDIAMQKQIDNRVPQQKLNADSGRQKS
FT                   DKLLPPAPRKQPASTAKPPAAESVIAKQKVKQQEPQSAAAKPTKQKPLVSRWIPPNKGS
FT                   YTNSMHISYPPSRYNSAPAALVITALSKDSNADGNLELVGFGVPSPPPPPPLPSMRGGP
FT                   PPPPPPPVLGVPPPPPPPPLRGGPPAPPPPPSRGGPPPPPPPPSRGGPPPPPPPPLHGA
FT                   PPPPPPPPRSGVPPPPPPPMRGAPPPPPPPMRGAPPPPPPPMGRAPPPPPPPMRGAPPP
FT                   PFGGAPPPPPPPTGRGPPPPPPPGGRAPGPPAPPRPPGGGPPPPPPFAPRRSSLKPLHW
FT                   SKVTRALQGSLWEELQRYGEPQIAPEFDVSELETLFSATVPNSANSLGGKSGGRRKSVG
FT                   SKADRVNLIDLRRANNTEIMLTKVKMPLSDMMAAVLAMDESILDVDQVENLIKFCPTKE
FT                   EMELLKAYTGDKEALGKCEQFFLELMKVPRVESKLRVFSFKIQFGSQISDFRKSLNTVN
FT                   SACEEVRNSVKLKEIMKKILYLGNTLNQGTARGSAVGFKLDSLLKLTDTRASNSKMTLM
FT                   HYLCKVLASKSPGLLDFHEDLVSLEAASKIQLKSLAEEMQAIMKGLEKVKQELNASEND
FT                   GPVSDIFRKTLKEFIGVAEGQVGSVTNLYSVVGRNADALALYFGEDPVRCPFEQVTVTL
FT                   LNFIRLFRKAHEENCKQAELERKKAQKEVEMEKAKGINLTKKGVK"
FT   gap             5923152..5923251
FT                   /estimated_length=100
FT   3'UTR           join(5937432..5938246,5938369..5938533)
FT                   /locus_tag="VIT_17s0000g06640"
FT                   /old_locus_tag="Vv17s0000g06640"
FT   gene            complement(5939690..5940999)
FT                   /locus_tag="VIT_17s0000g06630"
FT                   /old_locus_tag="Vv17s0000g06630"
FT   mRNA            complement(join(5939690..5939918,5939919..5940899,
FT                   5940900..5940999))
FT                   /locus_tag="VIT_17s0000g06630"
FT                   /old_locus_tag="Vv17s0000g06630"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(5939690..5939918)
FT                   /locus_tag="VIT_17s0000g06630"
FT                   /old_locus_tag="Vv17s0000g06630"
FT   CDS_pept        complement(5939919..5940899)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06630"
FT                   /old_locus_tag="Vv17s0000g06630"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT56"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT56"
FT                   /protein_id="CCB43065.1"
FT                   /translation="MERTGRIMRRSVYTFLQQYQFFTSTAALLVLPFSASILLSQAFLP
FT                   FSSPLLPVIHDRLQFLFKAAGFPPSSQFFTILNLKLSQTISSSIFTLPFTISFLLIGKA
FT                   CIIQALNHNKPGFPPSFSSFISLYCPLLITYIWNSLLILSANATAFSVLFIAFNCLEGL
FT                   GYSSPNFVPFLSAAAAILYSIILANSLIICNLALVLSGMERCGGYIAILKACVMIRGRT
FT                   STALSLALPINLALAAVEALFQYRVVRAYHISGKPRSSIALEGLFIAYMYSILVVLDTI
FT                   VSCIFFKRCKRGCWTDQDGTHSYRIEIAEEGGKAFENTRISEELP"
FT   5'UTR           complement(5940900..5940999)
FT                   /locus_tag="VIT_17s0000g06630"
FT                   /old_locus_tag="Vv17s0000g06630"
FT   gene            complement(5946130..5948007)
FT                   /locus_tag="VIT_17s0000g06620"
FT                   /old_locus_tag="Vv17s0000g06620"
FT   mRNA            complement(join(5946130..5946447,5946448..5948007))
FT                   /locus_tag="VIT_17s0000g06620"
FT                   /old_locus_tag="Vv17s0000g06620"
FT                   /product="Probable receptor-like protein kinase At5g61350"
FT   3'UTR           complement(5946130..5946447)
FT                   /locus_tag="VIT_17s0000g06620"
FT                   /old_locus_tag="Vv17s0000g06620"
FT   CDS_pept        complement(5946448..5948007)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06620"
FT                   /old_locus_tag="Vv17s0000g06620"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT57"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT57"
FT                   /protein_id="CCB43066.1"
FT                   /translation="MGVSGLDLSTLTSGLAIAYYKDFVLNATAITNGSIMVQVGPASNL
FT                   GSGQSNAILNGLEVMKMSNMAGSLDGLFNVDESFKGSSGSKKMKILAAVGLIMAITAML
FT                   LLGMVFFRWQKRPKDWEKKNSFSSWLLPLHAGQSSFLSSKSGSQRSNLYGSHKSKSGYS
FT                   SFLSSGLGLGRLFSFAELQDATRNFDEKAVIGVGGFGKVYLGELEDGTKLAIKRGNANS
FT                   EQGINEFQTEIQMLSKLRHRHLVSLIGYCDEQSEMILVYEYMANGPLRDHIYGSNLPHL
FT                   SWKQRLDICIGAARGLHYLHTGAAQGIIHRDVKTTNILLDDNFVAKVSDFGLSKAAPTL
FT                   EQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPAINPALPREQVN
FT                   LAEWAMQWNRKGMIEKIVDPHIAGTVSSGSLKKYVEAAEKCLAEHGVDRPSMGDVLWNL
FT                   EYALQMQEASSLIDPLDSSAKLITLEPGKEEPKGAASTPVSDDSEVTVGSPVFSQTGFQ
FT                   GR"
FT   gene            complement(5950773..5962870)
FT                   /locus_tag="VIT_17s0000g06610"
FT                   /old_locus_tag="Vv17s0000g06610"
FT   mRNA            complement(join(5950773..5951021,5951022..5951081,
FT                   5951364..5951432,5951512..5951591,5952772..5952847,
FT                   5953125..5953194,5953280..5953329,5954329..5954365,
FT                   5954530..5954591,5954702..5954740,5956285..5956462,
FT                   5956921..5956981,5957067..5957257,5957412..5957473,
FT                   5959338..5959424,5959525..5959609,5959763..5959845,
FT                   5962347..5962448,5962724..5962792,5962793..5962870))
FT                   /locus_tag="VIT_17s0000g06610"
FT                   /old_locus_tag="Vv17s0000g06610"
FT                   /product="Predicted protein"
FT   3'UTR           complement(5950773..5951021)
FT                   /locus_tag="VIT_17s0000g06610"
FT                   /old_locus_tag="Vv17s0000g06610"
FT   CDS_pept        complement(join(5951022..5951081,5951364..5951432,
FT                   5951512..5951591,5952772..5952847,5953125..5953194,
FT                   5953280..5953329,5954329..5954365,5954530..5954591,
FT                   5954702..5954740,5956285..5956462,5956921..5956981,
FT                   5957067..5957257,5957412..5957473,5959338..5959424,
FT                   5959525..5959609,5959763..5959845,5962347..5962448,
FT                   5962724..5962792))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06610"
FT                   /old_locus_tag="Vv17s0000g06610"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI75"
FT                   /protein_id="CBI15185.3"
FT                   /translation="MSAGASSSGLPSDDFNDVEDFNWVNEGEGLSKRDRYPELLDLVKK
FT                   GNRAFRENRMEEAINCYTKASNIQPNDAVILSNRCAAYIRISDFLKQRTPTDSEYRPLN
FT                   GLDPTIHAELALKDATRLVDLRSNSVKPYIFKANALILLEKYDLAREAILSGLQVDPLS
FT                   NALQVSLQKLEKATASLNHRGRGKPERSDDFDCTLCLKLLFEPVTTACGHSFCRSCLFQ
FT                   AMDCSNKCPLCRMVLFINPKTCSISVTLNNIIQRNFPEEYAERKSEHESLTNFGFDLLP
FT                   LFVMDVVLPCQKVLLNIFEPRYRLMVRRIMEGNHRMGMVIIDSTTGVPAEFGCEVEITE
FT                   CDPLPDGRFYLEVEGRRRFRIINCWDQDGYRVAAVEWVQDILPPDRTKEQVDLQEMSSN
FT                   AAKYARLWIKRAKEAAWQDRRRLAELCHAEAMMPTPQDPELFSFWLAGLSNRRPPERLD
FT                   LLYIRDTKERIRRGLIYMRDAEQGCQVQ"
FT   5'UTR           complement(5962793..5962870)
FT                   /locus_tag="VIT_17s0000g06610"
FT                   /old_locus_tag="Vv17s0000g06610"
FT   gene            5970988..5973839
FT                   /locus_tag="VIT_17s0000g06600"
FT                   /old_locus_tag="Vv17s0000g06600"
FT   mRNA            join(5970988..5971008,5971009..5971416,5972029..5972127,
FT                   5972128..5972131,5972532..5972659,5973789..5973839)
FT                   /locus_tag="VIT_17s0000g06600"
FT                   /old_locus_tag="Vv17s0000g06600"
FT   5'UTR           5970988..5971008
FT                   /locus_tag="VIT_17s0000g06600"
FT                   /old_locus_tag="Vv17s0000g06600"
FT   CDS_pept        join(5971009..5971416,5972029..5972127)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06600"
FT                   /old_locus_tag="Vv17s0000g06600"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SI76"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI76"
FT                   /protein_id="CBI15186.3"
FT                   /translation="MVEGDVEDCSVFPPSNHEGLPIQSQNQQDPPSSSSLSSSLPSHLN
FT                   VRGTTLGFGLTRWFAFGLRHLHSKLLAIASSFRHYANTRPTLGSFGPATGVITALVLAF
FT                   FFITLRRRRRSRPHSWEGTLDHLMLLIKERDEKIIQLLYQIIQMNEALLTHHRVGAVET
FT                   QKQLT"
FT   3'UTR           join(5972128..5972131,5972532..5972659,5973789..5973839)
FT                   /locus_tag="VIT_17s0000g06600"
FT                   /old_locus_tag="Vv17s0000g06600"
FT   gene            complement(5975991..5977646)
FT                   /locus_tag="VIT_17s0000g06590"
FT                   /old_locus_tag="Vv17s0000g06590"
FT   mRNA            complement(join(5975991..5976197,5976198..5977550,
FT                   5977551..5977646))
FT                   /locus_tag="VIT_17s0000g06590"
FT                   /old_locus_tag="Vv17s0000g06590"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(5975991..5976197)
FT                   /locus_tag="VIT_17s0000g06590"
FT                   /old_locus_tag="Vv17s0000g06590"
FT   CDS_pept        complement(5976198..5977550)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06590"
FT                   /old_locus_tag="Vv17s0000g06590"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT58"
FT                   /db_xref="InterPro:IPR008630"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT58"
FT                   /protein_id="CCB43067.1"
FT                   /translation="MGLDNFTTQKRTGAGIPTTNGRPAGGRLSGLPRGRQIHKTFNNIK
FT                   ITILCGFVTILVLRGTIGVGNLGGSGGEVENQNLIEETNRILAEIRSDGDPTDPDDPAE
FT                   SEINPNVTYTLGPKITNWNEERKVWLDRNPEFPNFVNGKARILLVTGSPPNPCDNPIGD
FT                   HYLLKSIKNKIDYCRIHGIEIVYNMAHLDKELAGYWAKLPLIRRLMLSHPEVEWIWWMD
FT                   SDALFTDMVFEIPLSKYDNYNLVVHGYPDLMFNQKSWIALNTGSFLFRNCQWSLDLLDA
FT                   WAPMGPKGPIRDEAGKILTANLKGRPAFEADDQSALIYLLISKKDEWMDKVFLENSYYL
FT                   HGYWAGLVDRYEEMIEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLRSMERAFN
FT                   FADNQVLKLYGFRHRGLLSPKIKRIRNETATPLEFVDQFDIRRPEHGGHSL"
FT   5'UTR           complement(5977551..5977646)
FT                   /locus_tag="VIT_17s0000g06590"
FT                   /old_locus_tag="Vv17s0000g06590"
FT   gene            5979147..5992276
FT                   /locus_tag="VIT_17s0000g06580"
FT                   /old_locus_tag="Vv17s0000g06580"
FT   mRNA            join(5979147..5979240,5979436..5979459,5979460..5979553,
FT                   5981372..5981430,5981521..5981709,5991108..5991278,
FT                   5992051..5992203,5992204..5992276)
FT                   /locus_tag="VIT_17s0000g06580"
FT                   /old_locus_tag="Vv17s0000g06580"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           5979147..5979240
FT                   /locus_tag="VIT_17s0000g06580"
FT                   /old_locus_tag="Vv17s0000g06580"
FT   CDS_pept        join(5979460..5979553,5981372..5981430,5981521..5981709,
FT                   5991108..5991278,5992051..5992203)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06580"
FT                   /old_locus_tag="Vv17s0000g06580"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT59"
FT                   /db_xref="InterPro:IPR007705"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="InterPro:IPR027027"
FT                   /db_xref="InterPro:IPR038407"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT59"
FT                   /protein_id="CCB43068.1"
FT                   /translation="MSQVFEGYERQYCELSANLSRKCTAASLLNGEQKKQKVSEIKAGL
FT                   DDADALIRKMDLEARSLQPSVKAMLLAKLREYKTDLNNVKNEVKRITSANTNQAARDNL
FT                   LESGMADTMTVSADQKTRLLMSTGRLNQSGDRIKESRRTMLETEELGVSILQDLHQQRQ
FT                   SLLHAHNTLHGVDDNISKSKKILTAMSRRMSRNKWIIGSVIAALVLAIILILYFKLAH"
FT   3'UTR           5992204..5992276
FT                   /locus_tag="VIT_17s0000g06580"
FT                   /old_locus_tag="Vv17s0000g06580"
FT   gene            complement(5993219..6000389)
FT                   /locus_tag="VIT_17s0000g06570"
FT                   /old_locus_tag="Vv17s0000g06570"
FT   mRNA            complement(join(5993219..5993520,5993960..5994614,
FT                   5994615..5995555,5997531..5997633,5997995..5998159,
FT                   5998749..5998882,5998984..5999145,6000125..6000275,
FT                   6000276..6000389))
FT                   /locus_tag="VIT_17s0000g06570"
FT                   /old_locus_tag="Vv17s0000g06570"
FT                   /product="Timing of CAB expression 1 protein"
FT   3'UTR           complement(join(5993219..5993520,5993960..5994614))
FT                   /locus_tag="VIT_17s0000g06570"
FT                   /old_locus_tag="Vv17s0000g06570"
FT   CDS_pept        complement(join(5994615..5995555,5997531..5997633,
FT                   5997995..5998159,5998749..5998882,5998984..5999145,
FT                   6000125..6000275))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06570"
FT                   /old_locus_tag="Vv17s0000g06570"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT60"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR010402"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT60"
FT                   /protein_id="CCB43069.1"
FT                   /translation="MARNEIGSGGSNSKSSDSFIDRSNVRILLCDNDTKSSDEIFTLLC
FT                   GCSYQVTSVRSARQVIDALNAEGHDIDIILAEVDLPMTKGMKMLKYIMRDKELRRIPII
FT                   MMSAQDEVSVVVKCLRLGAADYLVKPLRTNELLNLWTHMWRRRRMLGLAEKNILNYDFD
FT                   VAASDPSDANTNSTMFSDDTDDKSRMSANPEMVVSVHQEDESNATIDSTDVAAEPPVVN
FT                   QLECRPDVPGISDRRTGQLLSGPKKSELKVGESSAFFTYVKSSMIKTNSQGIPNINESA
FT                   PQHSRMEERVQAWSEKGVNDTQEHENGEAWENYSQGDDFPSSNSIPDSLSVEMSCTPPA
FT                   PIEFVQGRNSKGEEFSQVPIHPRNEHQVDISGFPGHTAYPYCMSGVMNQVMMPSSAQLY
FT                   PKSLHDMQNNATTSAMLPQYNHLPQCPPHVPGVASFPYYPVSICLQPGQMSTTHPWPSY
FT                   GNSSSTEVKLGKVDRREAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRKM
FT                   NGVNVDLNGRPASVDFDEDEEEYEEENASRDSTP"
FT   5'UTR           complement(6000276..6000389)
FT                   /locus_tag="VIT_17s0000g06570"
FT                   /old_locus_tag="Vv17s0000g06570"
FT   gene            complement(6003526..6005767)
FT                   /locus_tag="VIT_17s0000g06560"
FT                   /old_locus_tag="Vv17s0000g06560"
FT   mRNA            complement(join(6003526..6003734,6005069..6005220,
FT                   6005709..6005767))
FT                   /locus_tag="VIT_17s0000g06560"
FT                   /old_locus_tag="Vv17s0000g06560"
FT   CDS_pept        complement(join(6003526..6003734,6005069..6005220,
FT                   6005709..6005767))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06560"
FT                   /old_locus_tag="Vv17s0000g06560"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SI80"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI80"
FT                   /protein_id="CBI15190.3"
FT                   /translation="MPCYGLQPLHDGSCHYFLHMPAKSDASGNGNTNKRICAFVNRSKL
FT                   KILLCDANVNNCREVATLLRGCSYQMTSVGSTREVIYVLNCEGASIDIVLAEADLPMAN
FT                   SMKILKYITQDQELRCIPVMSMFVLTFILPFSIAS"
FT   gene            6006333..6007398
FT                   /locus_tag="VIT_17s0000g06550"
FT                   /old_locus_tag="Vv17s0000g06550"
FT   mRNA            join(6006333..6006594,6006595..6006718,6007260..6007357,
FT                   6007358..6007398)
FT                   /locus_tag="VIT_17s0000g06550"
FT                   /old_locus_tag="Vv17s0000g06550"
FT   5'UTR           6006333..6006594
FT                   /locus_tag="VIT_17s0000g06550"
FT                   /old_locus_tag="Vv17s0000g06550"
FT   CDS_pept        join(6006595..6006718,6007260..6007357)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06550"
FT                   /old_locus_tag="Vv17s0000g06550"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SI81"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI81"
FT                   /protein_id="CBI15191.3"
FT                   /translation="MNKVSSSAASNLLNIGLCVIHEESFRYVSVAYIVISPFAVVAYFY
FT                   HMVGEFKNPFFQVTTGLHLDLLPESMDM"
FT   3'UTR           6007358..6007398
FT                   /locus_tag="VIT_17s0000g06550"
FT                   /old_locus_tag="Vv17s0000g06550"
FT   gene            complement(6007543..6009168)
FT                   /locus_tag="VIT_17s0000g06540"
FT                   /old_locus_tag="Vv17s0000g06540"
FT   mRNA            complement(join(6007543..6007766,6007767..6007975,
FT                   6008868..6008931,6009056..6009121,6009122..6009168))
FT                   /locus_tag="VIT_17s0000g06540"
FT                   /old_locus_tag="Vv17s0000g06540"
FT   3'UTR           complement(6007543..6007766)
FT                   /locus_tag="VIT_17s0000g06540"
FT                   /old_locus_tag="Vv17s0000g06540"
FT   CDS_pept        complement(join(6007767..6007975,6008868..6008931,
FT                   6009056..6009121))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06540"
FT                   /old_locus_tag="Vv17s0000g06540"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT61"
FT                   /protein_id="CCB43070.1"
FT                   /translation="MVKKSSWQLQLPIPLRQFGNRKELRLCSDKSGSSLVLCNGFVLGV
FT                   KPPDILTTDSWISPNTITRTRANGKASSEGMSLNMSTPSSSLKFENHSVLKIIQYYLPV
FT                   ITAVWKES"
FT   5'UTR           complement(6009122..6009168)
FT                   /locus_tag="VIT_17s0000g06540"
FT                   /old_locus_tag="Vv17s0000g06540"
FT   gene            complement(6029551..6030695)
FT                   /locus_tag="VIT_17s0000g06530"
FT                   /old_locus_tag="Vv17s0000g06530"
FT   mRNA            complement(join(6029551..6029943,6029982..6030205,
FT                   6030295..6030420,6030421..6030459,6030555..6030593,
FT                   6030594..6030695))
FT                   /locus_tag="VIT_17s0000g06530"
FT                   /old_locus_tag="Vv17s0000g06530"
FT   3'UTR           complement(join(6029551..6029943,6029982..6030205,
FT                   6030295..6030420))
FT                   /locus_tag="VIT_17s0000g06530"
FT                   /old_locus_tag="Vv17s0000g06530"
FT   CDS_pept        complement(join(6030421..6030459,6030555..6030593))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06530"
FT                   /old_locus_tag="Vv17s0000g06530"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI83"
FT                   /protein_id="CBI15193.3"
FT                   /translation="MATNKKIQNALIMAQLERRSMYSQL"
FT   5'UTR           complement(6030594..6030695)
FT                   /locus_tag="VIT_17s0000g06530"
FT                   /old_locus_tag="Vv17s0000g06530"
FT   gene            complement(6033312..6034499)
FT                   /locus_tag="VIT_17s0000g06520"
FT                   /old_locus_tag="Vv17s0000g06520"
FT   mRNA            complement(join(6033312..6033553,6033554..6033576,
FT                   6033703..6033834,6033947..6034096,6034283..6034457,
FT                   6034458..6034499))
FT                   /locus_tag="VIT_17s0000g06520"
FT                   /old_locus_tag="Vv17s0000g06520"
FT                   /product="Type-b response regulator"
FT   3'UTR           complement(6033312..6033553)
FT                   /locus_tag="VIT_17s0000g06520"
FT                   /old_locus_tag="Vv17s0000g06520"
FT   CDS_pept        complement(join(6033554..6033576,6033703..6033834,
FT                   6033947..6034096,6034283..6034457))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06520"
FT                   /old_locus_tag="Vv17s0000g06520"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SI84"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI84"
FT                   /protein_id="CBI15194.3"
FT                   /translation="MDKGKQIVTGKSDAGVSGSTNKKIRALIDRSKLRILLCDTNAGSC
FT                   KEVASLLKECSYQGSTGEAIHVLSSEGPSIDIVLAELDLPMANCLKMLKYITEDQELRC
FT                   IPVIMLVTEDKISMIANCLRYGAVDYLLTPLGINELLNLSIHMESKAHAPTSREE"
FT   5'UTR           complement(6034458..6034499)
FT                   /locus_tag="VIT_17s0000g06520"
FT                   /old_locus_tag="Vv17s0000g06520"
FT   gene            complement(6035008..6041066)
FT                   /locus_tag="VIT_17s0000g06510"
FT                   /old_locus_tag="Vv17s0000g06510"
FT   mRNA            complement(join(6035008..6035228,6035229..6035463,
FT                   6036005..6036714,6037944..6038007,6038981..6039027,
FT                   6040097..6040254,6040734..6041013,6041014..6041066))
FT                   /locus_tag="VIT_17s0000g06510"
FT                   /old_locus_tag="Vv17s0000g06510"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(6035008..6035228)
FT                   /locus_tag="VIT_17s0000g06510"
FT                   /old_locus_tag="Vv17s0000g06510"
FT   CDS_pept        complement(join(6035229..6035463,6036005..6036714,
FT                   6037944..6038007,6038981..6039027,6040097..6040254,
FT                   6040734..6041013))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06510"
FT                   /old_locus_tag="Vv17s0000g06510"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT62"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT62"
FT                   /protein_id="CCB43071.1"
FT                   /translation="MGPGEERSEIAFFDVETTVPTRVGQGFAILEFGAILVCPRKLVEL
FT                   ESYSTLVRPHDLSLVSSLSVRCNGITRDAVVSAPNFRDIADRVYDILHGRIWAGHNILR
FT                   FDCARIREAFAEIGRPAPEPKGSIDSLALLTQRFGRRAGDMKMATLATYFGLGQQTHRS
FT                   LDDVRMNLEVLKYCATVLFLESSLPDIFTTNSWVSPNAVTRSRSNGKASPVGMNLNMST
FT                   PSSSIKFENHSISSPSTHSSMEGILNLVEPNTNQPDPFNLGALSSEIERESLKPDYALE
FT                   EKPVTESLEMLSTTTASQDCCDYAGFLDPAEVSVASISASFVPLYRGTRRMQILHNDVK
FT                   LLLHCTQLRVRFGISTRFVDPAGRPRLSFVVDGSPSLCQVLDACDQLAYKLSVDSGSSS
FT                   EWRPVVIRKTGFLNTPTIRLSIPTVTNGDIAIYATEIYQKDPSGTTQRLIFSRFDAAEL
FT                   DTLFVPGTLVDTYFALDPYDYQQNAGIKLVAKKLIIHGK"
FT   5'UTR           complement(6041014..6041066)
FT                   /locus_tag="VIT_17s0000g06510"
FT                   /old_locus_tag="Vv17s0000g06510"
FT   gene            complement(6042426..6044031)
FT                   /locus_tag="VIT_17s0000g06500"
FT                   /old_locus_tag="Vv17s0000g06500"
FT   mRNA            complement(join(6042426..6043829,6043830..6044031))
FT                   /locus_tag="VIT_17s0000g06500"
FT                   /old_locus_tag="Vv17s0000g06500"
FT                   /product="Predicted protein"
FT   CDS_pept        complement(6042426..6043829)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06500"
FT                   /old_locus_tag="Vv17s0000g06500"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SI86"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI86"
FT                   /protein_id="CBI15196.3"
FT                   /translation="MIRGHSQSETPHKLVELYNRMVEAEAEPNEFTYSFLIGGCARSRL
FT                   LREGEQVHGRVVANGYCTNVFVRTSLVNLYAIAGGYDGVRKARRVFDEIVDRNIVSWNS
FT                   LLAGYVRCGDVDGARRIFDEMPERNVVSWTTMIAGCAQIGRCKQALHLFHEMRRAGVKL
FT                   DQVALVAALSACAELGDLKLGTWIHSYIDERLHAGNQPLLVSLNNSLIHMYASCGVIDK
FT                   AYKVFIGMQQRSTISWTSMITGFAKQGHAEEALGVFQWMQRLGTDEGRPDGITFIGVLC
FT                   ACSHAGFVDQGRHFFECMNKKWGIVPRIEHYGCMVDLLSRAGFLDEAHRLIESMPMKPN
FT                   DAVWGALLGGCRIHKNAELASHVAQKLALELKPDQAAGYLVLLSNVYATAKRWQDVALV
FT                   RQKMVEIGVRKPAGRSWVQINGVVHDFVAGDWTHKHASSVYEMLSKITRQAKLEGYKLD
FT                   ISEVLLDVE"
FT   5'UTR           complement(6043830..6044031)
FT                   /locus_tag="VIT_17s0000g06500"
FT                   /old_locus_tag="Vv17s0000g06500"
FT   gene            6044927..6045307
FT                   /locus_tag="VIT_17s0000g06490"
FT                   /old_locus_tag="Vv17s0000g06490"
FT   mRNA            6044927..6045307
FT                   /locus_tag="VIT_17s0000g06490"
FT                   /old_locus_tag="Vv17s0000g06490"
FT   CDS_pept        6044927..6045307
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06490"
FT                   /old_locus_tag="Vv17s0000g06490"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI87"
FT                   /protein_id="CBI15197.3"
FT                   /translation="MSSMSPLDVAVYNFSTIKVVKAEEDLNSDIGESKLINDVSLLKRS
FT                   IIHVLQQHLDFADVVVHVMALHHVGVIHISKDLDYSIDLVEHNVLVVSVDHLQGVQPPR
FT                   QLVEDLVHSVTAVTPHRTKTEL"
FT   gene            6047551..6048715
FT                   /locus_tag="VIT_17s0000g06480"
FT                   /old_locus_tag="Vv17s0000g06480"
FT   mRNA            join(6047551..6047896,6047897..6048715)
FT                   /locus_tag="VIT_17s0000g06480"
FT                   /old_locus_tag="Vv17s0000g06480"
FT                   /product="Pentatricopeptide repeat-containing protein
FT                   At5g61400"
FT   5'UTR           6047551..6047896
FT                   /locus_tag="VIT_17s0000g06480"
FT                   /old_locus_tag="Vv17s0000g06480"
FT   CDS_pept        6047897..6048715
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06480"
FT                   /old_locus_tag="Vv17s0000g06480"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT63"
FT                   /protein_id="CCB43072.1"
FT                   /translation="MKKKGFLPNAVTYNTLIDGYCKEGNMEKAIEVCSQMTEKGIEPNI
FT                   ITFSTLIDGYCKAGKMEAAMGLYTEMVIKGLLPDVVAYTALIDGHFKDGNTKEAFRLHK
FT                   EMQEAGLHPNVFTLSCLIDGLCKDGRISDAIKLFLAKTGTDTTGSKTNELDRSLCSPNH
FT                   VMYTALIQGLCTDGRIFKASKFFSDMRCSGLRPDVFTCIVIIQGHFRAMHLRDVMMLQA
FT                   DILKMGIIPNSSVYRVLAKGYEESGYLKSALRCSEDLSGIGIGCSNLNDL"
FT   gene            6050148..6051257
FT                   /locus_tag="VIT_17s0000g06470"
FT                   /old_locus_tag="Vv17s0000g06470"
FT   mRNA            6050148..6051257
FT                   /locus_tag="VIT_17s0000g06470"
FT                   /old_locus_tag="Vv17s0000g06470"
FT                   /product="putative pentatricopeptide repeat-containing
FT                   protein At1g74400"
FT   CDS_pept        6050148..6051257
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06470"
