(data stored in ACNUC16935 zone)

EMBL: FN595991

ID   FN595991; SV 1; linear; genomic DNA; STD; PLN; 8015839 BP.
XX
AC   FN595991;
XX
PR   Project:PRJEA18785;
XX
DT   25-NOV-2009 (Rel. 102, Created)
DT   24-MAY-2011 (Rel. 108, Last updated, Version 4)
XX
DE   Vitis vinifera cv. PN40024, annotated scaffold_7.assembly12x
XX
KW   .
XX
OS   Vitis vinifera (wine grape)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; Vitales; Vitaceae; Viteae; Vitis.
XX
RN   [1]
RP   1-8015839
RA   Vitulo N., Olivier J., Forcato C., Albiero A., D'Angelo M., Zimbello R.,
RA   Schiavon R., Rigobello C., Policriti A., Clepet C., Casagrande A.,
RA   Choisne N., Vezzi A., Hugueney P., Horner D., Mica E., Cattonaro F.,
RA   Del Fabbro C., Alaux M., Di Gaspero G., Scalabrin S., Pesole G.,
RA   Delledonne M., Pezzotti M., Pe E.M., Caboche M., Adam-Blondon A.-F.,
RA   Weissenbach J., Quetier F., Wincker P., Morgante M., Valle G.;
RT   "High quality assembly and annotation of grapevine genome";
RL   Unpublished.
XX
RN   [2]
RP   1-8015839
RA   Vitulo N.;
RT   ;
RL   Submitted (20-MAY-2011) to the INSDC.
XX
DR   MD5; 8d3830f2ca0883cd90470fa2fbc705c3.
DR   ENA-CON; FN597027.
DR   BioSample; SAMEA2272750.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00015; U4.
DR   RFAM; RF00020; U5.
DR   RFAM; RF00332; snoZ266.
DR   RFAM; RF00645; MIR169_2.
DR   RFAM; RF01236; snoU19.
DR   RFAM; RF01286; snoR26.
DR   RFAM; RF01287; snoR27.
DR   RFAM; RF01431; snoR135.
DR   RFAM; RF01847; Plant_U3.
XX
CC   This is a 'working draft' sequence, generated by whole genome
CC   shotgun. The assembly was made at a 12X coverage of the genome,
CC   sequenced by Sanger method. Sequencing effort has been performed by
CC   GENOSCOPE, CRIBI and IGA.  This annotation is done on an updated
CC   gene prediction version (V1).   More information available at
CC   http://genomics.cribi.unipd.it , http://www.genoscope.cns.fr/vitis
CC   and http://www.appliedgenomics.org/ Email: seqref@genoscope.cns.fr.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..8015839
FT                   /organism="Vitis vinifera"
FT                   /chromosome="chr8"
FT                   /cultivar="PN40024"
FT                   /mol_type="genomic DNA"
FT                   /note="scaffold_7.assembly12x"
FT                   /db_xref="taxon:29760"
FT   gene            1804..4434
FT                   /locus_tag="VIT_08s0007g09040"
FT                   /old_locus_tag="Vv08s0007g09040"
FT   mRNA            join(1804..1859,1860..3527,4417..4434)
FT                   /locus_tag="VIT_08s0007g09040"
FT                   /old_locus_tag="Vv08s0007g09040"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           1804..1859
FT                   /locus_tag="VIT_08s0007g09040"
FT                   /old_locus_tag="Vv08s0007g09040"
FT   CDS_pept        join(1860..3527,4417..4434)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g09040"
FT                   /old_locus_tag="Vv08s0007g09040"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKR8"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKR8"
FT                   /protein_id="CCB55096.1"
FT                   /translation="MASEGRCLYEVLGLTTDATADEIRSAYKKLALQRHPDKLVHSGLS
FT                   KADATAQFQELLNAYEVLSNPEERAWYDSHRSQILFSNPTSSNGSVPNLFSFFSNSVYS
FT                   GYDDTRKGFYKVYSEVFDKIYATEVNFAKKLGLGSIKEAPMMGNLESPYSQVTAFYGYW
FT                   IGFSTVMDFAWVDEYDVRAGPNRKSRRLMEEENRKLRKKAKREYNETVRGLAKFVKRRD
FT                   KRVIDMQVKKSLEEEKRKEEEKTRKWEEFERGRLERARAKVEPEWVRAVEDDGNDDDWE
FT                   FEDAGGGRKEEEEFYCVLCRKKFKSEKQWKNHEKSKKHKEWVAEFRESVKEEDERYGDA
FT                   EAGIHGNGDQSEVELQEQFEDGLELEEEEIEDGAQIESSNEEEFVVGDVSHSGNGTNAE
FT                   LGSDDEMSVLEAMLSGHKNRKNGKTAVASVLEPESSVTEAPVDINNDEMDFMEYDNRKS
FT                   SRRRRGKKDKGKRSNGEAMKPDSSTGDKGGQDEQNSGSDASHIQDSSTYSVAENETDGK
FT                   EDHHAETNKIPKQPVNRKATSKGEIDTKPKESNKVRKAKVLMRA"
FT   gene            7791..11775
FT                   /locus_tag="VIT_08s0007g09030"
FT                   /old_locus_tag="Vv08s0007g09030"
FT   mRNA            join(7791..7943,11064..11125,11241..11298,11299..11775)
FT                   /locus_tag="VIT_08s0007g09030"
FT                   /old_locus_tag="Vv08s0007g09030"
FT   CDS_pept        join(7791..7943,11064..11125,11241..11298)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g09030"
FT                   /old_locus_tag="Vv08s0007g09030"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKR9"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKR9"
FT                   /protein_id="CCB55097.1"
FT                   /translation="MVERYLGLLVWADKGWKRPVVVYLGMPLLFSDSRGVGPLNLGQSQ
FT                   VCTKSKVAQRKALGNTCETCGEDFESRNKLHQHLGDTGHAMLRAR"
FT   3'UTR           11299..11775
FT                   /locus_tag="VIT_08s0007g09030"
FT                   /old_locus_tag="Vv08s0007g09030"
FT   gene            13153..30591
FT                   /locus_tag="VIT_08s0007g09020"
FT                   /old_locus_tag="Vv08s0007g09020"
FT   mRNA            join(13153..13313,13314..13373,13653..13740,14255..14648,
FT                   15251..15686,15796..15996,16200..16310,18110..18543,
FT                   18654..18762,18851..18931,19132..19304,20253..20378,
FT                   21030..21191,21293..21350,24595..24825,24987..25133,
FT                   26376..26936,27036..27293,27408..27515,27759..27853,
FT                   27992..28148,28789..28986,29098..29244,29667..30005,
FT                   30006..30591)
FT                   /locus_tag="VIT_08s0007g09020"
FT                   /old_locus_tag="Vv08s0007g09020"
FT                   /product="Chromatin remodeling complex subunit"
FT   5'UTR           13153..13313
FT                   /locus_tag="VIT_08s0007g09020"
FT                   /old_locus_tag="Vv08s0007g09020"
FT   CDS_pept        join(13314..13373,13653..13740,14255..14648,15251..15686,
FT                   15796..15996,16200..16310,18110..18543,18654..18762,
FT                   18851..18931,19132..19304,20253..20378,21030..21191,
FT                   21293..21350,24595..24825,24987..25133,26376..26936,
FT                   27036..27293,27408..27515,27759..27853,27992..28148,
FT                   28789..28986,29098..29244,29667..30005)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g09020"
FT                   /old_locus_tag="Vv08s0007g09020"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7THS3"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR020838"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031047"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:D7THS3"
FT                   /protein_id="CBI29799.3"
FT                   /translation="MEPKPHPNNGFSFSNLFNLESLMNFQLPQQDDDFDYYGNSSQDES
FT                   RGSQGGTMGDYHNGIMSERELSLVSKKRRSQNSEDEEEDGNYSTFISEERYRSMLGEHI
FT                   QKYKRRFKDPSPSPAPARMGVSVPKSTLGSKTRKLGNEHRGGLHEVETPSEWLADVGPQ
FT                   KMVGFHDADFAPEYGTSRTIYESSYLDIGEGIAYRIPPAYEKLAVTLNLPTFSDIRVEE
FT                   YYLKSTLDLGSLAEMMTADKRFGPKSRAGMGEPQSQYESLQARLRALSSSNSVQKFSLK
FT                   VSDIALNSSSIPEGAAGSIQRSILSEGGALQVYYVKVLEKGDTYEIIERSLPKKQKVKK
FT                   DPSMIEKEEMERIGKVWVNIVRRDIPKHQRIFINFHRKQLIDAKRFSENCQREVKLKVS
FT                   RSLKLMRGAAIRTRKLARDMLVFWKRVDKEMAELRKKEEREAAEALRREQELREVKRQQ
FT                   QRLNFLITQTELFSHFMQNKATSQPSEALPVDGEKPKDQELLVSSSDDVPGEEQDPEDD
FT                   ELKKEALKAAQDAVSKQKRLTSAFDNECLKLRQAAEPEVPSPDASGAAGSSNIDLLHPS
FT                   TMPVASSVQTPELFKGSLKEYQLKGLQWLVNCYEQGLNGILADEMGLGKTIQAMAFLAH
FT                   LAEEKNIWGPFLVVAPASVLNNWADEISRFCPDLKTLPYWGGLQERMILRKNINPKRLY
FT                   RREAGFHILITSYQLLVSDEKYFRRVKWQYMVLDEAQAIKSSNSIRWKTLLSFNCRNRL
FT                   LLTGTPIQNNMAELWALLHFIMPTLFDSHEQFNEWFSKGIENHAEHGGTLNEHQLNRLH
FT                   AILKPFMLRRVKKDVVSELTGKTEVTVHCKLSSRQQAFYQAIKNKISLAELFDGNRGHL
FT                   NEKKILNLMNIVIQLRKVCNHPELFERNEGSTYLYFGEIPNSLLPPPFGELEDMHYAGA
FT                   QNPITYKVPKLVHQEVMQSSGIISSTARRGVHRETFLKHFNIFSPVNIYQSVLPQENNS
FT                   NGSAVKSGTFGFTHLMDLSPEEVAFLATGTFMERLLFFIMRWDRQFLDGILDLLMEAEE
FT                   EDFSNSHLDSGKVRAVTRMLLMPSRSETNLLRRKLATGLGHAPFEALVVPHQDRLQANT
FT                   RLVHATYTFIPRTRAPPINAHCSNRNFAYKLLEELHHPWLKRLFIGFARTSDYNGPKKP
FT                   DVPHHLIQEIDSELPVSKPALQLTYKIFGSSPPMQSFDPAKLLTDSGKLQTLDILLKRL
FT                   RAENHRVLLFAQMTKMLNILEDYMNYRKYRYLRLDGSSTIMDRRDMVRDFQLRSDIFVF
FT                   LLSTRAGGLGINLTAADTVIFYESDWNPTLDLQAMDRAHRLGQTKDVTVYRLICKETVE
FT                   EKILQRASQKSTVQQLVMTGGHVQGDLLAPEDVVSLLLDDAQLEQKLRDLPLQDKQKKK
FT                   RGTKGILLDAEGDATLEDFPNISQGNGQEPSPDAERPKSSSKKRKAATDKQTPPKPRNS
FT                   QKAMKNVDSYTGMTDPNSMAMDYELDDSLQNDDMQLQKHKRPKRPTKSVNENLEPAFTN
FT                   STVIIEQTQYQPHLELGPGGLRAGGKDDTPLHTDSLT"
FT   3'UTR           30006..30591
FT                   /locus_tag="VIT_08s0007g09020"
FT                   /old_locus_tag="Vv08s0007g09020"
FT   gene            complement(30908..41826)
FT                   /locus_tag="VIT_08s0007g09010"
FT                   /old_locus_tag="Vv08s0007g09010"
FT   mRNA            complement(join(30908..31106,31107..31307,31553..31618,
FT                   31706..31804,32140..32336,33180..33227,36518..36635,
FT                   41614..41760,41761..41826))
FT                   /locus_tag="VIT_08s0007g09010"
FT                   /old_locus_tag="Vv08s0007g09010"
FT                   /product="S-formylglutathione hydrolase"
FT   3'UTR           complement(30908..31106)
FT                   /locus_tag="VIT_08s0007g09010"
FT                   /old_locus_tag="Vv08s0007g09010"
FT   CDS_pept        complement(join(31107..31307,31553..31618,31706..31804,
FT                   32140..32336,33180..33227,36518..36635,41614..41760))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g09010"
FT                   /old_locus_tag="Vv08s0007g09010"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7THS4"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7THS4"
FT                   /protein_id="CBI29800.3"
FT                   /translation="MEAKPTEISGSKMFGGYNKRFKHFSPTLGCSMTFHVYFPPLPSPS
FT                   HKFPVLYWLSGLSCTDENFIIKSGAQRVASSEGIALVAPDTSPRGLNVEGEADSWDFGV
FT                   GAGFYLNATQEKWKNWQMYDYVVKELPKVLSENFAQLDTSRASISGHSMGGHGALTIYL
FT                   KNLDKYKSVSAFAPIVNPMNCPWGQKAFTNYLGGNKADWEEYDATCLISKFNDVSATIL
FT                   IDQGEDDKFLHDQLLPHKFEEACKNAKVPLLLRLQPGYDHSYYFIATFIDHHIQHHAQA
FT                   LNMCFKPLHP"
FT   5'UTR           complement(41761..41826)
FT                   /locus_tag="VIT_08s0007g09010"
FT                   /old_locus_tag="Vv08s0007g09010"
FT   gene            45785..47919
FT                   /locus_tag="VIT_08s0007g09000"
FT                   /old_locus_tag="Vv08s0007g09000"
FT   mRNA            join(45785..45896,45897..46554,46713..46934,47134..47381,
FT                   47479..47618,47712..47835,47836..47919)
FT                   /locus_tag="VIT_08s0007g09000"
FT                   /old_locus_tag="Vv08s0007g09000"
FT                   /product="unknown predicted protein"
FT   5'UTR           45785..45896
FT                   /locus_tag="VIT_08s0007g09000"
FT                   /old_locus_tag="Vv08s0007g09000"
FT   CDS_pept        join(45897..46554,46713..46934,47134..47381,47479..47618,
FT                   47712..47835)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g09000"
FT                   /old_locus_tag="Vv08s0007g09000"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7THS5"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7THS5"
FT                   /protein_id="CBI29801.3"
FT                   /translation="MVGSIKVKSQNLHSNGSVQNCASMEEKLDELRHLLGKAEGDILKI
FT                   VGVGAGAWGSVFAALLQDNYGQFREKVQIRIWRRPGRTVDKATAEHLFEVINSREDVLR
FT                   RLIRRCAYLKYVEARLGDRTLLADEILKDGFCLNMIHTPLCPLKVVTNLQEAVWDADIV
FT                   VNGLPSTETREVFEEINHYWKERITVPIIISLSKGIEAALEPLPHIITPTQMINRATGV
FT                   AMENILYLGGPNIASEIYNKEYANARICGAEKWRKPLAKFLRQPHFIVWDNSDLVTHEV
FT                   MGGLKNVYAIGAGMVAALTNESATSKSVYFAHCTSEMIFITHLLAEEPEKLAGPLLADT
FT                   YVTLLKGRNAWYGQMLAKGELSLDMGDSISGKGMIQGVSAVGAFYELLSQSSLSVLHPE
FT                   ENKHVAPVELCPILKTLYRILITRELASQGILQALRDETLNDPRERIEIAQTHAFYRPS
FT                   LLGQP"
FT   3'UTR           47836..47919
FT                   /locus_tag="VIT_08s0007g09000"
FT                   /old_locus_tag="Vv08s0007g09000"
FT   gene            48698..50514
FT                   /locus_tag="VIT_08s0007g08990"
FT                   /old_locus_tag="Vv08s0007g08990"
FT   mRNA            join(48698..48728,48729..48791,49185..49227,49317..49408,
FT                   49498..49608,49609..49938,50351..50514)
FT                   /locus_tag="VIT_08s0007g08990"
FT                   /old_locus_tag="Vv08s0007g08990"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           48698..48728
FT                   /locus_tag="VIT_08s0007g08990"
FT                   /old_locus_tag="Vv08s0007g08990"
FT   CDS_pept        join(48729..48791,49185..49227,49317..49408,49498..49608)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08990"
FT                   /old_locus_tag="Vv08s0007g08990"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:A5AZY8"
FT                   /protein_id="CCB55098.1"
FT                   /translation="MAETDMKEVLKPFHQRASEAEDRLSKLEAALSSTKDSGNEELLKM
FT                   ISDLQSKLQHAEAEQISEREKAQKDIQKLTVENAKLQYRVTHLVRALKEADCKLEAK"
FT   3'UTR           join(49609..49938,50351..50514)
FT                   /locus_tag="VIT_08s0007g08990"
FT                   /old_locus_tag="Vv08s0007g08990"
FT   gene            complement(53050..56399)
FT                   /locus_tag="VIT_08s0007g08980"
FT                   /old_locus_tag="Vv08s0007g08980"
FT   mRNA            complement(join(53050..53089,53284..53308,53445..53472,
FT                   53727..53936,55377..55595,56203..56283,56284..56399))
FT                   /locus_tag="VIT_08s0007g08980"
FT                   /old_locus_tag="Vv08s0007g08980"
FT   CDS_pept        complement(join(53050..53089,53284..53308,53445..53472,
FT                   53727..53936,55377..55595,56203..56283))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08980"
FT                   /old_locus_tag="Vv08s0007g08980"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7THS7"
FT                   /protein_id="CBI29803.3"
FT                   /translation="MRREPAERIHEIIKVLLRRYCLENDEQEQRPVIIIKQSSSDMQEH
FT                   ATNLSDEKKKLSDFDSNIINVGRKESSTTIIERFTIFNSSLKPHGTKENCAEMVKAANI
FT                   TIENSGTDTSNQESGCSSENKKFSNSCFKITKEEVQHSSTPTPDIVILESSLKPEGNRG
FT                   EVDEKAEPSSIVVEDFKKIIRKLLSLQMLWRIPIQML"
FT   5'UTR           complement(56284..56399)
FT                   /locus_tag="VIT_08s0007g08980"
FT                   /old_locus_tag="Vv08s0007g08980"
FT   gene            71085..76122
FT                   /locus_tag="VIT_08s0007g08970"
FT                   /old_locus_tag="Vv08s0007g08970"
FT   mRNA            join(71085..71105,71106..71579,73148..73251,74245..74473,
FT                   75850..75996,75997..76122)
FT                   /locus_tag="VIT_08s0007g08970"
FT                   /old_locus_tag="Vv08s0007g08970"
FT                   /product="Predicted protein"
FT   5'UTR           71085..71105
FT                   /locus_tag="VIT_08s0007g08970"
FT                   /old_locus_tag="Vv08s0007g08970"
FT   CDS_pept        join(71106..71579,73148..73251,74245..74473,75850..75996)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08970"
FT                   /old_locus_tag="Vv08s0007g08970"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5B8H8"
FT                   /db_xref="InterPro:IPR004853"
FT                   /db_xref="UniProtKB/TrEMBL:A5B8H8"
FT                   /protein_id="CCB55099.1"
FT                   /translation="MSSSASSSSSSPSRRKALFISSLIILWYSSNIGVILLNKFLLSNY
FT                   GFSFPIFLTMCHMSACAILSYVSIVFLKIAPLQALKSRAQFLKIATLSIVFCASVVGGN
FT                   ISLRYLPVSFNQAVGATTPFFTAVFAYLMTLKREAWVTYVALVPVVAGVVIASGGEPSF
FT                   HLFGFIMCISATAARAFKSVLQGVLLSSEGEKLNSMNLLLYMSPIAVLVLLPAALIMEP
FT                   NVLDATISLGKEHKFMWMLLLVNSAMAYSANLSNFLVTKHTSPLTLQVLGNAKGAVAVV
FT                   ISILIFQNPVTVVGISGYTITVLGVVAYGETKRRFK"
FT   3'UTR           75997..76122
FT                   /locus_tag="VIT_08s0007g08970"
FT                   /old_locus_tag="Vv08s0007g08970"
FT   gene            complement(77105..93845)
FT                   /locus_tag="VIT_08s0007g08960"
FT                   /old_locus_tag="Vv08s0007g08960"
FT   mRNA            complement(join(77105..77636,77637..77939,78073..78371,
FT                   78507..78678,81323..81481,81573..83512,83602..83656,
FT                   93545..93718,93719..93845))
FT                   /locus_tag="VIT_08s0007g08960"
FT                   /old_locus_tag="Vv08s0007g08960"
FT                   /product="Type IIB calcium ATPase"