FT                   /old_locus_tag="Vv17s0000g06470"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT64"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT64"
FT                   /protein_id="CCB43073.1"
FT                   /translation="MYSATGNVADAHNMFDEIPSKNLISWTSVISAYVDNQRPNKALQL
FT                   FRQMQMDDVQPDIVTVTVALSACADLGALDMGEWIHAYIRHRGLDTDLCLNNSLINMYS
FT                   KCGEIGTARRLFDGTQKKDVTTWTSMIVGHALHGQAEEALQLFTEMKETNKRARKNKRN
FT                   GEHESSLVLPNDVTFMGVLMACSHAGLVEEGKQHFRSMKEDYSLRPRISHFGCMVDLLC
FT                   RAGLLTEAYEFILKMPVRPNAVVWRTLLGACSLQGDSNGNGNSNIKIYSEARRQLLELE
FT                   PSHVGDNVIMSNLYAAKGMWDKKMLVRNQIKQRRDPGCSSIEVGIDIKEFVAADDQHPC
FT                   MPQIYEILDHLTRTMRASDCALGTDTPME"
FT   gene            6051656..6056121
FT                   /locus_tag="VIT_17s0000g06460"
FT                   /old_locus_tag="Vv17s0000g06460"
FT   mRNA            join(6051656..6051803,6051804..6051912,6052678..6052856,
FT                   6053244..6053327,6055460..6055618,6055720..6055842,
FT                   6055843..6056121)
FT                   /locus_tag="VIT_17s0000g06460"
FT                   /old_locus_tag="Vv17s0000g06460"
FT                   /product="unknown predicted protein"
FT   5'UTR           6051656..6051803
FT                   /locus_tag="VIT_17s0000g06460"
FT                   /old_locus_tag="Vv17s0000g06460"
FT   CDS_pept        join(6051804..6051912,6052678..6052856,6053244..6053327,
FT                   6055460..6055618,6055720..6055842)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06460"
FT                   /old_locus_tag="Vv17s0000g06460"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SI89"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI89"
FT                   /protein_id="CBI15199.3"
FT                   /translation="MEHGGFEEGGEIRVYHYIPRLIAGALSGALTGVFALAGAFTGAIT
FT                   GAIAGRASDSGVLRGAGLGAIAGAVLSVEVLEASRAYWCSDRSNSQNSLSITDFIEELL
FT                   RGRIVEESFTPAVLTTYRWQVSIGNLSYDEMYDVYGEVASRGLSGDSLKKLPCHVILDE
FT                   IKAAQSNCCTICLQDIEVGEIARSLPWCHHTFHLACVDKWLIRHGTCPVCRRNV"
FT   3'UTR           6055843..6056121
FT                   /locus_tag="VIT_17s0000g06460"
FT                   /old_locus_tag="Vv17s0000g06460"
FT   gene            complement(6056973..6064091)
FT                   /locus_tag="VIT_17s0000g06450"
FT                   /old_locus_tag="Vv17s0000g06450"
FT   mRNA            complement(join(6056973..6057292,6057795..6057803,
FT                   6057804..6057866,6057939..6058046,6058522..6058578,
FT                   6058657..6058766,6060690..6060768,6061961..6062074,
FT                   6062156..6062296,6062587..6062701,6063883..6063995,
FT                   6063996..6064091))
FT                   /locus_tag="VIT_17s0000g06450"
FT                   /old_locus_tag="Vv17s0000g06450"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(join(6056973..6057292,6057795..6057803))
FT                   /locus_tag="VIT_17s0000g06450"
FT                   /old_locus_tag="Vv17s0000g06450"
FT   CDS_pept        complement(join(6057804..6057866,6057939..6058046,
FT                   6058522..6058578,6058657..6058766,6060690..6060768,
FT                   6061961..6062074,6062156..6062296,6062587..6062701,
FT                   6063883..6063995))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06450"
FT                   /old_locus_tag="Vv17s0000g06450"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT65"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT65"
FT                   /protein_id="CCB43074.1"
FT                   /translation="MATASLGSSTLQSQINGFGVNKLQRSSLFQPTSFTFSRRKFSSTV
FT                   KASARVDKFSKSDIIVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIG
FT                   PLIVGALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTINQIK
FT                   SLGAKAGVVLNPATPLSTIEYVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRICA
FT                   EKGVNPWIEVDGGVGPANAYKVIEAGANALVAGSAVFGAKDYAEGMDSVNLNESERDEL
FT                   KPARGLLQLQYESQLQMI"
FT   5'UTR           complement(6063996..6064091)
FT                   /locus_tag="VIT_17s0000g06450"
FT                   /old_locus_tag="Vv17s0000g06450"
FT   gene            6070422..6074605
FT                   /locus_tag="VIT_17s0000g06440"
FT                   /old_locus_tag="Vv17s0000g06440"
FT   mRNA            join(6070422..6070572,6070573..6070816,6072891..6074368,
FT                   6074369..6074605)
FT                   /locus_tag="VIT_17s0000g06440"
FT                   /old_locus_tag="Vv17s0000g06440"
FT                   /product="Galactoside 2-alpha-L-fucosyltransferase"
FT   5'UTR           6070422..6070572
FT                   /locus_tag="VIT_17s0000g06440"
FT                   /old_locus_tag="Vv17s0000g06440"
FT   CDS_pept        join(6070573..6070816,6072891..6074368)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06440"
FT                   /old_locus_tag="Vv17s0000g06440"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT66"
FT                   /db_xref="InterPro:IPR004938"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT66"
FT                   /protein_id="CCB43075.1"
FT                   /translation="MRLRRNTDDEQLRLSDPEHHTVSRPLDRECEQNPMRLMGILVVCL
FT                   MVVSVLFSVSVVLRDPPSDGVWASEETKFLQVNPRKDAEDNLSWSAEEPKDKLLGGLLD
FT                   AGFNERSCLSRYQSALYRKELLHKPSSYLLSKLRSYEALHKRCGPYTESYNRTLKQLQL
FT                   GQHMEQSDCNYLVWISFSGLGNRILTLASAFLYAILTNRVLLVDPGADMPDLFCEPFPE
FT                   VSWLLPLDFPLKNEFNSFDQKSPFCYGKMLKNKTLTDSSWSILPPYVYLHLVHDYDDHD
FT                   KMFFCNQDQSFLRKIPCLIIKTDNYFVPSLFLIPSFEQELSNLFPVKGTVFHFLGRYLF
FT                   HPTNVVWGLITRYYQAYLAKADETIGIQIRVFDTGIGPFQHVLDQIIACTMTENLLPEI
FT                   NMREPVVSSYGHKKSKAVLMTSLSAGYFEKVRNMYWEHPTVTGEVIGVYQPSHEEYQQT
FT                   EKQNHNRKAWAEMYLLSLTDVLVTSSWSTFGYVAQGLGGLKPWILYKPENQTAPDPPCR
FT                   RAMSMEPCFHAPPFYDCKAKKGVDTGALVPHVRHCEDMSWGLKLVDDSQEHGVVRT"
FT   3'UTR           6074369..6074605
FT                   /locus_tag="VIT_17s0000g06440"
FT                   /old_locus_tag="Vv17s0000g06440"
FT   gene            complement(6075062..6078205)
FT                   /locus_tag="VIT_17s0000g06430"
FT                   /old_locus_tag="Vv17s0000g06430"
FT   mRNA            complement(join(6075062..6075267,6075268..6075310,
FT                   6075429..6075571,6076106..6076215,6076303..6076453,
FT                   6078125..6078205))
FT                   /locus_tag="VIT_17s0000g06430"
FT                   /old_locus_tag="Vv17s0000g06430"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(6075062..6075267)
FT                   /locus_tag="VIT_17s0000g06430"
FT                   /old_locus_tag="Vv17s0000g06430"
FT   CDS_pept        complement(join(6075268..6075310,6075429..6075571,
FT                   6076106..6076215,6076303..6076453,6078125..6078205))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06430"
FT                   /old_locus_tag="Vv17s0000g06430"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SI92"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI92"
FT                   /protein_id="CBI15202.3"
FT                   /translation="MLFHCIRNRSFWVLFFWMNAAYNPNLTVCNIMGKDSKAKEGKGKG
FT                   KQAASGGDENASKGKGKAGKSADGLGTCTYVKARHILCEKQGKINEAYKKLQDGWLSNG
FT                   DKVPPAEFAKLAAEYSECPSGKKGGDLGWFPRGKMAGPFQDVAFSTVIGATSAPFKSTH
FT                   GYHIILCEGRKN"
FT   gene            complement(6079874..6105423)
FT                   /locus_tag="VIT_17s0000g06420"
FT                   /old_locus_tag="Vv17s0000g06420"
FT   mRNA            complement(join(6079874..6080067,6080068..6080196,
FT                   6080437..6080697,6082060..6082119,6082333..6082566,
FT                   6084334..6084474,6084887..6085029,6086339..6086392,
FT                   6086499..6086569,6087792..6087928,6090437..6090472,
FT                   6092259..6092355,6092559..6092616,6095278..6095388,
FT                   6096098..6096155,6101420..6101502,6101633..6101717,
FT                   6101839..6101916,6102216..6102258,6104852..6104921,
FT                   6104995..6105142,6105143..6105423))
FT                   /locus_tag="VIT_17s0000g06420"
FT                   /old_locus_tag="Vv17s0000g06420"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(6079874..6080067)
FT                   /locus_tag="VIT_17s0000g06420"
FT                   /old_locus_tag="Vv17s0000g06420"
FT   CDS_pept        complement(join(6080068..6080196,6080437..6080697,
FT                   6082060..6082119,6082333..6082566,6084334..6084474,
FT                   6084887..6085029,6086339..6086392,6086499..6086569,
FT                   6087792..6087928,6090437..6090472,6092259..6092355,
FT                   6092559..6092616,6095278..6095388,6096098..6096155,
FT                   6101420..6101502,6101633..6101717,6101839..6101916,
FT                   6102216..6102258,6104852..6104921,6104995..6105142))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06420"
FT                   /old_locus_tag="Vv17s0000g06420"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SI93"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI93"
FT                   /protein_id="CBI15203.3"
FT                   /translation="MVRVSSGGAASSSMASTLKAYSIPLVLLAAAIFLQLFVIPNSFPL
FT                   NHYDVLGIKRYSTVEEVAEAYEKFSSKWNSGTEVPETIDFLKIRYAFELLTDPLWKRDY
FT                   DIFGIDEQIDVFENVKKQFSGVSFSGINLPLLSAASSDPGDHVFNVITSNDFHSVLEKT
FT                   EPLLIQIYSLGSNSCRQFSNDWKRIATFLEGVANTGMVELGDARLAAYLAEKKPTGQPF
FT                   FRNGLPSLVAFPSGCRTSDCLVRYEGELSVDAVTDWFATAILTLPRISYYSKESLGQAF
FT                   LAKSSPWKVKVIVFSRTGQRATPFLRQAAKNYWAHASFAFVLWQEEDSSVWWNTFEVES
FT                   APAIVFLKDPGVKPVVHHGFFNNSWFVNIMEQNKQQELPQLRSITSMELGCDARGYSRA
FT                   GYDTMTWYCVILAGRLSLELNKMRETMRRVQQILSSAAELNGADKQQPSEPSAIALKDK
FT                   RLTFTWLDGEAQKQYCFFYIHSEDSYDTCGPRRDVADVPQLFIVRYKRNATVDDLKVER
FT                   RPKGIWNPFQEEDVDPASQLVARYNGSGEIPEIIKWISQIIKDGDSRDLPLFRTKTPQL
FT                   VPEDGDPIWSKGAQSILSTSKGLKYRIKSIISGMNDRLGDPRIGPMLLLGSLMSFASIW
FT                   LKRSQATHQSRLDQPSQPSNMDEDRKTRRNRKTTVSSQDRPTSITDMEPKDAYQAPLSD
FT                   SDSD"
FT   5'UTR           complement(6105143..6105423)
FT                   /locus_tag="VIT_17s0000g06420"
FT                   /old_locus_tag="Vv17s0000g06420"
FT   gene            complement(6106769..6108060)
FT                   /locus_tag="VIT_17s0000g06410"
FT                   /old_locus_tag="Vv17s0000g06410"
FT   mRNA            complement(join(6106769..6107498,6107671..6107800,
FT                   6107928..6108060))
FT                   /locus_tag="VIT_17s0000g06410"
FT                   /old_locus_tag="Vv17s0000g06410"
FT                   /product="Protein 1"
FT   CDS_pept        complement(join(6106769..6107498,6107671..6107800,
FT                   6107928..6108060))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06410"
FT                   /old_locus_tag="Vv17s0000g06410"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SI94"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI94"
FT                   /protein_id="CBI15204.3"
FT                   /translation="MGGSPCCDTTSLKRGPWTPEEDRKLLAYIQEHGHGSWRCVPENAG
FT                   LQRCGKSCRLRWTNYLRPDIKRGKFSLREEQTIIQLHALLGNRWSAIATHLPNRTDNEI
FT                   KNYWNTHLKKRLAKMGIDPVTHKPSHAVLTSPNGDSKNAANLSHMAQWESARLEAEARL
FT                   VKDSKLRQTQHASASAPAPAQLLNKMATRLTPPRRLDVLNAWENVGSKLKIGSSGSNRD
FT                   IPSPTSTLSFLENVSTISRVESSEITGILGTLGTEIDAFGTQQCDINMTWTMESTDENA
FT                   NFVHLLLSRSGDGILTNGGRDGEELEDNKNYWNDIMNLMTCQPSRSPNL"
FT   gene            complement(6122756..6124581)
FT                   /locus_tag="VIT_17s0000g06400"
FT                   /old_locus_tag="Vv17s0000g06400"
FT   mRNA            complement(join(6122756..6123000,6123001..6123618,
FT                   6123715..6123992,6124111..6124297,6124298..6124581))
FT                   /locus_tag="VIT_17s0000g06400"
FT                   /old_locus_tag="Vv17s0000g06400"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(6122756..6123000)
FT                   /locus_tag="VIT_17s0000g06400"
FT                   /old_locus_tag="Vv17s0000g06400"
FT   CDS_pept        complement(join(6123001..6123618,6123715..6123992,
FT                   6124111..6124297))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06400"
FT                   /old_locus_tag="Vv17s0000g06400"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5B814"
FT                   /db_xref="InterPro:IPR003441"
FT                   /db_xref="InterPro:IPR036093"
FT                   /db_xref="UniProtKB/TrEMBL:A5B814"
FT                   /protein_id="CCB43076.1"
FT                   /translation="MENIAGLSVEDDQMILPPGFRFHPTDEELITHYLSKKVIDSNFSA
FT                   RAIGQVNLNNSEPWELPGKAKMGEKEWYFFCVRDRKYPTGLRTNRATEAGYWKATGKDK
FT                   EIFRGKSLVGMKKTLVFYAGRAPKGEKTNWVMHEYRLEGKFSLHNLPQTAKNEWVICRV
FT                   FQKSSGGKKTHISGIGRLSSYGNELNPSVLPPLMDASAAYNPRTRPATSQSPHVPCFSN
FT                   PIDVPRNQEDIFDCFNNPLLAISSNPSDIFQRFHLPNPFYSSHAATIPGTLQYPTSFLM
FT                   QDQPSLRALLENHGSNMRQSQKLEREMISVSQETGLSTDINTEISSVVSNLELGKRPFE
FT                   DQHVPSTSVGPVDLDPLWNY"
FT   5'UTR           complement(6124298..6124581)
FT                   /locus_tag="VIT_17s0000g06400"
FT                   /old_locus_tag="Vv17s0000g06400"
FT   gene            6129551..6131030
FT                   /locus_tag="VIT_17s0000g06390"
FT                   /old_locus_tag="Vv17s0000g06390"
FT   mRNA            join(6129551..6130801,6130802..6131030)
FT                   /locus_tag="VIT_17s0000g06390"
FT                   /old_locus_tag="Vv17s0000g06390"
FT                   /product="Predicted protein"
FT   CDS_pept        6129551..6130801
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06390"
FT                   /old_locus_tag="Vv17s0000g06390"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SI96"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI96"
FT                   /protein_id="CBI15206.3"
FT                   /translation="MDYALRVFGKIENPDGFLWNTMIRGLGRTRQPEKAFEFYKRMQVK
FT                   GEVLDNFTYSFLVKVCGQLGSDLLGKQIHCNVLKHGLEEHVFVRNTLVHMYGMFKDIEA
FT                   ATHLFEEMPKSYLVAWNTIIDCNVYCGRYKEAIELFFRMLQSGLKPDDATFVVTLSACA
FT                   ALGELDIGRRVHSCIDHTGLGNVVSVSNSLIDMYAKCGVVEAAYEIFNKMKGRNIVSWN
FT                   TMILGLAMHGHGDEALELFSKMLEEKLATPNEVTFLGVLCACSHGGMVEEGRRYFDIMR
FT                   RDYNIQPTIKHYGSMVDILGRAGLVEEAYRLIKSMPIESNSIVWRTLLAACRVHGNLEL
FT                   AEQVRQQLLELEPDHSSDYVLLANMYASAGQWNKVVRVRKSMHIRGVQKPKPGNSYIGF
FT                   QPSMRLEMESTEASCVH"
FT   3'UTR           6130802..6131030
FT                   /locus_tag="VIT_17s0000g06390"
FT                   /old_locus_tag="Vv17s0000g06390"
FT   gene            complement(6131031..6134642)
FT                   /locus_tag="VIT_17s0000g06380"
FT                   /old_locus_tag="Vv17s0000g06380"
FT   mRNA            complement(join(6131031..6131147,6131235..6131306,
FT                   6131423..6131485,6134123..6134470,6134471..6134642))
FT                   /locus_tag="VIT_17s0000g06380"
FT                   /old_locus_tag="Vv17s0000g06380"
FT                   /product="Predicted protein"
FT   CDS_pept        complement(join(6131031..6131147,6131235..6131306,
FT                   6131423..6131485,6134123..6134470))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06380"
FT                   /old_locus_tag="Vv17s0000g06380"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT68"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT68"
FT                   /protein_id="CCB43077.1"
FT                   /translation="MGLFDLERHFAFYGAYHSDPVNVFLHMLFVWPLFFTALVLFYFTP
FT                   SFFILPQIGLLPSGFNHTFLLNFGFLFTLIYSLFYVLLDKKAGCLAALLCFSCWVGSSF
FT                   LASYLGFSLAWKVVLASQLFCWTGQFIGHGVFEKRAPALLDNLAQAFIMAPFFVLLEAL
FT                   QTTIGYEPYPGFSKNVKEKIGADIKEWHDKKQKKIS"
FT   5'UTR           complement(6134471..6134642)
FT                   /locus_tag="VIT_17s0000g06380"
FT                   /old_locus_tag="Vv17s0000g06380"
FT   gap             6137873..6154157
FT                   /estimated_length=16285
FT   gap             6168592..6182384
FT                   /estimated_length=13793
FT   gene            6185290..6187006
FT                   /locus_tag="VIT_17s0000g06370"
FT                   /old_locus_tag="Vv17s0000g06370"
FT   mRNA            join(6185290..6185648,6185649..6185831,6185927..6186109,
FT                   6186220..6186384,6186497..6186751,6186752..6187006)
FT                   /locus_tag="VIT_17s0000g06370"
FT                   /old_locus_tag="Vv17s0000g06370"
FT                   /product="unknown predicted protein"
FT   5'UTR           6185290..6185648
FT                   /locus_tag="VIT_17s0000g06370"
FT                   /old_locus_tag="Vv17s0000g06370"
FT   CDS_pept        join(6185649..6185831,6185927..6186109,6186220..6186384,
FT                   6186497..6186751)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06370"
FT                   /old_locus_tag="Vv17s0000g06370"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SI98"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7SI98"
FT                   /protein_id="CBI15208.3"
FT                   /translation="MEASFRPKSKGVHESCASFGSLKFKESLVLGSRFTGKHVFITDQK
FT                   CLRDWSFKAPYKFSVHAQASICVSRALRWWEKTLKTNMVEIHSAQELVDSLLNAGDRLV
FT                   VVDFYSPRCGGCKALHPKICQLAELNPNAIFLKVDYEELKTMCHALHIHVLPFFRFYRG
FT                   AEGRVCSFSCTNATIKKFKDALAKHGANRCSLGPAKGLDESELLKLAAVGEIPLNLPLP
FT                   SSKGEVMEDSALKGAHMSGFWGKAGSNMELEEESAILKV"
FT   3'UTR           6186752..6187006
FT                   /locus_tag="VIT_17s0000g06370"
FT                   /old_locus_tag="Vv17s0000g06370"
FT   gene            6212213..6213219
FT                   /locus_tag="VIT_17s0000g06360"
FT                   /old_locus_tag="Vv17s0000g06360"
FT   mRNA            join(6212213..6212227,6212228..6212354,6212460..6212772,
FT                   6212904..6213210,6213211..6213219)
FT                   /locus_tag="VIT_17s0000g06360"
FT                   /old_locus_tag="Vv17s0000g06360"
FT                   /product="Expansin 2"
FT   5'UTR           6212213..6212227
FT                   /locus_tag="VIT_17s0000g06360"
FT                   /old_locus_tag="Vv17s0000g06360"
FT   CDS_pept        join(6212228..6212354,6212460..6212772,6212904..6213210)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06360"
FT                   /old_locus_tag="Vv17s0000g06360"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT69"
FT                   /db_xref="InterPro:IPR002963"
FT                   /db_xref="InterPro:IPR007112"
FT                   /db_xref="InterPro:IPR007117"
FT                   /db_xref="InterPro:IPR007118"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR036749"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT69"
FT                   /protein_id="CCB43078.1"
FT                   /translation="MSLLGFLLVGLFSLLSSVQGDAGGWTDAHATFYGGGDASGTMGGA
FT                   CGYGNLYSQGYGTNTAALSTALFNSGLSCGACFEIRCANDPRWCRSGSITVTATNFCPP
FT                   NNALPNNAGGWCNPPQQHFDLSQPVFERIAEYRAGIVPVSYRRVPCIKKGGIRFTMNGH
FT                   SYFNLVLISNVGGAGDVHSVSIKGSKTGWQPMSRNWGQNWQSNSYLNGQSLSFKVTLSD
FT                   GRTAVSNNVVPAGWSFGQTFSGSQFT"
FT   3'UTR           6213211..6213219
FT                   /locus_tag="VIT_17s0000g06360"
FT                   /old_locus_tag="Vv17s0000g06360"
FT   gene            6214490..6215673
FT                   /locus_tag="VIT_17s0000g06350"
FT                   /old_locus_tag="Vv17s0000g06350"
FT   mRNA            join(6214490..6214515,6214516..6214721,6214882..6215297,
FT                   6215390..6215526,6215527..6215673)
FT                   /locus_tag="VIT_17s0000g06350"
FT                   /old_locus_tag="Vv17s0000g06350"
FT                   /product="unknown predicted protein"
FT   5'UTR           6214490..6214515
FT                   /locus_tag="VIT_17s0000g06350"
FT                   /old_locus_tag="Vv17s0000g06350"
FT   CDS_pept        join(6214516..6214721,6214882..6215297,6215390..6215526)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06350"
FT                   /old_locus_tag="Vv17s0000g06350"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5AEI0"
FT                   /db_xref="InterPro:IPR001344"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="InterPro:IPR023329"
FT                   /db_xref="UniProtKB/TrEMBL:A5AEI0"
FT                   /protein_id="CCB43079.1"
FT                   /translation="MATVTTQASAAVFRPCASKSRFLTGSSGKLGREVSVKPMTSSSYR
FT                   SFKVEAKKGEWLPGLSSPSYLDGSLPGDNGFDPLGLAEDPENLKWYVQAELVNSRWAML
FT                   GVAGMLLPEVFTKIGIINAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNP
FT                   GSVNQDPIFKNYSLPPNEVGYPGGIFNPLNFAPTEEAKEKELANGRLAMLAFLGFIVQH
FT                   NVTGKGPFDNLLQHISDPWHNTIIQTLRGF"
FT   3'UTR           6215527..6215673
FT                   /locus_tag="VIT_17s0000g06350"
FT                   /old_locus_tag="Vv17s0000g06350"
FT   gene            complement(6215674..6221192)
FT                   /locus_tag="VIT_17s0000g06340"
FT                   /old_locus_tag="Vv17s0000g06340"
FT   mRNA            complement(join(6215674..6216110,6216111..6216131,
FT                   6217105..6217531,6217771..6217898,6218016..6218063,
FT                   6218424..6218520,6219595..6219656,6219754..6219769,
FT                   6219854..6219918,6220051..6220069,6220171..6220230,
FT                   6220826..6221010,6221011..6221011,6221145..6221192))
FT                   /locus_tag="VIT_17s0000g06340"
FT                   /old_locus_tag="Vv17s0000g06340"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(6215674..6216110)
FT                   /locus_tag="VIT_17s0000g06340"
FT                   /old_locus_tag="Vv17s0000g06340"
FT   CDS_pept        complement(join(6216111..6216131,6217105..6217531,
FT                   6217771..6217898,6218016..6218063,6218424..6218520,
FT                   6219595..6219656,6219754..6219769,6219854..6219918,
FT                   6220051..6220069,6220171..6220230,6220826..6221010))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06340"
FT                   /old_locus_tag="Vv17s0000g06340"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SIA1"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="InterPro:IPR036879"
FT                   /db_xref="UniProtKB/TrEMBL:D7SIA1"
FT                   /protein_id="CBI15211.3"
FT                   /translation="MGRVKLKIKRLESTSNRQVTYSKRRNGILKKARELSILCDIEIIL
FT                   LMFSPTGRPTLFHGARSDIEEVIAKFAQLTPQERAKRKLESLEALKKTFKKLDHDVNLQ
FT                   DFLGASTQTIEELTNQARLLQAQLTEVHKRLSYWSNPDKVDSTEHLRQMEDSLRESLNR
FT                   IRVHKENFGKHQLMSLECASQFQNGMHLPLIMDGVQEAQPLSWLPNNENQHLILPEEPS
FT                   YLPQRDMECSADASIPGYSGYYSTGKQTEIGNSGQVDEQGQEGSALNQLSGNSNLRLQL
FT                   SEQYLYSPFGNLNLPDEKKLKPEMEMNLQGNPVDYQVNGNFEIPAPIYDNRQHTWVSAS
FT                   GPCSIAMFDENSFSQGNVPPIVHSAFPDSQQNSLS"
FT   5'UTR           complement(6221145..6221192)
FT                   /locus_tag="VIT_17s0000g06340"
FT                   /old_locus_tag="Vv17s0000g06340"
FT   gene            complement(6223861..6230766)
FT                   /locus_tag="VIT_17s0000g06330"
FT                   /old_locus_tag="Vv17s0000g06330"
FT   mRNA            complement(join(6223861..6224032,6224033..6224272,
FT                   6225177..6225325,6226210..6226448,6227129..6227307,
FT                   6227308..6227452,6228972..6229130,6229217..6229262,
FT                   6230621..6230766))
FT                   /locus_tag="VIT_17s0000g06330"
FT                   /old_locus_tag="Vv17s0000g06330"
FT                   /product="Predicted protein"
FT   3'UTR           complement(6223861..6224032)
FT                   /locus_tag="VIT_17s0000g06330"
FT                   /old_locus_tag="Vv17s0000g06330"
FT   CDS_pept        complement(join(6224033..6224272,6225177..6225325,
FT                   6226210..6226448,6227129..6227307))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06330"
FT                   /old_locus_tag="Vv17s0000g06330"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SIA2"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:D7SIA2"
FT                   /protein_id="CBI15212.3"
FT                   /translation="MTISQTRNVGLPLMKLVRWKGVPILQQLHLEEQLLRTSSENWCII
FT                   NDGANDPTIVMGISGKPAQLLKLDSVLNDRIPVIRRYTGGGTVVVDCGTVFVTFICNKD
FT                   AVPGLQPYPQPIMSWSSLLYALVFRGFGDFSLRENDYAFGNHKFGGNAQSITKNRWIHH
FT                   TSFLWDYEARNMAYLKLPARAPEYRVARDHLEFICRMKDYMPRSVFVDRTIKAVETHFS
FT                   VRPVELEAMETNLNSKFPHSTKLLTEQELEAAAFESHFEKALSHSL"
FT   5'UTR           complement(6230621..6230766)
FT                   /locus_tag="VIT_17s0000g06330"
FT                   /old_locus_tag="Vv17s0000g06330"
FT   gene            6242213..6247716
FT                   /locus_tag="VIT_17s0000g06320"
FT                   /old_locus_tag="Vv17s0000g06320"
FT   mRNA            join(6242213..6242261,6242262..6242654,6244024..6244062,
FT                   6247326..6247410,6247508..6247590,6247591..6247716)
FT                   /locus_tag="VIT_17s0000g06320"
FT                   /old_locus_tag="Vv17s0000g06320"
FT                   /product="unknown predicted protein"
FT   5'UTR           6242213..6242261
FT                   /locus_tag="VIT_17s0000g06320"
FT                   /old_locus_tag="Vv17s0000g06320"
FT   CDS_pept        join(6242262..6242654,6244024..6244062,6247326..6247410,
FT                   6247508..6247590)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06320"
FT                   /old_locus_tag="Vv17s0000g06320"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT71"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT71"
FT                   /protein_id="CCB43080.1"
FT                   /translation="MRPIKERRRSRSSPARDRPIGPSGFEPRPSGSRSTTRLSPSSTSL
FT                   LDTPFITEDEDATLFDNLKISPNPNFNPRSFPYSVKQQCWEKAEKIKGRDPDRWRRDPL
FT                   GNIVFRKLVGCPGCLCHDYDHIVPYSKGGKSTLENCQVLQATVNRSKGNRTEISKADLI
FT                   QKSSYCRVSGRDMDLLELSAYGNVRRGQDSGGCTIQ"
FT   3'UTR           6247591..6247716
FT                   /locus_tag="VIT_17s0000g06320"
FT                   /old_locus_tag="Vv17s0000g06320"
FT   gene            complement(6253084..6256049)
FT                   /locus_tag="VIT_17s0000g06310"
FT                   /old_locus_tag="Vv17s0000g06310"
FT   mRNA            complement(join(6253084..6253429,6253430..6254701,
FT                   6255809..6255958,6255959..6256049))
FT                   /locus_tag="VIT_17s0000g06310"
FT                   /old_locus_tag="Vv17s0000g06310"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(6253084..6253429)
FT                   /locus_tag="VIT_17s0000g06310"
FT                   /old_locus_tag="Vv17s0000g06310"
FT   CDS_pept        complement(join(6253430..6254701,6255809..6255958))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06310"
FT                   /old_locus_tag="Vv17s0000g06310"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT72"
FT                   /db_xref="InterPro:IPR003851"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT72"
FT                   /protein_id="CCB43081.1"
FT                   /translation="MQEPKDPAFKLFGKTIPMLADGDAPVSSGDVGDSGAAVAREDGLE
FT                   EETEKDALGGKPAETKGEDGSEESRNSETVAESNENPKTPSIAEENVTLKTSKAEKGQS
FT                   DSPDSQEKTLKKPDKILPCPRCNSMDTKFCYYNNYNINQPRHFCKSCQRYWTAGGTMRN
FT                   VPVGAGRRKNKNSASHYRHITISEALQTVRIEATNGVHQPTLKSNGTVLTFGSDAPFCD
FT                   SMTSVLNLEEKKMPNGARNGFHTHEEQGIPVSFRVQENGDDHSSASSITVSNSSEEGSK
FT                   YGLHEAKRNSHGVPSRIPCIPGIPWPYPWNSAVPPPFCPPGFPMPFYPAAYWNCHVTAP
FT                   WNIPWLSPPSSSANQKTPNSRQNSPTLGKHSREGDILKPSIVEDEETPKQRSSERCLWV
FT                   PKTLRIDDPAEAAKSSIWTTLGIKNDKVDSVSGGGLFNAFHLKGDDKNHAIDTSAVLRA
FT                   NPAALSRSLNFQESS"
FT   5'UTR           complement(6255959..6256049)
FT                   /locus_tag="VIT_17s0000g06310"
FT                   /old_locus_tag="Vv17s0000g06310"
FT   gap             6263513..6263612
FT                   /estimated_length=100
FT   gene            6269267..6270495
FT                   /locus_tag="VIT_17s0000g06300"
FT                   /old_locus_tag="Vv17s0000g06300"
FT   mRNA            join(6269267..6269375,6269376..6269454,6269563..6269621,
FT                   6269714..6269827,6269828..6270495)
FT                   /locus_tag="VIT_17s0000g06300"
FT                   /old_locus_tag="Vv17s0000g06300"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           6269267..6269375
FT                   /locus_tag="VIT_17s0000g06300"
FT                   /old_locus_tag="Vv17s0000g06300"
FT   CDS_pept        join(6269376..6269454,6269563..6269621,6269714..6269827)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06300"
FT                   /old_locus_tag="Vv17s0000g06300"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SIA5"
FT                   /protein_id="CBI15215.3"
FT                   /translation="MASNLRLLVILLGFSYLICVNAVPVARTRRMHGYHQGHQVSEVSF
FT                   LNNMEKIWEEQNIRARMDAELNDYPGSGANNRHTPNPH"
FT   3'UTR           6269828..6270495
FT                   /locus_tag="VIT_17s0000g06300"
FT                   /old_locus_tag="Vv17s0000g06300"
FT   gene            complement(6274217..6275958)
FT                   /locus_tag="VIT_17s0000g06290"
FT                   /old_locus_tag="Vv17s0000g06290"
FT   mRNA            complement(join(6274217..6274357,6274358..6274656,
FT                   6274787..6275036,6275127..6275366,6275477..6275607,
FT                   6275721..6275958))
FT                   /locus_tag="VIT_17s0000g06290"
FT                   /old_locus_tag="Vv17s0000g06290"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(6274217..6274357)
FT                   /locus_tag="VIT_17s0000g06290"
FT                   /old_locus_tag="Vv17s0000g06290"
FT   CDS_pept        complement(join(6274358..6274656,6274787..6275036,
FT                   6275127..6275366,6275477..6275607,6275721..6275958))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06290"
FT                   /old_locus_tag="Vv17s0000g06290"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SIA6"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR035669"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D7SIA6"
FT                   /protein_id="CBI15216.3"
FT                   /translation="MKLTVAWTIMVTTLLGVAMDGYDCKVVQFIFGDSLSDVGNNDRLS
FT                   KSLAQASLPWYGIDFGNGLPNGRFCNGRTVADIIGDRTGLPRPPAFLDPSLTEDMILEN
FT                   GVNYASGGGGILNETGSLFIQRFSLYKQIGLFQGTQELIKAKIGKEAAENFFQKSRYVV
FT                   ALGSNDFINNYLLPVYNDGWKYSDEGFINYLMETLKAQLTILHGLGARELMVFGLGPMG
FT                   CIPLQRVLSTSGECQDKTNKLALSFNQAGSKMLKELSGNLPNASFKFGDAYDVVDAVIT
FT                   NPQKYGFNNSDSPCCSFGKIRPALTCVPASILCEDRSKYVFWDEYHPSDSANELIATEL
FT                   IRKFGFLPVNETNAPSPGPTVDAPSPGLAVDAPSPGLAVAPSPEG"
FT   gene            complement(6279219..6280978)
FT                   /locus_tag="VIT_17s0000g06280"
FT                   /old_locus_tag="Vv17s0000g06280"
FT   mRNA            complement(join(6279219..6279315,6279316..6279751,
FT                   6279996..6280963,6280964..6280978))
FT                   /locus_tag="VIT_17s0000g06280"
FT                   /old_locus_tag="Vv17s0000g06280"
FT                   /product="Geranylgeranyl reductase"
FT   3'UTR           complement(6279219..6279315)
FT                   /locus_tag="VIT_17s0000g06280"
FT                   /old_locus_tag="Vv17s0000g06280"
FT   CDS_pept        complement(join(6279316..6279751,6279996..6280963))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06280"
FT                   /old_locus_tag="Vv17s0000g06280"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT73"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010253"
FT                   /db_xref="InterPro:IPR011774"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT73"
FT                   /protein_id="CCB43082.1"
FT                   /translation="MASISLKTFVGLRQSSSDTYNSGHVFPVKHLPAQPASRGLRIVAG
FT                   KFSPKVTGRNLRVAVVGGGPAGGSAAETLAKGGIETFLIERKLDNCKPCGGAIPLCMVG
FT                   EFDLPLDIIDRRVTKMKMISPSNVAVDIGQTLKPHEYIGMVRREVLDSYLRERASASGA
FT                   TVINGLFLKMDAPKGATAPYVLHYTGYDSKTGGVGERRTLEVDAVIGADGANSRVAKFI
FT                   GAGDYDYAIAFQERIKIPDDKMVYYENLAEMYVGDDVSPDFYGWVFPKCDHVAVGTGTV
FT                   THKSDIKKFQLATRLRAKEKILGGKIIRVEAHPIPEHPRPRRLAGRVALVGDAAGYVTK
FT                   CSGEGIYFAAKSGRMCAEAIVEGSENGKRMVDEGDLRKYLEKWDKTYWPTYKVLDVLQK
FT                   VFYRSNPAREAFVEMCADEYVQKMTFDSYLYKKVVPGNPLEDLKLAVNTIGSLVRANAL
FT                   RREMDKMSV"
FT   5'UTR           complement(6280964..6280978)
FT                   /locus_tag="VIT_17s0000g06280"
FT                   /old_locus_tag="Vv17s0000g06280"
FT   gene            6295551..6298280
FT                   /locus_tag="VIT_17s0000g06270"
FT                   /old_locus_tag="Vv17s0000g06270"
FT   mRNA            join(6295551..6295670,6296831..6296846,6296847..6298088,
FT                   6298089..6298280)
FT                   /locus_tag="VIT_17s0000g06270"
FT                   /old_locus_tag="Vv17s0000g06270"
FT                   /product="Predicted protein"
FT   5'UTR           6295551..6295670
FT                   /locus_tag="VIT_17s0000g06270"
FT                   /old_locus_tag="Vv17s0000g06270"
FT   CDS_pept        6296847..6298088
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06270"
FT                   /old_locus_tag="Vv17s0000g06270"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT74"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT74"
FT                   /protein_id="CCB43083.1"
FT                   /translation="MAATSLTTITIGSSASIGSKAIPLSRSKCFGVSFNSQNYLKSFSG
FT                   LKAASSISCESEASFLGKESSAALRNSFAPKAGKQNLRHQYYLQPQASSSKVAILGAAG
FT                   GIGQPLALLIKMSPLVSALHLYDIANVKGVAADLSHCNTPAQVLDFTGTSELANSLKGV
FT                   DVVVIPAGVPRKPGMTRDDLFNINANIVKTLVEAVADNCPDAFIHIISNPVNSTVPIAV
FT                   EVLRRKGVYDPKKVFGVTTLDVVRANTFVAQKKNLRLIDVDVPVVGGHAGITILPLLSR
FT                   TKPSVSFTDEEVEELTVRIQNAGTEVVEAKAGAGSATLSMAYAAARFVESSLRALDGDT
FT                   DVYECAYVQSELTELPFFASRVKIGKKGIEAVISSDLQGLTEYEEKALEALKPELKASI
FT                   EKGVAFAQKQTVTA"
FT   3'UTR           6298089..6298280
FT                   /locus_tag="VIT_17s0000g06270"
FT                   /old_locus_tag="Vv17s0000g06270"
FT   gene            complement(6299245..6300189)
FT                   /locus_tag="VIT_17s0000g06260"
FT                   /old_locus_tag="Vv17s0000g06260"
FT   mRNA            complement(join(6299245..6299250,6299251..6300189))
FT                   /locus_tag="VIT_17s0000g06260"
FT                   /old_locus_tag="Vv17s0000g06260"
FT                   /product="Predicted protein"
FT   3'UTR           complement(6299245..6299250)
FT                   /locus_tag="VIT_17s0000g06260"
FT                   /old_locus_tag="Vv17s0000g06260"
FT   CDS_pept        complement(6299251..6300189)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06260"
FT                   /old_locus_tag="Vv17s0000g06260"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT75"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR032867"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT75"
FT                   /protein_id="CCB43084.1"
FT                   /translation="MDERNVVSWSAMISGFAMHGYGREAIEAFEQMQQLGVSPDDQTLT
FT                   GVLSACSHCGLVDDGLMFFDRMSKVFGIEPNIHHYGCMVDLLGRAGLLDQAYQLIMSMV
FT                   IKPDSTLWRTLLGACRIHRHATLGERVIGHLIELKAQEAGDYVLLLNIYSSVGNWDKVT
FT                   DLRKFMKEKGIQTSPGCSTIELKGKVHEFVVDDILHPRTDEIYEMLDEIGKQLKIAGYV
FT                   AELSSELHNLGAEEKGNRLSYHSEKLAIAFGVLATPPGTTIRVAKNLRICVDCHNFAKV
FT                   LSGAYNREVVIRDRTRFHHFREGQCSCNGYW"
FT   gene            complement(6301817..6302757)
FT                   /locus_tag="VIT_17s0000g06250"
FT                   /old_locus_tag="Vv17s0000g06250"
FT   mRNA            complement(join(6301817..6302137,6302248..6302600,
FT                   6302688..6302757))
FT                   /locus_tag="VIT_17s0000g06250"
FT                   /old_locus_tag="Vv17s0000g06250"
FT                   /product="unknown predicted protein"
FT   CDS_pept        complement(join(6301817..6302137,6302248..6302600,
FT                   6302688..6302757))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06250"
FT                   /old_locus_tag="Vv17s0000g06250"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR003035"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT76"
FT                   /protein_id="CCB43085.1"
FT                   /translation="MESFPTDPLYSPLDIIPSPAVIQEDFGCGYGNELGGWNEVNPAFD
FT                   HEKQPFLLCDKNGRQTEEESTKENKETRKGRDEKSNSSKMLSRNTISQYFYMPITQAAR
FT                   ELKVGLTLLKKRCRELGIRRWPHRKLMSLQTLIKNVQELGKDEGDGSDQGKLREAIQIL
FT                   EQERKLMEEMPDLQLEDKTKRLRQAYFKANYKKRKLMGTMDSSQSSSNSNPQTVEVAMN
FT                   YTTMDEEDEMKSLLSDSFSSTNMML"
FT   gene            complement(6304258..6306375)
FT                   /locus_tag="VIT_17s0000g06240"
FT                   /old_locus_tag="Vv17s0000g06240"
FT   mRNA            complement(join(6304258..6304411,6304412..6304738,
FT                   6305947..6306327,6306328..6306375))
FT                   /locus_tag="VIT_17s0000g06240"
FT                   /old_locus_tag="Vv17s0000g06240"
FT                   /product="Predicted protein"
FT   3'UTR           complement(6304258..6304411)
FT                   /locus_tag="VIT_17s0000g06240"
FT                   /old_locus_tag="Vv17s0000g06240"
FT   CDS_pept        complement(join(6304412..6304738,6305947..6306327))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06240"
FT                   /old_locus_tag="Vv17s0000g06240"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT77"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT77"
FT                   /protein_id="CCB43086.1"
FT                   /translation="MAETVVSETPETVTERETANTQDMDVEAPEPSQPNGSDSADNVTN
FT                   GDSNSKRGREEAGEGEDANDAVTKKQKVEKSVEEERLEKLEAEVVETGRFSLGPKTFGS
FT                   SVEMFDHFFKFLHYWPANLDVNKYEHMMLLDLLKKGHTEPDKKIGGGIHAFQVRYHPVF
FT                   KSRCFFVIRDDESVDDFSFRKCVDHISPLPENMKAKSEVNKALGGGRGGKGGGGGGRGG
FT                   GRGRGGRGGRGRN"
FT   5'UTR           complement(6306328..6306375)
FT                   /locus_tag="VIT_17s0000g06240"
FT                   /old_locus_tag="Vv17s0000g06240"
FT   gene            6308491..6315953
FT                   /locus_tag="VIT_17s0000g06230"
FT                   /old_locus_tag="Vv17s0000g06230"
FT   mRNA            join(6308491..6308583,6309180..6309181,6309182..6309466,
FT                   6311201..6311272,6312857..6312921,6313799..6313955,
FT                   6314748..6314828,6314954..6315043,6315496..6315621,
FT                   6315622..6315953)
FT                   /locus_tag="VIT_17s0000g06230"
FT                   /old_locus_tag="Vv17s0000g06230"
FT                   /product="unknown predicted protein"
FT   5'UTR           6308491..6308583
FT                   /locus_tag="VIT_17s0000g06230"
FT                   /old_locus_tag="Vv17s0000g06230"
FT   CDS_pept        join(6309182..6309466,6311201..6311272,6312857..6312921,
FT                   6313799..6313955,6314748..6314828,6314954..6315043,
FT                   6315496..6315621)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06230"
FT                   /old_locus_tag="Vv17s0000g06230"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SIB2"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR022143"
FT                   /db_xref="InterPro:IPR033275"
FT                   /db_xref="UniProtKB/TrEMBL:D7SIB2"
FT                   /protein_id="CBI15222.3"
FT                   /translation="MGDHLVLCVDRLIKPQTLQSLQGTEVSGSSEGGDEGSCSHTVDPS
FT                   TSALEDKGLEEHHGPEEEEPLIQTVECRICQEEDSIKNLEVPCACSGSLKFAHRKCVQR
FT                   WCNEKGDVTCEICHQPYQPGYTAPPPPQSEDATIDISEGWTISGTPLDLNDPRLLAMAA
FT                   AERHFLEAEYEEYADTNASGAAFCRSAALILMALLLLRHALNITNADGDDDASNFFSLF
FT                   LLRAAGFLLPCYIMAWAISILQRRRQRQEAAAALAATEVAFMLQAGQHRGLQFTIAPGP
FT                   AVTPHQEPLQ"
FT   3'UTR           6315622..6315953
FT                   /locus_tag="VIT_17s0000g06230"
FT                   /old_locus_tag="Vv17s0000g06230"
FT   gene            complement(6319446..6323178)
FT                   /locus_tag="VIT_17s0000g06220"
FT                   /old_locus_tag="Vv17s0000g06220"
FT   mRNA            complement(join(6319446..6319635,6319636..6320157,
FT                   6321290..6322264,6322265..6322806,6323021..6323178))
FT                   /locus_tag="VIT_17s0000g06220"
FT                   /old_locus_tag="Vv17s0000g06220"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(6319446..6319635)
FT                   /locus_tag="VIT_17s0000g06220"
FT                   /old_locus_tag="Vv17s0000g06220"
FT   CDS_pept        complement(join(6319636..6320157,6321290..6322264))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06220"
FT                   /old_locus_tag="Vv17s0000g06220"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT78"
FT                   /db_xref="InterPro:IPR004263"
FT                   /db_xref="InterPro:IPR040911"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT78"
FT                   /protein_id="CCB43087.1"
FT                   /translation="MSEKSMLPSRFLFCLITISMFLLILSSLFLLQFSNTSFIPNSVFK
FT                   LILVNSTSVYFKSSGKNEQTKLPFVTSVASPVDSKRPMGREGSCQISNASKKMDALGQG
FT                   RRKGCDPNQAHLRAFMYDLPPEFHFGLLGWTGKANQIWPNVSNPGRIPSYPGGLNLQHS
FT                   IEYWLTLDLLSSDTPNIVRPCSAIRVKNSSQADIIFVPFFSSLSYNRHSRLHGKEKVSV
FT                   NKMLQDKLVNFLMGQDEWKQLGGKNHLIVAHHPNSMLDARKKLGSAMFVLADFGRYPVE
FT                   IANIDKDVIAPYKHVLRSNPVADSATFEGRPLLVYFQGAIYRKDGGAIRQELYYLLRDE
FT                   KDVHFTFGSVRGNGINGASEGMASSKFCLNIAGDTPSSNRLFDAIVSHCVPVIISDEIE
FT                   LPFEDVLDYSEFCIFVRASDAVKNGFLLNLLRGIKREKWTKMWERLKEIAHHFEYQYPS
FT                   QAGDAVDMIWGAVSRKISSIQNKLHRKNRYRRSQILLKRN"
FT   5'UTR           complement(6323021..6323178)
FT                   /locus_tag="VIT_17s0000g06220"
FT                   /old_locus_tag="Vv17s0000g06220"
FT   gene            complement(6331340..6332532)
FT                   /locus_tag="VIT_17s0000g06210"
FT                   /old_locus_tag="Vv17s0000g06210"
FT   mRNA            complement(join(6331340..6331591,6331592..6331773,
FT                   6332158..6332191,6332279..6332314,6332417..6332479,
FT                   6332480..6332532))
FT                   /locus_tag="VIT_17s0000g06210"
FT                   /old_locus_tag="Vv17s0000g06210"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(6331340..6331591)
FT                   /locus_tag="VIT_17s0000g06210"
FT                   /old_locus_tag="Vv17s0000g06210"
FT   CDS_pept        complement(join(6331592..6331773,6332158..6332191,
FT                   6332279..6332314,6332417..6332479))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06210"
FT                   /old_locus_tag="Vv17s0000g06210"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR003854"
FT                   /db_xref="UniProtKB/TrEMBL:D7SIB4"
FT                   /protein_id="CBI15224.3"
FT                   /translation="MAKLVPLLLLALFSISMVATKVMAKEAQYHLDSGSYGPGSLKSNQ
FT                   CPSQCTRRCSKTQYHKPCMFFCQKCCAKCLCVPPGYYGNKAVCPCYNNWKTKEGGPKCP
FT                   "
FT   5'UTR           complement(6332480..6332532)
FT                   /locus_tag="VIT_17s0000g06210"
FT                   /old_locus_tag="Vv17s0000g06210"
FT   gene            complement(6336882..6337304)
FT                   /locus_tag="VIT_17s0000g06200"
FT                   /old_locus_tag="Vv17s0000g06200"
FT   mRNA            complement(join(6336882..6337011,6337012..6337161,
FT                   6337162..6337304))
FT                   /locus_tag="VIT_17s0000g06200"
FT                   /old_locus_tag="Vv17s0000g06200"
FT                   /product="At1g74660"
FT   3'UTR           complement(6336882..6337011)
FT                   /locus_tag="VIT_17s0000g06200"
FT                   /old_locus_tag="Vv17s0000g06200"
FT   CDS_pept        complement(6337012..6337161)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06200"
FT                   /old_locus_tag="Vv17s0000g06200"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR006456"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT79"
FT                   /protein_id="CCB43088.1"
FT                   /translation="MGGHAVDGCREFMASGVEGTSAAFTCAACGCHRNFHRKEVDSEVV
FT                   CDSS"
FT   5'UTR           complement(6337162..6337304)
FT                   /locus_tag="VIT_17s0000g06200"
FT                   /old_locus_tag="Vv17s0000g06200"
FT   gene            complement(6345985..6347909)
FT                   /locus_tag="VIT_17s0000g06190"
FT                   /old_locus_tag="Vv17s0000g06190"
FT   mRNA            complement(join(6345985..6346294,6346295..6346955,
FT                   6347195..6347324,6347672..6347804,6347805..6347909))
FT                   /locus_tag="VIT_17s0000g06190"
FT                   /old_locus_tag="Vv17s0000g06190"
FT                   /product="MYB domain class transcription factor"
FT   3'UTR           complement(6345985..6346294)
FT                   /locus_tag="VIT_17s0000g06190"
FT                   /old_locus_tag="Vv17s0000g06190"
FT   CDS_pept        complement(join(6346295..6346955,6347195..6347324,
FT                   6347672..6347804))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06190"
FT                   /old_locus_tag="Vv17s0000g06190"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT80"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT80"
FT                   /protein_id="CCB43089.1"
FT                   /translation="MGRPPCCDKIGVKKGPWTPEEDIILVSYIQEHGPGNWRAVPTSTG
FT                   LLRCSKSCRLRWTNYLRPGIKRGNFTDQEEKTIIHLQALLGNRWAAIASYLPQRTDNDI
FT                   KNYWNTHLKKKLKKFPTGVDDHNQDGFSISKGQWERRLQTDIHMAKQALCEALSIDTSS
FT                   SLPDLKSSNGYNPNTRPVQASTYASSAENIAKLLEGWMRNSPKSTRTNSEATQNSKNSS
FT                   EGATTPDALDSLFSFNSSNSDLSLSNDETANFTPETILFQDESKPNLETQVPLTMIEKW
FT                   LFDEGAATQEQEDLIDMSLEDTAQLF"
FT   5'UTR           complement(6347805..6347909)
FT                   /locus_tag="VIT_17s0000g06190"
FT                   /old_locus_tag="Vv17s0000g06190"
FT   gene            complement(6355198..6359559)
FT                   /locus_tag="VIT_17s0000g06180"
FT                   /old_locus_tag="Vv17s0000g06180"
FT   mRNA            complement(join(6355198..6355356,6355357..6355825,
FT                   6356262..6356421,6357825..6358140,6359202..6359381,
FT                   6359382..6359559))
FT                   /locus_tag="VIT_17s0000g06180"
FT                   /old_locus_tag="Vv17s0000g06180"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(6355198..6355356)
FT                   /locus_tag="VIT_17s0000g06180"
FT                   /old_locus_tag="Vv17s0000g06180"
FT   CDS_pept        complement(join(6355357..6355825,6356262..6356421,
FT                   6357825..6358140,6359202..6359381))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06180"
FT                   /old_locus_tag="Vv17s0000g06180"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT81"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT81"
FT                   /protein_id="CCB43090.1"
FT                   /translation="MASSAILHFSPSSSLLLSRKICRPSVFTAAQFPRSLTIKASTSLD
FT                   YSNVSVIDKSAAPSKTNNWKWKFEDNSINIYYEEYEKESSDPPKDILMIPTISDVSTVE
FT                   EWRLVARDIVQRVGKVNWRATIIDWPGLGYSDRPKIDYNADVLEKFLVDFMSAPDCPIS
FT                   QTKNDLVVFGGGHAATITIRAAKKGLVKPAAIAAVAPTWAGPLPIVFGRDSDMETRYGL
FT                   LRGTLRAPAVGWMMYNMLVSNEKAIQSQYKSHVYADPNNVTPSIVESRYALTKRKGARY
FT                   VPAAFLTGLLDPVNSREEFLELFAALEGQIPVLVVSTKGSPKRSKAEMEALRGAKGVSK
FT                   FVELPGALLPQEEYPAVVAEELYRFLQENFECKA"
FT   5'UTR           complement(6359382..6359559)
FT                   /locus_tag="VIT_17s0000g06180"
FT                   /old_locus_tag="Vv17s0000g06180"
FT   gene            complement(6362862..6364800)
FT                   /locus_tag="VIT_17s0000g06170"
FT                   /old_locus_tag="Vv17s0000g06170"
FT   mRNA            complement(join(6362862..6362868,6362869..6364800))
FT                   /locus_tag="VIT_17s0000g06170"
FT                   /old_locus_tag="Vv17s0000g06170"
FT                   /product="Predicted protein"
FT   3'UTR           complement(6362862..6362868)
FT                   /locus_tag="VIT_17s0000g06170"
FT                   /old_locus_tag="Vv17s0000g06170"
FT   CDS_pept        complement(6362869..6364800)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06170"
FT                   /old_locus_tag="Vv17s0000g06170"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT82"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR032867"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT82"
FT                   /protein_id="CCB43091.1"
FT                   /translation="MNHTQHLCSSLLTNCRSLKNLKQVHAYVCKTGLDTDPIIAGKLLL
FT                   HSAVSVPDALDYARRLFLHFPNPDVFMHNTLIRGLAESDTPQNSLITFVEMRRRLTAPL
FT                   DSFSFAFLLKAAASYRSLESGIQLHCQAIVHGLDTHLFVGTTLVSMYSECGFVAFAKKV
FT                   FEEMFEPNVVAWNAVVTACFRCGDVKGADMMFNRMPFRNLTSWNVMLAGYTKAGELELA
FT                   RKLFLEMPVKDDVSWSTMIVGFAHNGFFYEAFGFFRELQQVGMRPNEVSLTGALSACAD
FT                   AGAIEFGKILHGFIEKSGFLWMVSVNNALLDTYSKCGNVGMARLVFERMPEKRSIVSWT
FT                   SMIAGLAMHGYGEEAIQLFHEMEESGIRPDGIAFISILYACSHAGLIEKGYEYFYKMKD
FT                   IYNIEPAIEHYGCMVDLYGRAGQLDKAYEFIIHMPVLPTAIIWRTLLGACSIHGNVKLA
FT                   ERVKERLSELDPNNSGDHVLLSNIYAVAGKWKDVAAVRRSMTDQRMNKTPGWSMIEVDK
FT                   IMYSFVAGEVQNSITEEAYEKLKEIMLKLRVEGCYIPEVGSVLHDIEDEEKEDSVSRHS
FT                   EKLAVAFGIARLCKGSIIRIVKNLRVCRDCHTVMKLISKVYGLEIVVRDRSRFHSFKTG
FT                   SCSCRDYW"
FT   gap             6372932..6373031
FT                   /estimated_length=100
FT   gap             6374634..6375144
FT                   /estimated_length=511
FT   gap             6389498..6389597
FT                   /estimated_length=100
FT   gap             6396702..6396801
FT                   /estimated_length=100
FT   gene            complement(6399281..6400132)
FT                   /locus_tag="VIT_17s0000g06150"
FT                   /old_locus_tag="Vv17s0000g06150"
FT   mRNA            complement(join(6399281..6399655,6399814..6399948,
FT                   6399949..6400132))
FT                   /locus_tag="VIT_17s0000g06150"
FT                   /old_locus_tag="Vv17s0000g06150"
FT                   /product="unknown predicted protein"
FT   CDS_pept        complement(join(6399281..6399655,6399814..6399948))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06150"
FT                   /old_locus_tag="Vv17s0000g06150"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SIB9"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:D7SIB9"
FT                   /protein_id="CBI15229.3"
FT                   /translation="MENPSLSLSSFLNISMKPGRMLPGCCLMIYERAKVRFWASFLNQQ
FT                   LFEDMGRVITSDGEAQEKATKDLFEKLTILEEGMKDFFPGGTPSINGENMGLLDILMYA
FT                   LFGPYKAHEEVLGMKMIDPERNSLLFSWVMALTELPVVKESTPPHEKLVALVQFIRQNA
FT                   LQSCVA"
FT   5'UTR           complement(6399949..6400132)
FT                   /locus_tag="VIT_17s0000g06150"
FT                   /old_locus_tag="Vv17s0000g06150"
FT   gene            complement(6408234..6409087)
FT                   /locus_tag="VIT_17s0000g06140"
FT                   /old_locus_tag="Vv17s0000g06140"
FT   mRNA            complement(join(6408234..6408608,6408767..6409087))