FT   3'UTR           complement(77105..77636)
FT                   /locus_tag="VIT_08s0007g08960"
FT                   /old_locus_tag="Vv08s0007g08960"
FT   CDS_pept        complement(join(77637..77939,78073..78371,78507..78678,
FT                   81323..81481,81573..83512,83602..83656,93545..93718))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08960"
FT                   /old_locus_tag="Vv08s0007g08960"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7THS9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006408"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR024750"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D7THS9"
FT                   /protein_id="CBI29805.3"
FT                   /translation="MERYLKKDFDVQSKHSSEAALRRWRSAVTIVKNRRRRFRDVANLH
FT                   MRSEAEKKKLKIQEKIRVALYVQKAALQFIDAGGRVDHGLSEEAREAGFGIDPDELASI
FT                   VRGHDIMGLKAHGGLEGLARKVHVSLDEGVKSSDIAMRQNIYGLNRYTEKPSRTFLMFV
FT                   WDALHDLTLIILMICAVISIGVGLPTEGWPEGMYSGVGILVSIFLVVLVTAISDYRQSL
FT                   QFRDLDKEKKKIFVQVTRDGYRQKISIYDLVVGDIVHLSIGDQVPADGVFISGYSLLID
FT                   ESGMSGESEPVHISEEKPFFLSGTKVTDGSGKMLVTTVGMRTEWGKLMETLTEGGDDET
FT                   PLQVKLNGVATIIGKIGLAFAVLTFVVLVVRFLVEKALRKEFTDWSSSDALTLLNYFAI
FT                   AVTIIVVAVPEGLPLAVTLSLAFAMKKLMKEKALVRHLSACETMGSASCICTDKTGTLT
FT                   TNHMVVHKIWICGKAEEIKGSESADVLKSEISGRVSSILLQAIFQNTSSEVVKDKDGKN
FT                   TILGTPTESALLEFGLLLGGNFDAQRKENKIVEVEPFNSVKKKMSVLVALPDGRIRAFC
FT                   KGASEIILSMCNKIVNYDGESIPLSEVQERNITDIINGFASEALRTLCLAFKDVDDPSN
FT                   ENDIPTYGYTLIMVVGIKDPTRPGVKDAVQTCLAAGIAVRMVTGDNINTAKAIAKECGI
FT                   LTEDGLAIEGPEFHSMSLEEMREIIPRIQVMARSLPSDKHTLVTHLRKLYGEVVAVTGD
FT                   GTNDAPALHEADIGLAMGIAGTEVAKENADVIIMDDNFATIVNVAKWGRAVYINIQKFV
FT                   QFQLTVNVVALVVNFVSACITGSAPFTAVQLLWVNLIMDTLGALALATEPPNDALMKRP
FT                   PVGRSVSFITKTMWRNIIGQSIYQLIVIGVISVYGKRLLRLSGSDASDIIDTFIFNTFV
FT                   FCQLFNEINSRDIEKINIFRGMFDSWIFIIVMVCTVAFQIIIVELLGTFASTVPQSWQL
FT                   WILSILIGAVGMPVAVVLKCIPVETGSFKQHDDYEALPSGPEQA"
FT   5'UTR           complement(93719..93845)
FT                   /locus_tag="VIT_08s0007g08960"
FT                   /old_locus_tag="Vv08s0007g08960"
FT   gene            complement(109330..114244)
FT                   /locus_tag="VIT_08s0007g08950"
FT                   /old_locus_tag="Vv08s0007g08950"
FT   mRNA            complement(join(109330..109351,113657..113991,
FT                   114109..114222,114223..114244))
FT                   /locus_tag="VIT_08s0007g08950"
FT                   /old_locus_tag="Vv08s0007g08950"
FT                   /product="Predicted protein"
FT   CDS_pept        complement(join(109330..109351,113657..113991,
FT                   114109..114222))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08950"
FT                   /old_locus_tag="Vv08s0007g08950"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKU3"
FT                   /db_xref="InterPro:IPR003428"
FT                   /db_xref="InterPro:IPR036561"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKU3"
FT                   /protein_id="CCB55100.1"
FT                   /translation="MRRVNGILRQSQKALQDLDLLKVLQSEIRHEQSHDRFQNYQGGNP
FT                   GDFVVDWDSPASQDVVLRRKCESGEEVAVSALLSPITFRNEEGSFPRDLLMKVCVKKPG
FT                   LSPVLQFDCGVFSKDHERLEFNIHSAYYIPSPACLNPSAYRGPSFRGEAGAA"
FT   5'UTR           complement(114223..114244)
FT                   /locus_tag="VIT_08s0007g08950"
FT                   /old_locus_tag="Vv08s0007g08950"
FT   gene            115062..127606
FT                   /locus_tag="VIT_08s0007g08940"
FT                   /old_locus_tag="Vv08s0007g08940"
FT   mRNA            join(115062..115068,115069..115170,115765..115856,
FT                   116228..116294,117988..118047,119439..119528,
FT                   119708..119977,120180..120275,120353..120487,
FT                   120736..120789,120899..120982,122323..122409,
FT                   122487..123389,124190..124371,126288..126579,
FT                   127451..127528,127529..127606)
FT                   /locus_tag="VIT_08s0007g08940"
FT                   /old_locus_tag="Vv08s0007g08940"
FT                   /product="Predicted protein"
FT   5'UTR           115062..115068
FT                   /locus_tag="VIT_08s0007g08940"
FT                   /old_locus_tag="Vv08s0007g08940"
FT   CDS_pept        join(115069..115170,115765..115856,116228..116294,
FT                   117988..118047,119439..119528,119708..119977,
FT                   120180..120275,120353..120487,120736..120789,
FT                   120899..120982,122323..122409,122487..123389,
FT                   124190..124371,126288..126579,127451..127528)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08940"
FT                   /old_locus_tag="Vv08s0007g08940"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7THT1"
FT                   /db_xref="InterPro:IPR007231"
FT                   /db_xref="UniProtKB/TrEMBL:D7THT1"
FT                   /protein_id="CBI29807.3"
FT                   /translation="MATDSDMSSWTDLLHSSTKLLEQAAPSAQFPPLQRNLDQLEALSK
FT                   KLKSKTLRAEAPSQSVAATRLLAREGLNAEQLARDLKSFELKTTFEDVFPAEATSVEEY
FT                   LQQVHEMAIVSAIQEAQKDNLKSFNDYMMKVMEEDWQKEKRDFLQSLSRISTLPKTNIS
FT                   DSSTGATRPGQIASMISSPQVSSGLSSMELVPLANKPVLEKKTSVYAEVVKNLNSARER
FT                   GLPFKPATAFKGAYDSLGLETSGGKSVNMQKIWHLIQTLMGEDTAAQWNVSKKMSLVIG
FT                   ARRHLEWGHEKYMIDTIQSHPAQAALGGVVGNLQRIHAFLRIRLRDYGVLDFDAGDARR
FT                   QPPVDTTWQQIYFCLRTGYYEEAIEVARSSRVSNQFASQLTEWITTRGMVSAEIAAVAS
FT                   EECDKMLRMGDRVGRAAYDKKRLLLYAIISGSRRHIDRLLRDLPTLFNTIEDFLWFKLS
FT                   AVRDCPGGSSSVVLNEGLVPYSLDDLQNYLNKFEPSYYTKNGKDPLVYPYVLLLSIQLL
FT                   PAVLYLSKEMGVEGYNVDATHISIVLADHGVLSEGAGVGQKLGVMDAFAEASSIIRQYG
FT                   SVYLRAGDLSTALEYYAQAAAAVGGGQLSWTGRGNIDQQWQRNLMLKQLLTELLLRDGG
FT                   IYLLLGPRGAGEEGELARFLTDVKARQQFLLEASRQCQDAGLYDQSIEIQKRIGAFSMA
FT                   LDTINKCLSEAVCALARGRLDGESRTAGLIQSGNEILETYKYFPEVSLQEREHVMEQQT
FT                   VLRELEAILSIHKLARVGHYLDALREVAKLPFLPLDPRAPDTTPDVFQNLSPHVQACVP
FT                   DLLKIALSCLDYVTDTDGSLRALRTKIANFLANNLNRNWPRDLYEKVARTL"
FT   3'UTR           127529..127606
FT                   /locus_tag="VIT_08s0007g08940"
FT                   /old_locus_tag="Vv08s0007g08940"
FT   gene            131671..135813
FT                   /locus_tag="VIT_08s0007g08930"
FT                   /old_locus_tag="Vv08s0007g08930"
FT   mRNA            join(131671..131737,131928..132039,132117..132248,
FT                   133979..134374,135541..135679,135680..135813)
FT                   /locus_tag="VIT_08s0007g08930"
FT                   /old_locus_tag="Vv08s0007g08930"
FT                   /product="putative uncharacterized protein"
FT   CDS_pept        join(131671..131737,131928..132039,132117..132248,
FT                   133979..134374,135541..135679)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08930"
FT                   /old_locus_tag="Vv08s0007g08930"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7THT2"
FT                   /db_xref="InterPro:IPR024336"
FT                   /db_xref="InterPro:IPR024337"
FT                   /db_xref="UniProtKB/TrEMBL:D7THT2"
FT                   /protein_id="CBI29808.3"
FT                   /translation="MQSFNPYWRRKKKSVSLLMQNKAIDIMEDGASDSEIYLQDANDEE
FT                   EHYYTSSSISKLQFRKDVSKAIWNDAMRMAEVVEMKGKMWTTTGMLHSGKIYCSIEETL
FT                   FLAELGALHLLDDNDVPISLKGIYDKVSQGKCGCCWESFEAYRHLKSLGYIVGRHGIPW
FT                   TSKGAKTCLDSHQGTPEGNSRTDEGSEEENSTIELVNNMHITEVKLLFDVYLPNSKFRK
FT                   SSPGDPSFVLCLTRGHPPLKTEIEDLERRCGSIPFKFFHVSHGRVSFFSFNRVELPVLP
FT                   "
FT   3'UTR           135680..135813
FT                   /locus_tag="VIT_08s0007g08930"
FT                   /old_locus_tag="Vv08s0007g08930"
FT   gene            138685..140130
FT                   /locus_tag="VIT_08s0007g08920"
FT                   /old_locus_tag="Vv08s0007g08920"
FT   mRNA            138685..140130
FT                   /locus_tag="VIT_08s0007g08920"
FT                   /old_locus_tag="Vv08s0007g08920"
FT                   /product="Predicted protein"
FT   CDS_pept        138685..140130
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08920"
FT                   /old_locus_tag="Vv08s0007g08920"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKU4"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="InterPro:IPR035595"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKU4"
FT                   /protein_id="CCB55101.1"
FT                   /translation="MGEDQNQQNHEENGVKEAPHVAVVMVPFPAQGHLNQLLQLSRIIS
FT                   SYNIPVHYVGSATHINQAKLRLQGWDPLLEPNFHFHDFPTPHFHSPPPDPDASVQFPAH
FT                   LQPCFEASSELREPVAALLRELSLTVDRLIVINDSLMGSVVQDFVGIGNAESYTFHSVS
FT                   VFSIFFFFWESLGRPALEGVKIPEDVPSLDGCFTLEFFKFLVFQHEFKKLSSGNLYYTS
FT                   KLIEGPYVDILREEEIDGVKKKGWALGPLNLVTTYSDKTSNPGDKCLEWLDKQAPKSVL
FT                   LVSFGTSTSLTDEQIKELAIGLERSGHKFIWLLRDADKGDIFSEEVRRSELPEGYEERM
FT                   KETGMGVVVREWAPQLEILGHSSTGGLMCHCGWNSCLESISMGVPIAAWPMHSDQPRNA
FT                   ALVTQVLQVGLAVKEWAEREQLVAASAIEKAVRRLMASEEGNAMRKKAQQLGNSLQRSM
FT                   EEGGVSRKELDGFIAHITRQLGF"
FT   gene            142202..146522
FT                   /locus_tag="VIT_08s0007g08910"
FT                   /old_locus_tag="Vv08s0007g08910"
FT   mRNA            join(142202..142216,144899..146506,146507..146522)
FT                   /locus_tag="VIT_08s0007g08910"
FT                   /old_locus_tag="Vv08s0007g08910"
FT                   /product="Predicted protein"
FT   CDS_pept        join(142202..142216,144899..146506)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08910"
FT                   /old_locus_tag="Vv08s0007g08910"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKU5"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="InterPro:IPR035595"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKU5"
FT                   /protein_id="CCB55102.1"
FT                   /translation="MDNEHIQNWETNRWHVINCFVIQEKIPLKIVSSLSPREVCFFVYK
FT                   SWARGRSNLIVIQQPQASASLGMDNHQNHEESEMKEAPVAVVMVPFPAQGHLNQLLQLS
FT                   RLISSYNVSVHYVGSVTHTHQAKLRVQGWDPLLHPNFQFHHFPTPHFHSPPPNPNSSVQ
FT                   FPAHLESSFEASSQLRQPVAALLRELSPRARRIIVIHDSLMGSVIQDVASIRNAESYTF
FT                   HSVSAFSIFLFLWEAAGKPVLKEAKFLEDVPSLDGCFPLEFLNFIASQHQFKKLNSGNI
FT                   YNTCKSMEGCYVDLLDGLEIYGGKKKHWALGPFNPLTICYDKKSNPGHRCLGWLDKQAP
FT                   KSVLLVSFGTTTSLTDEQIKELAIGLEQSKQKFIWVLRDADKGDVFSGEVRRAELPEGY
FT                   EERVGGRGMGLVVRDWAPQLEILGHSSTGGFMSHCGWNSCLESISMGVPIAAWPMHSDQ
FT                   PRNTVLVAQVLKVGLVVRDWAQREQLVAASTVEKKVRSLMASKEGDDMRKRAAELGATI
FT                   QRSMDEGGVSRKELDSFVAHITR"
FT   3'UTR           146507..146522
FT                   /locus_tag="VIT_08s0007g08910"
FT                   /old_locus_tag="Vv08s0007g08910"
FT   gene            147633..148374
FT                   /locus_tag="VIT_08s0007g08900"
FT                   /old_locus_tag="Vv08s0007g08900"
FT   mRNA            join(147633..147975,147976..148374)
FT                   /locus_tag="VIT_08s0007g08900"
FT                   /old_locus_tag="Vv08s0007g08900"
FT   5'UTR           147633..147975
FT                   /locus_tag="VIT_08s0007g08900"
FT                   /old_locus_tag="Vv08s0007g08900"
FT   CDS_pept        147976..148374
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08900"
FT                   /old_locus_tag="Vv08s0007g08900"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKU6"
FT                   /protein_id="CCB55103.1"
FT                   /translation="MPPFVSPPPNPNSSNKCSAHLQPSIEASMHLRQPVSALSPTTKRM
FT                   IIIHDPLIASVVWDATSIPNAEAYGFHCALLFPFSPTCGKPWEKLSHQQQKYLTSFHPC
FT                   FTFEIMNFSAHQYEFAKTAVGDLYNTCR"
FT   gene            148428..149136
FT                   /locus_tag="VIT_08s0007g08890"
FT                   /old_locus_tag="Vv08s0007g08890"
FT   mRNA            join(148428..148724,148725..148910,148911..149136)
FT                   /locus_tag="VIT_08s0007g08890"
FT                   /old_locus_tag="Vv08s0007g08890"
FT   5'UTR           148428..148724
FT                   /locus_tag="VIT_08s0007g08890"
FT                   /old_locus_tag="Vv08s0007g08890"
FT   CDS_pept        148725..148910
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08890"
FT                   /old_locus_tag="Vv08s0007g08890"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKU7"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKU7"
FT                   /protein_id="CCB55104.1"
FT                   /translation="MGLGMVVRDWAPPLEILGHVSTGGFMSHCGWNSCMESITMGVPIA
FT                   AWPMHSDQPQNSLLVT"
FT   3'UTR           148911..149136
FT                   /locus_tag="VIT_08s0007g08890"
FT                   /old_locus_tag="Vv08s0007g08890"
FT   gene            complement(151870..154182)
FT                   /locus_tag="VIT_08s0007g08880"
FT                   /old_locus_tag="Vv08s0007g08880"
FT   mRNA            complement(join(151870..151909,154028..154182))
FT                   /locus_tag="VIT_08s0007g08880"
FT                   /old_locus_tag="Vv08s0007g08880"
FT   CDS_pept        complement(join(151870..151909,154028..154182))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08880"
FT                   /old_locus_tag="Vv08s0007g08880"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7THT4"
FT                   /protein_id="CBI29810.3"
FT                   /translation="MIHGESKDKISIIELVNNVHITKVKLVFDVYLPNSKFRKSFSGDP
FT                   SIPYFINGPPPLKAQIEDL"
FT   gene            complement(155787..156749)
FT                   /locus_tag="VIT_08s0007g08870"
FT                   /old_locus_tag="Vv08s0007g08870"
FT   mRNA            complement(join(155787..155797,155798..155945,
FT                   156025..156160,156408..156592,156727..156749))
FT                   /locus_tag="VIT_08s0007g08870"
FT                   /old_locus_tag="Vv08s0007g08870"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(155787..155797)
FT                   /locus_tag="VIT_08s0007g08870"
FT                   /old_locus_tag="Vv08s0007g08870"
FT   CDS_pept        complement(join(155798..155945,156025..156160,
FT                   156408..156592,156727..156749))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08870"
FT                   /old_locus_tag="Vv08s0007g08870"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKU8"
FT                   /db_xref="InterPro:IPR024336"
FT                   /db_xref="InterPro:IPR024337"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKU8"
FT                   /protein_id="CCB55105.1"
FT                   /translation="MGGKIKYLVCCSVTCTSLLSATRIQAVRFRSFLFRSLSPSSSLPT
FT                   NPYNHQPQHRRRKKKTASTLLQKEVIGIVEDEDWASSSGGASNSEIYLQDANDEEEHYC
FT                   ISGSISNLQFSKAVSKAIWNDEIGMAAVVEKKGKIWITTGVVRNSKTYCSIEETLYATY
FT                   "
FT   gene            complement(157005..163737)
FT                   /locus_tag="VIT_08s0007g08860"
FT                   /old_locus_tag="Vv08s0007g08860"
FT   mRNA            complement(join(157005..157319,157320..157453,
FT                   157744..157820,159951..160039,160162..160292,
FT                   160384..160513,162113..162137,163254..163606,
FT                   163607..163737))
FT                   /locus_tag="VIT_08s0007g08860"
FT                   /old_locus_tag="Vv08s0007g08860"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(157005..157319)
FT                   /locus_tag="VIT_08s0007g08860"
FT                   /old_locus_tag="Vv08s0007g08860"
FT   CDS_pept        complement(join(157320..157453,157744..157820,
FT                   159951..160039,160162..160292,160384..160513,
FT                   162113..162137,163254..163606))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08860"
FT                   /old_locus_tag="Vv08s0007g08860"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7THT6"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR023486"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:D7THT6"
FT                   /protein_id="CBI29812.3"
FT                   /translation="MADAFCTDCKKNTEVVFDHSAGDTVCSECGLVLESHSIDETSEWR
FT                   TFANESGDNDPVRVGGPSNPLLTDGGLSTVIAKPNGVSGDFLSSSLGRWQNRGSNPDRG
FT                   LILAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSTRGRNQDALLAACLYIACRQED
FT                   KPRTVKEICSVANGATKKEIGRAKEYIVKQLEAEKGQSVEMGTIHAGDFMRRFCSNLGM
FT                   TNQVVKAAQEAVQKSEEFDIRRSPVSIAAAVIYIITQLSDEKKLLRDISIATGVAEGTI
FT                   RNSYKDLYPHISKIIPSWYAKEEDLRNLCSP"
FT   5'UTR           complement(163607..163737)
FT                   /locus_tag="VIT_08s0007g08860"