FT                   /locus_tag="VIT_17s0000g06140"
FT                   /old_locus_tag="Vv17s0000g06140"
FT                   /product="unknown predicted protein"
FT   CDS_pept        complement(join(6408234..6408608,6408767..6409087))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06140"
FT                   /old_locus_tag="Vv17s0000g06140"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT83"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT83"
FT                   /protein_id="CCB43092.1"
FT                   /translation="MEEENQIKLHGMWGSTFTKRVELALKIKGIPYEYIEEDLSNKSQL
FT                   VLKYNPVHKKVPVLVHNGKPIIESLIILEYIDETWKNAPRLLPDDPYERAKVRFWASFF
FT                   HQQLFEDMGRVITSDGEAQEKATKDLFEKLTVLEEGMKDFFPGGTPSINGENMGLLDIL
FT                   MCALFGPYKAHEEVLGMKMIDPERNPLLFSWVMAITEIPVVQESTPPHEKLVGLVQFIR
FT                   QHALQSCVA"
FT   gene            complement(6414480..6415458)
FT                   /locus_tag="VIT_17s0000g06130"
FT                   /old_locus_tag="Vv17s0000g06130"
FT   mRNA            complement(join(6414480..6414842,6415040..6415360,
FT                   6415361..6415458))
FT                   /locus_tag="VIT_17s0000g06130"
FT                   /old_locus_tag="Vv17s0000g06130"
FT                   /product="unknown predicted protein"
FT   CDS_pept        complement(join(6414480..6414842,6415040..6415360))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06130"
FT                   /old_locus_tag="Vv17s0000g06130"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT84"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT84"
FT                   /protein_id="CCB43093.1"
FT                   /translation="MGEENKVTLYGMWASPFVKRVEIALKIKGIPYEYVEEDLRNKSQL
FT                   LLQYNPVHKKVPVLVHNGKPITESLVILEYIEETWKNGPKLLPEDPYERAKVRFWASFI
FT                   QQQFVDSMVSAAKSSGEAHEKAMKEAFEKMTVFEEGMKDFFPSGTPHFEDENIGFLDIV
FT                   LCSLFGPHKAQEEALGLKIIDPERHPLVYSWVTALNEVPAVKESLPPHDKMVALIQFLR
FT                   RNAPH"
FT   5'UTR           complement(6415361..6415458)
FT                   /locus_tag="VIT_17s0000g06130"
FT                   /old_locus_tag="Vv17s0000g06130"
FT   gene            complement(6419664..6420002)
FT                   /locus_tag="VIT_17s0000g06120"
FT                   /old_locus_tag="Vv17s0000g06120"
FT   mRNA            complement(join(6419664..6419996,6419997..6420002))
FT                   /locus_tag="VIT_17s0000g06120"
FT                   /old_locus_tag="Vv17s0000g06120"
FT                   /product="Glutathione S-transferase GST 12"
FT   CDS_pept        complement(6419664..6419996)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06120"
FT                   /old_locus_tag="Vv17s0000g06120"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT85"
FT                   /protein_id="CCB43094.1"
FT                   /translation="MAEENQVKLHGIWASPYVKRVEMALKLEGIPYEYVEEDLRNKSQL
FT                   LLQYNPVHKKVPVLIHNGKPIAESLIILEYIDKTWKNGPPLLPQDHYKRAKVRFWASFV
FT                   QQEVRK"
FT   5'UTR           complement(6419997..6420002)
FT                   /locus_tag="VIT_17s0000g06120"
FT                   /old_locus_tag="Vv17s0000g06120"
FT   gene            complement(6423119..6424031)
FT                   /locus_tag="VIT_17s0000g06110"
FT                   /old_locus_tag="Vv17s0000g06110"
FT   mRNA            complement(join(6423119..6423496,6423688..6424020,
FT                   6424021..6424031))
FT                   /locus_tag="VIT_17s0000g06110"
FT                   /old_locus_tag="Vv17s0000g06110"
FT                   /product="unknown predicted protein"
FT   CDS_pept        complement(join(6423119..6423496,6423688..6424020))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06110"
FT                   /old_locus_tag="Vv17s0000g06110"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT86"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT86"
FT                   /protein_id="CCB43095.1"
FT                   /translation="MGEENKVTLYGMWASPFVRRVEITLKIKGIPYEYVEEDLRNKSQL
FT                   LLQYNPVHKKVPVLVHNGKPIAESLVILEYIEETWKNGPKILPEDPYERAKVRFWASFI
FT                   QQQARQSLFDSLVSAAKSSGEAHEKAMKEVFEKLTVFEEGMKDFFPSGTPHFEDENIGF
FT                   LDIVLCSLFGHHKAQEEALGLKIIDPERHPLVYSWVTALNEVPAVKESLPPHDKMVALI
FT                   QFLRRNAPHRSSEA"
FT   5'UTR           complement(6424021..6424031)
FT                   /locus_tag="VIT_17s0000g06110"
FT                   /old_locus_tag="Vv17s0000g06110"
FT   gene            6430888..6433158
FT                   /locus_tag="VIT_17s0000g06100"
FT                   /old_locus_tag="Vv17s0000g06100"
FT   mRNA            6430888..6433158
FT                   /locus_tag="VIT_17s0000g06100"
FT                   /old_locus_tag="Vv17s0000g06100"
FT                   /product="unknown predicted protein"
FT   CDS_pept        6430888..6433158
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06100"
FT                   /old_locus_tag="Vv17s0000g06100"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT87"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT87"
FT                   /protein_id="CCB43096.1"
FT                   /translation="MRFSGFDPNQFTYGSVLSACTALGSPLYGELVYSLALKNGFFSNG
FT                   YVRAGMIDLFAKLCSFEDALRVFQDVLCENVVCWNAIISGAVKNRENWVALDLFCQMCC
FT                   RFFMPNSFTFSSILTACAALEELEFGRGVQGWVIKCGAGEDVFVGTAIIDLYAKCRDMD
FT                   QAVKEFLRMPIRNVVSWTTIISGFVQKDDSISAFHFFKEMRKVGEKINNYTITSVLTAC
FT                   TEPVMIKEAVQLHSWIFKTGFYLDSNVSSALINMYSKIGVVDLSERVFREMESTKNLAM
FT                   WAVMISAFAQSGSTGRAVELFQRMLQEGLRPDKFCSSSVLSIIDSLSLGRLIHCYILKI
FT                   GLFTDISVGSSLFTMYSKCGSLEESYTVFEQMPDKDNVSWASMITGFSEHDHAEQAVQL
FT                   FREMLLEEIRPDQMTLTAALTACSALHSLEKGKEVHGYALRARVGKEVLVGGALVNMYS
FT                   KCGAIVLARRVFDMLPQKDQFSCSSLVSGYAQNGYIEDALLLFHEIRMADLWIDSFTVS
FT                   SVIGAVAILNSLDIGTQLHACVTKMGLNAEVSVGSSLVTMYSKCGSIDECHKVFEQIEK
FT                   PDLISWTAMIVSYAQHGKGAEALKVYDLMRKEGTKPDSVTFVGVLSACSHNGMVEEGYS
FT                   HLNSMAKEYGIEPGYYHYACMVDLLGRSGRLKEAERFINNMPIEPDALLWGILLAACKV
FT                   HGDIELGRLAAKRVIELEPCEAGAYVTLSNICADMGWWEDVMKIRSLMEGTGVKKEPGW
FT                   SSV"
FT   gene            complement(6438518..6440812)
FT                   /locus_tag="VIT_17s0000g06090"
FT                   /old_locus_tag="Vv17s0000g06090"
FT   mRNA            complement(6438518..6440812)
FT                   /locus_tag="VIT_17s0000g06090"
FT                   /old_locus_tag="Vv17s0000g06090"
FT                   /product="Predicted protein"
FT   CDS_pept        complement(6438518..6440812)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06090"
FT                   /old_locus_tag="Vv17s0000g06090"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D7SIC2"
FT                   /protein_id="CBI15232.3"
FT                   /translation="MSPALLPKHVAAVVKYQKNPLKALEIFNSVKKEDGFKHTLLTYKG
FT                   MIEKLGFHGEFEAMEEVLAETRMNIDNGLLEGVYIGAMRNYGRKGKIQEAVDVFERMDF
FT                   FNCEPSVQSYNAIMNILVEYRYFDQAHKVYMRMRDKGIVPDVYTFTIRMKSFCRTSRPH
FT                   AARRLLNNMPSQGCESSAVAYCTVIGGFYEENHRVEAHELFEEMLGLGICPDIMAFNKL
FT                   IHTLCRKGHVQESERLLNKVLKRGVSPNLFTVNIFIQGFCQRAMLNEAIRLLDGVGRGL
FT                   TPDVITYNTLICGLCKNFKVVEAEHYLRKMVNEGYEPDGFTYNSIIDGYCKLGMMQNAD
FT                   QILRDGAFKGFVPDESTYCSLINGLCQDGDIDRAINVFNEAMEKGLKPNLVLCNTLVKG
FT                   LSQQGLILQALKLMNEMSENGCSPDIWTYNLVINGLCKIGCVSDADNLVIDAIAKGHLP
FT                   DVFTFNTLIDGYCKKLKLDNAIEIVDRMWNHGVSPDVITYNSILNGLCKAGKYEDVMGT
FT                   FKLMMEKGCVPNIITYNILTESFCKARKVEEALNLIEEMQNKGLTPDVVNFGTLMKGFC
FT                   DNGDLDGAYQLFKRVDEQYKFSHTIATYNIMINAFAGKLNMNMAEKLFNKMCENGFSPD
FT                   SYTYRVMIDGFCKTGNINSGYSFLLVKIEKGLIPSLTTFGRVLNCLCLKRRVHEAVGII
FT                   HLMVHKGIVPEVVNTIFEADKKEVAAPKIVVENLMKKGHITYFAYEILHDGIRDKKLSR
FT                   KKLPTSQKVFS"
FT   gene            6442673..6443643
FT                   /locus_tag="VIT_17s0000g06080"
FT                   /old_locus_tag="Vv17s0000g06080"
FT   mRNA            join(6442673..6442966,6442967..6443643)
FT                   /locus_tag="VIT_17s0000g06080"
FT                   /old_locus_tag="Vv17s0000g06080"
FT   CDS_pept        6442673..6442966
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06080"
FT                   /old_locus_tag="Vv17s0000g06080"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SIC3"
FT                   /db_xref="UniProtKB/TrEMBL:D7SIC3"
FT                   /protein_id="CBI15233.3"
FT                   /translation="MVWVHSNRVSVLRFSTDHSLRIYIWNEAQYICHWIFLVCFLIFTL
FT                   FYPLFSLFPCTFYFYFKTFLWHDGNLHSHRPSYPSSAAHTSHAHVSTVKPIP"
FT   3'UTR           6442967..6443643
FT                   /locus_tag="VIT_17s0000g06080"
FT                   /old_locus_tag="Vv17s0000g06080"
FT   gene            6461613..6462023
FT                   /locus_tag="VIT_17s0000g06070"
FT                   /old_locus_tag="Vv17s0000g06070"
FT   mRNA            6461613..6462023
FT                   /locus_tag="VIT_17s0000g06070"
FT                   /old_locus_tag="Vv17s0000g06070"
FT   CDS_pept        6461613..6462023
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06070"
FT                   /old_locus_tag="Vv17s0000g06070"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SIC4"
FT                   /protein_id="CBI15234.3"
FT                   /translation="MGTVHACHPPSLHHHLLSLYPCPHHHSDLSAREPSSVAREWATAK
FT                   QLFIPHEPRRSRLWGSAPLPRFRAPPSMPATAARAPSSSTASAAWSTAPSAKTPIFWCR
FT                   GLEIHVSSPSQRRPRSRHPFPLLYVAVGGGLV"
FT   gap             6462322..6462496
FT                   /estimated_length=175
FT   gene            6463498..6467348
FT                   /locus_tag="VIT_17s0000g06060"
FT                   /old_locus_tag="Vv17s0000g06060"
FT   mRNA            join(6463498..6463514,6463515..6463664,6465616..6466263,
FT                   6466382..6466480,6466837..6467196,6467197..6467348)
FT                   /locus_tag="VIT_17s0000g06060"
FT                   /old_locus_tag="Vv17s0000g06060"
FT                   /product="unknown predicted protein"
FT   5'UTR           6463498..6463514
FT                   /locus_tag="VIT_17s0000g06060"
FT                   /old_locus_tag="Vv17s0000g06060"
FT   CDS_pept        join(6463515..6463664,6465616..6466263,6466382..6466480,
FT                   6466837..6467196)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06060"
FT                   /old_locus_tag="Vv17s0000g06060"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SIC5"
FT                   /db_xref="InterPro:IPR009349"
FT                   /db_xref="InterPro:IPR039128"
FT                   /db_xref="UniProtKB/TrEMBL:D7SIC5"
FT                   /protein_id="CBI15235.3"
FT                   /translation="MENSGQWLEKALIELCKGMETGLDLDEDIISGLVSYCELAPPLDA
FT                   QEYLHNIIGQEAGQSVIEEYLRRRGHKDSHSSTPDVPTSKLHAYVKPPSNEGSFGGAKK
FT                   PLRTQKQVMVPVNQEKQAPTDTSNSRNTHVANQGGSRKKKAGKVVSLAEAAKGSIVFKQ
FT                   GKPCTCQARQHTLVSNCLSCGKIVCEQEGEGPCSFCGALVLREGSTYAGLDESIVPLTD
FT                   AEAAAEAYAKRLVEYDRDSAARTTVIDDQSDYYEIEGNSWLSVEEKELLRKKKQEIEAA
FT                   EQAKRNKVIVTFDLVGRKVMVNQDEVSELESENRILRPPDEREINRIKPNPTLKVQPIF
FT                   MDPGPNRKPAKGKQLNKSLGNGMRLEITGRVQHDSNELKQFMPDNQLETSSNGKLWQRP
FT                   SVNGGLRVEDDDACSLDYR"
FT   3'UTR           6467197..6467348
FT                   /locus_tag="VIT_17s0000g06060"
FT                   /old_locus_tag="Vv17s0000g06060"
FT   gene            6480436..6484967
FT                   /locus_tag="VIT_17s0000g06050"
FT                   /old_locus_tag="Vv17s0000g06050"
FT   mRNA            join(6480436..6480446,6480447..6481073,6481392..6481602,
FT                   6482147..6482435,6483363..6483752,6483934..6484011,
FT                   6484324..6484561,6484562..6484967)
FT                   /locus_tag="VIT_17s0000g06050"
FT                   /old_locus_tag="Vv17s0000g06050"
FT                   /product="unknown predicted protein"
FT   5'UTR           6480436..6480446
FT                   /locus_tag="VIT_17s0000g06050"
FT                   /old_locus_tag="Vv17s0000g06050"
FT   CDS_pept        join(6480447..6481073,6481392..6481602,6482147..6482435,
FT                   6483363..6483752,6483934..6484011,6484324..6484561)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06050"
FT                   /old_locus_tag="Vv17s0000g06050"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT88"
FT                   /db_xref="InterPro:IPR004159"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT88"
FT                   /protein_id="CCB43097.1"
FT                   /translation="MAKKGNAAESKTRSSISIFVVLGLCCFFYILGAWQRSGFGKGDSI
FT                   AIEVTKQTDCSILSNLNFETHHKDEAGTIGDQFKPCDAQYIDYTPCQDQDRAMTFPRED
FT                   MNYRERHCPPEGEKLHCLIPAPKGYATPFPWPKSRDYVPFANAPYKNLTVEKAVQNWIQ
FT                   YEGNVFRFPGGGTQFPRGADAYIDELASVIPFENGMVRTALDTGCGVASWGAYLFKKNV
FT                   IAMSFAPRDSHVAQVQFALERGVPAVIGVLGTIKLPYPSGAFDMAHCSRCLIPWGANDG
FT                   MYMMEVDRVLRPGGYWVLSGPPISWNINYRAWQRPKEDLQEEQSKIEEIAKLLCWEKKY
FT                   EKGEIAIWRKRINHDSCSEQDSHVTFCEATNANDVWYKQMEACVTPYPKTTEADEVAGG
FT                   VWKPFPERLNAVPFRISSGSIPGVSDETFQEDDKLWKKHVKAYKRTNKIIDSGRYRNIM
FT                   DMNAGLGSFAAALESPKLWVMNVMPTIAEKDTLGVIYERGLIGIYHDWCEAFSTYPRTY
FT                   DLIHANGVFSLYKNSCSAEDILLEMDRILRPEGAVIFRDQIDVLIKVKKIVGGMRWNTK
FT                   LVDHEDGPLVSEKILFAVKQYWVVGENNSTAAPQ"
FT   3'UTR           6484562..6484967
FT                   /locus_tag="VIT_17s0000g06050"
FT                   /old_locus_tag="Vv17s0000g06050"
FT   gene            6487015..6488633
FT                   /locus_tag="VIT_17s0000g06040"
FT                   /old_locus_tag="Vv17s0000g06040"
FT   mRNA            join(6487015..6487539,6487611..6487632,6487757..6488402,
FT                   6488591..6488633)
FT                   /locus_tag="VIT_17s0000g06040"
FT                   /old_locus_tag="Vv17s0000g06040"
FT                   /product="unknown predicted protein"
FT   CDS_pept        join(6487015..6487539,6487611..6487632,6487757..6488402,
FT                   6488591..6488633)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06040"
FT                   /old_locus_tag="Vv17s0000g06040"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SIC7"
FT                   /db_xref="InterPro:IPR039615"
FT                   /db_xref="InterPro:IPR039819"
FT                   /db_xref="UniProtKB/TrEMBL:D7SIC7"
FT                   /protein_id="CBI15237.3"
FT                   /translation="MDNAANSLHLRDASFSAYLSTAEENFAVKLAESIQSPYLPLTSTQ
FT                   EAAYPVNLGRTMSVEEGELRVFGAEKYFNMKMDDGRRRLTTSSSLTHRQIKEDRADLHC
FT                   TKPKIRPGTPSASSEASWNSHAALLPRLLRNPSPSKQRKANAKMIFAGFGCNGSCSDKK
FT                   SVYVDTNAEPGGAFPTRVSIDKRAEEEGRKSLEVFGSHMLKKGDVATNLERKLSVLTWD
FT                   AIPKVQTVPTTSEGTGIYEDNESDASSDLFEIENLSGSAHPLFNRQASDGMSSCTRYEP
FT                   SEASIEWSVVTASAADFSVTSDFDEKKQVESTENSREMNFASTPTRPSKTKSSVGKEAQ
FT                   RSRPTGLLGCRSDKAVRVSEPAYRTNDKVKSDPGWHHRLDSSMPLGKSQGENKVKDFEV
FT                   FHLLISPCNVSQ"
FT   gene            6494574..6500700
FT                   /locus_tag="VIT_17s0000g06030"
FT                   /old_locus_tag="Vv17s0000g06030"
FT   mRNA            join(6494574..6494628,6494629..6494757,6495520..6495642,
FT                   6495784..6495834,6496082..6496153,6496315..6496428,
FT                   6496525..6496586,6497577..6497637,6497790..6497846,
FT                   6497972..6498016,6500242..6500334,6500335..6500700)
FT                   /locus_tag="VIT_17s0000g06030"
FT                   /old_locus_tag="Vv17s0000g06030"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           6494574..6494628
FT                   /locus_tag="VIT_17s0000g06030"
FT                   /old_locus_tag="Vv17s0000g06030"
FT   CDS_pept        join(6494629..6494757,6495520..6495642,6495784..6495834,
FT                   6496082..6496153,6496315..6496428,6496525..6496586,
FT                   6497577..6497637,6497790..6497846,6497972..6498016,
FT                   6500242..6500334)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06030"
FT                   /old_locus_tag="Vv17s0000g06030"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SIC8"
FT                   /db_xref="InterPro:IPR002164"
FT                   /db_xref="InterPro:IPR037231"
FT                   /db_xref="UniProtKB/TrEMBL:D7SIC8"
FT                   /protein_id="CBI15238.3"
FT                   /translation="MVADKGKKLKQSEKEEEVNSDHIDGDLVLSIEKLQEIQDDLEKIN
FT                   EEASDKVLEVEQKYNEIRKPIYDKRNDIIKSIPDFWLTAFLSHPALGDLLSEEDQKIFK
FT                   YLSSLEVEDFKDVKSGYSITFNFNPNPFFEDTKLKKTFTFLDEGITKISVTSIKWKDGM
FT                   GIPNGVNHEKKGNKRPIADASFFSWFSETQQKDIMDDIHDEIAEIIKEDLWPNPLTYFN
FT                   SEADEEDFDGEDADEEGKGGDGSEEDDDDQEDDDEDDDDDEGDEDD"
FT   3'UTR           6500335..6500700
FT                   /locus_tag="VIT_17s0000g06030"
FT                   /old_locus_tag="Vv17s0000g06030"
FT   gene            6511876..6513211
FT                   /locus_tag="VIT_17s0000g06020"
FT                   /old_locus_tag="Vv17s0000g06020"
FT   mRNA            join(6511876..6512055,6512056..6513162,6513163..6513211)
FT                   /locus_tag="VIT_17s0000g06020"
FT                   /old_locus_tag="Vv17s0000g06020"
FT                   /product="unknown predicted protein"
FT   5'UTR           6511876..6512055
FT                   /locus_tag="VIT_17s0000g06020"
FT                   /old_locus_tag="Vv17s0000g06020"
FT   CDS_pept        6512056..6513162
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06020"
FT                   /old_locus_tag="Vv17s0000g06020"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT89"
FT                   /db_xref="InterPro:IPR005333"
FT                   /db_xref="InterPro:IPR017887"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT89"
FT                   /protein_id="CCB43098.1"
FT                   /translation="MEGGDELHRPNFPFQLLEKKEEEACSSSGYPSLAISSAEPNTNRS
FT                   NSSLQIAAEPSKKPPPKRTSTKDRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGE
FT                   TIEWLLQQAEPAVIAATGTGTIPANFTSLNISLRSSGSSMSVPSQLRSTYFNPNFSVPQ
FT                   RRSLFPGLSSENSSTLVNFQSNNLNSMFQAKQELRDTSLDLSETEESIGRKRRPEQDLS
FT                   QQQMGSYLLQSSTGSIPASHGQIPANFWMLTNSNNQVMSADPIWPFPSVNNSNLYRGTM
FT                   SSGLHFMNFPTPVALLPSQQLSSGGGGGSGGGGGGGGSGMGEGHFNMLAGLNPYRPVMG
FT                   SGVSESQASGSQSHHGGDDRHDATSHHS"
FT   3'UTR           6513163..6513211
FT                   /locus_tag="VIT_17s0000g06020"
FT                   /old_locus_tag="Vv17s0000g06020"
FT   gene            6519816..6530184
FT                   /locus_tag="VIT_17s0000g06010"
FT                   /old_locus_tag="Vv17s0000g06010"
FT   mRNA            join(6519816..6519902,6519903..6520029,6520663..6520832,
FT                   6520926..6520990,6523211..6523251,6523424..6523512,
FT                   6523602..6523715,6525533..6525610,6528419..6528484,
FT                   6528598..6528678,6529816..6529959,6529960..6530184)
FT                   /locus_tag="VIT_17s0000g06010"
FT                   /old_locus_tag="Vv17s0000g06010"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           6519816..6519902
FT                   /locus_tag="VIT_17s0000g06010"
FT                   /old_locus_tag="Vv17s0000g06010"
FT   CDS_pept        join(6519903..6520029,6520663..6520832,6520926..6520990,
FT                   6523211..6523251,6523424..6523512,6523602..6523715,
FT                   6525533..6525610,6528419..6528484,6528598..6528678,
FT                   6529816..6529959)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06010"
FT                   /old_locus_tag="Vv17s0000g06010"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SID0"
FT                   /db_xref="UniProtKB/TrEMBL:D7SID0"
FT                   /protein_id="CBI15240.3"
FT                   /translation="MARVRNWWSHSKTVVLIWLTSALLFYFGLQFVLRNSSLNYPSAVS
FT                   TMSDSERRSKLYDKMESDLNEHGAAFLEHGETSQSLSLSDLFTLKDGIVTPVLKAAKPP
FT                   VRANVLYLSTEFSVPISEAVRSIFSPYFDKVIWFQNSSLYHFSMFHASHHITPVPATEV
FT                   EIEGEATAVEAVAKALCPLKIVLDRVLLTPTGVLLGCWQVASGTDPVTIRAKLRTALPR
FT                   APKNQLYDNAILHTSFARLLGPPKFSPTELHKASDQLQFFHELVTRLNNIIRGFEADVS
FT                   ELWYVEEYDVLALALNGRMKVRRFKLAASKSETSEDHKVEGKA"
FT   3'UTR           6529960..6530184
FT                   /locus_tag="VIT_17s0000g06010"
FT                   /old_locus_tag="Vv17s0000g06010"
FT   gene            6539798..6544908
FT                   /locus_tag="VIT_17s0000g06000"
FT                   /old_locus_tag="Vv17s0000g06000"
FT   mRNA            join(6539798..6540120,6540622..6540655,6540656..6540723,
FT                   6543466..6543584,6543760..6543887,6544176..6544631,
FT                   6544632..6544908)
FT                   /locus_tag="VIT_17s0000g06000"
FT                   /old_locus_tag="Vv17s0000g06000"
FT                   /product="unknown predicted protein"
FT   5'UTR           6539798..6540120
FT                   /locus_tag="VIT_17s0000g06000"
FT                   /old_locus_tag="Vv17s0000g06000"
FT   CDS_pept        join(6540656..6540723,6543466..6543584,6543760..6543887,
FT                   6544176..6544631)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g06000"
FT                   /old_locus_tag="Vv17s0000g06000"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT90"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT90"
FT                   /protein_id="CCB43099.1"
FT                   /translation="MDPEVPPSLVDKVNVVAENPLTRSCPTKNNQRKVPKRVHKAVREK
FT                   LKREHLHDLFLELANALDLTHQNTGKAFILCEAIRLVKDTIAQIDCLKKENAALFSESH
FT                   YVNIEKNELRDENSVLEDQIDKLQTEIKERAALYKPDLNSAPSEFQQTEVTQHCPGSSL
FT                   RFPSADQALQQSSVVGPVLVVPFASGLRAYPGAGAPRSISIVSKPHARYPTPGDSWPSQ
FT                   VLGDQPTARQKFELSGSINNSSSCGIGEEGSGKV"
FT   3'UTR           6544632..6544908
FT                   /locus_tag="VIT_17s0000g06000"
FT                   /old_locus_tag="Vv17s0000g06000"
FT   gene            6545416..6547900
FT                   /locus_tag="VIT_17s0000g05990"
FT                   /old_locus_tag="Vv17s0000g05990"
FT   mRNA            join(6545416..6545538,6545539..6545600,6546067..6546093,
FT                   6546311..6546433,6547037..6547280,6547552..6547599,
FT                   6547600..6547900)
FT                   /locus_tag="VIT_17s0000g05990"
FT                   /old_locus_tag="Vv17s0000g05990"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           6545416..6545538
FT                   /locus_tag="VIT_17s0000g05990"
FT                   /old_locus_tag="Vv17s0000g05990"
FT   CDS_pept        join(6545539..6545600,6546067..6546093,6546311..6546433,
FT                   6547037..6547280,6547552..6547599)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05990"
FT                   /old_locus_tag="Vv17s0000g05990"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5BHW6"
FT                   /db_xref="InterPro:IPR004345"
FT                   /db_xref="UniProtKB/TrEMBL:A5BHW6"
FT                   /protein_id="CBI15242.3"
FT                   /translation="MGSGTGNFLKVVLKNIDVLAGPVVSLAYPLYASIRAIETKSPVDD
FT                   QQWLTYWVLYSMITLFELTFAKVIEWLPFWPYAKLIATCWLVIPYFSGAAYVYEHFVRP
FT                   LFVNPRTVNIWYVPRKKDVFSKPDDILTAAEKYIQENGPDAFENIINRVDRESKSRGSN
FT                   YAIF"
FT   3'UTR           6547600..6547900
FT                   /locus_tag="VIT_17s0000g05990"
FT                   /old_locus_tag="Vv17s0000g05990"
FT   gene            6555003..6586869
FT                   /locus_tag="VIT_17s0000g05980"
FT                   /old_locus_tag="Vv17s0000g05980"
FT   mRNA            join(6555003..6555149,6565099..6565188,6577025..6577105,
FT                   6584337..6584522,6584892..6585807,6586131..6586747,
FT                   6586831..6586869)
FT                   /locus_tag="VIT_17s0000g05980"
FT                   /old_locus_tag="Vv17s0000g05980"
FT                   /product="unknown predicted protein"
FT   CDS_pept        join(6555003..6555149,6565099..6565188,6577025..6577105,
FT                   6584337..6584522,6584892..6585807,6586131..6586747,
FT                   6586831..6586869)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05980"
FT                   /old_locus_tag="Vv17s0000g05980"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT91"
FT                   /protein_id="CCB43100.1"
FT                   /translation="MYSSFFLSFFPFFFPSQNTQAITALKKGTYLLKYGRRGKPTFCPF
FT                   RISNDEKVLLWYAGREEKQLQLCQVSRIIQGQHTATFRQYPRLEKEDQSFSLMYKDGSL
FT                   DIICKDKDEAEVWFVALRALISQCNYHNWINETRSDSGSLDHHTDIRRNTPLTVSANSS
FT                   DIISKGEAISDALVSRGVCRVGSSSFARRNARLPKALESTVMLDAQNIACGSKHAVLVT
FT                   KQGAIFSWGEGYGGRLGHGVEADVSQPKLIDALSGLNIELVACGEYHTCAVTLSGDLYT
FT                   WGDGIYNFGLLGHGCGISHWTPRKVSCQIEGMHVSSISCGPWHTAAVTSAGQLFTFGDG
FT                   TFGALGHGDRNSSGTPREVETLKGLRTIRASCGIWHTAAVVEITTEPSISSSAGKLFTW
FT                   GDGDKGQLGHRDKEPRLAPSCVTILDDMTFCQVACGHSITAALTDSGQVYTMGSVEYGQ
FT                   LGSPQSADGLPSCTEAFCKACSSRKSLKASLAPNMNKPYRVCDDCFTKLKKALEFGFFP
FT                   LPRVASGIKIHNLNEVAEKESLDSRPHGRLPRLTSFGSFKQAENQHFKPNLKLELNNGH
FT                   VPTLNGSFQWEGFCTSNTSTSVFGSSQKASASVPGSRIVSRATSPGSSMVSRATSPVSR
FT                   NSTSSYSMTLALDRIARSNLEVSLDHSKQTNDSLLQEIILLRAQFSIVSQEQQACY"
FT   gene            6596872..6601673
FT                   /locus_tag="VIT_17s0000g05970"
FT                   /old_locus_tag="Vv17s0000g05970"
FT   mRNA            join(6596872..6596914,6596915..6596942,6597992..6598373,
FT                   6601368..6601551,6601552..6601673)
FT                   /locus_tag="VIT_17s0000g05970"
FT                   /old_locus_tag="Vv17s0000g05970"
FT                   /product="unknown predicted protein"
FT   5'UTR           6596872..6596914
FT                   /locus_tag="VIT_17s0000g05970"
FT                   /old_locus_tag="Vv17s0000g05970"
FT   CDS_pept        join(6596915..6596942,6597992..6598373,6601368..6601551)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05970"
FT                   /old_locus_tag="Vv17s0000g05970"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7FBA7"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005710"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D7FBA7"
FT                   /protein_id="CBI15244.3"
FT                   /translation="MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELW
FT                   RVQYVLSRIRNNARMLLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVE
FT                   NFLERRLQTLVFKSGMAKSIHHARVLIRQRHIRVGRQVVNIPSFLVRMDSQKHIDFSLT
FT                   SPLGGGRPGRVKRKNQKAAAKKAAGGDGDEEDED"
FT   gap             6597393..6597492
FT                   /estimated_length=100
FT   3'UTR           6601552..6601673
FT                   /locus_tag="VIT_17s0000g05970"
FT                   /old_locus_tag="Vv17s0000g05970"
FT   gene            complement(6602370..6603183)
FT                   /locus_tag="VIT_17s0000g05960"
FT                   /old_locus_tag="Vv17s0000g05960"
FT   mRNA            complement(join(6602370..6602551,6602552..6602701,
FT                   6602752..6602907,6602908..6603183))
FT                   /locus_tag="VIT_17s0000g05960"
FT                   /old_locus_tag="Vv17s0000g05960"
FT   3'UTR           complement(6602370..6602551)
FT                   /locus_tag="VIT_17s0000g05960"
FT                   /old_locus_tag="Vv17s0000g05960"
FT   CDS_pept        complement(join(6602552..6602701,6602752..6602907))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05960"
FT                   /old_locus_tag="Vv17s0000g05960"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7SID4"
FT                   /protein_id="CBI15245.3"
FT                   /translation="MSSIFDSVIIFFPGPTSMADIVLLTWAEASSRRLSQSRNAASERG
FT                   SLARRIRRGHEDELWIEFWGGVEGGESGEAGDRVLSDIADGFDRVGVAGRKGGVFG"
FT   5'UTR           complement(6602908..6603183)
FT                   /locus_tag="VIT_17s0000g05960"
FT                   /old_locus_tag="Vv17s0000g05960"
FT   gene            complement(6608016..6608817)
FT                   /locus_tag="VIT_17s0000g05950"
FT                   /old_locus_tag="Vv17s0000g05950"
FT   mRNA            complement(join(6608016..6608174,6608704..6608817))
FT                   /locus_tag="VIT_17s0000g05950"
FT                   /old_locus_tag="Vv17s0000g05950"
FT                   /product="unknown predicted protein"
FT   CDS_pept        complement(join(6608016..6608174,6608704..6608817))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05950"
FT                   /old_locus_tag="Vv17s0000g05950"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SID5"
FT                   /db_xref="InterPro:IPR004012"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/TrEMBL:D7SID5"
FT                   /protein_id="CBI15246.3"
FT                   /translation="MSTQRARASRVTDDEINDLILKLQALLPHSNQRRTSTGASAWRIL
FT                   KETCSYIKRLHREVGDLSERLSQLLDSLDNINGVEVEQLRSLLQR"
FT   gap             6616517..6616616
FT                   /estimated_length=100
FT   gap             6616762..6616861
FT                   /estimated_length=100
FT   gene            complement(6622628..6630088)
FT                   /locus_tag="VIT_17s0000g05940"
FT                   /old_locus_tag="Vv17s0000g05940"
FT   mRNA            complement(join(6622628..6622793,6622794..6624704,
FT                   6624801..6624904,6629577..6629678,6629784..6630069,
FT                   6630070..6630088))
FT                   /locus_tag="VIT_17s0000g05940"
FT                   /old_locus_tag="Vv17s0000g05940"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(6622628..6622793)
FT                   /locus_tag="VIT_17s0000g05940"
FT                   /old_locus_tag="Vv17s0000g05940"
FT   CDS_pept        complement(join(6622794..6624704,6624801..6624904,
FT                   6629577..6629678,6629784..6630069))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05940"
FT                   /old_locus_tag="Vv17s0000g05940"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT92"
FT                   /db_xref="InterPro:IPR007528"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT92"
FT                   /protein_id="CCB43101.1"
FT                   /translation="MEEIQSLPSLSSLSASTVSFLNKEFHRKEDLIRATHLVSELQKRC
FT                   GDLDQNLIDLNRTLEATLLAYAFHSNGLHDLFRNINLQLTRLNSTTCFSSDGGGGEGRA
FT                   GQLLAEELPALAKEVARVETVRMYAETALKLDSLVGDIEDAVSSTMNRNLKKHASTHSS
FT                   EEMRLHALKALKLTEDVLTSVTKTRPQWARLVSAVDQRVDRALAILRPQAIADHRTLLA
FT                   SLGWPPPLSTLNSNLDTRKSSEVLNPLFTMQGDLKHQYCENFLSLCSLQELQRRRKYRQ
FT                   LEGYYREIALHQPLWVIEELVNPISLAFQRHFSKWIDKPEFIFALVYKVTRDYVDSMDE
FT                   LLQPLVDEAMLAGYSCREEWISAMVTSLVIYLAKEIFPSYVGQLDEESVTGVQSQARIA
FT                   WLHLVDLMITFDKRVQSMLAHSGLLVFLQEDGNLQKISSLSVFCDRPDWLDLWAKIELD
FT                   DVLDKLKLEMEDRKNWTMKVQGAVLLPGPEDYRSPAISSVFLQRLSAVVDRCRALPSVS
FT                   LSSRFARLSGAPIIHKFLDCILLRCQEAEGLTALTDDDALIKVTNSINAARYFESVLKE
FT                   WCEDVFFLEMGLHEGDQLGTVVGVNSFSRPIEGPGSGIFDDEIEKLEKFRLEWVGKLSV
FT                   VLSRGFDARCRDYMKNRKQWQEKVEEGWMVSKSLLGALDYLQGKMSILEGSLNAIDFVG
FT                   VWRSLAAHVDRLIFSGILMSNVKFYDGGVERFRCDLEVLFGVFRAWCMRPEGFFPKASE
FT                   GLKLLKMGEDQLQDYSAAGEKWMVENGIRHLSVAEAEKIVKNRVFTS"
FT   5'UTR           complement(6630070..6630088)
FT                   /locus_tag="VIT_17s0000g05940"
FT                   /old_locus_tag="Vv17s0000g05940"
FT   gene            complement(6631764..6632637)
FT                   /locus_tag="VIT_17s0000g05930"
FT                   /old_locus_tag="Vv17s0000g05930"
FT   mRNA            complement(join(6631764..6632021,6632022..6632036,
FT                   6632539..6632562,6632563..6632637))
FT                   /locus_tag="VIT_17s0000g05930"
FT                   /old_locus_tag="Vv17s0000g05930"
FT   3'UTR           complement(6631764..6632021)
FT                   /locus_tag="VIT_17s0000g05930"
FT                   /old_locus_tag="Vv17s0000g05930"
FT   CDS_pept        complement(join(6632022..6632036,6632539..6632562))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05930"
FT                   /old_locus_tag="Vv17s0000g05930"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT93"
FT                   /protein_id="CCB43102.1"
FT                   /translation="MEKGLWRLLLDG"
FT   5'UTR           complement(6632563..6632637)
FT                   /locus_tag="VIT_17s0000g05930"
FT                   /old_locus_tag="Vv17s0000g05930"
FT   gene            complement(6632638..6635006)
FT                   /locus_tag="VIT_17s0000g05920"
FT                   /old_locus_tag="Vv17s0000g05920"
FT   mRNA            complement(join(6632638..6633969,6633970..6634034,
FT                   6634861..6635006))
FT                   /locus_tag="VIT_17s0000g05920"
FT                   /old_locus_tag="Vv17s0000g05920"
FT                   /product="F-box family protein"
FT   CDS_pept        complement(6632638..6633969)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05920"
FT                   /old_locus_tag="Vv17s0000g05920"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT94"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT94"
FT                   /protein_id="CCB43103.1"
FT                   /translation="MLEGPSYLISRDLPNACEQESKWIYNTFLVIELSNSKRPLEDGED
FT                   VGLRKFSKPSDGHETEETMQGLHDLSLSQANQSNTHHDTGDQSDLSSLISQIGRDNSIN
FT                   CLLQCSRSDYGSIASLNRSFRSLIRGGELYRLRRKLGIVEHWVYFSCDLLQWEAFDPIR
FT                   RRWMHLPRMPSYECFMCSDKESLAVGTELLVFGKEVTSHVVYKYSILTNSWSSGMNMNS
FT                   PRCLFGSASLGEIAILAGGCDPRGNILSSAELYNSDTGTWVTLPSMNKPRKMCSGIFMD
FT                   RKFYVIGGIGVGNSNSLTCGEVYDLEMRTWREIPNMFPGRNGSAGVAEATPAAAEAPPL
FT                   VAVVNNELYAADYAEKEVRKYDKARNLWVTVGRLPEQAVSMNGWGLAFRACGDRLIVIG
FT                   GPRVLGGGIIELNSWSPGEGPPQWDLLARKQSGSFVYNCAVMGC"
FT   5'UTR           complement(6634861..6635006)
FT                   /locus_tag="VIT_17s0000g05920"
FT                   /old_locus_tag="Vv17s0000g05920"
FT   gene            complement(6637946..6642394)
FT                   /locus_tag="VIT_17s0000g05910"
FT                   /old_locus_tag="Vv17s0000g05910"
FT   mRNA            complement(join(6637946..6638013,6642355..6642394))
FT                   /locus_tag="VIT_17s0000g05910"
FT                   /old_locus_tag="Vv17s0000g05910"
FT   CDS_pept        complement(join(6637946..6638013,6642355..6642394))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05910"
FT                   /old_locus_tag="Vv17s0000g05910"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT95"
FT                   /protein_id="CCB43104.1"
FT                   /translation="MGDFLECSIKILRGLVVKKVKVEKMRKQRWMDGLG"
FT   gene            6645141..6646428
FT                   /locus_tag="VIT_17s0000g05900"
FT                   /old_locus_tag="Vv17s0000g05900"
FT   mRNA            join(6645141..6645411,6645412..6645537,6646120..6646269,
FT                   6646270..6646428)
FT                   /locus_tag="VIT_17s0000g05900"
FT                   /old_locus_tag="Vv17s0000g05900"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           6645141..6645411
FT                   /locus_tag="VIT_17s0000g05900"
FT                   /old_locus_tag="Vv17s0000g05900"
FT   CDS_pept        join(6645412..6645537,6646120..6646269)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05900"
FT                   /old_locus_tag="Vv17s0000g05900"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SID8"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/TrEMBL:D7SID8"
FT                   /protein_id="CBI15249.3"
FT                   /translation="MSSRRSRSRQSGGSRITDDQINDLVSKLQQLLPEIRGRHSDKVSA
FT                   AKVLQETCNYIRSLNREVDDLSERLSELLATTDSAQAAIIRSLLTQ"
FT   3'UTR           6646270..6646428
FT                   /locus_tag="VIT_17s0000g05900"
FT                   /old_locus_tag="Vv17s0000g05900"
FT   gap             6667971..6668070
FT                   /estimated_length=100
FT   gene            6671486..6674307
FT                   /locus_tag="VIT_17s0000g05890"
FT                   /old_locus_tag="Vv17s0000g05890"
FT   mRNA            join(6671486..6671694,6671695..6671754,6671846..6671981,
FT                   6672192..6672328,6672529..6672652,6673635..6674095,
FT                   6674096..6674307)
FT                   /locus_tag="VIT_17s0000g05890"
FT                   /old_locus_tag="Vv17s0000g05890"
FT                   /product="Protein kinase"
FT   5'UTR           6671486..6671694
FT                   /locus_tag="VIT_17s0000g05890"
FT                   /old_locus_tag="Vv17s0000g05890"
FT   CDS_pept        join(6671695..6671754,6671846..6671981,6672192..6672328,
FT                   6672529..6672652,6673635..6674095)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05890"
FT                   /old_locus_tag="Vv17s0000g05890"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SID9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D7SID9"
FT                   /protein_id="CBI15250.3"
FT                   /translation="MVVAVKKLIPAGFQGHKEWLAEVNFLGQLQHPNLVKLLGYCLEGE
FT                   DRLLVYEFMARGSLENHLFRRTVPPLSWETRIKVAVGAARGLAVLHNSQPEIIYRDFKA
FT                   SNILLDSEFNAKLSDFGLAKEGPTGDRTHVSTQVFGTQGYAAPEYIATGHLSTRCDIYS
FT                   FGVVLLEILSGRRAIDKTKPRAEEKLVSWARPYLNDKKMFYRIMDSRMEGGYPKTGAYI
FT                   ASTLALQCVCHAKNRPTMSEVVKILERILAATDTAGPSQSAQQSAPSPVGRSTVGSSNP
FT                   SPHPQSPAESPSPAHSPQPPQQLG"
FT   3'UTR           6674096..6674307
FT                   /locus_tag="VIT_17s0000g05890"
FT                   /old_locus_tag="Vv17s0000g05890"
FT   gene            6678323..6682223
FT                   /locus_tag="VIT_17s0000g05880"
FT                   /old_locus_tag="Vv17s0000g05880"
FT   mRNA            join(6678323..6678339,6678340..6678471,6680521..6680658,
FT                   6681708..6682013,6682014..6682223)
FT                   /locus_tag="VIT_17s0000g05880"
FT                   /old_locus_tag="Vv17s0000g05880"
FT                   /product="unknown predicted protein"
FT   5'UTR           6678323..6678339
FT                   /locus_tag="VIT_17s0000g05880"
FT                   /old_locus_tag="Vv17s0000g05880"
FT   CDS_pept        join(6678340..6678471,6680521..6680658,6681708..6682013)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05880"
FT                   /old_locus_tag="Vv17s0000g05880"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT96"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR028661"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT96"
FT                   /protein_id="CCB43105.1"
FT                   /translation="MVLVLALGDLHIPDRAPDLPPKFKSMLVPGKIQHIICTGNLCIKE
FT                   VHDYLKTLCPDMHITRGEYDEETRYPETKTLTIGQFKLGLCHGHQVIPWGDLDSLAMLQ
FT                   RQLDVDILVTGHTHRFTAYKHEGGVVINPGSATGAFSSITYDVNPSFVLMDIDGLRVVV
FT                   YVYELIDGEVKVDKIDFKKTAATTRSTQ"
FT   3'UTR           6682014..6682223
FT                   /locus_tag="VIT_17s0000g05880"
FT                   /old_locus_tag="Vv17s0000g05880"
FT   gene            complement(6688637..6691261)
FT                   /locus_tag="VIT_17s0000g05870"
FT                   /old_locus_tag="Vv17s0000g05870"
FT   mRNA            complement(join(6688637..6688649,6688650..6689269,
FT                   6689363..6689461,6689548..6689671,6689878..6689927,
FT                   6690999..6691170,6691171..6691261))
FT                   /locus_tag="VIT_17s0000g05870"
FT                   /old_locus_tag="Vv17s0000g05870"
FT                   /product="Predicted protein"
FT   3'UTR           complement(6688637..6688649)
FT                   /locus_tag="VIT_17s0000g05870"
FT                   /old_locus_tag="Vv17s0000g05870"
FT   CDS_pept        complement(join(6688650..6689269,6689363..6689461,
FT                   6689548..6689671,6689878..6689927,6690999..6691170))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05870"
FT                   /old_locus_tag="Vv17s0000g05870"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SIE1"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="UniProtKB/TrEMBL:D7SIE1"
FT                   /protein_id="CBI15252.3"
FT                   /translation="MAKIRELCCFLLLAFAIAKVSEASSEIGVYELKRGNFSVKLTNYG
FT                   ATVVSVILPDRNGKLDDVVLGFDSVEDYKNDTTYFGAIVGRVANRIKGAQFTLNGKKYK
FT                   LVPNEGKNMLHGGPKGFSDVIWHVQSYDKNSHVTFVYHSFDGEEGFPGDLHVSVTYMFF
FT                   QTNKLVIKMTGRPLNKATPVNLASHSYWNLGGHSSGDVFSHQVQLFADKITPVDDELIP
FT                   TGKILPVEGTPYDFLNIHEIKTRFHELPSGYDINYVLNYVGNEHFHKAAVVYESKSGRK
FT                   MELWTNQPGLQFYTSNMLGTVKGKGGVTYNNYDGICLETQGFPDAVNHPDFPSQIVNPG
FT                   EIYEHFMVYRFTAK"
FT   5'UTR           complement(6691171..6691261)
FT                   /locus_tag="VIT_17s0000g05870"
FT                   /old_locus_tag="Vv17s0000g05870"
FT   gene            complement(6693376..6705401)
FT                   /locus_tag="VIT_17s0000g05860"
FT                   /old_locus_tag="Vv17s0000g05860"
FT   mRNA            complement(join(6693376..6693542,6693543..6693842,
FT                   6694479..6694567,6694726..6694831,6694943..6695071,
FT                   6695535..6695619,6695736..6695845,6696224..6696424,
FT                   6696964..6697334,6698715..6698798,6698911..6699036,
FT                   6699116..6699278,6700151..6700309,6702109..6702233,
FT                   6702321..6702440,6703478..6703622,6703805..6703884,
FT                   6704012..6704390,6705193..6705270,6705271..6705401))
FT                   /locus_tag="VIT_17s0000g05860"
FT                   /old_locus_tag="Vv17s0000g05860"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(6693376..6693542)
FT                   /locus_tag="VIT_17s0000g05860"
FT                   /old_locus_tag="Vv17s0000g05860"
FT   CDS_pept        complement(join(6693543..6693842,6694479..6694567,
FT                   6694726..6694831,6694943..6695071,6695535..6695619,
FT                   6695736..6695845,6696224..6696424,6696964..6697334,
FT                   6698715..6698798,6698911..6699036,6699116..6699278,
FT                   6700151..6700309,6702109..6702233,6702321..6702440,
FT                   6703478..6703622,6703805..6703884,6704012..6704390,
FT                   6705193..6705270))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05860"
FT                   /old_locus_tag="Vv17s0000g05860"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GT97"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR026082"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT97"
FT                   /protein_id="CCB43106.1"
FT                   /translation="MADSSSGPASFWTQANALLRKNLTFQKRNIRTNIRLVSFPILLCV
FT                   LLVVIQKLVNSELDKAENKCGCISVTNENGQTEKRCGIQYSTLDQVGTCPIPSPPEWPA
FT                   LLQVPAPEYRAVRADFIQFTDLPDDSCRRTGSCPATILFTGNNRSLGLTLAGNMFSSSS
FT                   SLNSSNILGNLSNFVLGSESMPETTNFLDPAFFSDLPIYHVEPQCAPNSTFSVSFSLAS
FT                   TNVQQEIQCVQGLHLWRNSSSEINDELFKGYHKGNSERKINEIVAAYDFLNSNGNNFNV
FT                   SIWYNSTYKNDAGASSIALVRVPRSVNLASNAYLQLVQGDGVKMVLDFIKEMPKPETQV
FT                   RLDLSSVLGTLFFTWVILQLFPVVLTSLVYEKQQNLRIMMKMHGLGDGPYWMISYAYFL
FT                   VISSIYMLCFVIFGSVIGLKFFTLNDYSIQLVFYFIYINLQISLAFLLAAAFSNVKTAT
FT                   VLGYICVFGTGLLGGFLFQFFIQDTSFPNGWIIVMELYPGFSLYRGLYEFAQYSFTGNY
FT                   MGTDGMRWGDLSDSTNGMRDVLIIMFVEWLIVLFVAYYIDQVLSSGNGVKRSPLFFLQN
FT                   FRKKKPMSSFRKPSLKRQGSKVFVKMEKADVSQEREKVEQLLLESGANHAIICDNLRKV
FT                   YPGRDGNPEKIAVKGLSLALSHGECFGMLGPNGAGKTSFISMMIGLTVPTSGTAFVEGL
FT                   DIRIDMDGIYTSMGVCPQHDLLWETLTGREHLLFYGRLKNLKGAALTQAVEESLKSVNL
FT                   FHGGVGDKQAGKYSGGMKRRLSVAISLIGDPKVVYMDEPSTGLDPASRNNLWNVVKRAK
FT                   QGRAIILTTHSMEEAEVLCDRLGIFVDGSLQCIGNPKELKARYGGSYVFTMTTSSNHEE
FT                   EVENLVRQLSPNTNKIYQISGTQKFELPKQEVRIADVFQAVENAKSRFTVQAWGLADTT
FT                   LEDVFIKVARGAQAFDVLS"
FT   5'UTR           complement(6705271..6705401)
FT                   /locus_tag="VIT_17s0000g05860"
FT                   /old_locus_tag="Vv17s0000g05860"
FT   gap             6708307..6708406
FT                   /estimated_length=100
FT   gene            6714452..6722368
FT                   /locus_tag="VIT_17s0000g05850"
FT                   /old_locus_tag="Vv17s0000g05850"
FT   mRNA            join(6714452..6714498,6714499..6714867,6717442..6717673,
FT                   6717791..6717960,6718081..6718266,6718383..6718478,
FT                   6718557..6718757,6718972..6719131,6719227..6719453,
FT                   6719953..6720070,6720158..6720234,6720324..6720413,
FT                   6720609..6720752,6720832..6721137,6721227..6721307,
FT                   6721466..6721642,6722033..6722275,6722276..6722368)
FT                   /locus_tag="VIT_17s0000g05850"
FT                   /old_locus_tag="Vv17s0000g05850"
FT                   /product="ABC transporter A family member 2"
FT   5'UTR           6714452..6714498
FT                   /locus_tag="VIT_17s0000g05850"
FT                   /old_locus_tag="Vv17s0000g05850"
FT   CDS_pept        join(6714499..6714867,6717442..6717673,6717791..6717960,
FT                   6718081..6718266,6718383..6718478,6718557..6718757,
FT                   6718972..6719131,6719227..6719453,6719953..6720070,
FT                   6720158..6720234,6720324..6720413,6720609..6720752,
FT                   6720832..6721137,6721227..6721307,6721466..6721642,
FT                   6722033..6722275)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05850"
FT                   /old_locus_tag="Vv17s0000g05850"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SIE3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR026082"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7SIE3"
FT                   /protein_id="CBI15254.3"
FT                   /translation="MDLQRGLPLLIQQFGALFKKNFLLSWRNKGATFLQLFSSLFFIFL
FT                   IFCIGKAIRSRFSSSTEYENVFDPKPLVSLPIPPCEDKFYTKLPCFDFVWSGNGSAKIQ
FT                   SIVNRIMTNNPGRPIPSDKVKSFSTRDEVDAWLYSDPMRCPGALHFVETNATVISYGLQ
FT                   TNSTPVSKRGHYEDPTFKFQIPLQIVAEREMARSLIGDPNFNWTARFKEFAHPAIEEFS
FT                   VVAVVGPTFFLAIAMFGFVIQISSLITEKELKLRQAMTMMGLYDSAYWLSWLTWEGIII
FT                   LIASLFIVLFGMMFQFDFFLNNSFSVVFLLFFLFQLNMIGYAFMLSSFISKSSSSTIIG
FT                   FCIFIFGFFSQLVTIFGFPYSNNFPNFYRIIWSLFPPNLLAEALSLLADATSTPQDPGI
FT                   SWSKRADCAPNDLDCVITINDIYIWLTATFFLWFLLAIYFDNIIPNSSGVRKSLFYFLK
FT                   PGYWTGRGGNKVEEGGICSCIGSIPSLEDITPDDEDVLEEENKVKQQRREGVADPNIAV
FT                   QICGLAKTYPGTTNIGCCKCKKTSPYHALKGLWVNFPKNQLFCLLGPNGAGKTTTINCL
FT                   TGITPVTEGDALIYGYSIRSSVGMSNIRRIIGVCPQFDILWNSLSGQEHLELFSSIKGL
FT                   PPSSVKSVAQKSLAEVKLTQAAKMRAGSYSGGMKRRLSVAIALIGDPKLVIMDEPTTGM
FT                   DPITRRHVWDIIENAKKGRAIVLTTHSMEEADILSDRIGIMAKGRLRCIGTSIRLKSRF
FT                   GTGFIAHVSFTGSTNGNTRPNDDAVTTPYHEAVKQFFKYHLDIVPKEENKAFLTFVIPH
FT                   DREARLTKFFGELQDRETEFGIADIQLGLTTLEEVFLNIAKKAELESAAAEGSMESLTL
FT                   TSGIVVQVPVGARFVGIPGTESAENPRGVMVEVQWEQDDTGSLCISEHSPETPVPPGIP
FT                   QMPSLRRRSRTVQGVVIDPNQIVSNDDR"
FT   3'UTR           6722276..6722368
FT                   /locus_tag="VIT_17s0000g05850"
FT                   /old_locus_tag="Vv17s0000g05850"
FT   gene            complement(6722626..6733485)
FT                   /locus_tag="VIT_17s0000g05840"
FT                   /old_locus_tag="Vv17s0000g05840"
FT   mRNA            complement(join(6722626..6722887,6722888..6722922,
FT                   6724255..6725296,6726340..6726420,6727236..6727439,
FT                   6729379..6729654,6730343..6730473,6732326..6732390,
FT                   6733128..6733165,6733166..6733167,6733287..6733485))
FT                   /locus_tag="VIT_17s0000g05840"
FT                   /old_locus_tag="Vv17s0000g05840"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(6722626..6722887)
FT                   /locus_tag="VIT_17s0000g05840"
FT                   /old_locus_tag="Vv17s0000g05840"
FT   CDS_pept        complement(join(6722888..6722922,6724255..6725296,
FT                   6726340..6726420,6727236..6727439,6729379..6729654,
FT                   6730343..6730473,6732326..6732390,6733128..6733165))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05840"
FT                   /old_locus_tag="Vv17s0000g05840"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR025064"
FT                   /db_xref="UniProtKB/TrEMBL:F6GT98"
FT                   /protein_id="CCB43107.1"
FT                   /translation="MVDFVLGRTTFVWPCHLLFFLQVISQETLETICTRRGVQAFVILY
FT                   CSIPTMGKSPGKWIKTLLFGKKASKSNFSKGREKVANEREVWVAAKAPEADLGLDPLVA
FT                   SEAPNIIDKNEMLEFENREASAGGILSGDLDADIQGCRQLSTLNNPERIRQERAATKAQ
FT                   AAFRGYLARRAFRALKGIIRLQALIRGHLVRRQAICTLYCMLGIVKIQALARGRRIRHS
FT                   ELGLRVNKKCIQVKPLKGKLGDPAGVSSSTQIAKRTANAFVHKLLASSPTVMPLHLQYD
FT                   SAEPNSDFYWLQCWSASHFWKPIPQPRQVPDSKSQKKQGNPLAIETETGRPKRSVRRIP
FT                   AMNVDSVSAQSTTEFEKPKRNFKKLSSRPADPVLEHPQNELEKVKRNLRKVHNPVVESS
FT                   AQPGNETEKPKQSMEKMSSTPGHDVLEQSMGDSAEKMNMETPVTVSKLPEVETTTEPPA
FT                   VIWVNEASDSLHNDQTVVELQPVENSGKDENIPVANEELSSKEDAISNENQKSSRKASI
FT                   PAKPERAENGLESSPKLPSYMATTQSAKAKLRAQGSPRLGQDVPEKNNITRRHSLPSST
FT                   NGKMNSLSPKTQKPVQGNGKGGNRSERSILSSKDGNAKVAVQAEWRR"
FT   5'UTR           complement(6733287..6733485)
FT                   /locus_tag="VIT_17s0000g05840"
FT                   /old_locus_tag="Vv17s0000g05840"
FT   gene            6740773..6744248
FT                   /locus_tag="VIT_17s0000g05830"
FT                   /old_locus_tag="Vv17s0000g05830"
FT   mRNA            join(6740773..6740788,6740789..6740825,6741015..6741111,
FT                   6742114..6742471,6743099..6743576,6743666..6743724,
FT                   6743900..6743944,6743945..6744248)
FT                   /locus_tag="VIT_17s0000g05830"
FT                   /old_locus_tag="Vv17s0000g05830"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           6740773..6740788
FT                   /locus_tag="VIT_17s0000g05830"
FT                   /old_locus_tag="Vv17s0000g05830"
FT   CDS_pept        join(6740789..6740825,6741015..6741111,6742114..6742471,
FT                   6743099..6743576,6743666..6743724,6743900..6743944)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05830"
FT                   /old_locus_tag="Vv17s0000g05830"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SIE5"
FT                   /db_xref="UniProtKB/TrEMBL:D7SIE5"
FT                   /protein_id="CBI15256.3"
FT                   /translation="MEEAIKDQPSVHGKSKLRYPLRSATKSKEEKQSTADTSNSSATKR
FT                   GRIVSKVSQSVSVLDSSTKDTAAKPPRRFSIPAKSNVSPHMKPAGNITPISETRAKRSV
FT                   TNQGKIATPVSDVSKSGNRRNSSYISSATYWLSQIKLSESAAMHSISLGFFKLALEAGC
FT                   KPLQRMREELKSYARRNSLGELGESVKELFSSYEISENLEQLQVSETCSQVPGEGTRSS
FT                   DDDVHSSSSTRSTRKLKPKSLNTDAAQVSSVTESANKETTQKNNPATRVRGSLNKNSVN
FT                   TRSVSDSGSRNLQRKPQKPSKQDSKTEKVVIKKQGKKSANEEGPVNSLPTEETTLQENK
FT                   ENMDAPLMEETSLTEVM"
FT   3'UTR           6743945..6744248
FT                   /locus_tag="VIT_17s0000g05830"
FT                   /old_locus_tag="Vv17s0000g05830"
FT   gene            complement(6745344..6753018)
FT                   /locus_tag="VIT_17s0000g05820"
FT                   /old_locus_tag="Vv17s0000g05820"
FT   mRNA            complement(join(6745344..6745537,6745538..6745666,
FT                   6750339..6750427,6750523..6750612,6751883..6751908,