FT                   /old_locus_tag="Vv08s0007g08860"
FT   gene            complement(164275..173105)
FT                   /locus_tag="VIT_08s0007g08850"
FT                   /old_locus_tag="Vv08s0007g08850"
FT   mRNA            complement(join(164275..164359,169890..170170,
FT                   170396..170433,173042..173105))
FT                   /locus_tag="VIT_08s0007g08850"
FT                   /old_locus_tag="Vv08s0007g08850"
FT   CDS_pept        complement(join(164275..164359,169890..170170,
FT                   170396..170433,173042..173105))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08850"
FT                   /old_locus_tag="Vv08s0007g08850"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7THT7"
FT                   /db_xref="UniProtKB/TrEMBL:D7THT7"
FT                   /protein_id="CBI29813.3"
FT                   /translation="MNDGDCALNEPIFRSKHPPNAVKLNPSRVDSPRNVFLFVVAENGK
FT                   RGVVLIGRRRTTLETFCNLLCVSYDICERVEGFFFIVFFSFILKVFGGSLLLLDCTFKV
FT                   TPTSLSFKFYCIHSFHFSFLLMYIQKLEKSRFFFSFLFDSDFFIVCFPLKP"
FT   gene            173745..176029
FT                   /locus_tag="VIT_08s0007g08840"
FT                   /old_locus_tag="Vv08s0007g08840"
FT   mRNA            join(173745..173787,173829..173891,173892..174081,
FT                   174197..174268,174622..175949,175950..176029)
FT                   /locus_tag="VIT_08s0007g08840"
FT                   /old_locus_tag="Vv08s0007g08840"
FT                   /product="Glycosyltransferase"
FT   5'UTR           173745..173787
FT                   /locus_tag="VIT_08s0007g08840"
FT                   /old_locus_tag="Vv08s0007g08840"
FT   CDS_pept        join(173892..174081,174197..174268,174622..175949)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08840"
FT                   /old_locus_tag="Vv08s0007g08840"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKU9"
FT                   /db_xref="InterPro:IPR007657"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKU9"
FT                   /protein_id="CCB55106.1"
FT                   /translation="MVHHQRYHQLRKGEDDEEAQSLVDECGSAGYYKRTRPKLLALLFL
FT                   SLLSCCFVLAPCLFSFPIYSFGEYDGPVAEMDAKTLCSSIANGTICCDRSAFRTDTCFM
FT                   KGDVRTHSSSSSIFLYGSRNPNAFTDHVSSISGEGKEFEEEQLQHEKIKPYTRKWEASV
FT                   MDTIDELHLISKKEGYGTHHHCDVHHDVPAVFFSTGGYTGNIYHEFNDGILPLYITSQH
FT                   LNKRVVFVILEYHDWWITKYGDVISQLSDYPPIDFSGDNRTHCFPEAIVGLRIHDELTV
FT                   DSSLVEGNESIRDFRNLLDQAYLPRIRSLIQAKEQKVQSKMKEDPSLPPSLKPPLETGK
FT                   EEQVHQLKKPKLVVLSRTGARAITNEDLMVQMAKEIGFQVKVLRPNRATELAKIYRVLN
FT                   SSDAMVGVHGAAMTHILFLQPGSVFIQVIPLGTEWPAETYYGEPAEKLGLKYMGYKILP
FT                   RESSLYNEYAKDDPVLRDPDSLAKKGWEFTKRVYLDHQTVTLDLRRFRKQLVCAYDYYI
FT                   LKASRHSHFLSY"
FT   3'UTR           175950..176029
FT                   /locus_tag="VIT_08s0007g08840"
FT                   /old_locus_tag="Vv08s0007g08840"
FT   gene            complement(179844..180386)
FT                   /locus_tag="VIT_08s0007g08830"
FT                   /old_locus_tag="Vv08s0007g08830"
FT   mRNA            complement(join(179844..180063,180064..180318,
FT                   180319..180386))
FT                   /locus_tag="VIT_08s0007g08830"
FT                   /old_locus_tag="Vv08s0007g08830"
FT                   /product="Polcalcin Che a 3"
FT   3'UTR           complement(179844..180063)
FT                   /locus_tag="VIT_08s0007g08830"
FT                   /old_locus_tag="Vv08s0007g08830"
FT   CDS_pept        complement(180064..180318)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08830"
FT                   /old_locus_tag="Vv08s0007g08830"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKV0"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR039647"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKV0"
FT                   /protein_id="CCB55107.1"
FT                   /translation="MADNPQDQEERERIFKRFDTNGDGKISSTELGDALKTLGSVSADE
FT                   VQRMMQEIDTDGDGFISFDEFADFHRANRGLMKDVAKVF"
FT   5'UTR           complement(180319..180386)
FT                   /locus_tag="VIT_08s0007g08830"
FT                   /old_locus_tag="Vv08s0007g08830"
FT   gene            183376..183612
FT                   /locus_tag="VIT_08s0007g08820"
FT                   /old_locus_tag="Vv08s0007g08820"
FT   mRNA            183376..183612
FT                   /locus_tag="VIT_08s0007g08820"
FT                   /old_locus_tag="Vv08s0007g08820"
FT   CDS_pept        183376..183612
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08820"
FT                   /old_locus_tag="Vv08s0007g08820"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7THU0"
FT                   /db_xref="InterPro:IPR039768"
FT                   /db_xref="UniProtKB/TrEMBL:D7THU0"
FT                   /protein_id="CBI29816.3"
FT                   /translation="MILKLSYLPLILALPLSAVARESSMFRVHHQTIGRVPCCKCGIPT
FT                   APTAANMCVNCLPSEVDIPEGLQKHATLFGGNI"
FT   gap             197127..197189
FT                   /estimated_length=63
FT   gene            complement(199766..202479)
FT                   /locus_tag="VIT_08s0007g08810"
FT                   /old_locus_tag="Vv08s0007g08810"
FT   mRNA            complement(join(199766..200110,200111..201589,
FT                   202393..202479))
FT                   /locus_tag="VIT_08s0007g08810"
FT                   /old_locus_tag="Vv08s0007g08810"
FT                   /product="Predicted protein"
FT   3'UTR           complement(199766..200110)
FT                   /locus_tag="VIT_08s0007g08810"
FT                   /old_locus_tag="Vv08s0007g08810"
FT   CDS_pept        complement(join(200111..201589,202393..202479))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08810"
FT                   /old_locus_tag="Vv08s0007g08810"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKV1"
FT                   /db_xref="InterPro:IPR007064"
FT                   /db_xref="InterPro:IPR039768"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKV1"
FT                   /protein_id="CCB55108.1"
FT                   /translation="MAPHQEALSEIALQTRESPVFLCHSQSSQLSDMTEEAGMFRVHHT
FT                   IGSVLCCKCGIPMTPNAANMCVKCLRTEVDITEGLQKHATLVHCPECDRYFRPPKTWIE
FT                   PQLESKELLTLCLKTLKNLNQVRLIHAEFIWTEPHSKRIKVKLRVQKEVLNGAILEQAY
FT                   IVEYVQQEHMCESCSRVQANPDQWVASVQVRQHVPHRRTLFYLEQLILMHDAARCAKKI
FT                   KPMNQGIDFFFANWSHGKKFVEFIGKMVPIKSHRPSQQLVSHDPKSNNYYYKYTLSVEI
FT                   CPICREDLICLPREVASGLGNPHSLVICTKVTNRITFLDPYTLKHHCLDAEQYWRSPFK
FT                   ALLSSRQLVEYIVLDVGIVYSEVHVGGSKYALADAQVARLSDFGKNDTIFNITTHLGHL
FT                   LNPGDHALGYDMFATNSNDMELEKYRDFDLPPAILIRKTYEENCQGKGGKPPPLMSREY
FT                   EEFLRRLEDNPELTLNISLHENKEYPPPSVRDGEEDSACGALEKLLANVDLSDDEDGDD
FT                   AMAE"
FT   gene            complement(205073..215568)
FT                   /locus_tag="VIT_08s0007g08800"
FT                   /old_locus_tag="Vv08s0007g08800"
FT   mRNA            complement(join(205073..205483,205484..205509,
FT                   205950..206122,206215..206855,207147..207310,
FT                   207588..207838,208410..208567,208683..208880,
FT                   209106..209212,209315..209488,209622..209717,
FT                   210566..210647,212018..212104,213494..213615,
FT                   214340..214583,214654..214800,214972..215129,
FT                   215508..215568))
FT                   /locus_tag="VIT_08s0007g08800"
FT                   /old_locus_tag="Vv08s0007g08800"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(205073..205483)
FT                   /locus_tag="VIT_08s0007g08800"
FT                   /old_locus_tag="Vv08s0007g08800"
FT   CDS_pept        complement(join(205484..205509,205950..206122,
FT                   206215..206855,207147..207310,207588..207838,
FT                   208410..208567,208683..208880,209106..209212,
FT                   209315..209488,209622..209717,210566..210647,
FT                   212018..212104,213494..213615,214340..214583,
FT                   214654..214800,214972..215129,215508..215568))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08800"
FT                   /old_locus_tag="Vv08s0007g08800"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKV2"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="InterPro:IPR036872"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKV2"
FT                   /protein_id="CCB55109.1"
FT                   /translation="MEGSATTHDMNLASRKAEEAAWRRFQAAGWLETLVGPIGVSTHPS
FT                   EREFVSCLRNGLILCNAINKIHPGSVPKIVENHSSSQSLTWESQPLPAYQYFENVRNFL
FT                   VAVEELKLPAFEASDLERDTLEAGSAAKVVDCILVLKSYHEWKQMGGGNGYYKHVRSPM
FT                   VVHSANRVNSTASAANPSDSCRRLDMSVTPPLDGEARKLEDLIVSVFAECMVDVKENID
FT                   DNLLDSFRSGNRVINHFNDIYKMKPIFKDLLQEGSDSNVHSKSTPLENSSTDLKALLSR
FT                   TKREFKGLESQLQNDLKQLGNVVQEMSAAAVGYQRVVKENRNLYNMVQDLKGNIRVYCR
FT                   IRPAFSVGARSTIDFIGEDGSLVIVDPLKRQRDGRRVFQFDRVFDPTATQDAVFKDTQP
FT                   LIRSVMDGYNVCIFAYGQTGSGKTYTMCGPSGGSTKDMGINYLALNDLFQMSNKRKDII
FT                   TYDIYVQMVEIYNEQVRDLLAEDSSTTKYPFLMAIRSCTSENGLSLPDATVHSVKSTAD
FT                   VLNLMKLGELNRHVSSTAINNRSSRSHSVLTIHVHGNDLSGSILRSCLHLVDLAGSERV
FT                   DKSEVTGDRLKEAQYINKSLSCLGDVITALAQKNSHIPYRNSKLTLLLQDSLGGHAKTL
FT                   MFAHLSPEDDSFGETISTLKFAQRVSTVELGTARLNKESSKVMELKEQIENLKKALSNK
FT                   EGHSIIPSKVNEPRPPSEKPKGMIDRTPPRPRRLSIENCSSLKKEKAMHPEEKKGSKTP
FT                   SIRTRARRLSLEGSNQGKKDHLLVKMSEDVSKLQPLEAFGHFSTGSSMMEEEVFNYQKA
FT                   PKSPVSSTYKSRVAKAASRTQVAPFQLTKTPEPDRKEVQTMMQSDLSVSKDSQIPSFIS
FT                   SGNGKGSQIRKSLRTIGKLINGSEKRNQQKLMEARTPIKGSNNAEGGRSPLTANARAMR
FT                   RQSLTGIQTSGPWRSSVIGKSSDSCSNETRNA"
FT   gene            220783..222971
FT                   /locus_tag="VIT_08s0007g08790"
FT                   /old_locus_tag="Vv08s0007g08790"
FT   mRNA            join(220783..220809,220810..220991,221538..221610,
FT                   221692..221786,221914..222013,222100..222141,
FT                   222918..222971)
FT                   /locus_tag="VIT_08s0007g08790"
FT                   /old_locus_tag="Vv08s0007g08790"
FT                   /product="Predicted protein"
FT   5'UTR           220783..220809
FT                   /locus_tag="VIT_08s0007g08790"
FT                   /old_locus_tag="Vv08s0007g08790"
FT   CDS_pept        join(220810..220991,221538..221610,221692..221786,
FT                   221914..222013,222100..222141,222918..222971)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08790"
FT                   /old_locus_tag="Vv08s0007g08790"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7THU3"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="InterPro:IPR002487"
FT                   /db_xref="InterPro:IPR033896"
FT                   /db_xref="InterPro:IPR036879"
FT                   /db_xref="UniProtKB/TrEMBL:D7THU3"
FT                   /protein_id="CBI29819.3"
FT                   /translation="MGRGKIEIKKIENINSRQVTFSKRRAGLLKKAKELSVLCDAEVGV
FT                   IIFSSTGKLYEFSSSSMEHTLTRYGRGLDSELPSLHRSAEFTIPVVFTFEQESQPEVAS
FT                   LKEEVAKLQKGYLRMMGKELDGLSFKELQHLEHLLSEGILSVKDKKEQVLLEQLKKSRM
FT                   HEQRAMMENETLRKQVNP"
FT   gene            226184..227096
FT                   /locus_tag="VIT_08s0007g08780"
FT                   /old_locus_tag="Vv08s0007g08780"
FT   mRNA            join(226184..226297,226298..227086,227087..227096)
FT                   /locus_tag="VIT_08s0007g08780"
FT                   /old_locus_tag="Vv08s0007g08780"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           226184..226297
FT                   /locus_tag="VIT_08s0007g08780"
FT                   /old_locus_tag="Vv08s0007g08780"
FT   CDS_pept        226298..227086
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08780"
FT                   /old_locus_tag="Vv08s0007g08780"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKV3"
FT                   /db_xref="InterPro:IPR006460"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKV3"
FT                   /protein_id="CCB55110.1"
FT                   /translation="MKQEQLTLHRSSSSCRSTRKILPSTYTRSSSESGDISDKLLVPRD
FT                   SSPAFPRLARTRNSISALLRSLLGVISFPTIIPTCRWLSIPNHLSITPSLGRKVTGTLF
FT                   GHRRGHVSFAVQDDPRSEPVLLLELATSTSTLVKEMSSGLVRIALECEKVAARGRPVKL
FT                   FQEPMWTMYCNGRKCGYAMSRECGEFDRHVLSTVQSVSAGAGVIPTDDNRKSIVGVEGE
FT                   MLYMRARFERVVGSRDSEAFYMMNPDGTGGPELSIFLLRI"
FT   3'UTR           227087..227096
FT                   /locus_tag="VIT_08s0007g08780"
FT                   /old_locus_tag="Vv08s0007g08780"
FT   gene            229937..236010
FT                   /locus_tag="VIT_08s0007g08770"
FT                   /old_locus_tag="Vv08s0007g08770"
FT   mRNA            join(229937..229977,229978..230142,230229..230333,
FT                   231024..231101,232284..232425,232549..232619,
FT                   234270..234366,234552..234769,235602..235856,
FT                   235857..236010)
FT                   /locus_tag="VIT_08s0007g08770"
FT                   /old_locus_tag="Vv08s0007g08770"
FT                   /product="Predicted protein"
FT   5'UTR           229937..229977
FT                   /locus_tag="VIT_08s0007g08770"
FT                   /old_locus_tag="Vv08s0007g08770"
FT   CDS_pept        join(229978..230142,230229..230333,231024..231101,
FT                   232284..232425,232549..232619,234270..234366,
FT                   234552..234769,235602..235856)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08770"
FT                   /old_locus_tag="Vv08s0007g08770"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKV4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKV4"
FT                   /protein_id="CCB55111.1"
FT                   /translation="MGGVRSMVKKGLGEMGFNKGGGAINWFPGHMAAATRAIRHRLKVS
FT                   DLVIEVRDARLPLSSANEDLQPSLSGKRRVIALNKKDLANPNIMHKWTHYFDSCKQDCI
FT                   SINAHSRSSVKKLLELVELKLREVISREPTLLVMVVGVPNVGKSALINSIHQIATSRFP
FT                   VQEKMKRATVGPLPGVTQDIAGFKIAHQPSIYVLDTPGVLVPSIPDIETGLKLALAGSV
FT                   KDSVVGEERIAQYLLAVLNTRSTPLHWRHLNNRRIEELRNEYEDKHDYNLKDLLPNKRK
FT                   LPNRSDVKYIEDLVTEVQCALHVTLSEFNGNLEEENDLESLIEQQFEKLQKAMKIPHKA
FT                   SEARTMVSKKLLTLFRTGKLGPFILDDVPDSPNPVS"
FT   3'UTR           235857..236010
FT                   /locus_tag="VIT_08s0007g08770"
FT                   /old_locus_tag="Vv08s0007g08770"
FT   gene            complement(237124..247255)
FT                   /locus_tag="VIT_08s0007g08760"
FT                   /old_locus_tag="Vv08s0007g08760"
FT   mRNA            complement(join(237124..237315,237316..237376,
FT                   237698..237828,238909..239013,239107..239193,
FT                   240712..240819,241955..242234,243952..244217,
FT                   244692..244797,244926..245133,247018..247255))
FT                   /locus_tag="VIT_08s0007g08760"
FT                   /old_locus_tag="Vv08s0007g08760"
FT                   /product="Thioredoxin reductase"
FT   3'UTR           complement(237124..237315)
FT                   /locus_tag="VIT_08s0007g08760"
FT                   /old_locus_tag="Vv08s0007g08760"
FT   CDS_pept        complement(join(237316..237376,237698..237828,
FT                   238909..239013,239107..239193,240712..240819,
FT                   241955..242234,243952..244217,244692..244797,
FT                   244926..245133,247018..247255))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08760"
FT                   /old_locus_tag="Vv08s0007g08760"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKV5"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKV5"
FT                   /protein_id="CCB55112.1"
FT                   /translation="MAAKIGLGLGSVTQRAAMAAVTPSPSPSPLSNALPPPHSVIFLKS
FT                   WSARRRSLRLDSSRKSPFSLRVKASTSSDSEASSAKGVENVVIIGSGPAGYTAAIYAAR
FT                   ANLKPVVFEGYQVGGVPGGQLMTTTEVENFPGFPDGITGPDLMDRMRRQAERWGAELFQ
FT                   EDVEFLDVKTTPFTVQSSERKVKCYSVIFATGATAKRLKLPREDEFWSRGISACAICDG
FT                   ASPLFKGQVLAVVGGGDTATEEALYLTKYARHVHLLVRRNELRASKAMQDRVHNNPNIT
FT                   LHFNTEAVDIVSNNRGQMSGILLRKVDTGEESVLEAKGLFYGIGHTPNSQLLKGQVELD
FT                   SSGYVIVEEGSARTSVEGVFAAGDVQDHEWRQAVTAAGSGCVAALSVERYLVGNNLLIE
FT                   FHQPQTEEVKKELTDRDVREGFDITLTKHRGQYSLRKLYHESPRLICVLYTAPTCGPCR
FT                   TLKPILSKVIDEFDQNVHFVEIDIEEDPEIAEAAGIMGTPCVQFFKNKEMIKTLSGVKM
FT                   KNEYREFIESNK"
FT   gene            252040..253475
FT                   /locus_tag="VIT_08s0007g08750"
FT                   /old_locus_tag="Vv08s0007g08750"
FT   mRNA            join(252040..252341,252342..252581,252868..253353,
FT                   253354..253475)
FT                   /locus_tag="VIT_08s0007g08750"
FT                   /old_locus_tag="Vv08s0007g08750"