FT                   6752049..6752173,6752174..6752182,6752832..6753018))
FT                   /locus_tag="VIT_17s0000g05820"
FT                   /old_locus_tag="Vv17s0000g05820"
FT                   /product="Ubiquitin carrier protein"
FT   3'UTR           complement(6745344..6745537)
FT                   /locus_tag="VIT_17s0000g05820"
FT                   /old_locus_tag="Vv17s0000g05820"
FT   CDS_pept        complement(join(6745538..6745666,6750339..6750427,
FT                   6750523..6750612,6751883..6751908,6752049..6752173))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05820"
FT                   /old_locus_tag="Vv17s0000g05820"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SIE6"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/TrEMBL:D7SIE6"
FT                   /protein_id="CBI15257.3"
FT                   /translation="MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDD
FT                   TPWDGGTFKLTLQFSEEYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAA
FT                   ILTSIQSLLCDPNPNSPANSEAARMFSENKREYNRRVREIVEQSWTAD"
FT   5'UTR           complement(6752832..6753018)
FT                   /locus_tag="VIT_17s0000g05820"
FT                   /old_locus_tag="Vv17s0000g05820"
FT   gene            complement(6781919..6785785)
FT                   /locus_tag="VIT_17s0000g05810"
FT                   /old_locus_tag="Vv17s0000g05810"
FT   mRNA            complement(join(6781919..6782854,6783018..6783131,
FT                   6783257..6783748,6784013..6784096,6784969..6785028,
FT                   6785654..6785785))
FT                   /locus_tag="VIT_17s0000g05810"
FT                   /old_locus_tag="Vv17s0000g05810"
FT                   /product="Predicted protein"
FT   CDS_pept        complement(join(6781919..6782854,6783018..6783131,
FT                   6783257..6783748,6784013..6784096,6784969..6785028,
FT                   6785654..6785785))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05810"
FT                   /old_locus_tag="Vv17s0000g05810"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SIE7"
FT                   /db_xref="InterPro:IPR003657"
FT                   /db_xref="InterPro:IPR036576"
FT                   /db_xref="UniProtKB/TrEMBL:D7SIE7"
FT                   /protein_id="CBI15258.3"
FT                   /translation="MNKEERAMEAALRRSGHGVVVKEERRPEAPCDDDEGCRDKAAAKA
FT                   DKTKSSSPRREDLNCSSVQLPAISKMERSISSAEPDSGASSSSHKDQDDQLESAKAEMG
FT                   EVREENQRLRMYLDQIMKDYKTLQMQFYDVVRQEAKESTEKASILQIEEPEFVSLSLGR
FT                   VSSDPKKDEKNKTTSKVEDDGVKGGLSLGLDCKFEVLNPSPENSFGGPKEAAGESWPPS
FT                   KSLKTMRTGDDEISQQNPAKRCRVSVRARCDTPTMNDGCQWRKYGQKIAKGNPCPRAYY
FT                   RCTVAPSCPVRKQVQRFAEDMSILITTYEGTHNHPLPYSATAMASTTSAAASMLMSGSS
FT                   SSQSGSGSCPLSATSADLHGVNFYLSDNSKSKQFYSINSSLSAVSSNPTITLDLTTASS
FT                   SSSSSSHFNRLSSNYPPPRFPSTGFNFSSSESNSLPISWSNGLLSYGSTTTTQPYNRNH
FT                   TGSQNSGRHTQENFFHPHVQKNNPAPVQQPLPDPIAAATKAIASDPSFQSALAAALTSI
FT                   MGANGGTHANHSGGEAFGQKLMWGSESLPAVSTYQSTSKGNGCASSYLNKSPPTNSQPG
FT                   SLMFLPPALPFSTSKNASASPAENREHTS"
FT   gene            6796231..6811749
FT                   /locus_tag="VIT_17s0000g05800"
FT                   /old_locus_tag="Vv17s0000g05800"
FT   mRNA            join(6796231..6796336,6796337..6796398,6803192..6803271,
FT                   6803742..6803845,6804046..6804113,6804286..6804343,
FT                   6804456..6804569,6804991..6805074,6805602..6805706,
FT                   6806140..6806253,6807272..6807403,6807517..6807606,
FT                   6807824..6807913,6809226..6809435,6810401..6810511,
FT                   6811146..6811225,6811322..6811460,6811461..6811749)
FT                   /locus_tag="VIT_17s0000g05800"
FT                   /old_locus_tag="Vv17s0000g05800"
FT                   /product="unknown predicted protein"
FT   5'UTR           6796231..6796336
FT                   /locus_tag="VIT_17s0000g05800"
FT                   /old_locus_tag="Vv17s0000g05800"
FT   CDS_pept        join(6796337..6796398,6803192..6803271,6803742..6803845,
FT                   6804046..6804113,6804286..6804343,6804456..6804569,
FT                   6804991..6805074,6805602..6805706,6806140..6806253,
FT                   6807272..6807403,6807517..6807606,6807824..6807913,
FT                   6809226..6809435,6810401..6810511,6811146..6811225,
FT                   6811322..6811460)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05800"
FT                   /old_locus_tag="Vv17s0000g05800"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SIE8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D7SIE8"
FT                   /protein_id="CBI15259.3"
FT                   /translation="MRGRVPQIAALNWLGSLSLSRSIHNLPFATIEVEEISGSQPAEVQ
FT                   NLVQGKWTGSTSGETIVDPLNGEPFIQVAEVDETGIQPFVDSLSKCPKHGLHNPFKAPE
FT                   RYLMLGDISNKAAHMLSLPKVSDFFTRLIQRVAPKSYQQALGEVYVTQKFLENFSGDQV
FT                   RFLARSFAVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPILKV
FT                   DSKVSIVMEQMIRLLHHCGLPMEDLDFINSDGKTMNKLLLEANPRMTLFTGSSRVADKL
FT                   AVDLKGRIKLEDAGFDWKILGPDVQEVDYVAWVCDQDAYACSGQKCSAQSIVFMHENWF
FT                   KSSLISRMKDLAARRKLEDLTIGPVLSFTTEAMLEHMNKLLQIPGSELLFGGKALENHS
FT                   IPPIYGALKPTAIYIPLEEMLKDGNYELVTREIFGPFQVVTDYKDNQLPRVLEALERMH
FT                   AHLTAAVVSNDSLFLQEVIGKSVNGTTYAGLRARTTGAPQNHWFGPAGDPRGAGIGTPE
FT                   AIKLVWSCHREIIYDIGPLPSHWEIPPAT"
FT   3'UTR           6811461..6811749
FT                   /locus_tag="VIT_17s0000g05800"
FT                   /old_locus_tag="Vv17s0000g05800"
FT   gene            complement(6812244..6816102)
FT                   /locus_tag="VIT_17s0000g05790"
FT                   /old_locus_tag="Vv17s0000g05790"
FT   mRNA            complement(join(6812244..6812518,6812519..6812643,
FT                   6813029..6813253,6813358..6813520,6813659..6813780,
FT                   6815641..6815818,6815819..6815895,6815987..6816102))
FT                   /locus_tag="VIT_17s0000g05790"
FT                   /old_locus_tag="Vv17s0000g05790"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(6812244..6812518)
FT                   /locus_tag="VIT_17s0000g05790"
FT                   /old_locus_tag="Vv17s0000g05790"
FT   CDS_pept        complement(join(6812519..6812643,6813029..6813253,
FT                   6813358..6813520,6813659..6813780,6815641..6815818))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05790"
FT                   /old_locus_tag="Vv17s0000g05790"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5B4I9"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012864"
FT                   /db_xref="UniProtKB/TrEMBL:A5B4I9"
FT                   /protein_id="CCB43108.1"
FT                   /translation="MTIELARQKRRKGSMNSRSRKLMLSPVQHLYETCSEVFADGKAGF
FT                   VPPPKDIERLRSVLDNLKPENVGLSADMPYFRATGSDEVPPPVTYLHIYECDKFSIGIF
FT                   CLPPSGVIPLHNHPGMTVFSKLLFGSMHIKSYDWVADVSYSKNQNTHHEDLAALQHEPR
FT                   LAKVHADSDLTAPCKTSVLYPNAGGNMHCFTALTPCAMLDVLGPPYSDDEGRHCTYYND
FT                   FPYATFSGDTGSLQAEEMEGCGWLKEMEKPESFVVVGAMYRGPQFVEN"
FT   5'UTR           complement(6815987..6816102)
FT                   /locus_tag="VIT_17s0000g05790"
FT                   /old_locus_tag="Vv17s0000g05790"
FT   gene            6818188..6819656
FT                   /locus_tag="VIT_17s0000g05780"
FT                   /old_locus_tag="Vv17s0000g05780"
FT   mRNA            join(6818188..6818329,6818330..6819517,6819518..6819656)
FT                   /locus_tag="VIT_17s0000g05780"
FT                   /old_locus_tag="Vv17s0000g05780"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           6818188..6818329
FT                   /locus_tag="VIT_17s0000g05780"
FT                   /old_locus_tag="Vv17s0000g05780"
FT   CDS_pept        6818330..6819517
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05780"
FT                   /old_locus_tag="Vv17s0000g05780"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTA0"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTA0"
FT                   /protein_id="CCB43109.1"
FT                   /translation="MSLLELVTKAAANPKTLTAPSTYPIILNPEDSLLSLNPNVENPDP
FT                   NSLVVPVSGFQISQTDSEIIDSANKFFKKLKRKLKNPSSFNTDDLIGILSSFLEKNGKK
FT                   VDVSVGVDPSTEGYTRVLIEKLGFLMGRDVSELVLEACLVLGNWELVEALIVNGHVAHS
FT                   SYSNLVSVLVEKRRSDLVCLCIKHFTDLGSSELLCILKYFLLPPRGAYSSMVAVRKGWE
FT                   SQAKLAIEKASNKDLKGKKSHVAKEAAVLLVIAHDEFLASELCLHYLLSSPNLDDVIFP
FT                   YSISKLNGEEIMSLIRYLGKWLKKYERFPQAGPCPKASSMLGLKACDSVPTLEAVVKCF
FT                   GLVLNEHFSSLVLNLEFREELRSMKAVVTSLALEARLCCSVANVVEDLRAEAESA"
FT   3'UTR           6819518..6819656
FT                   /locus_tag="VIT_17s0000g05780"
FT                   /old_locus_tag="Vv17s0000g05780"
FT   gene            complement(6822679..6836094)
FT                   /locus_tag="VIT_17s0000g05770"
FT                   /old_locus_tag="Vv17s0000g05770"
FT   mRNA            complement(join(6822679..6822850,6822851..6822925,
FT                   6823069..6823143,6823257..6823325,6832432..6832545,
FT                   6833302..6833397,6833503..6833573,6833726..6833888,
FT                   6835176..6835389,6835979..6836094))
FT                   /locus_tag="VIT_17s0000g05770"
FT                   /old_locus_tag="Vv17s0000g05770"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(6822679..6822850)
FT                   /locus_tag="VIT_17s0000g05770"
FT                   /old_locus_tag="Vv17s0000g05770"
FT   CDS_pept        complement(join(6822851..6822925,6823069..6823143,
FT                   6823257..6823325,6832432..6832545,6833302..6833397,
FT                   6833503..6833573,6833726..6833888,6835176..6835389,
FT                   6835979..6836094))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05770"
FT                   /old_locus_tag="Vv17s0000g05770"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SIF1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D7SIF1"
FT                   /protein_id="CBI15262.3"
FT                   /translation="MLTFFRLYLQHKSPYLQSTRTHSIIFLQTLCFNPSLSSRRMKNSE
FT                   ANSIVTKKEKGIQIEGYPVEGLSIGGQETCIILPSLKLAFDIGRCPQRAISQDFLFISH
FT                   GHMDHIGGLPMYVATRGLYRMKPPIIIVPKAIKENVEMLFQVHRAMDESELKHNLIGLN
FT                   VGEEFYLRKDLKVRAFRTYHVIPSQGYVVYSVKQKLKQEYVGLPGNEIKNLKLSGVEIT
FT                   YTMTTPEIAFTGDTMSDFILDHTNVDALMARVLIMESTFVDNTVTVEHAREYGHTHLSE
FT                   IVSYADRFQNKAILLIHFSARYTTDEIQEAVSALPPPLGGRVFALTEGF"
FT   gene            6848334..6871877
FT                   /locus_tag="VIT_17s0000g05760"
FT                   /old_locus_tag="Vv17s0000g05760"
FT   mRNA            join(6848334..6848594,6848673..6848837,6849519..6850016,
FT                   6850980..6851157,6852607..6852719,6852900..6852998,
FT                   6856778..6856847,6857391..6857446,6867526..6867576,
FT                   6867699..6867803,6868054..6868098,6869414..6869522,
FT                   6870197..6870399,6870916..6870996,6871524..6871697,
FT                   6871698..6871877)
FT                   /locus_tag="VIT_17s0000g05760"
FT                   /old_locus_tag="Vv17s0000g05760"
FT                   /product="unknown predicted protein"
FT   CDS_pept        join(6848334..6848594,6848673..6848837,6849519..6850016,
FT                   6850980..6851157,6852607..6852719,6852900..6852998,
FT                   6856778..6856847,6857391..6857446,6867526..6867576,
FT                   6867699..6867803,6868054..6868098,6869414..6869522,
FT                   6870197..6870399,6870916..6870996,6871524..6871697)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05760"
FT                   /old_locus_tag="Vv17s0000g05760"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTA1"
FT                   /db_xref="InterPro:IPR026314"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTA1"
FT                   /protein_id="CCB43110.1"
FT                   /translation="MDHQWRPRPIQGNICPICSISHFPFCPPHPSLDQYPRFSLENNRL
FT                   FQRPVLDPLIDNRAHPFVGYPNDGYGDPRFWNRNPNLERDAYNDFLSGGDRNSKRMRFD
FT                   ETASGSFSNDYHLNPTRVMSEDERRLKLIRDHGGASSGPYTFEHPVKQKQDFQSHVQLS
FT                   DVRQSFEVRFPSQEGNQGTVLHQNSPLGAQYGSHRQGGYLPIHTGSNIVSEGLSQMQAS
FT                   RSFHVQPPLPASPPPPLPVDPPGHTSSKSKTSSSAPMKSSPLFPVPAGSLAMAPSSYPP
FT                   VPGANSLSQPYFHNKSHLHASTGFATEEPQDIRGTSSKQYLAEGQPYLIKHPSSEKPNS
FT                   IDASHLFKQPHRVGRPDHVVIILRGLPGSGKSYLAKMLRDLEVESGGDAPRIYSMDDYF
FT                   MTEVEKVEESESMKSFSARGKKPIVKKVMEYCYEPEMEEAYRASMLKAFKKTLEEGVFT
FT                   FIIVDDRNLRVADFAQFWATAKRSGYEVYLLEASYKDPAGCAARNVHGFTQDDIQRMAG
FT                   QWEEAPSMYLQLDIKSLFQGDDLKESGIQEVDMDTEDGDCDGGLSGSQEEKSEKVAAPP
FT                   VEDYAPDGSSKDGKRWDAEGDHPAEVKELGSSKWSNDLDEDDTEKSRGPKENLNALSGL
FT                   IQAYSKGGKSVHWGDQAGNTGFSIGTAKKANSLVIGPGAGYNLKSNPLREEENSTSSGN
FT                   TGGSKRTSMFQEQLRAERESFRAVFDRRRHRIGGLDADEES"
FT   gap             6860417..6860516
FT                   /estimated_length=100
FT   gap             6862418..6862517
FT                   /estimated_length=100
FT   3'UTR           6871698..6871877
FT                   /locus_tag="VIT_17s0000g05760"
FT                   /old_locus_tag="Vv17s0000g05760"
FT   gene            6874051..6883496
FT                   /locus_tag="VIT_17s0000g05750"
FT                   /old_locus_tag="Vv17s0000g05750"
FT   mRNA            join(6874051..6874161,6874162..6874266,6874366..6874554,
FT                   6875165..6875406,6875565..6875682,6876340..6876456,
FT                   6876550..6876696,6876922..6876996,6877094..6877162,
FT                   6878202..6878320,6878484..6878541,6878789..6878899,
FT                   6879191..6879275,6881437..6881534,6881787..6881879,
FT                   6882147..6882185,6882186..6882223,6883293..6883496)
FT                   /locus_tag="VIT_17s0000g05750"
FT                   /old_locus_tag="Vv17s0000g05750"
FT                   /product="unknown predicted protein"
FT   5'UTR           6874051..6874161
FT                   /locus_tag="VIT_17s0000g05750"
FT                   /old_locus_tag="Vv17s0000g05750"
FT   CDS_pept        join(6874162..6874266,6874366..6874554,6875165..6875406,
FT                   6875565..6875682,6876340..6876456,6876550..6876696,
FT                   6876922..6876996,6877094..6877162,6878202..6878320,
FT                   6878484..6878541,6878789..6878899,6879191..6879275,
FT                   6881437..6881534,6881787..6881879,6882147..6882185)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05750"
FT                   /old_locus_tag="Vv17s0000g05750"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTA2"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTA2"
FT                   /protein_id="CCB43111.1"
FT                   /translation="MAAAAAGRFMDLDLRKGHLGSSPHPTSHSLHVFHQRYESCSLSMN
FT                   GCQGDPKIPIGTIQTRTFPGVSTHSLALDTLSSAISHLKSDPPPFTSGILRLQVPIQQK
FT                   IEAIDWLHAQQELLPRCFFSSRSQSSSFDPFIDSVNGDGNGLEDHDLVRVAGIGAAVFF
FT                   RHIHPFSLDDWKSIKRFLSKKCPLIRAYGAIRFDPRANVSSEWRAFGSFYFVVPQVEFN
FT                   ELEGSSVLATTIAWDNALSWTWEKAIGALQATMCQVSSIVGKLRKEVCKTFVLSNSHVP
FT                   SKASWNLAVNRALQIIGRADSPLIKVVLARSSRVVTTSHIDPIAWLACLQVEGQNAYQF
FT                   FLQPPDAPAFIGNTPEQLFHRKRLCIHSEALAGTRARGGSKAQDLQIELDLLSSPKEDF
FT                   EFSIVRESIQRKLEAICSTVWVEPKKAIRKLPRIQHLYAQLSGRLRSEDDEFDILSSLH
FT                   PTPAVCGFPREEARLLIAETEMFDRGMFAGPVGWFGGGETEFAVGIRSALVEKGLGGLI
FT                   YAGTGIVRGSNSSLEWEELELKISQFTKPIKVEVPLS"
FT   3'UTR           join(6882186..6882223,6883293..6883496)
FT                   /locus_tag="VIT_17s0000g05750"
FT                   /old_locus_tag="Vv17s0000g05750"
FT   gene            complement(6884366..6885946)
FT                   /locus_tag="VIT_17s0000g05740"
FT                   /old_locus_tag="Vv17s0000g05740"
FT   mRNA            complement(join(6884366..6884584,6884675..6884917,
FT                   6884989..6885640,6885771..6885946))
FT                   /locus_tag="VIT_17s0000g05740"
FT                   /old_locus_tag="Vv17s0000g05740"
FT                   /product="unknown predicted protein"
FT   CDS_pept        complement(join(6884366..6884584,6884675..6884917,
FT                   6884989..6885640,6885771..6885946))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05740"
FT                   /old_locus_tag="Vv17s0000g05740"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTA3"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR007524"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR018082"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTA3"
FT                   /protein_id="CCB43112.1"
FT                   /translation="MRLVILIPFLVIVPAVTANIGDFDEVWQTRAEEARKAALQAYNPH
FT                   PEKVTDNFNKKVHKSFDSTNHTRRNLSKFSGLCMATNPIDRCWRCRSDWASNRMKLADC
FT                   VLGFGQKTTGGKGGKIYVVTDPSDNDMVNPKPGTLRHAAIQEEPLWIIFAHSMAIRLNE
FT                   ELIMTSNKTIDARGANVHIANGAGLTLQFVHNIIIHGLHIHDIKVGNGGLIRDSASHYG
FT                   FRTRSDGDGISIFGATNIWIDHISMSNCADGLIDAIMASTAITISNCHFTHHNEVMLFG
FT                   ASDGYSGDAIMQITITFNHFGQGLTQRMPRCRWGFFHVVNNDYTHWLMYAIGGSHHPTI
FT                   LSQGNRFIAPPDINCKEVTKRDYSPESVWKSWTWRSQGDLMMNGAFFVESGDPNFDFSN
FT                   KYVIRAKPGAFVTRLTRFSGALSCREGMPC"
FT   gene            6888364..6890560
FT                   /locus_tag="VIT_17s0000g05730"
FT                   /old_locus_tag="Vv17s0000g05730"
FT   mRNA            join(6888364..6888424,6889603..6889815,6890054..6890375,
FT                   6890491..6890560)
FT                   /locus_tag="VIT_17s0000g05730"
FT                   /old_locus_tag="Vv17s0000g05730"
FT   CDS_pept        join(6888364..6888424,6889603..6889815,6890054..6890375,
FT                   6890491..6890560)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05730"
FT                   /old_locus_tag="Vv17s0000g05730"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SIF5"
FT                   /db_xref="UniProtKB/TrEMBL:D7SIF5"
FT                   /protein_id="CBI15266.3"
FT                   /translation="MSRKKVLGKEGVVNTKEMKLSRKVPFSSYLYKAIKLIQSPSPQAT
FT                   NIVSAQGLTSLCFLHTLSMTDKTAVKAISDVGSWTEDGDCVQINITGAGKDVKLSIAQP
FT                   PPKKPLEMTIPKQQPVVTEKPKEESDKQKKEVEKTKEESDKQKKEVEKPKEEGSGIQKK
FT                   GGHESKRDETVLENVMTKLKSYKGIVITAFIAISLGVVHCLYDPHIQESDLIRIPIRQ"
FT   gene            6913311..6914563
FT                   /locus_tag="VIT_17s0000g05720"
FT                   /old_locus_tag="Vv17s0000g05720"
FT   mRNA            join(6913311..6913371,6913372..6913471,6913710..6913883,
FT                   6914124..6914422,6914423..6914563)
FT                   /locus_tag="VIT_17s0000g05720"
FT                   /old_locus_tag="Vv17s0000g05720"
FT   5'UTR           6913311..6913371
FT                   /locus_tag="VIT_17s0000g05720"
FT                   /old_locus_tag="Vv17s0000g05720"
FT   CDS_pept        join(6913372..6913471,6913710..6913883,6914124..6914422)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05720"
FT                   /old_locus_tag="Vv17s0000g05720"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTA4"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTA4"
FT                   /protein_id="CCB43113.1"
FT                   /translation="MTDNTAAKAISETPISDVGNWTEDGDRVQINITAAGREVKLCMPS
FT                   PTKPLEITIPKKDVTVKGNVEKPKTKPISNVGEWTEYQDHVQINITAAGKDVKLCIDQQ
FT                   TSPTKPLEIAIPKKQADVEVKGETPNDGSDKRTGKVGSDQQQKGSKRDETMLENVMIKL
FT                   KAYKGIVITAFIAISLGYLLRRKFKVA"
FT   3'UTR           6914423..6914563
FT                   /locus_tag="VIT_17s0000g05720"
FT                   /old_locus_tag="Vv17s0000g05720"
FT   gene            6920685..6921559
FT                   /locus_tag="VIT_17s0000g05710"
FT                   /old_locus_tag="Vv17s0000g05710"
FT   mRNA            join(6920685..6920775,6920776..6920911,6921104..6921177,
FT                   6921296..6921364,6921365..6921559)
FT                   /locus_tag="VIT_17s0000g05710"
FT                   /old_locus_tag="Vv17s0000g05710"
FT   5'UTR           6920685..6920775
FT                   /locus_tag="VIT_17s0000g05710"
FT                   /old_locus_tag="Vv17s0000g05710"
FT   CDS_pept        join(6920776..6920911,6921104..6921177,6921296..6921364)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05710"
FT                   /old_locus_tag="Vv17s0000g05710"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:D7SIF7"
FT                   /protein_id="CBI15268.3"
FT                   /translation="MASVEGAKEGKTRRNSSDHLSFQDIVPSSGWSEDEKCHYLLVDLP
FT                   GFKREEVKLQVDYQTNQLMASGERRSRNRRKNLRRRMGLPAPLRKRM"
FT   3'UTR           6921365..6921559
FT                   /locus_tag="VIT_17s0000g05710"
FT                   /old_locus_tag="Vv17s0000g05710"
FT   gene            6925379..6928991
FT                   /locus_tag="VIT_17s0000g05700"
FT                   /old_locus_tag="Vv17s0000g05700"
FT   mRNA            join(6925379..6925542,6925543..6928572,6928573..6928991)
FT                   /locus_tag="VIT_17s0000g05700"
FT                   /old_locus_tag="Vv17s0000g05700"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           6925379..6925542
FT                   /locus_tag="VIT_17s0000g05700"
FT                   /old_locus_tag="Vv17s0000g05700"
FT   CDS_pept        6925543..6928572
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05700"
FT                   /old_locus_tag="Vv17s0000g05700"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTA5"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR013583"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTA5"
FT                   /protein_id="CCB43114.1"
FT                   /translation="MTTSAQPPPPPSKTQRKLIVEIVDARDLLPKDGQGSSSPYVIVDF
FT                   DGHKQRTTTKYRDLNPVWNEKLEFLVSDPDTMEVEELEIEVFNDKRMGNGGGSSRKNHF
FT                   LGRVKLYGSQFAKRGEEGLVYFPLEKKSVFSWIRGEIGLRIYYYDEEVVEETKTPEEPP
FT                   PQADVKKPPVEESRVQSLEIPVAQMEVVREGSQSPPIVIIEESPPPPVSLQTEHHVPEE
FT                   VQSEMRRMVQGVKMGGGERVRLWRRPNGDYSPKVIRGRFTSESEKMTAYDLVEPMQYLF
FT                   VRIVKARRLSPTESPCVKIRTAGHFLRSKPATLRPGESWENPEWHQVFALGYNKSDSAS
FT                   ATLEISVWNGTSEQFLGGVCFDLSDVPVRDPPDSPLAPQWYRLEGADDQNSGIVSGDIQ
FT                   LSVWIGTQADDAFPESWSSDAPYVAHTRSKVYQSPKLWYLRVTVMEAQDLHIASNLPPL
FT                   TAPEVRVKAQLGFQSVRTRRGSMSSHSSSFFWHEDLVFVAGEALEDHLILLVEDRTAKD
FT                   ALLLGHVVVPVSAIEQRIDERHVASKWFPLDGGCVGGPYCGRINLRLCLEGGYHVLDEA
FT                   AQVCSDFRPTAKQLWKPAVGVLELGILGARGLLPMKTKGGGKGSTDAYCVAKYGKKWVR
FT                   TRTITDSFDPRWNEQYTWQVYDPCTVLTIGVFDNLRMFAPDMPEEKPDYRIGKVRIRVS
FT                   TLESNKVYTNSYPLLVLQRTGLKKMGEIELAIRFACPSMLPETCAIYGQPLLPRMHYLR
FT                   PLGVAQQEALRGAATKIVAAWLVRSEPPLGPEVVRYMLDADSHTWSMRKSKANWFRIVA
FT                   VLAWAVGLAKWLDDIRRWKNPITTVLVHVLYLVLVWYPDLIVPTGFLYIFLIGLWYYRF
FT                   RPKIPAGMDIRLSQAETVDPDELDEEFDTIPSSKPPEIIRARYDRLRMLAARVQTVLGD
FT                   FATQGERVQALVSWRDPRATKLFIGVCLIVTVVLYAVPPKMVAVAIGFYFLRHPMFRDP
FT                   MPPASLNFFRRLPSLSDRLM"
FT   3'UTR           6928573..6928991
FT                   /locus_tag="VIT_17s0000g05700"
FT                   /old_locus_tag="Vv17s0000g05700"
FT   gene            6931818..6934299
FT                   /locus_tag="VIT_17s0000g05690"
FT                   /old_locus_tag="Vv17s0000g05690"
FT   mRNA            join(6931818..6931847,6931848..6931896,6931997..6932083,
FT                   6932574..6932627,6933268..6933335,6933420..6933631,
FT                   6933727..6934033,6934034..6934299)
FT                   /locus_tag="VIT_17s0000g05690"
FT                   /old_locus_tag="Vv17s0000g05690"
FT                   /product="unknown predicted protein"
FT   5'UTR           6931818..6931847
FT                   /locus_tag="VIT_17s0000g05690"
FT                   /old_locus_tag="Vv17s0000g05690"
FT   CDS_pept        join(6931848..6931896,6931997..6932083,6932574..6932627,
FT                   6933268..6933335,6933420..6933631,6933727..6934033)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05690"
FT                   /old_locus_tag="Vv17s0000g05690"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SIG0"
FT                   /db_xref="InterPro:IPR001925"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR027246"
FT                   /db_xref="UniProtKB/TrEMBL:D7SIG0"
FT                   /protein_id="CBI15271.3"
FT                   /translation="MAYRPSFYLEIGRKARDLLYRDYTEQPPMHYHYGCCDWSYDLALR
FT                   SQICRSTSHEINDNNQELVGEHVPGISAVLRFIVPDPLSSKVELRYLRDFLGITAGIEG
FT                   MTTNPVMSFSGVIGSSVVSLGTDLAFDTILKNFTKCNAGLSFSSPIVSASLTLEDKGDT
FT                   AKASCFGLINPLTSTAIAAELKHTFSQNETSLTLGAQHEVAPLTVIKARADTTGKVGAL
FT                   FQHQLVSKIFLTLAGDVDIQELKTSPTIGLSLALRP"
FT   3'UTR           6934034..6934299
FT                   /locus_tag="VIT_17s0000g05690"
FT                   /old_locus_tag="Vv17s0000g05690"
FT   gene            complement(6935495..6939937)
FT                   /locus_tag="VIT_17s0000g05680"
FT                   /old_locus_tag="Vv17s0000g05680"
FT   mRNA            complement(join(6935495..6935724,6935725..6936086,
FT                   6936552..6936648,6936742..6936833,6936990..6937110,
FT                   6937627..6937827,6939830..6939937))
FT                   /locus_tag="VIT_17s0000g05680"
FT                   /old_locus_tag="Vv17s0000g05680"
FT                   /product="Hypersensitive-induced response protein"
FT   3'UTR           complement(6935495..6935724)
FT                   /locus_tag="VIT_17s0000g05680"
FT                   /old_locus_tag="Vv17s0000g05680"
FT   CDS_pept        complement(join(6935725..6936086,6936552..6936648,