FT                   /product="Predicted protein"
FT   5'UTR           252040..252341
FT                   /locus_tag="VIT_08s0007g08750"
FT                   /old_locus_tag="Vv08s0007g08750"
FT   CDS_pept        join(252342..252581,252868..253353)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08750"
FT                   /old_locus_tag="Vv08s0007g08750"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKV6"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR027725"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKV6"
FT                   /protein_id="CCB55113.1"
FT                   /translation="MEGDHCEKGLLEYVRKSTPPPFLLKTYMLVEDPATDGVISWNSDG
FT                   TAFVVWQPAEFARDLLPTLFKHSNFSSFVRQLNTYGFRKVATSRWEFCNDMFRRGEREL
FT                   LCEIRRRKAWTKQQQQQQQQQQAVGGPADQNGVQELEDDQRSSSTSSSSGYSSLVDENK
FT                   RLKKENGVLCSELTSMKNKCKELLDLVAMHAGPEKEEEDDERPKLFGVRLEVQGDRERK
FT                   RKRAEISETASILLSQSCK"
FT   3'UTR           253354..253475
FT                   /locus_tag="VIT_08s0007g08750"
FT                   /old_locus_tag="Vv08s0007g08750"
FT   gene            complement(256304..257145)
FT                   /locus_tag="VIT_08s0007g08740"
FT                   /old_locus_tag="Vv08s0007g08740"
FT   mRNA            complement(join(256304..256635,256636..256779,
FT                   257101..257145))
FT                   /locus_tag="VIT_08s0007g08740"
FT                   /old_locus_tag="Vv08s0007g08740"
FT   3'UTR           complement(256304..256635)
FT                   /locus_tag="VIT_08s0007g08740"
FT                   /old_locus_tag="Vv08s0007g08740"
FT   CDS_pept        complement(join(256636..256779,257101..257145))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08740"
FT                   /old_locus_tag="Vv08s0007g08740"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKV7"
FT                   /protein_id="CCB55114.1"
FT                   /translation="MTKRMGFDPTSIFMITEWEEEDGEKGKLKRGRLQLMGVDDEFAKY
FT                   LNLEEGQLPSTHIQNGD"
FT   gene            complement(257236..285876)
FT                   /locus_tag="VIT_08s0007g08730"
FT                   /old_locus_tag="Vv08s0007g08730"
FT   mRNA            complement(join(257236..257382,257383..257464,
FT                   257564..257619,257967..258100,258412..258712,
FT                   258793..258867,258966..259102,259919..260069,
FT                   260362..260469,260578..260657,261034..261169,
FT                   261279..261539,262707..262853,265151..265255,
FT                   265352..265479,269079..269175,269263..269304,
FT                   269919..270002,271910..272120,272615..272793,
FT                   272930..273631,273998..274069,274184..274238,
FT                   275325..275509,275590..275688,277119..277205,
FT                   278684..278746,279143..279249,280102..280214,
FT                   280294..280502,280710..280799,280882..280996,
FT                   281097..281329,281458..281544,281719..281779,
FT                   281907..282121,282272..282488,283700..283782,
FT                   283967..284138,284733..284812,285790..285876))
FT                   /locus_tag="VIT_08s0007g08730"
FT                   /old_locus_tag="Vv08s0007g08730"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(257236..257382)
FT                   /locus_tag="VIT_08s0007g08730"
FT                   /old_locus_tag="Vv08s0007g08730"
FT   CDS_pept        complement(join(257383..257464,257564..257619,
FT                   257967..258100,258412..258712,258793..258867,
FT                   258966..259102,259919..260069,260362..260469,
FT                   260578..260657,261034..261169,261279..261539,
FT                   262707..262853,265151..265255,265352..265479,
FT                   269079..269175,269263..269304,269919..270002,
FT                   271910..272120,272615..272793,272930..273631,
FT                   273998..274069,274184..274238,275325..275509,
FT                   275590..275688,277119..277205,278684..278746,
FT                   279143..279249,280102..280214,280294..280502,
FT                   280710..280799,280882..280996,281097..281329,
FT                   281458..281544,281719..281779,281907..282121,
FT                   282272..282488,283700..283782,283967..284138,
FT                   284733..284812,285790..285876))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08730"
FT                   /old_locus_tag="Vv08s0007g08730"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKV8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR026082"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKV8"
FT                   /protein_id="CCB55115.1"
FT                   /translation="MGRQRAQLRAMLRKNWLLKIRHPFVTCAEILLPTVVMLMLIAVRT
FT                   QVDTKVHSAQPYVRKGMFVEVGKGDVSPSFGQVLELLLAKGEYLAFAPDTKETRMMINL
FT                   MSIKFPLLKLVTRVYKDELELDTYIRSDLYGTCNQVKNCSNPKIKGAVVFHDQGPLVFD
FT                   YSIRLNHSWAFSGFPDVKTIMDTNGPYLNDLELGVDAVPTLQYSFSGFLTLQQVLDSFI
FT                   IFAAQQNEANMVNENIELPSNTSLIKQSWMQFIPSNIKIVPFPTREYTDDEFQSIIKSV
FT                   MGLLYLLGFLYPISRLISYSVFEKEQKIKESLYMMGLKDEIFHLSWFITYALQFAVTSG
FT                   IITACTMDTLFQYSDKSLVFIYFFLFGLSAIMLSFLISTFFTRAKTAVAVGTLSFLGAF
FT                   FPYYTVNDQAVPMILKFIASLLSPTAFALGSINFADYERAYVGLRWSNVWRASSGVNFL
FT                   ACLLMMLLDALLYCAIGLYLDKVLPRENGVRSPWNFPFLKCSWRKRSSIKHEDCSFDFK
FT                   NDRRKVNFCSNDISGPAVEAISLDMKQQELDGRCIQIRNLHKVYATKKGNCCAVNSLRL
FT                   TLYENQILALLGHNGAGKSTTISMLVGLLPPTSGDALVFGKNIITEMDEIRKQLGVCPQ
FT                   NDILFPELTVKEHLEIFAILKGVTENFLESAVTEMVDEVGLADKVNTVVGALSGGMKRK
FT                   LSLGIALIGNSKVIVLDEPTSGMDPYSMRLTWQLIKRIKKGRIILLTTHSMDEADVLGD
FT                   RIAIMANGSLKCCGSSLFLKHQYGVGYTLTLVKSAPSASIAADIVYRHVPSATCVSEVG
FT                   TEISFKLPLSSSSSFESMFREIESCMNSVHNSDRSGNEDKYNLGIESYGISVTTLEEVF
FT                   LRVAGCDFDETECSKQEKLHVLPDSVVSQASPNHAPKQIFHSKPLGKYKIIGVVSTIVE
FT                   RACSLIFAAVLSFINFFSVQCCSCCFISKSIFWEHSKALLIKRAIIARRDRKTIVFQLL
FT                   IPAVFLLFGLLLLKLKPHPDQQSVTFTTSHFNPLLRGGGGGGPIPFDLSWPIAKEVAWY
FT                   VEGGWIQRFKPTTYRFPDPDKALADAIEAAGPTLGPTLLSMSEFLMSSFNESYQSRYGA
FT                   VVMDDQNKDGSLGYTVLHNGSCQHAAPTFINLMNAAILRFATLNKNMTIQTRNHPLPMT
FT                   KSQHLQRHDLDAFSAAVIVNIALSFVPASFAVSIVKEREVKAKHQQLISGVSVLSYWAS
FT                   TYLWDFVSFLLPSSFAITLFYIFGMDQFIGKGRFFPTVLMFLEYGLAIASSTYCLTFSF
FT                   SDHTMAQNVVLLLHFFTGLVLMVISFIMGLIQTTESTNSVLKNFFRLSPGFCFADGLAS
FT                   LALLRQGMKGGSSDGVLDWNVTGASICYLGVESIGFFLLTLGLELLPPRKFSLFTILEP
FT                   WRAIKNSWHGTSSYLEPLLESTSETASIDLDEDIDVQTERNRVLSGSADNAIIYLRNLR
FT                   KVYPGGKHLSPKIAVHSLTFSVHEGECFGFLGTNGAGKTTTLSMLTGEECPTDGTAFIF
FT                   GKDVCSNPKAARRHIGYCPQFDALLEYLTVQEHLELYARIKGVPGYRMQDVVMEKLVEF
FT                   DLLRHANKPSFSLSGGNKRKLSVAIAMVGDPPIVILDEPSTGMDPIAKRFMWEVISRLS
FT                   TRRGKTAVILTTHSMAEAQALCTRIGIMVGGRLRCIGSSQHLKTRFGNHLELEVKPTEV
FT                   SHVDLENLCRFIQERLFHIPHPRSILSDLEVCIGAVDSITSENASVAEISLSPEMIVMI
FT                   GRWLGNEERISTLVSSTPVSDGVFGEQLSEQLFRDGGISLPIFSEWWLAKEKFSAIDSF
FT                   ILSSFPGATFHGCNGLSVKYQLPYGYISLADVFGHLERNRYQLGIAEYSLSQSTLESIF
FT                   NHFAANS"
FT   gene            290571..293013
FT                   /locus_tag="VIT_08s0007g08720"
FT                   /old_locus_tag="Vv08s0007g08720"
FT   mRNA            join(290571..290616,290617..293013)
FT                   /locus_tag="VIT_08s0007g08720"
FT                   /old_locus_tag="Vv08s0007g08720"
FT                   /product="unknown predicted protein"
FT   5'UTR           290571..290616
FT                   /locus_tag="VIT_08s0007g08720"
FT                   /old_locus_tag="Vv08s0007g08720"
FT   CDS_pept        290617..293013
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08720"
FT                   /old_locus_tag="Vv08s0007g08720"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKV9"
FT                   /protein_id="CCB55116.1"
FT                   /translation="MNLSPQICRSVLHFIPKQSRFRCLHANLFTTAQGAAISNEVLTVM
FT                   ETVNPMEDALEKLAPFLSSEIVNDVMREQRRPELGFRFFIWTTRRRSFRSWVTHNLVID
FT                   MLAKDDGFDTYWKILEELKNSNIQIPPPTFSVLIAAYAKSGMAEKAVESFGKMKDFGCK
FT                   PDVFTYNSILHVMVQKEVFLLALAVYNQMLKLNYNPNRATFVILLNGLCKNGKTDDALK
FT                   MFDEMTQKGIPPNTMIYTIILSGLCQAKRTDDVHRLLNTMKVSGCCPDSITCNALLDGF
FT                   CKLGQIDEAFALLQLFEKEGYVLGIKGYSSLIDGLFRAKRYDEVQEWCRKMFKAGIEPD
FT                   VVLYTILIRGFCEVGMVDYALNMLNDMTQRGLSPDTYCYNALIKGFCDVGLLDKARSLQ
FT                   LEISKNDCFPTSCTYTILICGMCRNGLLDEARQIFNQMENLGCSPSIMTFNALIDGLCK
FT                   AGELEEARHLFYKMEIGKNPSLFLRLSQGADRVMDTASLQTMVERLCESGLILKAYKLL
FT                   MQLADSGVVPDIMTYNVLINGFCKAKNINGAFKLFRELQLKGHSPDSVTYGTLIDGFHR
FT                   VDREEDAFRVLDQMVKNGCTPSSAVYKCLMTWSCRKGKLSVAFSLWLKYLRSLPSQEDE
FT                   TLKLAEEHFEKGELEKAVRCLLEMNFKLNNFEIAPYTIWLIGLCQARRSEEALKIFLVL
FT                   KECQMDVNPPSCVMLINGLCKDGNLEMAVDIFLYTLEKGFMLMPRICNQLLRSLILQDK
FT                   MKHALDLLNRMNSAGYDLDEYLHHRIKSYLLSVWKAQEMENVAPG"
FT   gene            complement(294070..298860)
FT                   /locus_tag="VIT_08s0007g08710"
FT                   /old_locus_tag="Vv08s0007g08710"
FT   mRNA            complement(join(294070..294181,294182..294342,
FT                   296280..296404,296903..297033,297789..297866,
FT                   298021..298126,298590..298642,298643..298860))
FT                   /locus_tag="VIT_08s0007g08710"
FT                   /old_locus_tag="Vv08s0007g08710"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(294070..294181)
FT                   /locus_tag="VIT_08s0007g08710"
FT                   /old_locus_tag="Vv08s0007g08710"
FT   CDS_pept        complement(join(294182..294342,296280..296404,
FT                   296903..297033,297789..297866,298021..298126,
FT                   298590..298642))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08710"
FT                   /old_locus_tag="Vv08s0007g08710"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKW0"
FT                   /db_xref="InterPro:IPR023128"
FT                   /db_xref="InterPro:IPR037132"
FT                   /db_xref="InterPro:IPR039733"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKW0"
FT                   /protein_id="CCB55117.1"
FT                   /translation="MTTSNLDISQFDHTPFYCEENVYMLCKKLGMIGMADAEGSDLFAV
FT                   FISNEKKQVPLWHQKASKRADGIILWDYHVICIQIKKEGSSPPQVWDLDSSLPFPSHLD
FT                   HYMSDSFRPSFQLFSDYQRFFRIVHAPLFLHSFASDRRHMKNSDGNWISPPPAQDPIVA
FT                   DDGSLYNLDEYIRMNAADAVTEVKDDTISAVFTQKYGVLVRESQLEEFFSLLSG"
FT   5'UTR           complement(298643..298860)
FT                   /locus_tag="VIT_08s0007g08710"
FT                   /old_locus_tag="Vv08s0007g08710"
FT   gene            298979..299743
FT                   /locus_tag="VIT_08s0007g08700"
FT                   /old_locus_tag="Vv08s0007g08700"
FT   mRNA            298979..299743
FT                   /locus_tag="VIT_08s0007g08700"
FT                   /old_locus_tag="Vv08s0007g08700"
FT                   /product="At2g41750"
FT   CDS_pept        298979..299743
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08700"
FT                   /old_locus_tag="Vv08s0007g08700"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="InterPro:IPR039262"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKW1"
FT                   /protein_id="CCB55118.1"
FT                   /translation="MDLEGELTRLDLSDADAASSSGVDGGSESRRRICDNCSRPENVCL
FT                   CGSLPSEPISTATQIVILHHPHEHRHKLSTVPILTKCLLNTHTIVGRRLRHGSSAMLDS
FT                   LHSSSSTDQLPRAIYLFPGPTSTHISQLNPKPGTVLILFDATWKHAKEMVDASAEYLST
FT                   FAIRACLDCDFGETGGSIFDSELILRKEPFRGCVSTMEAAARALRFLEPNGPEIESRLL
FT                   NVLREMVKFQASHLKPMKPRPKLLKKGQPKKE"
FT   gene            311918..322576
FT                   /locus_tag="VIT_08s0007g08690"
FT                   /old_locus_tag="Vv08s0007g08690"
FT   mRNA            join(311918..311959,311960..312015,312234..312333,
FT                   312939..313007,313100..313336,313420..313597,
FT                   313751..313883,315186..315345,315419..315569,
FT                   315649..315749,315854..316012,317268..317336,
FT                   317408..317476,317615..317752,318352..318480,
FT                   319201..319348,319521..319531,319631..319771,
FT                   319852..319977,320617..320679,321165..321432,
FT                   321680..321918,322008..322121,322122..322576)
FT                   /locus_tag="VIT_08s0007g08690"
FT                   /old_locus_tag="Vv08s0007g08690"
FT                   /product="Predicted protein"
FT   5'UTR           311918..311959
FT                   /locus_tag="VIT_08s0007g08690"
FT                   /old_locus_tag="Vv08s0007g08690"
FT   CDS_pept        join(311960..312015,312234..312333,312939..313007,
FT                   313100..313336,313420..313597,313751..313883,
FT                   315186..315345,315419..315569,315649..315749,
FT                   315854..316012,317268..317336,317408..317476,
FT                   317615..317752,318352..318480,319201..319348,
FT                   319521..319531,319631..319771,319852..319977,
FT                   320617..320679,321165..321432,321680..321918,
FT                   322008..322121)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08690"
FT                   /old_locus_tag="Vv08s0007g08690"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7THV1"
FT                   /db_xref="InterPro:IPR003128"
FT                   /db_xref="InterPro:IPR007122"
FT                   /db_xref="InterPro:IPR007123"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="InterPro:IPR036886"
FT                   /db_xref="UniProtKB/TrEMBL:D7THV1"
FT                   /protein_id="CBI29827.3"
FT                   /translation="MSSSGKVLDPAFQGVGQRVGTEIWRIENFQPVPLPKSDYGKFYTG
FT                   DSYIVLQTSPGKGGAYLYDIHFWIGKDTSQDESGTAAIKTVELDTVLGGRAVQHRELQG
FT                   YESDKFLSYFKPCIIPLEGGIASGFKKPEEEVFETRLYVCKGKRVVRLKQVPFARSSLN
FT                   HDDVFILDTENKIYQFNGANSNIQERAKALEVIQFFKDKYHEGKCDVAIVDDGKLVAES
FT                   DSGEFWVLFGGFAPIGKKVATEDDVIPETTPAKLYSITDGQVNAVEGELSKAMLENNKC
FT                   YLLDCGAEVFVWVGRVTQVEDRKAASQAAEEFVSSQNRPKATRVTRVIQGYETHSFKSN
FT                   FDSWPSGSAAGGAEEGRGKVAALLKQQGVGVKGMSKGSPVNEEVPPLLEAGGKIEVWRI
FT                   NGSAKTPVLKEDIGKFYSGDCYIVLYTYHSGDKKEEYFLCCWIGNESIEEDQNMAARLA
FT                   NTMFNSLKGRPVQGRIFQGKEPPQFVAIFQPMVVLKGGMSSGYKKSIADKGLNDETYTA
FT                   DCIALLRISGTSVHNNKVVQVDAAATSLNSNECFLLQSGSSIFTWHGNQSTFEQQQLAA
FT                   KVADFLKPGVTLKHAKEGTESSAFWFALGGKQNYTSKKASQEIVRDPHLFTFSFNKGKF
FT                   EVEEIYNFNQDDLLTEDILILDTHAEVFVWVGQTVDPKEKQSAFEIGQKYIEVAASLEG
FT                   LALNVPLYRVTEGNEPCFFTIYFSWDSTKATVQGNSFQKKVFLLFGAGHAAETQDRSNG
FT                   SNQGGPTQRASAMAALTSAFRPSSGNRTTAPRPSGRGQGSSQRAAAVAALSSVLTAETK
FT                   KRSPDASPSRSSRSPPPPESSPSAAIKSEMAVSETEDSQGVSDANENEGAAAVPESNGE
FT                   DSAPKREEQQDDIGTEAGQSTFSYDQLKAKSENPVTGIDFKRREAYLSDEEFQTVLGMT
FT                   KDAFYKLPKWKQDMTKKKVDLF"
FT   3'UTR           322122..322576
FT                   /locus_tag="VIT_08s0007g08690"
FT                   /old_locus_tag="Vv08s0007g08690"
FT   gene            complement(331836..333558)
FT                   /locus_tag="VIT_08s0007g08680"
FT                   /old_locus_tag="Vv08s0007g08680"
FT   mRNA            complement(join(331836..331977,331978..333513,
FT                   333514..333558))
FT                   /locus_tag="VIT_08s0007g08680"
FT                   /old_locus_tag="Vv08s0007g08680"
FT                   /product="Predicted protein"
FT   3'UTR           complement(331836..331977)
FT                   /locus_tag="VIT_08s0007g08680"
FT                   /old_locus_tag="Vv08s0007g08680"
FT   CDS_pept        complement(331978..333513)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08680"
FT                   /old_locus_tag="Vv08s0007g08680"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKW2"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKW2"
FT                   /protein_id="CCB55119.1"
FT                   /translation="MSVSAKAKSSSEGWGMGFLLVFFPEDDPIINKKKNLFSSSSSSSS
FT                   SSLKSTTRIHSSNIFTRAQSTISICALIVFITLLLFTLSTFEPTTIAASSPHSIASRRW
FT                   LSEKSTASKLSATPKTSKPTRNSLFSTTWFRKEWRSNSLKSSSFALQGMGCLYRRGTRA
FT                   MNDLVVGHVTEDVTQDQFRMFLRALYRSSISAKTDVVLIFSSSSASSELGPVVQEETES
FT                   FSRLVRRYGELNSTSEESGVTSFDVTQFLKFGKKEKERREPLWGRRIRSNYSDPNSEEG
FT                   EEAEPTRLRYGSVVGFEAAELDPENSLAGFLDHVPMSLRRWACYPMILGRVRRNFKHMM
FT                   LVDVKSFVLLGDPLVRVRSKSTESVFLWTNPETLTPKGRKNSDKTQNHQKLVNSEIIMG
FT                   GTRGVRRLSNAMLIEIVRAAMQRKGKSPFSESVLLNQLVSNGVLSKGVDLTISNESVPD
FT                   SNSLAGVNSNSTSSLSLSKYSVVQRGNSNRDLNQIIMKDICSSTLDSSVYSDC"
FT   5'UTR           complement(333514..333558)
FT                   /locus_tag="VIT_08s0007g08680"
FT                   /old_locus_tag="Vv08s0007g08680"
FT   gene            339483..341305
FT                   /locus_tag="VIT_08s0007g08670"
FT                   /old_locus_tag="Vv08s0007g08670"
FT   mRNA            join(339483..339538,339587..339659,340387..340387,
FT                   340388..340654,340751..340885,340964..341257,
FT                   341258..341305)
FT                   /locus_tag="VIT_08s0007g08670"
FT                   /old_locus_tag="Vv08s0007g08670"
FT                   /product="Predicted protein"
FT   5'UTR           339483..339538
FT                   /locus_tag="VIT_08s0007g08670"
FT                   /old_locus_tag="Vv08s0007g08670"
FT   CDS_pept        join(340388..340654,340751..340885,340964..341257)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08670"
FT                   /old_locus_tag="Vv08s0007g08670"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKW3"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR039123"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKW3"
FT                   /protein_id="CCB55120.1"
FT                   /translation="MRMISGSKFISSKDGKNPKTKKDVHVKIGQTFVIAHGSCQFVRDL
FT                   ADNCSHIANKIKGLINPIDLLNHAYLETKVPGSSTACIITLNEWCLHAVNIGDNGFILL
FT                   RNEEILYESPVQQHTYKTPYQLGNANDSLEEIKLTELEPGDIIIAGSAGLFNNLFTHEI
FT                   KDLVIKEIRKDPAPSPDMIAAEIAKNAIERSIDKYRFTPYSKAAWQAGKRHKGGKMGDV
FT                   TAIFAFILP"
FT   3'UTR           341258..341305
FT                   /locus_tag="VIT_08s0007g08670"
FT                   /old_locus_tag="Vv08s0007g08670"
FT   gene            complement(345607..353206)
FT                   /locus_tag="VIT_08s0007g08660"
FT                   /old_locus_tag="Vv08s0007g08660"
FT   mRNA            complement(join(345607..345775,345776..346147,
FT                   346299..346400,346509..346637,346719..346880,
FT                   347443..347556,349661..349729,352673..352807,
FT                   352940..352996,353123..353206))
FT                   /locus_tag="VIT_08s0007g08660"
FT                   /old_locus_tag="Vv08s0007g08660"
FT                   /product="Binding protein"
FT   3'UTR           complement(345607..345775)
FT                   /locus_tag="VIT_08s0007g08660"
FT                   /old_locus_tag="Vv08s0007g08660"
FT   CDS_pept        complement(join(345776..346147,346299..346400,
FT                   346509..346637,346719..346880,347443..347556,
FT                   349661..349729,352673..352807,352940..352996,
FT                   353123..353206))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08660"
FT                   /old_locus_tag="Vv08s0007g08660"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKW4"
FT                   /protein_id="CCB55121.1"
FT                   /translation="MELASSLVEGANEDLIDLIYKFIRHTLLTADEEGQCKAYYALSRV
FT                   LEEHAWFCSSQFIELVELLLGLKSTDDITLLKSRFACFHILLVHALKMSLEEENTKAFL
FT                   ILNEIILTLKNSKEEVRKVAYDILLVISSSLENSSSLSSEGSHQKLISMIMGYLSGSSP
FT                   HIKSGAVSVLSVLVYKDANICTSVPDLVPSVLALLQGKAVEVVKAVLGFVKVVVSCLQA
FT                   RDLQSFLTDVLNGVLPWSSVSRNHFRSKVTVILEIVVRKCGSAAVKLLTPEKYKGFVKT
FT                   VLENRHNSKGSSKEADDPEKEEKRPNASSRGSDFTSLRQQKRGHKELGFSPRKRKREKQ
FT                   PDGIGSGMKRVKKARHSNFRNHEKQTEGQARGSVKKNMKRSSRREATSRGDGERKKMAW
FT                   KKQKKIHK"
FT   gene            complement(354666..356144)
FT                   /locus_tag="VIT_08s0007g08650"
FT                   /old_locus_tag="Vv08s0007g08650"
FT   mRNA            complement(join(354666..354678,354869..355017,
FT                   355462..355689,355841..356022,356105..356144))
FT                   /locus_tag="VIT_08s0007g08650"
FT                   /old_locus_tag="Vv08s0007g08650"
FT   CDS_pept        complement(join(354666..354678,354869..355017,
FT                   355462..355689,355841..356022,356105..356144))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08650"
FT                   /old_locus_tag="Vv08s0007g08650"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR012978"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKW5"
FT                   /protein_id="CCB55122.1"
FT                   /translation="MPLAESFKRASHKVKKSVIGEDLQAHAHGLWGLLPVFCRYPTDTR
FT                   QSFGSLTKHLISFLKKNSFMHESIAISLQELVNQNRSILRSSEGDCESNTYAIKDSMIQ
FT                   SSSVASYSKKTATKNIGALASCSMELLQALTDLFFGSPPEKRSYLKDAIGCLASISDSS
FT                   ITKRILISSLERLELINGVGEFENVGNSSTTEKDTQRTNM"
FT   gap             367045..367144
FT                   /estimated_length=100
FT   gene            378233..382004
FT                   /locus_tag="VIT_08s0007g08620"
FT                   /old_locus_tag="Vv08s0007g08620"
FT   mRNA            join(378233..378242,378243..378293,378456..378498,
FT                   379300..379369,381923..382004)
FT                   /locus_tag="VIT_08s0007g08620"
FT                   /old_locus_tag="Vv08s0007g08620"
FT   5'UTR           378233..378242
FT                   /locus_tag="VIT_08s0007g08620"
FT                   /old_locus_tag="Vv08s0007g08620"
FT   CDS_pept        join(378243..378293,378456..378498,379300..379369,
FT                   381923..382004)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08620"
FT                   /old_locus_tag="Vv08s0007g08620"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKW6"
FT                   /protein_id="CCB55123.1"
FT                   /translation="MLKQRILIWKTKAVGFKDFCQNFSGQDHFGSGFAHLTNVLGTQHT
FT                   DGMLIYWMVNSIGDNNAIARRKLRVRAPSVPTNPMI"
FT   gap             387613..387712
FT                   /estimated_length=100
FT   gap             393142..393296
FT                   /estimated_length=155
FT   gene            396310..396858
FT                   /locus_tag="VIT_08s0007g08610"
FT                   /old_locus_tag="Vv08s0007g08610"
FT   mRNA            396310..396858
FT                   /locus_tag="VIT_08s0007g08610"
FT                   /old_locus_tag="Vv08s0007g08610"
FT   CDS_pept        396310..396858
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08610"
FT                   /old_locus_tag="Vv08s0007g08610"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7THV7"
FT                   /db_xref="UniProtKB/TrEMBL:D7THV7"
FT                   /protein_id="CBI29833.3"
FT                   /translation="MSQFLCQIASMMLIEWSYVNNEVMYVAWQLFYQLKSLGHRMGEIT
FT                   FILKLLYYLWFLLFSISKYGFRNLIFWISFNLFFGNVLISINVGLTRCYKYTLMIISKY
FT                   HLVFPQLEEVSDVVNWKRFPLLYIQNAINKNTVEWVSWVYLTILLIFGKQGFHFPSSYV
FT                   VCVLVKSINNFTFIVDDFL"
FT   gene            399381..403622
FT                   /locus_tag="VIT_08s0007g08600"
FT                   /old_locus_tag="Vv08s0007g08600"
FT   mRNA            join(399381..400729,400732..400988,401032..401309,
FT                   401434..402245,402246..402290,402757..402807,
FT                   402808..402986,403120..403622)
FT                   /locus_tag="VIT_08s0007g08600"
FT                   /old_locus_tag="Vv08s0007g08600"
FT   5'UTR           399381..400729
FT                   /locus_tag="VIT_08s0007g08600"
FT                   /old_locus_tag="Vv08s0007g08600"
FT   CDS_pept        join(402246..402290,402757..402807)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08600"
FT                   /old_locus_tag="Vv08s0007g08600"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7THV8"
FT                   /protein_id="CBI29834.3"
FT                   /translation="MIISKYLHVFPQLEEVEWLDDLNNILLMRIS"
FT   3'UTR           join(402808..402986,403120..403622)
FT                   /locus_tag="VIT_08s0007g08600"
FT                   /old_locus_tag="Vv08s0007g08600"
FT   gene            415644..423334
FT                   /locus_tag="VIT_08s0007g08590"
FT                   /old_locus_tag="Vv08s0007g08590"
FT   mRNA            join(415644..416045,416123..416295,418211..418316,
FT                   419358..420467,420561..420666,420753..420957,
FT                   421185..421317,421490..421594,422555..422675,
FT                   422829..422926,422927..423334)
FT                   /locus_tag="VIT_08s0007g08590"
FT                   /old_locus_tag="Vv08s0007g08590"
FT                   /product="unknown predicted protein"
FT   CDS_pept        join(415644..416045,416123..416295,418211..418316,
FT                   419358..420467,420561..420666,420753..420957,
FT                   421185..421317,421490..421594,422555..422675,
FT                   422829..422926)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08590"
FT                   /old_locus_tag="Vv08s0007g08590"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7THV9"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D7THV9"
FT                   /protein_id="CBI29835.3"
FT                   /translation="MSSTPNPSPIIFDFPHSTHSPHPKSSNPTFTTHKTLISCKESKSK
FT                   GALEEKKKVVFVDYDNGKHQVSTHVSGLRKADIPKHYRLRVEADRFQKDWSVSEVVERL
FT                   LKLNHWDDVEGLLNRWVGRFSRKNFPLLIREITQIGSLEHSVQVFRWMKNQKNYCARND
FT                   IYNMMIRLHARHNIVDQARGLFFEMQKWRCKPDAETYNALINAHGRAGQWRWAMNIMDD
FT                   MLRAAIPPSRSTYNNLINACGSSGNWKEALNVCKKMTENGVGPDLVTHNIVLSAYKRGN
FT                   QYSKVLSYFELMKGTNIRPDTTTLNIVIYCLVKLGQNGKAIDIFNSMKEKRSECYPDVV
FT                   TFTTIIHLYSVCGQIENCQTAFNTMLAEGLKPNIVSYNALIGAYASHGMDKEAFSVFNE
FT                   IKKNGFHPDVVSYTSLLNAYGKSGKPEKAMKVFELMRRNHCKPNLVSYNALIDAYGSKG
FT                   LLTEAVEILHEMERNGVQPNIVSICTLLAACGRCGQKVKIKSVLSAAELRGIKLNTTAY
FT                   NSAIGSYLSVGEYDKALSLYRAMRTKKVKPDPVTYNVLISGCCKMSKYGEALGFLDEMM
FT                   DLKIPLSKEVYSSVICAYSKQGQVTEAESMFTKMKMVGCRPDVITYTAMIHAYDVAENW
FT                   EKASALFLEMETDDVQPDSIACSSLMRAFNKGGQPAKVLVLAEFMREKKIPFNNSSFFE
FT                   MVSACSLLREWREIIGLIKLMEPSISVVSIGLLNQLLHFLGKSGKIETMMKLFYKIVAS
FT                   GAEINFYTYSILLKNLLAAGNWRKYIEVLQWMEEAGLQPSVGMYRSISSFAQNRSGAEY
FT                   AAVIQERIESLKRNSRNQNPTKKLNDSLLPASSLLDGTKV"
FT   3'UTR           422927..423334
FT                   /locus_tag="VIT_08s0007g08590"
FT                   /old_locus_tag="Vv08s0007g08590"
FT   gene            424290..428878
FT                   /locus_tag="VIT_08s0007g08580"
FT                   /old_locus_tag="Vv08s0007g08580"
FT   mRNA            join(424290..424335,424336..424562,425440..425522,
FT                   425759..425847,426334..426407,426484..426534,
FT                   427047..427111,427273..427907,428389..428445,
FT                   428446..428878)
FT                   /locus_tag="VIT_08s0007g08580"
FT                   /old_locus_tag="Vv08s0007g08580"
FT                   /product="AP2 domain-containing transcription factor"
FT   5'UTR           424290..424335
FT                   /locus_tag="VIT_08s0007g08580"
FT                   /old_locus_tag="Vv08s0007g08580"
FT   CDS_pept        join(424336..424562,425440..425522,425759..425847,
FT                   426334..426407,426484..426534,427047..427111,
FT                   427273..427907,428389..428445)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08580"
FT                   /old_locus_tag="Vv08s0007g08580"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKW7"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="InterPro:IPR036955"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKW7"
FT                   /protein_id="CCB55124.1"
FT                   /translation="MASSSSEPGLKPESGGGSGSGGGETSEAAVASDQLLLYRGLKKAK
FT                   KERGSTAKERISKMPPCAAGKRSSIYRGVTRHRWTGRYEAHLWDKSTWNQNQNKKGKQG
FT                   AYDDEEAAARAYDLAALKYWGPGTLINFPVTDYARDLEEMQNVSREEYLASLRRKSSGF
FT                   SRGISKYRGLASNRWDQPFGRIAGQEYFNNMHYGMGDDAAAESELFGGFCMERKIDLTG
FT                   YIKWWGPNKTRQSDSLAKSSEETKQGSGEDIGSELKTLEWAIQPTEPYQMPRLGLPHEG
FT                   KKQKSSTVSALSILSRSAAYKSLEEKASKKQENNTENDENENKNKINKMDHGKAVEKST
FT                   SHDSGSERLGVALGLGGEFSIQRSVYPLTPLLSAPLLTNYSSVDPLADPILWTSLVPAL
FT                   PTGLPRTAEVTKTETSSTYTFFHQEEQ"
FT   3'UTR           428446..428878
FT                   /locus_tag="VIT_08s0007g08580"
FT                   /old_locus_tag="Vv08s0007g08580"
FT   gene            complement(429583..430131)
FT                   /locus_tag="VIT_08s0007g08570"
FT                   /old_locus_tag="Vv08s0007g08570"
FT   mRNA            complement(429583..430131)
FT                   /locus_tag="VIT_08s0007g08570"
FT                   /old_locus_tag="Vv08s0007g08570"
FT                   /product="Predicted protein"
FT   CDS_pept        complement(429583..430131)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08570"
FT                   /old_locus_tag="Vv08s0007g08570"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKW8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKW8"
FT                   /protein_id="CCB55125.1"
FT                   /translation="MPKKFSYQELAAAAKNFPSSTMLGQGGTGRVYKGFLTDSGRIERI
FT                   WASYEHAKEDFMAELKIMSQLECRNVVSLIGWCIDQGELLLVYDYMFNGSLDKYLFGNN
FT                   RMHLSWNLFGNNRMHLSWNLRYNVVLSLASALLYLHEDSGQCIPHRDVKSANVMLDFNF
FT                   NAKLGDFGAAQFLDQLSNN"
FT   gene            complement(431830..434920)
FT                   /locus_tag="VIT_08s0007g08560"
FT                   /old_locus_tag="Vv08s0007g08560"
FT   mRNA            complement(join(431830..431976,431977..432025,
FT                   432595..432992,433230..433308,433470..433591,
FT                   433916..434002,434096..434435,434570..434901,
FT                   434902..434920))
FT                   /locus_tag="VIT_08s0007g08560"
FT                   /old_locus_tag="Vv08s0007g08560"
FT                   /product="Predicted protein"
FT   3'UTR           complement(431830..431976)
FT                   /locus_tag="VIT_08s0007g08560"
FT                   /old_locus_tag="Vv08s0007g08560"
FT   CDS_pept        complement(join(431977..432025,432595..432992,
FT                   433230..433308,433470..433591,433916..434002,
FT                   434096..434435,434570..434901))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08560"
FT                   /old_locus_tag="Vv08s0007g08560"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7THW2"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019407"
FT                   /db_xref="UniProtKB/TrEMBL:D7THW2"
FT                   /protein_id="CBI29838.3"
FT                   /translation="MACGAGNCQSGCFRDDDDSVVTEKKKLTNRTLSSGSDIDLPNHHN
FT                   LCLKCKVNETLASSGTVSVDGDIGRFCFDCFRGNLFGKFKLAVTSNAMISPTDNVLVAF
FT                   SGGPSSRVALQFVHEMQHKAQKNFDASRDRSLPVFGVGVAFVDESAVSRIPSDEFDKAI
FT                   QDMKSIVSNLAPPDKAFHVVPIESVYSSNGRDRLEELLNAVKDVTGKEDLLQHLRMLSL
FT                   QKNAYENGYTKLLLGSCTSRIACHVISATVKGQGYSLPADIQYVDARWEIPVVLPLRDC
FT                   LAQELNMLCRLDGLKTMEVLNSPHSGINGLVASFVTLLQEENPSRECTIVRTAGKLTPF
FT                   HFNQIPESDDSNVHLASRRRQKKFNLKPNESVPPESYCPICNSPLSKSDHINLSSLGSD
FT                   QTNADIFGATCCPSCQFQILPKEPVSMEHFYSLLPQQFVVQAKDRSFSMQRQLREQIQD
FT                   FLLSDSEDGT"
FT   5'UTR           complement(434902..434920)
FT                   /locus_tag="VIT_08s0007g08560"
FT                   /old_locus_tag="Vv08s0007g08560"
FT   gene            436957..442829
FT                   /locus_tag="VIT_08s0007g08550"
FT                   /old_locus_tag="Vv08s0007g08550"
FT   mRNA            join(436957..436974,437989..438025,438026..438185,
FT                   438282..438331,438513..438582,438675..438804,
FT                   440385..440451,440695..440770,441420..441718,
FT                   442439..442522,442523..442829)
FT                   /locus_tag="VIT_08s0007g08550"
FT                   /old_locus_tag="Vv08s0007g08550"
FT                   /product="Predicted protein"
FT   5'UTR           436957..436974
FT                   /locus_tag="VIT_08s0007g08550"
FT                   /old_locus_tag="Vv08s0007g08550"
FT   CDS_pept        join(438026..438185,438282..438331,438513..438582,
FT                   438675..438804,440385..440451,440695..440770,
FT                   441420..441718,442439..442522)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08550"
FT                   /old_locus_tag="Vv08s0007g08550"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7THW3"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR033196"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:D7THW3"
FT                   /protein_id="CBI29839.3"
FT                   /translation="MVSANVSGDLSSEMEVDAFRRLFPLRYHERFLLDSIRPDARPLGR
FT                   ARDTSLALGAVASADGSALAKIGCTTMLAAVKMEVMTPPKESPDEGSIAIEFYMPPICS
FT                   PLVRPGRPAEEAPVVSKQLSDTILRHVNVVTSFSGMINLKELSLVSGKAAWMAYLDIYC
FT                   LDADGSLFDAALLAAVAAFSHLRIPVVSLNEEGRVVVVSEENEEGKSEKEPVNKGKRKL
FT                   TLSSLPFSLTCILHKNYILADPTAEEESIMETLVTVVLDSSGQLVSLYKPGGPVLAYAS