FT                   6936742..6936833,6936990..6937110,6937627..6937827,
FT                   6939830..6939937))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05680"
FT                   /old_locus_tag="Vv17s0000g05680"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTA6"
FT                   /protein_id="CCB43115.1"
FT                   /translation="MAKSPTFCLLSISSPFHTAVHRLYCFFFFFIHLIFISAENMGNLL
FT                   GCIQVDQSTVAIKERFGKFEEVLEPGCHCLPWCFGSQLAGHLSLRLQQLDVRCETKTKD
FT                   NVFVNVVASIQYRALADKANDAFYKLSNTRSQIQAYVFDVIRASVPKLNLDDAFEQKNE
FT                   IAKSVEDELEKAMSAYGYEIVQTLIVDIEPDEHVKRAMNEINAAARMRVAANEKAEAEK
FT                   ILQIKRAEGEAESKYLSGLGIARQRQAIVDGLRDSVLGFSVNVPGTTAKDVMDMVLVTQ
FT                   YFDTMKEIGAASKSSAVFIPHGPGAVRDVATQIRDGLLQSTLSHQ"
FT   gene            complement(6945235..6947304)
FT                   /locus_tag="VIT_17s0000g05670"
FT                   /old_locus_tag="Vv17s0000g05670"
FT   mRNA            complement(join(6945235..6945471,6945561..6945674,
FT                   6945753..6945861,6945990..6946071,6946186..6946393,
FT                   6946658..6946822,6946925..6947062,6947176..6947304))
FT                   /locus_tag="VIT_17s0000g05670"
FT                   /old_locus_tag="Vv17s0000g05670"
FT                   /product="Polygalacturonase-like protein"
FT   CDS_pept        complement(join(6945235..6945471,6945561..6945674,
FT                   6945753..6945861,6945990..6946071,6946186..6946393,
FT                   6946658..6946822,6946925..6947062,6947176..6947304))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05670"
FT                   /old_locus_tag="Vv17s0000g05670"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SIG2"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:D7SIG2"
FT                   /protein_id="CBI15273.3"
FT                   /translation="MASRLEILFLVSLFSVLLTPLHCSVFDVTQYGAIGNGSTDDSPAF
FT                   MLAWTDVCNSSASTPIFHIPGNKTFLLNPVFFQGPCRSTNIQFQIDGIITAESEPSNWK
FT                   CTRNRCDKWIHFKRVDGLFINGSGIIDGNGKNWWSSGYINALEVTSSNKVQLTGLSFRN
FT                   NPHMHVVFDSCDMVHISNVSIDAPGDSPNTDGIHLKESTHVNIEFCSIRTGDDCISIVD
FT                   KCSNITIQNIECGPGHGISIGSMGQYGAYETVENIYVSDVQFKGSLSGVRIKTWQGGKG
FT                   HARKMVFKGITSLNTQYPIQIDQFYCPHAKCDEQADAVEISDISYIDIKGTSMRKTAVK
FT                   LACSESVPCKNIFMQDINLSYQGTNASAYCKNVNGTSQGIMEPSVPCLYYQTS"
FT   gene            complement(6947972..6950658)
FT                   /locus_tag="VIT_17s0000g05660"
FT                   /old_locus_tag="Vv17s0000g05660"
FT   mRNA            complement(join(6947972..6948220,6948325..6948438,
FT                   6949168..6949276,6949399..6949480,6949575..6949811,
FT                   6950089..6950197,6950286..6950420,6950530..6950658))
FT                   /locus_tag="VIT_17s0000g05660"
FT                   /old_locus_tag="Vv17s0000g05660"
FT                   /product="Polygalacturonase-like protein"
FT   CDS_pept        complement(join(6947972..6948220,6948325..6948438,
FT                   6949168..6949276,6949399..6949480,6949575..6949811,
FT                   6950089..6950197,6950286..6950420,6950530..6950658))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05660"
FT                   /old_locus_tag="Vv17s0000g05660"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SIG3"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:D7SIG3"
FT                   /protein_id="CBI15274.3"
FT                   /translation="MAFPRSTCLLLLLASFLLTPLEGHTFNVMDYGAIGNGRTDDSEAF
FT                   MKAWSDVCKASASPTFLVPGDRRFLINPVVFEGRCRSKKIKFKVDGTITAPSEPSKWKC
FT                   INKQCHSWISFKHVDGLVISDCMYSLTNLQALVVARSNNVQLHDLSFKDNPHMHVVFHH
FT                   CDGVKISHISIDAPEDSPNTDGIHLKETASVIIEHCTIGTGDDCISLVDGSTHIDMRHI
FT                   KCGPGHGISIGSLGKFGLSETVEYIHVKDAQFTGTTNGVRIKTWQGGRGHARNMIFEKI
FT                   RSSDSEYPIIIDQFYCDHTECHDKPNAVEIRNISYIDVKGTSKKETAVKIACSDTVPCR
FT                   DIFIQNINLIYDQSGKQASAYCKNVINGYYHGVVRPNISCLQNDKLP"
FT   gene            6952782..6953836
FT                   /locus_tag="VIT_17s0000g05650"
FT                   /old_locus_tag="Vv17s0000g05650"
FT   mRNA            join(6952782..6952847,6952848..6952985,6953227..6953670,
FT                   6953671..6953836)
FT                   /locus_tag="VIT_17s0000g05650"
FT                   /old_locus_tag="Vv17s0000g05650"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           6952782..6952847
FT                   /locus_tag="VIT_17s0000g05650"
FT                   /old_locus_tag="Vv17s0000g05650"
FT   CDS_pept        join(6952848..6952985,6953227..6953670)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05650"
FT                   /old_locus_tag="Vv17s0000g05650"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5C347"
FT                   /db_xref="InterPro:IPR009500"
FT                   /db_xref="UniProtKB/TrEMBL:A5C347"
FT                   /protein_id="CBI15275.3"
FT                   /translation="MAVTTASPAAFLRKLEHNLYPTKSRFRRDFPAKKPLRILAMASKK
FT                   KVNRYDENWKKEWFGAGIFVEGSEEVEVDVFKNLEKKKVLSNVEKSGLLSKAEELGFTL
FT                   SSIEKLGVFSKAEDLGLLSLLEKAASFSPSALASAALPIFVAAIAAIVLIPDDSAALIA
FT                   VQALIAGALVVGATGLVVGSVVLGGLQEAE"
FT   3'UTR           6953671..6953836
FT                   /locus_tag="VIT_17s0000g05650"
FT                   /old_locus_tag="Vv17s0000g05650"
FT   gene            complement(6953957..6956962)
FT                   /locus_tag="VIT_17s0000g05640"
FT                   /old_locus_tag="Vv17s0000g05640"
FT   mRNA            complement(join(6953957..6954072,6954073..6955044,
FT                   6955146..6955586,6956237..6956454,6956664..6956769,
FT                   6956867..6956962))
FT                   /locus_tag="VIT_17s0000g05640"
FT                   /old_locus_tag="Vv17s0000g05640"
FT                   /product="Predicted protein"
FT   3'UTR           complement(6953957..6954072)
FT                   /locus_tag="VIT_17s0000g05640"
FT                   /old_locus_tag="Vv17s0000g05640"
FT   CDS_pept        complement(join(6954073..6955044,6955146..6955586,
FT                   6956237..6956454,6956664..6956769,6956867..6956962))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05640"
FT                   /old_locus_tag="Vv17s0000g05640"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SIG5"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7SIG5"
FT                   /protein_id="CBI15276.3"
FT                   /translation="MTLSITSLSNSNNILAIKSSITRDPTQAGKEMDGEQQLSTWEGYV
FT                   DWRNRPAVKGRHGGMLAAFFVLVVEVLENLAYLANASNLVLYLSKFMHFSPSSSANIVT
FT                   NFMGTAFLLALLGGFLSDAFFSTYLIYLISAAIELVGLLILAIQAHVPSLKPPACDLGN
FT                   ISNPCREADGGKAGMLFAGLYLVALGVGGIKGSLPPHGAEQFDDNTPKGRKQRSTFFNY
FT                   YVFSLSCGALIAVTFVVWIEDNKGWQWGFGISTASILISIPIFLLGSATYRTKIPTGSP
FT                   ITTIVKVLVAAICNAYKLRNCSNSVMSMATSPSYTTEIGGKEESCSKEMVPRQAPTESL
FT                   KFLNNAVIDKPFHSALECTVKQVEEVKIVLRILPIFACTIMLNCCLAQLSTFSVQQAAT
FT                   MNTKLGTLKVPPASLPIFPVLFIMILAPTYNHIIIPFTRRTTKTEMGITHLQRIGTGLI
FT                   LSIVAMVVAAFVEIKRKRVAAESGLVHSSEPLPITFFWVALQYLFLGSADLFTLAGLME
FT                   FFFTEAPTSMRSLATALSWASLAMGYYLSSVLVSIVNSVTNSYSHHAWLFGNNLNHYHL
FT                   EKFYWLMCGLSGLNFLHYLLWASRYKYRTASPDN"
FT   gene            6965531..6967780
FT                   /locus_tag="VIT_17s0000g05630"
FT                   /old_locus_tag="Vv17s0000g05630"
FT   mRNA            join(6965531..6965852,6965853..6965964,6966600..6966994,
FT                   6967092..6967538,6967539..6967780)
FT                   /locus_tag="VIT_17s0000g05630"
FT                   /old_locus_tag="Vv17s0000g05630"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           6965531..6965852
FT                   /locus_tag="VIT_17s0000g05630"
FT                   /old_locus_tag="Vv17s0000g05630"
FT   CDS_pept        join(6965853..6965964,6966600..6966994,6967092..6967538)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05630"
FT                   /old_locus_tag="Vv17s0000g05630"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTA7"
FT                   /db_xref="InterPro:IPR000047"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR003106"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTA7"
FT                   /protein_id="CCB43116.1"
FT                   /translation="MASGRVNLAAMLQNQRVPCSSQPLDALFLSASSPSFLGSRSMLSF
FT                   EDVRAGKRPDNPFFCQFDHDENGDEDLDEYFHQPEKKRRLTADQVQFLERNFEVENKLE
FT                   PERKVQLAKDLGLQPRQVAIWFQNRRARWKTKQLEKDFGALQASYNSLKAEYENLLKEK
FT                   DELKTEVILLTDKLLVKEKERGNLEVSNTDTLSQELPQVVVADSVSEGEVSKVSLVVCK
FT                   QEDLSSTKSDVFDSDSPHYADGGHSALPEPGDSSYVFEADQSDVSQDEEDNFSKSLLPP
FT                   SYIFPKLEDVDYPDPPTNPCSFGFPVEDHAFWSWSY"
FT   3'UTR           6967539..6967780
FT                   /locus_tag="VIT_17s0000g05630"
FT                   /old_locus_tag="Vv17s0000g05630"
FT   gene            complement(6971233..6973819)
FT                   /locus_tag="VIT_17s0000g05620"
FT                   /old_locus_tag="Vv17s0000g05620"
FT   mRNA            complement(join(6971233..6971521,6971522..6971563,
FT                   6971825..6971931,6972015..6972162,6972837..6972970,
FT                   6973404..6973650,6973651..6973819))
FT                   /locus_tag="VIT_17s0000g05620"
FT                   /old_locus_tag="Vv17s0000g05620"
FT                   /product="Predicted protein"
FT   3'UTR           complement(6971233..6971521)
FT                   /locus_tag="VIT_17s0000g05620"
FT                   /old_locus_tag="Vv17s0000g05620"
FT   CDS_pept        complement(join(6971522..6971563,6971825..6971931,
FT                   6972015..6972162,6972837..6972970,6973404..6973650))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05620"
FT                   /old_locus_tag="Vv17s0000g05620"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SIG7"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:D7SIG7"
FT                   /protein_id="CBI15278.3"
FT                   /translation="MAQPPLSITCGSSNSLLFNGKKATLRLDGSLGLHFTSRKIDRRRR
FT                   DFGIVASSNVAAPFWDGWKPEKSSAAPSLSDILWPSAGAFAAMAILGKMDQTLASKGIS
FT                   MTIAPLGAVCAVLFATPSSPAARKYNMFMAQIGCAAIGVLAFSLLGPGWLARSTALGAS
FT                   IAFMIYTRSTHPPAASLPLLFIDGAKFHHLNFWYALFPGATACILLCLIQEMVCYLKQN
FT                   FKF"
FT   5'UTR           complement(6973651..6973819)
FT                   /locus_tag="VIT_17s0000g05620"
FT                   /old_locus_tag="Vv17s0000g05620"
FT   gene            complement(6975143..6976138)
FT                   /locus_tag="VIT_17s0000g05610"
FT                   /old_locus_tag="Vv17s0000g05610"
FT   mRNA            complement(join(6975143..6975336,6975337..6975516,
FT                   6975517..6976138))
FT                   /locus_tag="VIT_17s0000g05610"
FT                   /old_locus_tag="Vv17s0000g05610"
FT                   /product="At3g29250"
FT   3'UTR           complement(6975143..6975336)
FT                   /locus_tag="VIT_17s0000g05610"
FT                   /old_locus_tag="Vv17s0000g05610"
FT   CDS_pept        complement(6975337..6975516)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05610"
FT                   /old_locus_tag="Vv17s0000g05610"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTA8"
FT                   /protein_id="CCB43117.1"
FT                   /translation="MCKALEMEADEVEKVYEARTRLKGVLRARHVADAVLFLASDQSAF
FT                   VTGHDLSVDGGFST"
FT   5'UTR           complement(6975517..6976138)
FT                   /locus_tag="VIT_17s0000g05610"
FT                   /old_locus_tag="Vv17s0000g05610"
FT   gene            complement(6976808..6977952)
FT                   /locus_tag="VIT_17s0000g05600"
FT                   /old_locus_tag="Vv17s0000g05600"
FT   mRNA            complement(join(6976808..6976977,6976978..6977766,
FT                   6977767..6977952))
FT                   /locus_tag="VIT_17s0000g05600"
FT                   /old_locus_tag="Vv17s0000g05600"
FT                   /product="Predicted protein"
FT   3'UTR           complement(6976808..6976977)
FT                   /locus_tag="VIT_17s0000g05600"
FT                   /old_locus_tag="Vv17s0000g05600"
FT   CDS_pept        complement(6976978..6977766)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05600"
FT                   /old_locus_tag="Vv17s0000g05600"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTA9"
FT                   /protein_id="CCB43118.1"
FT                   /translation="MTDPTPFNKKLQGKVAIITGGASGIGEATARLFADHGARAVVVAD
FT                   IQDELGRGVAESIGLHRCRYIHCDVTDEQQIKAMVESTVKMFGQLDIMFSNAGVMSMGD
FT                   QTILELDLSASDKVFAVNARGMAACVKHAARAMVEGGVKGSIVCTASVAATVGNDKFTD
FT                   YIMSKHAVLGLVRSASKQLGAYGIRVNCVSPTAVATPMLCSAFKMGVEEAEKFFVEDMD
FT                   LKGRGAVQVRHVGDAALFLASDDSEFITGHNLAIDGGFRR"
FT   5'UTR           complement(6977767..6977952)
FT                   /locus_tag="VIT_17s0000g05600"
FT                   /old_locus_tag="Vv17s0000g05600"
FT   gene            complement(7012449..7020352)
FT                   /locus_tag="VIT_17s0000g05580"
FT                   /old_locus_tag="Vv17s0000g05580"
FT   mRNA            complement(join(7012449..7012597,7019672..7020047,
FT                   7020048..7020352))
FT                   /locus_tag="VIT_17s0000g05580"
FT                   /old_locus_tag="Vv17s0000g05580"
FT                   /product="Predicted protein"
FT   CDS_pept        complement(join(7012449..7012597,7019672..7020047))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05580"
FT                   /old_locus_tag="Vv17s0000g05580"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SIH0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7SIH0"
FT                   /protein_id="CBI15281.3"
FT                   /translation="MSVGMQDVLDFDLSAYDTLFAINVRGVAASVKHAARAMVEGKVKG
FT                   SIICTASVSASTGSDKFIDYVMSKMAVLGLVKSASRQLGAYGIRVNSVSPGAVATPLLC
FT                   DKFQMSATEVENNFEQYMSLKGLNMEKHLFLLFPKETFKTLKIAKNIKNALDNDSTPNI
FT                   FSRSTFRRITY"
FT   gap             7015846..7015945
FT                   /estimated_length=100
FT   5'UTR           complement(7020048..7020352)
FT                   /locus_tag="VIT_17s0000g05580"
FT                   /old_locus_tag="Vv17s0000g05580"
FT   gene            complement(7020594..7025904)
FT                   /locus_tag="VIT_17s0000g05570"
FT                   /old_locus_tag="Vv17s0000g05570"
FT   mRNA            complement(join(7020594..7020642,7020643..7020867,
FT                   7020951..7021084,7022644..7022901,7023407..7023739,
FT                   7023815..7023988,7024065..7024171,7024539..7024610,
FT                   7024726..7024797,7025003..7025074,7025166..7025237,
FT                   7025329..7025400,7025493..7025628,7025723..7025804,
FT                   7025805..7025904))
FT                   /locus_tag="VIT_17s0000g05570"
FT                   /old_locus_tag="Vv17s0000g05570"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(7020594..7020642)
FT                   /locus_tag="VIT_17s0000g05570"
FT                   /old_locus_tag="Vv17s0000g05570"
FT   CDS_pept        complement(join(7020643..7020867,7020951..7021084,
FT                   7022644..7022901,7023407..7023739,7023815..7023988,
FT                   7024065..7024171,7024539..7024610,7024726..7024797,
FT                   7025003..7025074,7025166..7025237,7025329..7025400,
FT                   7025493..7025628,7025723..7025804))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05570"
FT                   /old_locus_tag="Vv17s0000g05570"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTB0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013210"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR031071"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTB0"
FT                   /protein_id="CCB43119.1"
FT                   /translation="MGLWIWFFSAILGGTLLGPCCLALSEDGVTLLEIKSRLNDSRNFL
FT                   GNWRDSDEFPCKWTGVSCYHHDHRVRSINLPYMQLGGIISPSIGKLNKLQRLALHQNSL
FT                   HGSIPNEIANCAELRALYLRANYLQGGIPSDLGNLSYLTILDFSSNSLKGAIPSSLGRL
FT                   KRLRYLNLSTNFLSGEIPDVGVLSTFDNKSFIGNLDLCGQQVHKPCRTSLGFPAVLPHA
FT                   ESDEAAVPVKRSAHFTKGVLIGAMSTMALVLVMLLAFLWICFLSKKERASRKYTEVKKQ
FT                   VHQEPSTKLITFHGDLPYPSCEIIEKLEALDEEDVVGSGGFGTVYRMVMNDCGTFAVKR
FT                   IDRSREGSDKVFERELEILGSIKHINLVNLRGYCRLPTSKLLIYDYLALGSLDDFLHEH
FT                   GGQDERSLNWSARLNIALGSARGLAYLHHDCSPRIVHRDIKSSNILLDENLEPHVSDFG
FT                   LAKLLVDEDAHITTVVAGTFGYLAPEYLQSGRATEKSDVYSFGVLLLELVTGKRPTDPT
FT                   FVKRGLNVVGWMNTLLKENRLEDVVDKRCRDAEVETVEAILDIAGRCTDANPDDRPSMS
FT                   QVLQLLEQEVMSPCPSDFYESHSDYC"
FT   5'UTR           complement(7025805..7025904)
FT                   /locus_tag="VIT_17s0000g05570"
FT                   /old_locus_tag="Vv17s0000g05570"
FT   gene            7031331..7034079
FT                   /locus_tag="VIT_17s0000g05560"
FT                   /old_locus_tag="Vv17s0000g05560"
FT   mRNA            join(7031331..7031370,7034072..7034079)
FT                   /locus_tag="VIT_17s0000g05560"
FT                   /old_locus_tag="Vv17s0000g05560"
FT   CDS_pept        join(7031331..7031370,7034072..7034079)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05560"
FT                   /old_locus_tag="Vv17s0000g05560"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTB1"
FT                   /protein_id="CCB43120.1"
FT                   /translation="MEAHESFEKSASTRT"
FT   gene            7038451..7050073
FT                   /locus_tag="VIT_17s0000g05550"
FT                   /old_locus_tag="Vv17s0000g05550"
FT   mRNA            join(7038451..7038468,7038469..7038550,7038658..7038875,
FT                   7039016..7039575,7039765..7040551,7043758..7043890,
FT                   7043965..7044182,7044368..7044927,7045229..7045680,
FT                   7045714..7046123,7047648..7047753,7047868..7048085,
FT                   7048386..7048939,7049037..7049883,7049884..7050073)
FT                   /locus_tag="VIT_17s0000g05550"
FT                   /old_locus_tag="Vv17s0000g05550"
FT                   /product="unknown predicted protein"
FT   5'UTR           7038451..7038468
FT                   /locus_tag="VIT_17s0000g05550"
FT                   /old_locus_tag="Vv17s0000g05550"
FT   CDS_pept        join(7038469..7038550,7038658..7038875,7039016..7039575,
FT                   7039765..7040551,7043758..7043890,7043965..7044182,
FT                   7044368..7044927,7045229..7045680,7045714..7046123,
FT                   7047648..7047753,7047868..7048085,7048386..7048939,
FT                   7049037..7049883)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05550"
FT                   /old_locus_tag="Vv17s0000g05550"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTB2"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTB2"
FT                   /protein_id="CCB43121.1"
FT                   /translation="MENNEKVVATDEPKTKHRGIKAMPFVIGNETFEKLGTIGTSTNLL
FT                   VYLTTVFNMKSITATTFVNVFNGSTNFATLIGAFLCDTYFGRYTTLGFASISSFLGMLV
FT                   ITLTAAVQKMHPPHCGTTDTGTCIGPTAGQMAFLLSGFGLLVIGAAGIRPCNLAFGADQ
FT                   FNPETESGKRGISSFFNWYYFTYTFAMMVSLTVIVYVQSDVSWSLGLAIPTLLMLLSCA
FT                   LFFMGTRIYVKVKPEGSPLKNVAQVIVAAVKKRRLELPGQPWLSLFNHIPANSINSKLP
FT                   HTDQFRFLSKGAILTPEVQINSDGSAANPWRLSSMQKVEEVKCVIRVIPIWAAGIIYYV
FT                   ALVQQSTYVVFQALQSDRRLGSTGFKIPAASYTVFTMLSLTIWIPIYDQIIVPLLRRLT
FT                   GKEVGITLLQKMGIGMVLAVITMILSALVEERRRTLALTKATVGIEARRGAISSLSGMW
FT                   LVPQLTLIGISEGLTIIGQVEFFYKQFPENMRSFAGAFLFCGIAFSNYLSSFLVSIVHQ
FT                   STGGTATGNWLPEDLNKGRLDYFYYLVAALGMGSTLSSPLERGSLLWATMEKNEKAGTA
FT                   DEPNFEYRGLKAMPFIIGNETFENLGTVGTSSNLLVYLTAVFNMKSITAVTLINIFYGT
FT                   TNLGTLVGAFLCDTYFGRYKTLGFATVASFMGMLVITLTALISKLHPPHCEIEQTGTCI
FT                   GPTSWQIAFLLLGFGLLVIGASGIRPCNLAFGADQFNPITESGKRGLSSFFNWWYFTGT
FT                   VAMMISLTLVIYVQSDVSWALGLAIPTFLMLLACVLFFMGTRIYVKLEPKGSPLKSVVQ
FT                   VIVAAARKRQLKLPEQPWLTLFSHVPSNSINSKLPYTDQFRFLDKGAIITPEDQINSEG
FT                   LAADPWRLSSIQQVEEVKCLMRVIPIWASAIIYYVALAQQQTYTVFQSLQSDRHLGHSN
FT                   FKIPAASYSIFSMLGLIIWIPIYDRIMVPLLQRFTGKEGGITVLQKMGVGMFLSIVTML
FT                   VSAFVEHQRRTLALCAISSMSGLWFIPQLTLVGVSEAFTVIAQVEFFYKQFPESMRSVG
FT                   GSFSFLGVAVSSYLSSFLVSTVHRMTAGAASGNWLPEDLNKGRLDYFYYLVAALGVINL
FT                   GYFLLCAKWYKYKGSACSTQEVPMERVESEKPLRISSLRETMEKNEEIDTADEPEVNYR
FT                   GVKAMPYIIGNETFEKLGAIGTLSNLLLYVTVVFNMKSITATTLINIFNGTTNFATLPG
FT                   AFLSDTYFGRYKTLGFASISSFMGLLVIALTAAIPNLHPPECGKASRCIGATAWQMAFL
FT                   LTGFGLLVIGAGGIRPCNLAFGADQFNPKTESGKRGIDSFFNWYFFTLTFAQMVSLTAI
FT                   VYVQSKVSWGIGLGIPALLMLLSCVVFFMGTKIYVKVKPTGSPMTSVAQVIVVAVKKRR
FT                   LKLPEQPWLSLFSYIPPNSINSKLPYTDQFRFLDKAAVLSPEDQLNPDGSAAYPWRLCS
FT                   MQQVEEVKCIMRVIPIWSSAIIYHCAIVQQHTYAVFQALQSNRYVGNSKFQIPAASYTV
FT                   FSMLSLTIWVPIYDRIVVPFLRRITGKEAGITILQRIGIGIFLSVLTSLVSALVEEWRR
FT                   TRPIIGVYPRRGGISSMSGFWLIPQLTLAGLAEAFTAIGQVEFYYKQFPENMRSIAGSF
FT                   FFCGMAASSYVSGLLVSIVHRTTAGAKTGNWLPEDLNKGRLDYFYYLVASLGVINLGYF
FT                   LVCAKWYTYKGSYQQHP"
FT   3'UTR           7049884..7050073
FT                   /locus_tag="VIT_17s0000g05550"
FT                   /old_locus_tag="Vv17s0000g05550"
FT   gene            complement(7051436..7059096)
FT                   /locus_tag="VIT_17s0000g05540"
FT                   /old_locus_tag="Vv17s0000g05540"
FT   mRNA            complement(join(7051436..7051762,7051763..7051859,
FT                   7052061..7052239,7052329..7052511,7052598..7052783,
FT                   7053299..7053459,7054122..7054203,7054403..7054435,
FT                   7054639..7054877,7055036..7055200,7056257..7056401,
FT                   7056503..7056607,7056694..7056816,7056902..7057021,
FT                   7057114..7057233,7057312..7057518,7057620..7057799,
FT                   7057882..7058016,7058167..7058304,7058438..7058536,
FT                   7058615..7058734,7058845..7058898,7058899..7059096))
FT                   /locus_tag="VIT_17s0000g05540"
FT                   /old_locus_tag="Vv17s0000g05540"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(7051436..7051762)
FT                   /locus_tag="VIT_17s0000g05540"
FT                   /old_locus_tag="Vv17s0000g05540"
FT   CDS_pept        complement(join(7051763..7051859,7052061..7052239,
FT                   7052329..7052511,7052598..7052783,7053299..7053459,
FT                   7054122..7054203,7054403..7054435,7054639..7054877,
FT                   7055036..7055200,7056257..7056401,7056503..7056607,
FT                   7056694..7056816,7056902..7057021,7057114..7057233,
FT                   7057312..7057518,7057620..7057799,7057882..7058016,
FT                   7058167..7058304,7058438..7058536,7058615..7058734,
FT                   7058845..7058898))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05540"
FT                   /old_locus_tag="Vv17s0000g05540"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SIH5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006534"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D7SIH5"
FT                   /protein_id="CBI15286.3"
FT                   /translation="MADKPEVLEAVLKETVDLENIPIEEVFENLRCSREGLTSEAAQER
FT                   LAIFGYNRLEEKKESKFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGII
FT                   TLLLINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSEEDAAVLVPGDIISIKLG
FT                   DIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHT
FT                   FFGKAAHLVDTTNQVGHFQKVLTAIGNFCICSIAVGMIIEIIVMYPIQDRDYRPGIDNL
FT                   LVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTL
FT                   NKLTVDKNLIEVFAKGVDPDTVVLMAARASRIENQDAIDTAIVGMLADPKEARAGIQEV
FT                   HFLPFNPTDKRTALTYIDSEGKMHRVSKGAPEQILNLARNKSEIERRVHAVIDKFAERG
FT                   LRSLAVAYQEVPDGRKESAGGPWQFIGLMPLFDPPRHDSAETIRRALNLGVNVKMITGD
FT                   QLAIGKETGRRLGMGTNMYPSSALLGQNKDESIAALPIDELIEKADGFAGVFPEHKYEI
FT                   VKRLQARKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDIVLTEPGLSVIISA
FT                   VLTSRAIFQRMKNYTIYAVSITIRIVLGFMLLALIWEFDFPPFMVLIIAILNDGTIMTI
FT                   SKDRVKPSPLPDSWKLAEIFTTGIVLGSYLAMMTVIFFWAAYKTDFFPRVFHVSTLEKT
FT                   AHDDFRKLASAIYLQVSTVSQALIFVTRSRSWSYVERPGLLLVGAFLVAQLVATLIAVY
FT                   ANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDFIKFIIRYALSGRAWDLVIEQRIAFTRQ
FT                   KDFGKEARELKWAHAQRTLHGLQPPDTKMFTDRTNFTELNQMAEEAKRRAEIARLRELH
FT                   TLKGHVESVVRLKGLDINTIPQAYTV"
FT   5'UTR           complement(7058899..7059096)
FT                   /locus_tag="VIT_17s0000g05540"
FT                   /old_locus_tag="Vv17s0000g05540"
FT   gene            complement(7072548..7079948)
FT                   /locus_tag="VIT_17s0000g05530"
FT                   /old_locus_tag="Vv17s0000g05530"
FT   mRNA            complement(join(7072548..7072945,7072946..7073393,
FT                   7079020..7079601,7079929..7079948))
FT                   /locus_tag="VIT_17s0000g05530"
FT                   /old_locus_tag="Vv17s0000g05530"
FT                   /product="Predicted protein"
FT   3'UTR           complement(7072548..7072945)
FT                   /locus_tag="VIT_17s0000g05530"
FT                   /old_locus_tag="Vv17s0000g05530"
FT   CDS_pept        complement(join(7072946..7073393,7079020..7079601,
FT                   7079929..7079948))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05530"
FT                   /old_locus_tag="Vv17s0000g05530"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTB3"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTB3"