FT                   AVQDCIALTRQRVKELKSILNEAISDMEVD"
FT   3'UTR           442523..442829
FT                   /locus_tag="VIT_08s0007g08550"
FT                   /old_locus_tag="Vv08s0007g08550"
FT   gene            444362..450126
FT                   /locus_tag="VIT_08s0007g08540"
FT                   /old_locus_tag="Vv08s0007g08540"
FT   mRNA            join(444362..444372,444373..445781,446117..446222,
FT                   446750..448552,448648..449124,449213..449586,
FT                   449931..450126)
FT                   /locus_tag="VIT_08s0007g08540"
FT                   /old_locus_tag="Vv08s0007g08540"
FT                   /product="Magnesium chelatase subunit"
FT   5'UTR           444362..444372
FT                   /locus_tag="VIT_08s0007g08540"
FT                   /old_locus_tag="Vv08s0007g08540"
FT   CDS_pept        join(444373..445781,446117..446222,446750..448552,
FT                   448648..449124,449213..449586,449931..450126)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08540"
FT                   /old_locus_tag="Vv08s0007g08540"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKY8"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR011771"
FT                   /db_xref="InterPro:IPR022571"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKY8"
FT                   /protein_id="CCB55126.1"
FT                   /translation="MASLVSSPFTLPTSKVDQLSSFSQKHYFLHSFLPKKTNQANSKSC
FT                   LRVKCAAIGNGLFTQTTPEVRRIVPDNDHGLPTVKVVYVVLEAQYQSALTAAVQTLNSK
FT                   ARYASFQVVGYLVEELRDEATYKTFCKDLEDANIFIGSLIFVEELALKVKAAVEKERDR
FT                   LDAVLVFPSMPEVMRLNKLGSFSMSQLGQSKSPFFQLFKKKKSSAGFADSMLKLVRTLP
FT                   KVLKYLPSDKAQDARLYILSLQFWLGGSPDNLMNFLKMISGSYVPALKRTKIEYSDPVL
FT                   FLDSGIWHPLAPCMYDDVKEYLNWYGTRRDANEKLKGPNAPVIGLVLQRSHIVTGDESH
FT                   YVAVIMELEARGAKVIPIFAGGLDFSGPVERFLIDPVTKRPFVNSVVSLTGFALVGGPA
FT                   RQDHPRAVEALMKLDVPYIVALPLVFQTTEEWLNSTLGLHPIQVALQVALPELDGGMEP
FT                   IVFAGRDPRTGKVKCNVNAGKSHALHKRVEQLCIRAIRWAELKRKSKAEKKLAITVFSF
FT                   PPDKGNVGTAAYLNVFDSIFSVLKELKRDGYNVEGLPETSESLIEDVLHDKEAKFSSPN
FT                   LNIAYKMGVREYQTLTPYATALEESWGKPPGNLNSDGENLLVYGKQYGNVFIGVQPTFG
FT                   YEGDPMRLLFSKSASPHHGFAAYYSFVEKIFKADAVLHFGTHGSLEFMPGKQVGMSDVC
FT                   YPDSLIGNIPNVYYYAANNPSEATIAKRRSYANTISYLTPPAENAGLYKGLKQLSELIS
FT                   SYQSLKDTGRGPQIVSSIISTAKQCNLDKDVSLPDEGEEISAKERDLVVGKVYSKIMEI
FT                   ESRLLPCGLHVIGEPPSAMEAVATLVNIAALNRPEEGISSLPAILAETVGRNIEDVYRG
FT                   SDKGILKDVELLRQITDTSRGAVSAFVERTTNKKGQVVDVADKLTSVFGFGLNEPWVQY
FT                   LSSTKFYQADREKLRTLFAFLGECLKLVVADNELRSLKQALEGKYVEPGPGGDPIRNPK
FT                   VLPTGKNIHALDPQSIPTAAALQSAMVVVDRLLERQKADNGGKYPETVALVLWGTDNIK
FT                   TYGESLAQVLWMIGVRPVADTFGRVNRVEPVSLEELGRPRIDVVVNCSGVFRDLFINQM
FT                   NLLDRAVKMVAELDEPADQNYVRKHALEQAQALGIEVRDAATRVFSNASGSYSSNINLA
FT                   VENSSWNDEKQLQDMYLSRKSFAFDCDAPGAGMTEKRKVFEMALSTADATFQNLDSSEI
FT                   SLTDVSHYFDSDPTNLVQGLRKDGKKPNAYIADTTTANAQVRTLSETVRLDARTKLLNP
FT                   KWYEGMMSSGYEGVREIEKRLTNTVGWSATSGQVDNWVYEEANSTFIQDEEMLKRLMNT
FT                   NPNSFRKLVQTFLEANGRGYWETSEDNIEKLRQLYSEVEDKIEGIDRNNHQCTLNLFLI
FT                   LFNASKLGLRKLDPWLLVDASKLENLRERKLKRKIKIIKTFLYITLNSFNLF"
FT   gene            complement(450947..455834)
FT                   /locus_tag="VIT_08s0007g08530"
FT                   /old_locus_tag="Vv08s0007g08530"
FT   mRNA            complement(join(450947..451116,451117..451587,
FT                   451715..451841,453867..455557,455558..455834))
FT                   /locus_tag="VIT_08s0007g08530"
FT                   /old_locus_tag="Vv08s0007g08530"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(450947..451116)
FT                   /locus_tag="VIT_08s0007g08530"
FT                   /old_locus_tag="Vv08s0007g08530"
FT   CDS_pept        complement(join(451117..451587,451715..451841,
FT                   453867..455557))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08530"
FT                   /old_locus_tag="Vv08s0007g08530"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKY9"
FT                   /db_xref="InterPro:IPR005049"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKY9"
FT                   /protein_id="CCB55127.1"
FT                   /translation="MLVQDRSTPKSPKTHIRALHSLHPDRFTEPKNLDFSTWFSENLYK
FT                   IVTISLLIATVAALFFLRNVADTAALVSYETQAKSLEKIEFPQINWNSVALVSDKSPYA
FT                   NFRSERWILVSVSNYPTDSLRKLVKIKGWQVLAIGNSKTPSDWSLKGAIFLSLEQQANL
FT                   GFRVVDHLPYDSFVRKNVGYLFAIQHGAKKIFDADDRGDVIDNDLGKHFDVELIGEGAR
FT                   QDIILQYSHENPNRTIVNPYIHFGQRSVWPRGLPLENVGEIGHEEFYTEVFGGKQFIQQ
FT                   GISNGLPDVDSVFYFTRKPGLEAFDIRFDEHAPKVALPQGTMVPVNSFNTLYHSSAFWA
FT                   LMLPVSVSTMASDVLRGYWGQRLLWEIGGYVVVYPPTVHRYDRIESYPFSEEKDLHVNV
FT                   GRLLKFLVSWRSSKHRLFEKILELSYVMAEEGFWTEKDVKFTAAWLQDLLAVGYQQPRL
FT                   MSLELDRPRASIGHGDRKEFIPQKLPSVHLGVEETGVVNNEIGSLIRWRKNFGNVVLIM
FT                   FCSGPVERTALEWRLLYGRIFRTVVILAEQKNADLAVEEGRLDFVYKQLLNIFSRFTSA
FT                   EGFLFLHDNTILNYWNLLQADKSNLWITDKVSKSWSTVSTSGNSDWFSKQADMVKKVVS
FT                   MMPVHFQVNYKETINSDQLLTVCSSDVFYIPRRFIADFTELVNLVDNLEIHHKVAIPMF
FT                   FLSMDSPQNFDPVLSRMIYEENPPSTNSSTFYSDKVPAVHPWNVSSEQEFIKLIRIMAA
FT                   GDLLLLELV"
FT   5'UTR           complement(455558..455834)
FT                   /locus_tag="VIT_08s0007g08530"
FT                   /old_locus_tag="Vv08s0007g08530"
FT   gene            464052..464537
FT                   /locus_tag="VIT_08s0007g08520"
FT                   /old_locus_tag="Vv08s0007g08520"
FT   mRNA            join(464052..464211,464212..464424,464425..464537)
FT                   /locus_tag="VIT_08s0007g08520"
FT                   /old_locus_tag="Vv08s0007g08520"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           464052..464211
FT                   /locus_tag="VIT_08s0007g08520"
FT                   /old_locus_tag="Vv08s0007g08520"
FT   CDS_pept        464212..464424
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08520"
FT                   /old_locus_tag="Vv08s0007g08520"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKZ0"
FT                   /protein_id="CCB55128.1"
FT                   /translation="MGKYVEILDAGVRIVARFHSHCPQTARMYYHPPSNKGESGSNAPV
FT                   HEQAPAAKRGVKAFDTNHFIFYLVV"
FT   3'UTR           464425..464537
FT                   /locus_tag="VIT_08s0007g08520"
FT                   /old_locus_tag="Vv08s0007g08520"
FT   gene            complement(479676..481440)
FT                   /locus_tag="VIT_08s0007g08500"
FT                   /old_locus_tag="Vv08s0007g08500"
FT   mRNA            complement(join(479676..480315,480902..481241,
FT                   481298..481436,481437..481440))
FT                   /locus_tag="VIT_08s0007g08500"
FT                   /old_locus_tag="Vv08s0007g08500"
FT                   /product="AT2G03820 protein"
FT   CDS_pept        complement(join(479676..480315,480902..481241,
FT                   481298..481436))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08500"
FT                   /old_locus_tag="Vv08s0007g08500"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKZ1"
FT                   /db_xref="InterPro:IPR007064"
FT                   /db_xref="InterPro:IPR039768"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKZ1"
FT                   /protein_id="CCB55129.1"
FT                   /translation="MAQESSMFRGHPTVGRVLCCKCGIPIVPNAASMCVKCLSSEVDIT
FT                   EATQSLDPSPIGVDTALDLMLDDAEELELRLIHAEFVWTEPHSKRIKVKLRVQKEVLNG
FT                   AILEQVYIVEYVQKEHMCESCCRAQGNPDQWVASVQVRQHVPLRRTLFHLEQLILRYFV
FT                   LPDAILIKKIYVENCQRKGGKPPELSLPATSSGGHFICSSSPSIFFLGSASSPAVSTGS
FT                   DLSTEQETAAIVRHSPARTQAVGHLHHGSVEATLQRPLTPRSCRSHYDDLKRRFQRIVG
FT                   GDGGGAVVSFLFSFYALLRIGLASSFLMPLLCGSCIFFSDSIPHVENNHRSQLQKIKIQ
FT                   FTNCLEILRERRIVSSSAIASDDALNRRLKSS"
FT   5'UTR           complement(481437..481440)
FT                   /locus_tag="VIT_08s0007g08500"
FT                   /old_locus_tag="Vv08s0007g08500"
FT   gene            complement(483443..504931)
FT                   /locus_tag="VIT_08s0007g08490"
FT                   /old_locus_tag="Vv08s0007g08490"
FT   mRNA            complement(join(483443..483829,483830..484081,
FT                   484201..484323,485351..485437,485509..485560,
FT                   485669..485793,486909..487117,487211..487412,
FT                   488954..489058,490593..490654,490909..491098,
FT                   491181..491276,491449..491551,493594..493697,
FT                   495669..495755,497452..497537,497777..497869,
FT                   499082..499244,499432..499544,499632..499754,
FT                   500002..500053,500508..500551,500635..500708,
FT                   500808..500899,502114..502181,504550..504625,
FT                   504739..504855,504856..504931))
FT                   /locus_tag="VIT_08s0007g08490"
FT                   /old_locus_tag="Vv08s0007g08490"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(483443..483829)
FT                   /locus_tag="VIT_08s0007g08490"
FT                   /old_locus_tag="Vv08s0007g08490"
FT   CDS_pept        complement(join(483830..484081,484201..484323,
FT                   485351..485437,485509..485560,485669..485793,
FT                   486909..487117,487211..487412,488954..489058,
FT                   490593..490654,490909..491098,491181..491276,
FT                   491449..491551,493594..493697,495669..495755,
FT                   497452..497537,497777..497869,499082..499244,
FT                   499432..499544,499632..499754,500002..500053,
FT                   500508..500551,500635..500708,500808..500899,
FT                   502114..502181,504550..504625,504739..504855))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08490"
FT                   /old_locus_tag="Vv08s0007g08490"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7THW7"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="InterPro:IPR032632"
FT                   /db_xref="UniProtKB/TrEMBL:D7THW7"
FT                   /protein_id="CBI29843.3"
FT                   /translation="MGEAAAEIVKPRTDTREYRRIVLRNSLEVLLISDPDTDKAAASMS
FT                   VSVGSFCDPEGFPGLAHFLEHMLFYASEKYPLEDSYSKYIIEHGGSTNAFTSSEHTNYY
FT                   FDVNSDCFEEALDRFAQFFVKPLMSADATTREIKAVDSENQKNLLSDAWRMCQLQKHIS
FT                   AEGHPYHKFSTGNWDTLEVKPKEKGLDTRHELIKFYEEHYSANLMHLVVYTKESLDKIQ
FT                   SLVEHKFQEIQNKDRSNFQIPGQPCTSEHLQILVKTVPIKQGHKLRVIWPITPSIHNYK
FT                   EGPCRYLGHLIGHEGEGSLFYILKTLGWATSLSAGEGDWTCEFSFFKVVIDLTEAGHEH
FT                   MQDIVGLLFKYISLLQQTGVCKWIFDELSAICETVFHYQDKIPPIDYVVNVSSNMELYP
FT                   PKDWLVGSSLPSKFSPDVIQKVLDELAPNNVRIFWESKNFEGHTDMVEPWYGTAYSIEK
FT                   ITSSMIQQWMLAAPNEHLHLPSPNVFIPTDLSLKDVQEKAKFPVLLRKSSYSTLWYKPD
FT                   TMFSTPKAYVKIDFNCPFASSSPEADVLTDIFTRLLMDYLNEYAYYAQVAGLYYGINHT
FT                   DSGFQVAVTGYNHKLRILLETVVEKIANFKVKPDRFLVIKEMVTKEYQNFKFQQPYQQA
FT                   MYYCSLILQDNTWPWMDGLEVIPHLEADDLAKFVPMLLSRAFLDCYIAGNIEPKEAESM
FT                   IHHIEDIFYSGPHPISQPLFPSQYLTNRVIKLDRGMSYFYPAEGLNPSDENSALVHYIQ
FT                   VHRDDFLPNVKLQLFALIAKQRAFHQLRSVEQLGYITVLMQRNDSGIRGVQFIIQSTVK
FT                   GPGHIDSRVVEFLKMFESKLYAMSEDEFKSNVNALIDMKLEKHKNLREESGFYWREIYD
FT                   GTLKFDRREAEVAALKKLTQKELIDFFNEHIKVGAPQKKTLSVRVYGGLHTSEYADEKK
FT                   EANQPKQVKIDDIFKFRKSQPLYGSFKGGLGQVKL"
FT   5'UTR           complement(504856..504931)
FT                   /locus_tag="VIT_08s0007g08490"
FT                   /old_locus_tag="Vv08s0007g08490"
FT   gene            complement(508899..553545)
FT                   /locus_tag="VIT_08s0007g08480"
FT                   /old_locus_tag="Vv08s0007g08480"
FT   mRNA            complement(join(508899..509173,509174..509425,
FT                   509545..509667,510700..510786,510858..510909,
FT                   511027..511151,529078..529286,529380..529581,
FT                   531190..531294,533730..533791,534049..534238,
FT                   534321..534416,534590..534692,536611..536714,
FT                   543374..543460,545145..545230,545443..545535,
FT                   546769..546931,547127..547239,547327..547449,
FT                   547697..547748,548202..548245,548329..548402,
FT                   548502..548593,549849..549916,553173..553248,
FT                   553354..553470,553471..553545))
FT                   /locus_tag="VIT_08s0007g08480"
FT                   /old_locus_tag="Vv08s0007g08480"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(508899..509173)
FT                   /locus_tag="VIT_08s0007g08480"
FT                   /old_locus_tag="Vv08s0007g08480"
FT   CDS_pept        complement(join(509174..509425,509545..509667,
FT                   510700..510786,510858..510909,511027..511151,
FT                   529078..529286,529380..529581,531190..531294,
FT                   533730..533791,534049..534238,534321..534416,
FT                   534590..534692,536611..536714,543374..543460,
FT                   545145..545230,545443..545535,546769..546931,
FT                   547127..547239,547327..547449,547697..547748,
FT                   548202..548245,548329..548402,548502..548593,
FT                   549849..549916,553173..553248,553354..553470))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08480"
FT                   /old_locus_tag="Vv08s0007g08480"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7THW8"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="InterPro:IPR032632"
FT                   /db_xref="UniProtKB/TrEMBL:D7THW8"
FT                   /protein_id="CBI29844.3"
FT                   /translation="MGEAAVEIVKPRTDTREYRRIVLRNSLEALLISDPDTDKAAASMS
FT                   VSVGSFSDPEGFPGLAHFLEHMLFYASEKYPLEDSYSKYITEHGGSTNAFTASEHTNYF
FT                   FDVNTDCFEEALDRFAQFFVKPLMSADATTREIKAVDSENKKNLLSDAWRMDQLQKHVS
FT                   AEGHPYHKFSTGNRDTLEVKPKEKGLDTRHELIKFYEEHYSANLMHLVVYTKESLDKIQ
FT                   SLVEHKFQEIQNKDRINFHICGQPCTSEHLQILVKTVPIKQGHKLIVVWPITPSIHNYK
FT                   EGPCRYLGHLIGHEGKGSLFYILKTLGWATSLSAWEEDWTCEFSFFEVVIDLTDAGHEH
FT                   MQDIVGLLFKYISLLQQTGVCKWIFDELSAICETMFHYQDKIPSIDYVVNVSSNMELYP
FT                   PKDWLVGSSLPSKFSPDVIQKVLDELAPNNVRIFWESKNFEGHTDMVEPWYGTAFSIEK
FT                   ITVSMIQQWMLAAPTEHLHLPDPNDFIPTDLSLKNVQEKAKFPVLLRKSSYSTLWYKPD
FT                   TMFSTPKAYVKIDFNCPFASSSPEADVLTDIFTRLLMDYLNEDAYYAEVAGLYYCLSNT
FT                   DSGFQVAMAGYNHKLRILLETVVKKIANFKVKPDRFLVIKELVTKGYQNVKFQQPYQQA
FT                   MCYRSLILHDNTWPWMDGLEVIPHLEADDLAKFVPMLLSRAFLECYIAGNIEPKEAEAM
FT                   IHHIEDIFYSGPRPICQPLFPSQYLTNRVIKLDRGMSYFYPAEGLNPSDENSALVHYIQ
FT                   VHRDDFLPNVKLQLFALIAKQQAFHQLRSVEQLGYITELMLRNDSGIHGVQFMIQSTVK
FT                   GPGHIDSRIEEFLKMFEFKLYAMSEDEFKSNVNTLVDMKLEKYKNLWEESGFYWQEIYD
FT                   GTLKFDRTEAEVAALKKLTQKELIDFFNEHIKVGAPQKKTLSVRVYGCLHTSEYAEEQK
FT                   EANQPIQVKIDDIFKFRKSQPLYGSFKGGLGHVKL"
FT   gap             512854..512953
FT                   /estimated_length=100
FT   5'UTR           complement(553471..553545)
FT                   /locus_tag="VIT_08s0007g08480"
FT                   /old_locus_tag="Vv08s0007g08480"
FT   gene            complement(556740..560232)
FT                   /locus_tag="VIT_08s0007g08470"
FT                   /old_locus_tag="Vv08s0007g08470"
FT   mRNA            complement(join(556740..556870,556871..556925,
FT                   557299..557396,557569..557694,557793..557876,
FT                   557955..558071,558187..558270,558450..558497,
FT                   558665..558719,558846..558901,559005..559089,
FT                   559180..559253,559331..559397,560150..560232))
FT                   /locus_tag="VIT_08s0007g08470"
FT                   /old_locus_tag="Vv08s0007g08470"
FT                   /product="24-sterol C-methyltransferase"
FT   3'UTR           complement(556740..556870)
FT                   /locus_tag="VIT_08s0007g08470"
FT                   /old_locus_tag="Vv08s0007g08470"
FT   CDS_pept        complement(join(556871..556925,557299..557396,
FT                   557569..557694,557793..557876,557955..558071,
FT                   558187..558270,558450..558497,558665..558719,
FT                   558846..558901,559005..559089,559180..559253,
FT                   559331..559397,560150..560232))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08470"
FT                   /old_locus_tag="Vv08s0007g08470"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7THW9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR013705"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030384"
FT                   /db_xref="UniProtKB/TrEMBL:D7THW9"
FT                   /protein_id="CBI29845.3"
FT                   /translation="MSRSGALDLASGVGGKIEKNEVLSAVQKYEKYHVCHGGDEEERRA
FT                   NYTDMVNKYYDLATSFYEYGWGESFHFASRWKGESLRESIKRHEHFLAVQLGLKCGQKV
FT                   LDVGCGIGGPLREIARFSDTSITGLNNNEYQITRGKELNRLAGVDKTCNFELADFMKMP
FT                   FSNDTFDAVFAIEATCHAPDVLDCYKEIYRVLKPGQCFAAYEWCITDCFDPMNREHQRI
FT                   KGEVELGNGLPDIRSVGQCLEALKLAGFEVLWEKDVAADSPLPWYLPLDTTQFSLSNFR
FT                   TTSFGRFITRNMVKALEFVRLAPEGSQRVQAFLEKAAEALVEGGREGIFTPMYFFVARK
FT                   PRS"
FT   gene            complement(561743..563460)
FT                   /locus_tag="VIT_08s0007g08460"
FT                   /old_locus_tag="Vv08s0007g08460"
FT   mRNA            complement(join(561743..561747,561748..562268,
FT                   562793..563290,563376..563460))
FT                   /locus_tag="VIT_08s0007g08460"
FT                   /old_locus_tag="Vv08s0007g08460"
FT                   /product="Predicted protein"
FT   3'UTR           complement(561743..561747)
FT                   /locus_tag="VIT_08s0007g08460"
FT                   /old_locus_tag="Vv08s0007g08460"
FT   CDS_pept        complement(join(561748..562268,562793..563290,
FT                   563376..563460))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08460"
FT                   /old_locus_tag="Vv08s0007g08460"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR006946"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKZ2"
FT                   /protein_id="CCB55130.1"
FT                   /translation="MALFLSLCLVFFSIVCSSASATLPPYLDGLLPNGDFEKGPKASNL
FT                   KKTVIKGKHSLPDWEIKGLVEYVSGGPQPGGFFLAVPRGVHAVKLGNEASISQNVRVRP
FT                   GFIYSLTFGATRTCAQDEVLRVSIPGQSADLPIQTLYSTDGGDTYAWAFNATTEVVNVT
FT                   FHNPGIQEDRTCGPLLDAIAIKQMPPLKLTRGSLAKNGGYETGPHVFKNFSTGVLLLPK
FT                   QQDLISPLPGWIIESLKPVKYIDSKHFSVPTGLAAIELIGGRESAIAQIIRTVPNKSYN
FT                   LTFTIGDAKNGCHGSMTVEAFAAKETVKVPHASQGKGEFKAASLKFKALSARTRITFYS
FT                   AYYHTKLHDFGHMCGPVLDDVRVYPVS"
FT   gap             586701..587505
FT                   /estimated_length=805
FT   gene            598021..601295
FT                   /locus_tag="VIT_08s0007g08450"
FT                   /old_locus_tag="Vv08s0007g08450"
FT   mRNA            join(598021..598515,598516..600853,600967..601292,
FT                   601293..601295)
FT                   /locus_tag="VIT_08s0007g08450"
FT                   /old_locus_tag="Vv08s0007g08450"
FT                   /product="Predicted protein"
FT   5'UTR           598021..598515
FT                   /locus_tag="VIT_08s0007g08450"
FT                   /old_locus_tag="Vv08s0007g08450"
FT   CDS_pept        join(598516..600853,600967..601292)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08450"
FT                   /old_locus_tag="Vv08s0007g08450"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5AJ32"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A5AJ32"
FT                   /protein_id="CCB55131.1"
FT                   /translation="MAFVCLLSLVLMGSLSISQVVDAQLHDQATLLAINKELGVPGWDV
FT                   NNSDYCSWRGIGCAADELIVERLDLSHRGLRGNLTLISGLKSLKSLDLSDNNFHGSIPS
FT                   IFGNLSELVFLDLSWNKFGNSIPIELGSLRNLRSLNLSNNLLIGEIPDELQSLEKLQEF
FT                   QISGNKFNGSIPIWVGNLTNLRVFTAYENELAGKIPDNLGSHSELQLLNLHSNQLEGAI
FT                   PDTIFASGKLEVLVLTQNELTGNLPELVGKCKGLSNIRIGNNNLIGNIPRSIGNVSSLT
FT                   YFEADNNNLSGEIVPEFAQCSNLTLLNLASNGFTGMIPPGLGQLTNLQELIVSGNSLFG
FT                   DIPESILRCKNLNKLDLSNNRFNGTIPGDLCNTSRLQYLLLSQNSIRGEIPHEIGNCVK
FT                   LLELQMGSNYLTGSIPPEIGHIKNLQIALNLSFNHLHGLLPLELGKLDKLVSLDLSNNQ
FT                   LSGNIPSALKGMLSLIEVNFSNNLFTGPVPTFVPFQKSPNSSFLGNKGLCGEPLSSSCG
FT                   TNGSDHESYHHKVSYRIILAVIGSGLAVFVSVTVVVLLFMMRERQEKAAKAGGVADDGI
FT                   NNRAVIIAGNVFVDNLRQAIDFDAVVKATLKDSNKLNSGTFSTVYKAVMPSGLILSVKS
FT                   LRSMDRTIIHHQNKMIRELERLSKLCHDNLMRPIGFVIYEDVALLLHNYLPNGTLAQFL
FT                   HDPTKISEYEPDWPTRLNIATGVAEGLAFLHHVAIIHLDISSGNILLDADFKPLVGEIE
FT                   ISKLLDPSKGTASISAVAGSFGYIPPEYAYTMQVTAPGNVYSYGVVLLEILTTRLPVDE
FT                   AFGEGIDLVKWVHTAPARGETPEQILDARLSTVSFAWRKEMLSALKVALLCTDNTPAKR
FT                   PKMKKVVEMLQEIKQN"
FT   3'UTR           601293..601295
FT                   /locus_tag="VIT_08s0007g08450"
FT                   /old_locus_tag="Vv08s0007g08450"
FT   gene            complement(603268..604395)
FT                   /locus_tag="VIT_08s0007g08440"
FT                   /old_locus_tag="Vv08s0007g08440"
FT   mRNA            complement(603268..604395)
FT                   /locus_tag="VIT_08s0007g08440"
FT                   /old_locus_tag="Vv08s0007g08440"
FT                   /product="unknown predicted protein"
FT   CDS_pept        complement(603268..604395)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08440"
FT                   /old_locus_tag="Vv08s0007g08440"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKZ4"
FT                   /protein_id="CCB55132.1"
FT                   /translation="MHDLVHDLAKSVAQFEQHTLDAIEKINSNEVQHVLLSGDDPEEVL
FT                   TLLQKITKLRTILFRNGGATSLSFVTTCASKFKYMRYLDLSDSSFEVLPSSIGNMKHLR
FT                   YLSLLRNKRIKKLPASICKLYHLQTLILAECSELEELPRDMGNLINLMFLSITTKQRAL
FT                   SGTENGLECLISLRSLLIYACNNLEFIFEGMQNLTALRTLVIVGCPSLVSLPTSVKHLP
FT                   ALENLVFGDCERLNLMDGDGDSEDDIQGSSSRLCTFIIGALPQLEALPQWLVQGPTTSN
FT                   LHCLGINGCHNFKGLPESLENLTSLQELRIGDCPQLSTLTEGMHRLTTLKVLSIDDCPE
FT                   LSKRCMPKIGEDWHRIAHVPEINIDGESIKWTTNN"
FT   gene            608528..608755
FT                   /locus_tag="VIT_08s0007g08430"
FT                   /old_locus_tag="Vv08s0007g08430"
FT   mRNA            608528..608755
FT                   /locus_tag="VIT_08s0007g08430"
FT                   /old_locus_tag="Vv08s0007g08430"
FT                   /product="Similar to receptor-like protein kinase"
FT   CDS_pept        608528..608755
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08430"
FT                   /old_locus_tag="Vv08s0007g08430"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKZ5"
FT                   /protein_id="CCB55133.1"
FT                   /translation="MQVTAPGNVYNYGAVLLEILTTRLPVDEAFGEGIDLVKWVHSAPA
FT                   RAETPEQILDARLSTVSFVWRKEMLSALKA"
FT   gene            complement(609817..613144)
FT                   /locus_tag="VIT_08s0007g08420"
FT                   /old_locus_tag="Vv08s0007g08420"
FT   mRNA            complement(join(609817..610116,610520..613144))
FT                   /locus_tag="VIT_08s0007g08420"
FT                   /old_locus_tag="Vv08s0007g08420"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(609817..610116)
FT                   /locus_tag="VIT_08s0007g08420"
FT                   /old_locus_tag="Vv08s0007g08420"
FT   CDS_pept        complement(610520..613144)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08420"
FT                   /old_locus_tag="Vv08s0007g08420"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKZ6"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR038005"
FT                   /db_xref="InterPro:IPR041118"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKZ6"
FT                   /protein_id="CCB55134.1"
FT                   /translation="MAESFAFDLANKVLGKIASLALQEVALAWGVTADLDGLKDTLSVI
FT                   QAVISDAEEQQSNSRQIADWLRKLKKALYEAEDVLDDFEYEALRRKVAKAGSITKQVHS
FT                   FFSTSNPLPFSFKMGRKMKNLKERLDKIAADRSKFNLTERAVVVDTTHVVHRKREMTHS
FT                   YVDVSNIIGREQDKENIVSILMKSSSDEQENVSVIPIIGIGGMGKTALAKLVYNDGRVV
FT                   KHFDKRMWVCVSDEDNEIETLTKKILISATMGGTGTLSMDQFQNLRFSLAEFSMDELQT
FT                   QLRNALDDKRYLLVLDDVWNSDREKWLKLKELLMGSAGGSKIVVTTRKKSVASVLGTFP
FT                   AQELKGLPDEDCQSLFLKCAFKDGQGKQYPNLVKIGNQIVKKCGGVPLAVRSLGGLLYS
FT                   KLEERDWELVRDNEIWTLEEKDDGILPALKLSYDELPSHLKPCFVFCSMFPKDYELNNV
FT                   ELIQLWMARGLIQPSSHNQELEDIGNQCIIELCSRSFFQDVEDYKVSVFFKMHDLVHDL
FT                   ALSIKKIESKEVEDASITDNVPEQILALLQEKNNIRTIWFPYSEINATAEYVGTCSSRF
FT                   KYMRVLDLRGTDFEELPSSIGNMKHLRYLDICGNKRVKKLPASICKLYLLLTLSFKECT
FT                   ELEELPRDMGNFISLRFLAITTKQRAWPRKGNGLACLISLRWLLIAECNHVEFMFEGLQ
FT                   NLTALRSLEIRRCPSLVSLPPSVKHLPALETLMIFNCEMFNFMDEDGDEENDIQGISCR
FT                   LRSLMVVDLPKLEALPGWLIQGLAASTLHYLLIRRCHKFKALPESLENLTSLQELRIDD
FT                   CPQLSTLSGGMHRLTTLKVLSIRDCPELSKRCKPEIGEDWHKIAHVPEIYIDGEAIKST
FT                   TNN"
FT   gene            complement(617142..619759)
FT                   /locus_tag="VIT_08s0007g08410"
FT                   /old_locus_tag="Vv08s0007g08410"
FT   mRNA            complement(join(617142..617315,617316..617511,
FT                   617659..618029,619384..619608,619609..619759))
FT                   /locus_tag="VIT_08s0007g08410"
FT                   /old_locus_tag="Vv08s0007g08410"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(617142..617315)
FT                   /locus_tag="VIT_08s0007g08410"
FT                   /old_locus_tag="Vv08s0007g08410"
FT   CDS_pept        complement(join(617316..617511,617659..618029,
FT                   619384..619608))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08410"
FT                   /old_locus_tag="Vv08s0007g08410"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5BGZ7"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:A5BGZ7"
FT                   /protein_id="CBI29851.3"
FT                   /translation="MDTFYISHGSPTLSIDESLPARHFLKSWKEKVMGQRPTSILVISA
FT                   HWETHEPTVNVVPQNDTIYDFYGFPKSMYKLKYPAPGAPELAKRVKELLMASNFKSVKE
FT                   DKKRGLDHGAWVPLMLMYPEADIPVCQLSVQTNRDGSYHYNMGRALAPLREEGVLIIGS
FT                   GSATHNLRALNPNSESVVPWAYEFDTWLKEALLDGRYEDINHYEEKAPHAREAHPWPEH
FT                   FYPLHVAMGAAGENAKAKLIHHSWSLGTLSYASYQFTTTAT"
FT   5'UTR           complement(619609..619759)
FT                   /locus_tag="VIT_08s0007g08410"
FT                   /old_locus_tag="Vv08s0007g08410"
FT   gene            complement(622979..623767)
FT                   /locus_tag="VIT_08s0007g08400"
FT                   /old_locus_tag="Vv08s0007g08400"
FT   mRNA            complement(join(622979..623065,623066..623758,
FT                   623759..623767))
FT                   /locus_tag="VIT_08s0007g08400"
FT                   /old_locus_tag="Vv08s0007g08400"
FT                   /product="ABC transporter family protein"
FT   3'UTR           complement(622979..623065)
FT                   /locus_tag="VIT_08s0007g08400"
FT                   /old_locus_tag="Vv08s0007g08400"
FT   CDS_pept        complement(623066..623758)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08400"
FT                   /old_locus_tag="Vv08s0007g08400"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5BGZ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5BGZ8"
FT                   /protein_id="CBI29852.3"
FT                   /translation="MSLRKAPLPRLLLNNVSCMRNGHQILRHTNVSLHDGSALVLSGAN
FT                   GSGKTTMLRMLAGFNRPSAGQVLWNGHDVTKAGVFDQYKLQLNWLSLKDAINDKFTVFE
FT                   NVVWFELLDKKEGRSMPALELMGLGRLANEKPRRLSMGQRKRVQLARLLALDRPIWLLD
FT                   EPSVALDEDGLRLLEYIIADHRKKGGIVIVATHQPIQIEDAMFLRLPPRFPRGMSHTDM
FT                   LDRADWIV"
FT   5'UTR           complement(623759..623767)
FT                   /locus_tag="VIT_08s0007g08400"
FT                   /old_locus_tag="Vv08s0007g08400"
FT   gene            complement(626714..627848)
FT                   /locus_tag="VIT_08s0007g08390"
FT                   /old_locus_tag="Vv08s0007g08390"
FT   mRNA            complement(join(626714..626972,626973..627121,
FT                   627797..627848))
FT                   /locus_tag="VIT_08s0007g08390"
FT                   /old_locus_tag="Vv08s0007g08390"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(626714..626972)
FT                   /locus_tag="VIT_08s0007g08390"
FT                   /old_locus_tag="Vv08s0007g08390"
FT   CDS_pept        complement(join(626973..627121,627797..627848))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08390"
FT                   /old_locus_tag="Vv08s0007g08390"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR009515"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKZ7"
FT                   /protein_id="CCB55135.1"
FT                   /translation="MGHGTNLILECLSFLGKGTTPKTVANKEWWEETDKKFQAWPRTAG
FT                   PPVVMNPISRQNFIVKSQSES"
FT   gene            656250..663891
FT                   /locus_tag="VIT_08s0007g08380"
FT                   /old_locus_tag="Vv08s0007g08380"
FT   mRNA            join(656250..656270,657221..657416,657509..657729,
FT                   657846..657948,658080..658308,658782..659048,
FT                   659148..659493,659579..659716,660073..660198,
FT                   660280..660492,660697..660961,661566..661768,
FT                   662505..662855,663302..663886,663887..663891)
FT                   /locus_tag="VIT_08s0007g08380"
FT                   /old_locus_tag="Vv08s0007g08380"
FT                   /product="Cellulose synthase"
FT   CDS_pept        join(656250..656270,657221..657416,657509..657729,
FT                   657846..657948,658080..658308,658782..659048,
FT                   659148..659493,659579..659716,660073..660198,
FT                   660280..660492,660697..660961,661566..661768,
FT                   662505..662855,663302..663886)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08380"
FT                   /old_locus_tag="Vv08s0007g08380"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKZ8"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR005150"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR027934"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKZ8"
FT                   /protein_id="CCB55136.1"
FT                   /translation="MEIGGVGPKPSKHTGDQVCQICNDNVGTTVDGEPFIACSVCAFPV
FT                   CRPCYEYERKDGNQSCPQCKTKYKRHKGSPPIHGEDVEDGDMDDVAKDFKYSSRDQGEK
FT                   QKIAERSLSWHMSHGQGEDVVPPNYDKEVSLNHIPLLTNGPSVSGELSAASPERLSMTS
FT                   PEAGLGVKRVCPLPYAAANIRVGDPGREFGSAGFGKVAWKERVDGWKMKQEKNGAPMSV
FT                   SHAPSEGRGGLAPSEGRGGVDIDASTDVVMDDTLLNDEARQPLSRKVSIPSSRINPYRM
FT                   VIVLRLIILCIFLHYRITNPVPNAFALWLISVICEIWFAISWILDQFPKWLPVNRETYL
FT                   DRLALRYDREGEPSQLAAVDIFVSTVDPLKEPPLVTANTVLSILAVDYPVDKVSCYVSD
FT                   DGSAMLTFEALSETSEFARKWVPFSKKYNIEPRAPEWYFAQKIDYLKDKVQPSFVKDRR
FT                   AMKREYEEFKIRVNALVAKAQKVPDEGWIMQDGTPWPGNNTRDHPGMIQVFLGHSGGLD
FT                   TEGNELPRLVYVSREKRPGFQHHKKAGAMNALVRVSAVLTNGPYLLNLDCDHYINNSKA
FT                   LREAMCFLMDPNLGKSVCYVQFPQRFDGIDKSDRYANRNTVFFDINLRGLDGIQGPVYV
FT                   GTGCVFNRPALYGYEPPVKPKHKKPGLFSSCFGGSQKKSSGSSKKDSSKKKSGKQLDPT
FT                   VPIFNLEDIEEGLEGAGFDDEKSLLMSQMSLEKRFGQSAVFVASTLMENGGVPQSAAPE
FT                   ILLKEAIHVISCGYEDKTDWGNEIGWIYGSVTEDILTGFKMHARGWRSIYCMPQRPAFK
FT                   GSAPINLSDRLNQVLRWALGSVEILLSRHCPIWYGYGGRLKWLERFAYVNTTIYPVTAI
FT                   PLLAYCTLPAVCLLTGKFIIPQISNFASIWFISLFLSIFATGILEMRWSGVGIDEWWRN
FT                   EQFWVIGGVSAHLFAVCQGLLKVLAGIDTNFTVTSKASDEEGDFAELYMFKWTTLLIPP
FT                   TTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPT
FT                   IVVVWSILLASIFSLLWVRIDPFTTRVTGPDVEQCGINC"
FT   3'UTR           663887..663891
FT                   /locus_tag="VIT_08s0007g08380"
FT                   /old_locus_tag="Vv08s0007g08380"
FT   gene            670800..673308
FT                   /locus_tag="VIT_08s0007g08370"
FT                   /old_locus_tag="Vv08s0007g08370"
FT   mRNA            join(670800..670857,670858..671520,672936..673094,
FT                   673095..673308)
FT                   /locus_tag="VIT_08s0007g08370"
FT                   /old_locus_tag="Vv08s0007g08370"
FT                   /product="unknown predicted protein"
FT   5'UTR           670800..670857
FT                   /locus_tag="VIT_08s0007g08370"
FT                   /old_locus_tag="Vv08s0007g08370"
FT   CDS_pept        join(670858..671520,672936..673094)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08370"
FT                   /old_locus_tag="Vv08s0007g08370"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5BIQ8"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005711"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:A5BIQ8"
FT                   /protein_id="CCB55137.1"
FT                   /translation="MAERGGGGERGGFGRGFGRGGRGDRGRGGRRRSAGRREEEEKWVP
FT                   VTKLGRLVKDGKIRTVEEIYLHSLPIKEHQIIDTLVGPSLKDEVMKIMPVQKQTRAGQR
FT                   TRFKAFVVVGDGNGHVGLGVKCSKEVATAIRGAIILAKLSVIPVRRGYWGNKIGKPHTV
FT                   PCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDVFTSSRGSTKTLGNFVKA
FT                   TFDCLLKTYAYLTPDFWRETRYTKSPFQEHTDLLAKPTKAIYQDDVERVEA"
FT   3'UTR           673095..673308
FT                   /locus_tag="VIT_08s0007g08370"