FT                   /protein_id="CCB43122.1"
FT                   /translation="MPAHLIMEKEMGVDYYNILKVNRNASEDDLRRAYRRLAMIWHPDK
FT                   NPSNKREAEAKFKQISEAYDVLSDPQKRQIYDLYGEEALKSGQVPPPPASTRGGPQHHN
FT                   HHPNPSFRFNPRDADDIYEEFFGPDGSGTGAGGGGGGRNRVYKDGFFRTSNGDYGSQAL
FT                   RKAAPVENLLPCSLEELYKGAKKKMKISRTISDAFGYGKIRTVEEILSIDIKPGWKKGT
FT                   KITFPEKGNQEPGVIPADLIFVVDEKPHLVFKRDGNDLIVDREITLLEALTGKALELKT
FT                   LDGRSLEIQLTDIVKPGYEMVVPNEGMPISKEPSRKGNLRIKFDVNYPSRLTSEQKSDL
FT                   KRVLGGSSS"
FT   gene            complement(7080330..7089010)
FT                   /locus_tag="VIT_17s0000g05520"
FT                   /old_locus_tag="Vv17s0000g05520"
FT   mRNA            complement(join(7080330..7080738,7080739..7080912,
FT                   7081034..7081264,7086641..7086808,7086925..7087040,
FT                   7088062..7088214,7088304..7088447,7088533..7088842,
FT                   7088843..7089010))
FT                   /locus_tag="VIT_17s0000g05520"
FT                   /old_locus_tag="Vv17s0000g05520"
FT                   /product="Calcium dependent protein kinase 10"
FT   3'UTR           complement(7080330..7080738)
FT                   /locus_tag="VIT_17s0000g05520"
FT                   /old_locus_tag="Vv17s0000g05520"
FT   CDS_pept        complement(join(7080739..7080912,7081034..7081264,
FT                   7086641..7086808,7086925..7087040,7088062..7088214,
FT                   7088304..7088447,7088533..7088842))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05520"
FT                   /old_locus_tag="Vv17s0000g05520"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTB4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTB4"
FT                   /protein_id="CCB43123.1"
FT                   /translation="MSSLPDHPNIVKLKATYEDSEAVHLVMELCEGGELFDRIVARGHY
FT                   SERAAAGVARTIAEVVRMCHENGVIHRDLKPENFLFANKRESSPLKAIDFGLSVFFRPG
FT                   ERFSEIVGSPYYMAPEVLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVALAILR
FT                   GVIDFKREPWPQISDNAKSLVRQMLEQDPRKRLTAQQVLEHSWLQNAKKAPNVPLGDIV
FT                   RTRLKQFSCMNRFKKKAMRVIAEHLSVEEVEVIRDMFTLMDTDNDGKVTYEELKAGLRK
FT                   VGSQLGEPEIKLLMEVADVDGNGVLDYGEFVAVTIHLQRMENDEHFQRAFMFFDKDGNG
FT                   FIDLIELQEALADESGETDADVVNEIMREVDTDKDGRINYDEFVAMMKTGTDWRKASRQ
FT                   YSRERFKSLSLNLMKDGSLHLEDRITGQSIAV"
FT   5'UTR           complement(7088843..7089010)
FT                   /locus_tag="VIT_17s0000g05520"
FT                   /old_locus_tag="Vv17s0000g05520"
FT   gene            7096308..7101436
FT                   /locus_tag="VIT_17s0000g05510"
FT                   /old_locus_tag="Vv17s0000g05510"
FT   mRNA            join(7096308..7096352,7098583..7101234,7101235..7101436)
FT                   /locus_tag="VIT_17s0000g05510"
FT                   /old_locus_tag="Vv17s0000g05510"
FT                   /product="unknown predicted protein"
FT   CDS_pept        join(7096308..7096352,7098583..7101234)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05510"
FT                   /old_locus_tag="Vv17s0000g05510"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTB5"
FT                   /protein_id="CCB43124.1"
FT                   /translation="MLMFFSYYFEGVELGKVLLYLQIMLRTKQIGPLSNSARSILISGT
FT                   RSSTPDGNSCPCSEDETCVSTKQHARNEVLIMQKQTTLASKTAARVGPLFLGDAVKVVG
FT                   SQKVESVEHATSLAQVVAAPRSVVGSDCVSYVSDNVGVNNDAVHAPPISDQFIRAGIVA
FT                   VNFLSDLVNYKIPMSDGSGMLKLPQNCMVDPTKPLSKIKSTNIKPIRKGKFSKVRAESS
FT                   ANIAAASNSTSSYHSTRGKGDKSGSVKGCSHVGDTWTRNTVDTRSLSSDTHNKRSMPQK
FT                   SKAYSNYSTSNSNFNSNVRNSEPRFVGGIAGGFSKPLRDTKMIGIAPVSRQFGSSGHVV
FT                   ENVSRILRQLSWGPAAEEALRNLNCLMDAYQANQVLKQIQDHPVALGFFYWLKRQTGFK
FT                   HDGHTYTTMVGILGRARQFGAINKLLAEMVRDGCQPNVVTYNRLIHSYGRANYLNEAVS
FT                   VFDRMQEAGCQPDRVTYCTLIDIHAKAGFLDVALHMYQKMQEAHLSPDTFTYSVIINCL
FT                   GKAGHLTSAHKLFCEMVDQGCVPNLVTYNIMIALQAKARNYPTALELYRDMQNAGFQPD
FT                   KVTYSIVMEVLGHCGHLEEAEAIFTEMKRKNWVPDEPVYGLLVDLWGKVGNVEKSWEWY
FT                   QAMLNAGLCPNVPTCNSLLSAFLRVHRLSDAYNLLQSMLRLGLQPSLQTYTLLLSCCTE
FT                   ARSSFDMGFCGELMAVTGHPAHMFLLSMPAAGPDGQNVRDHVSKFLDLMHSEDRESKRG
FT                   LVDAVVDFLHKSGLKEEAGSVWEVAAQKNVYPDAVREKSSCYWLINLHFMSDGTAVTAL
FT                   SRTLAWFHREMLVSGTVPSRIDIVTGWGRRSRVTGASLVRQAVQELLHIFSFPFFTENG
FT                   NSGCFVGRGEPLGRWLLQSYVERMHLL"
FT   3'UTR           7101235..7101436
FT                   /locus_tag="VIT_17s0000g05510"
FT                   /old_locus_tag="Vv17s0000g05510"
FT   gene            7102467..7113286
FT                   /locus_tag="VIT_17s0000g05500"
FT                   /old_locus_tag="Vv17s0000g05500"
FT   mRNA            join(7102467..7102503,7102504..7105020,7105106..7105234,
FT                   7105326..7105517,7105617..7105669,7105789..7106104,
FT                   7106331..7106472,7106555..7106758,7109494..7109607,
FT                   7110062..7110258,7110368..7110583,7110716..7110991,
FT                   7111130..7111277,7111355..7111488,7112308..7112394,
FT                   7112492..7112578,7112579..7113286)
FT                   /locus_tag="VIT_17s0000g05500"
FT                   /old_locus_tag="Vv17s0000g05500"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           7102467..7102503
FT                   /locus_tag="VIT_17s0000g05500"
FT                   /old_locus_tag="Vv17s0000g05500"
FT   CDS_pept        join(7102504..7105020,7105106..7105234,7105326..7105517,
FT                   7105617..7105669,7105789..7106104,7106331..7106472,
FT                   7106555..7106758,7109494..7109607,7110062..7110258,
FT                   7110368..7110583,7110716..7110991,7111130..7111277,
FT                   7111355..7111488,7112308..7112394,7112492..7112578)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05500"
FT                   /old_locus_tag="Vv17s0000g05500"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTB6"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR006865"
FT                   /db_xref="InterPro:IPR006866"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTB6"
FT                   /protein_id="CCB43125.1"
FT                   /translation="MVTGVESEGSAYSAIKLECERSLTALRRGNHNKALRIMKELSVRH
FT                   DNSVHSALIHRVQGTVCVKVASIIDDPNAKQRHLKNAIETAKKAVELSPNSIEFAHFYA
FT                   NLLYEAASEGKEYEEVVHECERALSIDSPVDPAKESLQDESQQKISTVEARIGHVQNEL
FT                   RSLIQKSNIASISTWMKNLGNGEEKFRLIPIRRVSEDPMEVRLVQSKRPNEIKKATKTQ
FT                   EERRKEIEVRVAAARLLQQKSDAPQSQSEGDRTDKASETSSGPGQRVGERRKNARKFGS
FT                   TVERKVRVRSYWNSMSFNMRKDLLKIRISDLKAHFSSVKDGLASGVLSEALSFVEVNKV
FT                   WKFWVCCRCGEKFKDSELHMQHVVQEHMGNLLPKMQSVLPQNIDNEWIEMIVNCSWKPL
FT                   DISAAVKMLKNESKCQQNELIDEFYTGNNTEECIDCFKDAWESSPEKGMLGDGCSCGNL
FT                   VKSDSDKIPNQGSRECDGNEGSKAYLLANSWPLADDSERAKLLEKIHVLFEMLIKHKCL
FT                   AGSHLSKVMQFTTDELQGIASGSQLLNYGVDQTPTCICFLGASQLRKLLKFLQELSHAC
FT                   GLARSSDKTSSAMDDANSLNRDFDIKENVLLNGDASCLLLDEHLLPTENTSTASHVAVT
FT                   DDAATETSPIICNENGVQPDGGSLLSWIFTGPSSVEQLASWMRIREEKSNQGMEILQML
FT                   EKEFYHLQSLCERKCEHLSYEEALQAVEDLCLEEGKKRENVTDFGSRSLESVLRKRREE
FT                   LRESENEVMLISNRFELDAVINVLKEAESLNMNQFGYEEHYNGVTSHLCDLESGEDDDW
FT                   RSKDFLHQMDACIEVAIQRQKEQLSVELSKIDARIMRNVTGMQQLELTLEPVSAFDYRS
FT                   IILPLLKSFMRAHLEDLAEKDATQKSDAAREAFLAELALDSKKSAIGGSDNSRHNHDKT
FT                   KEKKKGKEYRKMKDSKGTGGSEQHVLHHVTTEQDSSPVASDGEHPDSEPVVSVNDDNSK
FT                   HQEEELRRKIELEAEERKLEETLEYQRRIENEAKQKHLAEQRKKTTGIIPEKVVTGFSG
FT                   GYLNPSADEHDAHEQLEHFKQKSQFPNSFDGMPRDVMDGTTVLIDSITSSANQRLRSTP
FT                   SQYHAKVEQGLPNGGSPVDGVLLSERRIGRKTKRQKNSTKLIDGKYQAVSSGKENVEVG
FT                   ISHIEDRVKEQIKIHGSGVNLHLGDNGTKTLRQLQAEEDDEERFQADLKQAVRQSLDAY
FT                   QAHQKLPLVSSLRMPQRMSHEVDDVGLSPDDVVIKNMSGADMLGTGLKNEVGEYNCFLN
FT                   VIIQSLWHLRRFRNEFLGRSTSEHVHVGDPCVVCALYEIFTALSVASTDTRREAVAPSA
FT                   LRIALSNLYPDSNFFQEAQMNDASEVLGVIFDCLHRSFTSSSSISDTESVESNCMGSWD
FT                   CANSICLAHSLFGMDIFERMNCYNCSLESRHLKYTSFFHNINASALRTMKVMCAESSFD
FT                   ELLNLVEMNHQLACDPEAGGCGKFNYIHHILSTPPHVFTIVLGWQNTCESADDITATLA
FT                   ALNTEIDVSVLYRGLDPKNRYCLVSVVCYYGQHYHCFAYSHEHERWVMYDDKTVKVIGS
FT                   WDNVLTMCERGHLQPQVLFFEAVN"
FT   3'UTR           7112579..7113286
FT                   /locus_tag="VIT_17s0000g05500"
FT                   /old_locus_tag="Vv17s0000g05500"
FT   gene            7114735..7115919
FT                   /locus_tag="VIT_17s0000g05490"
FT                   /old_locus_tag="Vv17s0000g05490"
FT   mRNA            join(7114735..7114737,7114738..7115537,7115635..7115740,
FT                   7115741..7115919)
FT                   /locus_tag="VIT_17s0000g05490"
FT                   /old_locus_tag="Vv17s0000g05490"
FT                   /product="unknown predicted protein"
FT   5'UTR           7114735..7114737
FT                   /locus_tag="VIT_17s0000g05490"
FT                   /old_locus_tag="Vv17s0000g05490"
FT   CDS_pept        join(7114738..7115537,7115635..7115740)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05490"
FT                   /old_locus_tag="Vv17s0000g05490"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SII0"
FT                   /db_xref="InterPro:IPR004883"
FT                   /db_xref="UniProtKB/TrEMBL:D7SII0"
FT                   /protein_id="CBI15291.3"
FT                   /translation="MTLKGGTSQACAACKYQRRKCSSECPLAPYFPPDQPKMFADAHRL
FT                   FGVSNILKILKQLDPTQKLTAMQSIIYQATIRERYPVSGCLGLICQLHYQIRQTEDELH
FT                   VVLSQLEICRQHHHQQIQMASAPSDSSSSPLELGCSALSLHHNPPPPPPEYNAVSVAGG
FT                   GDGGLPVGVGTHHPYSPTTNAPFNFDFLDPKDNSLNPVWPQNSFSITNNNDVHNSLTIQ
FT                   PQPVATQPLPLQPQAAQDYDEIHPFFDTFDDRQSYVDSKEAYESSSESSFKDATQSTDN
FT                   VAENELKSAAACFSLISLGQ"
FT   3'UTR           7115741..7115919
FT                   /locus_tag="VIT_17s0000g05490"
FT                   /old_locus_tag="Vv17s0000g05490"
FT   gene            complement(7120800..7132869)
FT                   /locus_tag="VIT_17s0000g05480"
FT                   /old_locus_tag="Vv17s0000g05480"
FT   mRNA            complement(join(7120800..7120944,7120945..7121046,
FT                   7121138..7121209,7122771..7122830,7122923..7123157,
FT                   7125830..7125967,7126049..7126267,7126850..7128576,
FT                   7128728..7128959,7129102..7129448,7129526..7129720,
FT                   7130117..7130335,7132460..7132780,7132781..7132869))
FT                   /locus_tag="VIT_17s0000g05480"
FT                   /old_locus_tag="Vv17s0000g05480"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(7120800..7120944)
FT                   /locus_tag="VIT_17s0000g05480"
FT                   /old_locus_tag="Vv17s0000g05480"
FT   CDS_pept        complement(join(7120945..7121046,7121138..7121209,
FT                   7122771..7122830,7122923..7123157,7125830..7125967,
FT                   7126049..7126267,7126850..7128576,7128728..7128959,
FT                   7129102..7129448,7129526..7129720,7130117..7130335,
FT                   7132460..7132780))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05480"
FT                   /old_locus_tag="Vv17s0000g05480"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTB7"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR008913"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017921"
FT                   /db_xref="InterPro:IPR037274"
FT                   /db_xref="InterPro:IPR037275"
FT                   /db_xref="InterPro:IPR039512"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTB7"
FT                   /protein_id="CCB43126.1"
FT                   /translation="MGGDDGGGGGCGVSPELASQTEAEAAAQPLEPLCRSVSGAQLRDA
FT                   PILLFVFFHKALRAELAELRRLAAAESGCRGGSSNGNLVVEIRRRFEFLKLFYKYHSAA
FT                   EDEVIFLALDVHIKNVAHTYSLEHKSIDDLFSSIFHCLDVLMEGDANTAKPFQELVLLI
FT                   STIQTTICHHMLKEEEQVFPLLMKQFSPQEQASLVWQFMCSVPVLLLEDFLPWMTSFLS
FT                   PEEQVNVVNCIKEVVPEEKLLEEVVISWLGNNNQPFGSPTRIGEEAQSVGPANLKDALK
FT                   VYSSKSFSTEIRQWKEVFGLKTNVGQNPVDGLHLWHGAIRKDLKGILEELYQIRSSDSF
FT                   STLASVIVQLKFLADVLIFYSNALDKIFYPLLDLLSDGCLSPSYKRFPDESQIEGLQRL
FT                   LHYNAKNGIPLSKFVEKLCWELESFVMGIGDHLVFQEMEVFPLISAKCSHELQKWLLYM
FT                   SLLMMPLGLLKCVITWFLAHLSEEESKSILKSIKQEDSLVNMSFASLLHEWVRIGYSGK
FT                   TSVEKFRKDLQEMFKSRSSFHSDQIEEDGRSFFSPSDAKPCERSNPGLMKPIPGNKATH
FT                   SVNDSSSSGSHTSEKYGTSYSSGINLHIFFPGTLKIFHPVPNFPDGMGDASSILNLEPR
FT                   PVDLIFFFHKALKKDLEFLVFGSAKLAENTGYLADFHRRFRLIRFLYQIHSDAEDEIAF
FT                   PALEAKGKGQNISHSYTIDHKLEVEHFNKLSFILDEMSKLHISVSGVHFDKMDQRMLKY
FT                   HQLCMKLHDMCQSLQKILCDHVNHEEIELWPLFRECFSNKEQEKIIGSILGRMRAEILQ
FT                   EIIPWLMASLTPKEQHAMMSLWRKATKNTMFEEWLGEWWDGVNQYDIAKVVEESKMPQP
FT                   WLADPLEVVSRYLYKEDTGEEVSEKSDEFLLNDSVSANIMLPGNHAVDNKEKLLNEDHD
FT                   NHQCSECKKPYSENEKKRSNEVADVTNQVNRPGQLLQDNQQFSHQEHLLSMSQDDLEAA
FT                   IRRVSRDSSLDPQKKSHIIQNLLMSRWIVRQQKSHSEVAVLGSGKEIPGQCPSYRDPLK
FT                   LTFGCKHYKRNCKLVAACCNQLYACRLCHDDVTDHSMDRKKTTKMMCMRCLVIQPVGPT
FT                   CSTASCDNLSMAKYYCRICKFFDDEREIYHCPYCNLCRVGKGLGIDYFHCMNCNACMSR
FT                   SLSVHICREKWMEDNCPICHEFIFTSSSPVKALPCGHLMHSACFQDYTCTHYTCPICSK
FT                   SLGDMQVYFGMLDALLAEEKIPDEYSTQTQMILCNDCEKRGTAAFHWLYHKCPYCGSYN
FT                   TRVI"
FT   5'UTR           complement(7132781..7132869)
FT                   /locus_tag="VIT_17s0000g05480"
FT                   /old_locus_tag="Vv17s0000g05480"
FT   gene            7140400..7142853
FT                   /locus_tag="VIT_17s0000g05470"
FT                   /old_locus_tag="Vv17s0000g05470"
FT   mRNA            join(7140400..7140404,7140405..7140602,7140645..7140899,
FT                   7141441..7142625,7142626..7142853)
FT                   /locus_tag="VIT_17s0000g05470"
FT                   /old_locus_tag="Vv17s0000g05470"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           7140400..7140404
FT                   /locus_tag="VIT_17s0000g05470"
FT                   /old_locus_tag="Vv17s0000g05470"
FT   CDS_pept        join(7140405..7140602,7140645..7140899,7141441..7142625)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05470"
FT                   /old_locus_tag="Vv17s0000g05470"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTB8"
FT                   /db_xref="InterPro:IPR010658"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTB8"
FT                   /protein_id="CCB43127.1"
FT                   /translation="MLSSKWITTVASIWIQCTCGGSYAFGVYSSVLKSSQSYDQATLDT
FT                   VSVFKDIGANAGVLSGLLYSAASSVSYLLSFGGPWVVHVAGAIQCFAGYFLIWLSVTGV
FT                   IHRPAVPLMCLFMFIAAHAQTFFNTANVVTAVQNFPDYGGTIVGIMKGFLGLSGAVLIQ
FT                   VYDALFEGNPSIFILMLALLPTFISLLLMCLVRIDERDTQGNKKQLNRFSTVALLVAAY
FT                   LMIVIILENIFTFPLWARIATLILLLLLLASPLGIAANALKDESEISSQGLVSSERSPL
FT                   LSDNGSLQSERWSSAAGDPKEHHAADEDTPMLQDEEDLNVVQAMRTGNFWLLFIAMACG
FT                   MGSGLATINNISQIGESLGYTTVEINTLVSLWSIWNFLGRFGAGYVSDILLHRRGWARP
FT                   LLMVITLATMTIGHVIIASGFAGNLYVGSVIVGVCYGSQWSLMPTITSELFGVGHMGTI
FT                   FNTIAIASPVGSYLLSVRVIGYIYDKEASGKQNSCSGTHCFMLSFLIIGCVTLFGSLVA
FT                   SALFFRTKRFYKLVVLRRLNLSLQDDDR"
FT   3'UTR           7142626..7142853
FT                   /locus_tag="VIT_17s0000g05470"
FT                   /old_locus_tag="Vv17s0000g05470"
FT   gene            7143124..7145504
FT                   /locus_tag="VIT_17s0000g05460"
FT                   /old_locus_tag="Vv17s0000g05460"
FT   mRNA            join(7143124..7143141,7143142..7143615,7144247..7145443,
FT                   7145444..7145504)
FT                   /locus_tag="VIT_17s0000g05460"
FT                   /old_locus_tag="Vv17s0000g05460"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           7143124..7143141
FT                   /locus_tag="VIT_17s0000g05460"
FT                   /old_locus_tag="Vv17s0000g05460"
FT   CDS_pept        join(7143142..7143615,7144247..7145443)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05460"
FT                   /old_locus_tag="Vv17s0000g05460"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTB9"
FT                   /db_xref="InterPro:IPR010658"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTB9"
FT                   /protein_id="CCB43128.1"
FT                   /translation="MERIQSKWIATLASIWIQCSSGSLYTFSIFSSALKSSQGYDQSTL
FT                   DTVSVVKDVGATAGVLSGFLYSAVAVPHRSRRSSSCFLRGPWVVIAVGAIQCFAGYFFL
FT                   WLSVAGAIPRQPVPLMCLFMFLTAHAQTFFNTANVVTAVHNFPDFSGTVVGIMKGFLGL
FT                   SGAILIQLYQAIFKGNPASYLLMLMLVTTVNPLLLMCLVRIYNTKEGDEKKHLNGFSLV
FT                   ALVVAGYLMALIILENILTLQFPARLFTLVLLLLLLAMPLAVTIKAQQSNFDGTSQTFL
FT                   IEKNQLIDDPKQLDAEKIGKGQDPAGYHLVHSDAEQERNNDDNRVLLQGENLNLLQAMG
FT                   TCNFWCLFLAMACGMGSGLATVNNIGQIGGAFGYKSFETSTLVSLWSIWNFLGRFGTGY
FT                   VSDYFLHTRGWARPVFMVITLATMSIGHFVIASGMPGALYAGSVLVGVSYGSQWSLMPT
FT                   ITSEIFGVQHLGTIFNTITMASPVGSYIFSVRVVGYIYDKEASADGNKCTGTHCFMVSF
FT                   LIMASATLLGCFVALILFLRTKSFYNQVVLRRLQHPGRV"
FT   3'UTR           7145444..7145504
FT                   /locus_tag="VIT_17s0000g05460"
FT                   /old_locus_tag="Vv17s0000g05460"
FT   gene            7151555..7163148
FT                   /locus_tag="VIT_17s0000g05450"
FT                   /old_locus_tag="Vv17s0000g05450"
FT   mRNA            join(7151555..7151558,7151559..7151636,7152349..7152442,
FT                   7159024..7159109,7160701..7160750,7160853..7160922,
FT                   7161007..7161088,7161167..7161588,7161869..7162366,
FT                   7162596..7162817,7162818..7163148)
FT                   /locus_tag="VIT_17s0000g05450"
FT                   /old_locus_tag="Vv17s0000g05450"
FT                   /product="unknown predicted protein"
FT   5'UTR           7151555..7151558
FT                   /locus_tag="VIT_17s0000g05450"
FT                   /old_locus_tag="Vv17s0000g05450"
FT   CDS_pept        join(7151559..7151636,7152349..7152442,7159024..7159109,
FT                   7160701..7160750,7160853..7160922,7161007..7161088,
FT                   7161167..7161588,7161869..7162366,7162596..7162817)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05450"
FT                   /old_locus_tag="Vv17s0000g05450"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7SII5"
FT                   /db_xref="InterPro:IPR019007"
FT                   /db_xref="UniProtKB/TrEMBL:D7SII5"
FT                   /protein_id="CBI15296.3"
FT                   /translation="MKTKGGKVMNPTDAYRKELRKKELKRNKKERKKVREVGILKKDPE
FT                   TLREQIDKLEMMKADGALDKARKHKKRQLEDTLNLVLKKRKEYEEKLKEKGEAPVMFSH
FT                   LGPPRRRTTAEEEERVKHPKPEDSVYYHPTLNPTGAPPPGKPPMFKSSIGPRIPLSAAS
FT                   SSGAASSSMTDSEDADLVVPPPPPPPPPLPDTGHLEPGDSSVMPASLPLPPPPPMPPKP
FT                   AMADLGALPPPPLPPPPPGPPPKEQVTTHPSLPPPPLIQQSSQPPPPGIGRMEGEKTQS
FT                   ATSDDQTSKEPVQVPTVLPPPPPPPGLPLKLVSNQTEGTLPESDINNPSGTKEIPMVPP
FT                   PPPPPRQQPPVPRPGLIPTLQPDVLSPGISRFPPPPPPPPGLPSQAAPPGIMVPLIPRP
FT                   PFGPPPMMRPPLPPGAVPTLQEDDYAAIRPPMPQKPSYVKSAASTVVKRPLAQHTPELT
FT                   AMVPASVRVRREIAAPKAKPKPSVSTISAVPGQAAPSVVKPELVNPSAAAARPQSIDDS
FT                   YMAFLEDMKALGALDS"
FT   3'UTR           7162818..7163148
FT                   /locus_tag="VIT_17s0000g05450"
FT                   /old_locus_tag="Vv17s0000g05450"
FT   gene            7164359..7171851
FT                   /locus_tag="VIT_17s0000g05440"
FT                   /old_locus_tag="Vv17s0000g05440"
FT   mRNA            join(7164359..7164613,7164614..7164704,7164835..7164992,
FT                   7166020..7166817,7166899..7167112,7169281..7169459,
FT                   7170545..7170783,7171102..7171426,7171819..7171851)
FT                   /locus_tag="VIT_17s0000g05440"
FT                   /old_locus_tag="Vv17s0000g05440"
FT                   /product="unknown predicted protein"
FT   5'UTR           7164359..7164613
FT                   /locus_tag="VIT_17s0000g05440"
FT                   /old_locus_tag="Vv17s0000g05440"
FT   CDS_pept        join(7164614..7164704,7164835..7164992,7166020..7166817,
FT                   7166899..7167112,7169281..7169459,7170545..7170783,
FT                   7171102..7171426,7171819..7171851)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05440"
FT                   /old_locus_tag="Vv17s0000g05440"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTC0"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTC0"
FT                   /protein_id="CCB43129.1"
FT                   /translation="MGGVLTITLLFCTLLLLLDPSLSHPLCTDSRAPFTLKTPLNFCPY
FT                   NGSVCCNSTEDLQLRKQFQAMNISHQGCASLLKSILCARCDQFSAQLFRGDSISQPVPV
FT                   LCNSTFPLNTSQSSSALNGFCSEVWDTCQNVSILNSPFATSLQGQSGVTAGSNFTKLIE
FT                   LWQSKTDFCNAFGGASINGSLCFDGGPVVLNNTGTPTPPNGLCLEKIGNGSYINMVAHP
FT                   DGSNRAFFSDQPGKIWLATIPKEGAGGELELDEANPFLDLTDEVHFDAEFGMMGMAFHP
FT                   NFVQNGRFFASFNCDKIKWPRCSGRCSCNSEANCDPSKLQPDNNASPCQYHSIIAEFTT
FT                   NGTALQASLATVAKPSEVRRIFTMGLPFTSHHGGQILFGPDGYLYFMMGDGGGSGDPYN
FT                   FAQNKKSVLGKIMRLDIDIISSAAEISNLSLWGNYSIPKDNPFTEDEGLLPEIWAMGLR
FT                   NPWRCSFDSERPSYFMCADAGQDEYEEVDIITKDGNYGWRVYEGPNLYTPRESPGGNTS
FT                   ANSINAIFPVMGYYHDVNVNEGSASITGGYFYRSMTDPCMYGRYLFGDLYAHAIWAGTE
FT                   SPENSGNFTMSQIPFSCAHDSPIQCSSVPGSSLPALGYIFSFGEDNNKDIFLLTSSGVY
FT                   RVVRPSRCNYTCSKENATATASPSPAPSSPSSQHEACPDTWSA"
FT   gene            7207388..7228098
FT                   /locus_tag="VIT_17s0000g05430"
FT                   /old_locus_tag="Vv17s0000g05430"
FT   mRNA            join(7207388..7207583,7207584..7207970,7208066..7208176,
FT                   7210684..7210770,7210880..7210917,7210994..7211075,
FT                   7213725..7213831,7214052..7214208,7224777..7224869,
FT                   7224984..7225107,7226392..7226434,7226582..7226770,
FT                   7226849..7227587,7227588..7228098)
FT                   /locus_tag="VIT_17s0000g05430"
FT                   /old_locus_tag="Vv17s0000g05430"
FT                   /product="unknown predicted protein"
FT   5'UTR           7207388..7207583
FT                   /locus_tag="VIT_17s0000g05430"
FT                   /old_locus_tag="Vv17s0000g05430"
FT   CDS_pept        join(7207584..7207970,7208066..7208176,7210684..7210770,
FT                   7210880..7210917,7210994..7211075,7213725..7213831,
FT                   7214052..7214208,7224777..7224869,7224984..7225107,
FT                   7226392..7226434,7226582..7226770,7226849..7227587)
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05430"
FT                   /old_locus_tag="Vv17s0000g05430"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR018501"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTC1"
FT                   /protein_id="CCB43130.1"
FT                   /translation="MSQSSSPPIHNHRSSPQPHSQNDTPTPQNDTQTTTTTAAAIPAPA
FT                   VTRKERPPRACTTRAAARLYADPPVIERRSKPAKKERNEESPQQQQQCASKIVTPLVNS
FT                   PPPSQLPRWTLRSMWELASILNFLHVFRPLLNIAVEFSAEEFETALITPNNTLSDIHIP
FT                   LLKAIPPVTRMALTRGTWVTVLCRKLRDWWHWVAEGEIPIVASQGAEVGMYNALDPGVR
FT                   VVILKALCDIRVEQEDIRIFIDNSIKHGVQLSAFRKERVGGDSHGISYWYEDDPIIGHR
FT                   LYREIRKVEVKKAKVKGSQCLPNASYQWETVATNLDEFQDVSEKLFSSKNRTEASLGKK
FT                   LKNDMLPEIEKVHKRKERMLKKQHRQALLLDNFLSVDGLAPGRSLRDRKPVTYTFDDYD
FT                   RSINEAIKITKRKPPSPEPTVRREGVTKPEPSTNGRWSGPSQAPQHVNFNALSPKSPDY
FT                   DEIDDEHKSEPLDRSNRRRQRPQRYSEKEFVEAVSDNDADFDSDDDIVGEAVYDEEYLR
FT                   KRKQRKLSSSSEGDEEYRWDEENPEDEEEEEEEEESLSISEDSDGPQRFKKLPGRTRRE
FT                   TKLRSVDELQSGLRRSKRATRNRINYRQYDLSESETESLKQEKSNASDGRSDESDKVEY
FT                   SMGSQDSDDNDDDQELKVDQPVENYPQTVEKEINQPSEKSNSPVQDEAEGVRKRRFLDL
FT                   NELAPGSGFDDGPNTILKDDTNDF"
FT   gap             7217753..7217846
FT                   /estimated_length=94
FT   3'UTR           7227588..7228098
FT                   /locus_tag="VIT_17s0000g05430"
FT                   /old_locus_tag="Vv17s0000g05430"
FT   gene            complement(7228443..7229826)
FT                   /locus_tag="VIT_17s0000g05420"
FT                   /old_locus_tag="Vv17s0000g05420"
FT   mRNA            complement(join(7228443..7228490,7228491..7229135,
FT                   7229257..7229271,7229365..7229547,7229548..7229826))
FT                   /locus_tag="VIT_17s0000g05420"
FT                   /old_locus_tag="Vv17s0000g05420"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(7228443..7228490)
FT                   /locus_tag="VIT_17s0000g05420"
FT                   /old_locus_tag="Vv17s0000g05420"
FT   CDS_pept        complement(join(7228491..7229135,7229257..7229271,
FT                   7229365..7229547))
FT                   /codon_start=1
FT                   /locus_tag="VIT_17s0000g05420"
FT                   /old_locus_tag="Vv17s0000g05420"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6GTC2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F6GTC2"
FT                   /protein_id="CCB43131.1"
FT                   /translation="MDEHQRVTDEFRGAKVWWAASKVVPPARSSVSFYPEKEKRYYKLI
FT                   FHKKYREIMTDNYLEHPMWSHVWKRGYLLYGPPGTGKSTMIAAMANLLSYDVYDLELTA
FT                   VKDNTELRKLLIETTNKSIIVIEDIDCSLDLTGQRKKKEEKSSESQEDEKVKEISRKDN
FT                   REESSKVTLSGLLNFIDGLWSACGGERLIVFTTNYVEKLDPALIRRGRMDKHIEFSYCS
FT                   FKAFKVLANNYLGLETHPLFEMIQQSMEETNITPADVAENLMPKSPTEDAEKCLLNLI"
FT   5'UTR           complement(7