FT                   /old_locus_tag="Vv08s0007g08370"
FT   gene            674557..677203
FT                   /locus_tag="VIT_08s0007g08360"
FT                   /old_locus_tag="Vv08s0007g08360"
FT   mRNA            join(674557..674763,674764..674862,676294..677076,
FT                   677077..677203)
FT                   /locus_tag="VIT_08s0007g08360"
FT                   /old_locus_tag="Vv08s0007g08360"
FT                   /product="Predicted protein"
FT   5'UTR           674557..674763
FT                   /locus_tag="VIT_08s0007g08360"
FT                   /old_locus_tag="Vv08s0007g08360"
FT   CDS_pept        join(674764..674862,676294..677076)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08360"
FT                   /old_locus_tag="Vv08s0007g08360"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HL00"
FT                   /db_xref="InterPro:IPR000058"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR035896"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL00"
FT                   /protein_id="CCB55138.1"
FT                   /translation="MGTPEFPDLGKHCTVDDCKQIDFLPFTCDRCHQIFCLEHRSYIKH
FT                   HCPTADRKDVTVVICPLCAKGVRLIPDEDPNVTWETHVNTECDPSNYEKATKKKKCPVS
FT                   GCREILTFSNTLKCRDCTIDHCLKHRFGPDHKCPGPKKPEAAFPFIGLLNRSKKEDSKP
FT                   SRAPTSSSKWATSFLNVASNVRASAEAGMTKLTSEFSQAWQTTRDGVGQSSGSSSGSRV
FT                   GQVEECPQCHAKFSSVTSLVEHVEKVHEKNSNRAAVRKVTIDVCPKCSRGFRDPVSLVE
FT                   HVERDHGGTSKA"
FT   3'UTR           677077..677203
FT                   /locus_tag="VIT_08s0007g08360"
FT                   /old_locus_tag="Vv08s0007g08360"
FT   gene            679394..704632
FT                   /locus_tag="VIT_08s0007g08350"
FT                   /old_locus_tag="Vv08s0007g08350"
FT   mRNA            join(679394..679540,681472..681546,682608..682723,
FT                   692179..692293,692470..692598,695901..695948,
FT                   697002..697177,697271..697467,697762..698054,
FT                   698466..698478,698616..698632,698705..699118,
FT                   699512..699661,700742..700817,701623..701750,
FT                   701997..702197,702305..702433,702509..702634,
FT                   703513..703731,704468..704632)
FT                   /locus_tag="VIT_08s0007g08350"
FT                   /old_locus_tag="Vv08s0007g08350"
FT                   /product="Predicted protein"
FT   CDS_pept        join(679394..679540,681472..681546,682608..682723,
FT                   692179..692293,692470..692598,695901..695948,
FT                   697002..697177,697271..697467,697762..698054,
FT                   698466..698478,698616..698632,698705..699118,
FT                   699512..699661,700742..700817,701623..701750,
FT                   701997..702197,702305..702433,702509..702634,
FT                   703513..703731,704468..704632)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08350"
FT                   /old_locus_tag="Vv08s0007g08350"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL01"
FT                   /protein_id="CCB55139.1"
FT                   /translation="MSVVSGVISRKVLPACGNLCFLCPAMRPRSRQPLKRYKKLISDIF
FT                   PRAQDEEPNDRKIGKLCEYAAKNPLRIPKITNSLEQRCYKELRSENFRSAKVVMCIYRK
FT                   FLVSCKEQMPLFASSLLSIIHTLLDQARQDEMQIIGCQTLFDFVNNQRDGTYMCNLEGF
FT                   IPKLCQLAQEVGEDERAQHLRSAGLHALSSMVWFMGEHSHISAEIDNVVSVILENYLNV
FT                   NKPGAQNRWVQEVLKVEGHVSPSPEVTMRVLSWNTIVNEKGEVNVSTEDAKNPCFWSRV
FT                   CLHNMALLAKESTTKRRILESLFLYFDNGNLWSPENGLAFPVLKDMQFLGENSGQNTHF
FT                   LLSLLVKHLDHKNVLKKPSMQLDIVEVTTSLARHAKVESSVAIIGAVSDVMRHLRKSIH
FT                   CSIDDENLGADIIKWNRKFQETVDECLVQLSYKVGEAGMSTNSAFPEALFHQLLPAMVH
FT                   PDHETRVGAHRIFSVVLVPFSVCPRPCPITPELKKASDLPRMLSRTVSVFSSSAALFEK
FT                   LRKEKSFSKENICQENKEDELKNNNAGILNRMKSSLSRAYSLKSSAMSLTTDANFTSNS
FT                   NNELEAVSLKLSSRQIALLLSSIWAQSISPANMPENYEAIAHTYSLVLLFSRAKNSIHE
FT                   VLVRSFQLAFSLRSISLVDGGPLPPARRRSLFTLAISMIVFSSKAYDILPLVPCAKAAL
FT                   LDRMVDPFLHLVQDNKLQAVNSGSDCASKVYGSKEDDECALKALSQIKIAEEQTRESFA
FT                   TIIVKSLENLSESESSILREQLVHEFLPDDVYLWGTQMLLDATRLDFKSNESPEEAAAI
FT                   SATDDDAFLDLYDSQTKHDLQLSVQNPNLLGINQLLESVLEKAHEVGRFSVSTAPDVSY
FT                   KEMSGHCEALLMGKQQKMSNLISTQQKQVSLMNFSSQNHDDEAKKMITHCYDVRNPFSD
FT                   QNFAANLHKPPIDPAPIHCATEYLHHPHFFKLPASSPYDNFLKAAGC"
FT   gap             684972..685071
FT                   /estimated_length=100
FT   gene            complement(706527..707841)
FT                   /locus_tag="VIT_08s0007g08340"
FT                   /old_locus_tag="Vv08s0007g08340"
FT   mRNA            complement(join(706527..706619,706749..706892,
FT                   706989..707059,707168..707267,707354..707384,
FT                   707504..707601,707710..707841))
FT                   /locus_tag="VIT_08s0007g08340"
FT                   /old_locus_tag="Vv08s0007g08340"
FT                   /product="Predicted protein"
FT   CDS_pept        complement(join(706527..706619,706749..706892,
FT                   706989..707059,707168..707267,707354..707384,
FT                   707504..707601,707710..707841))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08340"
FT                   /old_locus_tag="Vv08s0007g08340"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7THY2"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:D7THY2"
FT                   /protein_id="CBI29858.3"
FT                   /translation="MEGKVERASSEKRWTFKRICVFCGSKPGSKSIFSDATVALGKQLV
FT                   ERNIDLVYGGGSKGLMGLISKTVLDGGRHVLGIIPKALMPYEITGKTIGDIKIVSSMHE
FT                   RKSEMAKRADAFIALPGGYGTMEELLEMVTWSQLGIHGKPVGLLNVDGYFNSLIELFDK
FT                   GVEEGFIVDSERHIIVSADTAEELMKKMEEYAPVHDAVTSRRSWEEEQSSGIITYGRAQ
FT                   "
FT   gene            complement(710144..712840)
FT                   /locus_tag="VIT_08s0007g08330"
FT                   /old_locus_tag="Vv08s0007g08330"
FT   mRNA            complement(join(710144..710334,710335..710553,
FT                   710631..710747,710881..710989,711117..711198,
FT                   711294..711501,711610..711630,711746..711913,
FT                   712030..712158,712497..712778,712779..712840))
FT                   /locus_tag="VIT_08s0007g08330"
FT                   /old_locus_tag="Vv08s0007g08330"
FT                   /product="Polygalacturonase"
FT   3'UTR           complement(710144..710334)
FT                   /locus_tag="VIT_08s0007g08330"
FT                   /old_locus_tag="Vv08s0007g08330"
FT   CDS_pept        complement(join(710335..710553,710631..710747,
FT                   710881..710989,711117..711198,711294..711501,
FT                   711610..711630,711746..711913,712030..712158,
FT                   712497..712778))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08330"
FT                   /old_locus_tag="Vv08s0007g08330"
FT                   /product="unknown"
FT                   /db_xref="GOA:Q94B15"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:Q94B15"
FT                   /protein_id="CBI29859.3"
FT                   /translation="MSLQRRFVPCLIVFLLSFPCYFSLQASPPYDYLGEASGYDSQANH
FT                   LHFSTIQSRETENWPWRKFGSKTGKSLASVKMVNVNYYGAKGDGSDATEAFKKAWKAAC
FT                   SSPGSVLVVPKNKNYLLKPITFQGPCKSSITVQIYGTVQASTDRSAYSNDMTHWLIFEN
FT                   VQNLAVQGGGTINGNGKTWWENSCKVNYDLPCKGAPTALTFYNCKNLAVKNLKIQNAQQ
FT                   MHVSFEKCVGVQASGLTITAPGNSPNTDGIHVSYTKIIQISSSVIGTGDDCISIVSGSQ
FT                   KVQVNGITCGPGHGISIGSLGSGDSEAHVSDVTVNGATLSGTTNGVRIKTWQGGSGSAS
FT                   NIKFQNIVMHNVENPIIIDQKYCDQSKPCKSQSSAVQVQNVLYQNIKGTSSSKEAISLD
FT                   CSAKFPCQGILLRDIDIKVGGGKAAKAVCSNARVTVMGDVSPNCA"
FT   5'UTR           complement(712779..712840)
FT                   /locus_tag="VIT_08s0007g08330"
FT                   /old_locus_tag="Vv08s0007g08330"
FT   gene            715921..718527
FT                   /locus_tag="VIT_08s0007g08320"
FT                   /old_locus_tag="Vv08s0007g08320"
FT   mRNA            join(715921..715947,715948..716814,717201..718011,
FT                   718445..718527)
FT                   /locus_tag="VIT_08s0007g08320"
FT                   /old_locus_tag="Vv08s0007g08320"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           715921..715947
FT                   /locus_tag="VIT_08s0007g08320"
FT                   /old_locus_tag="Vv08s0007g08320"
FT   CDS_pept        join(715948..716814,717201..718011,718445..718527)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08320"
FT                   /old_locus_tag="Vv08s0007g08320"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HL02"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR032867"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL02"
FT                   /protein_id="CCB55140.1"
FT                   /translation="MRVLRQIHARLLTHAMPISSISFGLCKIIGFCALSPYGDIDYARK
FT                   LFSQIQRPNIFSWNSMIRGCSQSQTPSKEPVILFRKMVRRGYPNPNTFTMAFVLKACSI
FT                   VSALEEGQQVHANVLKSGFGSSPFVETALVNFYAKCEDIVLASKVFDEITDRNLVAWST
FT                   MISGYARIGLVNEALGLFRDMQKAGVVPDEVTMVSVISACAASGALDTGKWVHAYINKQ
FT                   LIETDLELSTALVNMYAKCGCIERAKEVFDAMPVKDTKAWSSMIVGLAINGLAEDALEE
FT                   FFRMEEAKVKPNHVTFIGVLSACAHSGLVSEGRRYWSSMLEFGIVPSMELYGCMVDLLC
FT                   RASLVEDACTLVETMPISPNPVIWRTLLVGCKKSKNLDKSEVVAQRLLELEPHNAENYI
FT                   LLSNLYASMSQWEKMSQVRKKMKGMGIKAVPGCSSIEVDGLVHEFVMGDWSHPEAMEVR
FT                   EILRDISKRVHAVGHQPGISDVLHNVVDEEKENALCEHSERLAIAYGLLKTKTPMAIRI
FT                   VKNLRVCGDCHEVTKIISAEYRREIIVRDRVRFHKFVNGSCSYCSRASQLVLLPFKLHK
FT                   RVLKDCHAID"
FT   gene            complement(720176..726999)
FT                   /locus_tag="VIT_08s0007g08310"
FT                   /old_locus_tag="Vv08s0007g08310"
FT   mRNA            complement(join(720176..720465,720466..720825,
FT                   720906..720994,721145..721362,721463..721597,
FT                   721692..721759,721925..722477,722719..722841,
FT                   722972..723079,723200..723291,723421..723469,
FT                   723877..723967,724297..724544,725109..725313,
FT                   726957..726999))
FT                   /locus_tag="VIT_08s0007g08310"
FT                   /old_locus_tag="Vv08s0007g08310"
FT                   /product="Predicted protein"
FT   3'UTR           complement(720176..720465)
FT                   /locus_tag="VIT_08s0007g08310"
FT                   /old_locus_tag="Vv08s0007g08310"
FT   CDS_pept        complement(join(720466..720825,720906..720994,
FT                   721145..721362,721463..721597,721692..721759,
FT                   721925..722477,722719..722841,722972..723079,
FT                   723200..723291,723421..723469,723877..723967,
FT                   724297..724544,725109..725313,726957..726999))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08310"
FT                   /old_locus_tag="Vv08s0007g08310"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HL03"
FT                   /db_xref="InterPro:IPR008811"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL03"
FT                   /protein_id="CCB55141.1"
FT                   /translation="MRRWRDDGLKIEDSLRCSKMTVTPKISINEGNLVVQGKTILTGVP
FT                   DNIVLTPGSGGGLVAGTFIGATASHSKSLHVFPMGTLDGLRFMCCFRFKLWWMTQRMGT
FT                   CGKDVPFETQFMLIESKETTEGGEHDDAPTIYTVFLPLLEGQFRAVLQGNDKNEIEICL
FT                   ESGDTAVETNQGLHLVYMHSGTNPFEVIDQAVKAVEKHMQTFLHREKKKLPSFLDWFGW
FT                   CTWDAFYTDVTAEGIEEGLQSLSKGGAPPKFLIIDDGWQQIGNENKDNNCVVQEGAQFA
FT                   NRLTGIKENEKFQKNGRNNEQVPGLKHVVEDAKQRHNVKFVYVWHALAGYWGGVKPAAA
FT                   GMEHYECALAYPVQSPGVMGNQPDIVMDSLSVHGLGLVPPRTVFNFYNELHAYLASCGV
FT                   DGVKVDVQNIIETLGAGHGGRVALTRSYQQALEASIARNFTDNGCISCMCHNTDGLYST
FT                   KQTAVVRASDDFYPRDPASHTIHISSVAYNTLFLGEFMQPDWDMFHSLHPAAEYHGAAR
FT                   AVGGCAIYVSDKPGHHNFELLRKLVLPDGSVLRAQLPGRPTRDCLFADPARDGTSLLKI
FT                   WNVNKCSGVVGVFNCQGAGWCKIEKKTRVHDTSPDTLTGSVCAADVDQIAHVAGTNWKG
FT                   DVVVYAYKSGEVVRLPEGASLPVTLKVLEFEVFHFCPLKEIATNISFAPIGLLDMLNSG
FT                   GAVEQFEVHMASEKPELFDGEIPFELSTSLSENRSPTATIALTARGCGRFGAYSSQRPL
FT                   KCQVGDAEVEFSYDPNNGLLTFTIPIPEEEMYRWSIAIQV"
FT   gene            complement(736873..742134)
FT                   /locus_tag="VIT_08s0007g08300"
FT                   /old_locus_tag="Vv08s0007g08300"
FT   mRNA            complement(join(736873..737202,737203..737349,
FT                   737765..737995,738291..738458,738628..738743,
FT                   738873..739025,739884..740027,740140..740263,
FT                   741361..741858,741859..742134))
FT                   /locus_tag="VIT_08s0007g08300"
FT                   /old_locus_tag="Vv08s0007g08300"
FT                   /product="Calcium dependent protein kinase 32"
FT   3'UTR           complement(736873..737202)
FT                   /locus_tag="VIT_08s0007g08300"
FT                   /old_locus_tag="Vv08s0007g08300"
FT   CDS_pept        complement(join(737203..737349,737765..737995,
FT                   738291..738458,738628..738743,738873..739025,
FT                   739884..740027,740140..740263,741361..741858))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08300"
FT                   /old_locus_tag="Vv08s0007g08300"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HL04"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL04"
FT                   /protein_id="CCB55142.1"
FT                   /translation="MGNCCVTPVPSEKKKGKKKQNPFSLDYAANQGNGGSKLSVLKDPT
FT                   GREIELRYELGRELGRGEFGITHLCTDKSTGDVYACKSISKKKLRTAVDIDDVRREVEI
FT                   MKHLPKHPNIVTLKDTYEDDNAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKTIVE
FT                   VVQMCHKHGVMHRDLKPENFLFANKKETAPLKAIDFGLSVFFKPGERFTEIVGSPYYMA
FT                   PEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVLDFKRDPWPKVS
FT                   ENAKDLVKKMLDPDPKRRLSAQEVLDHPWLQNAKKAPNVSLGETVRARLKQFSMMNKLK
FT                   KRALRVIAEHLSVEEVAGIKEGFQLMDTGNKGKINMDELRVGLQKLGHQIPEQDLQILM
FT                   EAGDVDGDGHLDYGEFVAISVHLRKMGNDDHLLKAFEFFDQNNSGYIEIEELRDALAGE
FT                   LESNSEEVINAIIHDVDTDKDGRISYDEFAAMMKAGTDWRKASRQYSRERFNNLSLKLI
FT                   RDGSLEVRP"
FT   5'UTR           complement(741859..742134)
FT                   /locus_tag="VIT_08s0007g08300"
FT                   /old_locus_tag="Vv08s0007g08300"
FT   gene            complement(745960..757930)
FT                   /locus_tag="VIT_08s0007g08290"
FT                   /old_locus_tag="Vv08s0007g08290"
FT   mRNA            complement(join(745960..746164,746165..746298,
FT                   746959..747154,747239..747404,748306..748400,
FT                   748941..749025,749099..749250,754098..754214,
FT                   754382..754516,754649..754738,755535..755687,
FT                   756064..756240,756526..756729,756947..757056,
FT                   757618..757831,757832..757930))
FT                   /locus_tag="VIT_08s0007g08290"
FT                   /old_locus_tag="Vv08s0007g08290"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(745960..746164)
FT                   /locus_tag="VIT_08s0007g08290"
FT                   /old_locus_tag="Vv08s0007g08290"
FT   CDS_pept        complement(join(746165..746298,746959..747154,
FT                   747239..747404,748306..748400,748941..749025,
FT                   749099..749250,754098..754214,754382..754516,
FT                   754649..754738,755535..755687,756064..756240,
FT                   756526..756729,756947..757056,757618..757831))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08290"
FT                   /old_locus_tag="Vv08s0007g08290"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7THY7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:D7THY7"
FT                   /protein_id="CBI29863.3"
FT                   /translation="MEMAVAFHKPLNSRLSINPNPNSRRGLCFSSSLLFNCRLPSSPIA
FT                   TTPFKFPFRNSVPAPIKCSISTETAKEKKRQLMRRRDIRNIAIVAHVDHGKTTLVDAML
FT                   KQAKVFRDNQFVQERIMDSNDLERERGITILSKNTSIGYKDTKINIIDTPGHSDFGGEV
FT                   ERILNMVEGVLLVVDSVEGPMPQTRFVLKKALEFGHAVVVVVNKIDRPSARPDYVINAT
FT                   FELFIELNATDEQCDFQAIYASGIKGKAGLSPENLADDLGPLFESIIRCIPGPRIDKDG
FT                   ALQMLATNIEYDEHKGRIAIGRVHAGVLQKGMDVRVCTTEDACRYARVSELFVYEKFSR
FT                   VPAETVEAGDICAVCGIDDIQIGETIADKSSGKPLPAIKVEEPTVKMAFSINTSPFVGR
FT                   EGKYVTSRNLRDRLYREIERNLAMRVEDGETADTFIVSGRGTLHITILIENMRREGYEF
FT                   MVGPPKVINKRVDDKLQEPFEIATVEVPEEHMGSVVELLGKRRGQMFDMQGVGSEGTTL
FT                   LKYKIPTRGLLGLRNAILTASRGTAILNTIFDSYGPWAGDITTRDQGSLVAFEEGSTTS
FT                   YALCSSQERGQMFVGPGVDVYKGQIVGIHQRPGDLSLNVCKKKAATNVRSNKEQTVVLD
FT                   TPLDYSLDDCIEYIQEDEMVEVTPLSIRMCKNPKLAKKTR"
FT   5'UTR           complement(757832..757930)
FT                   /locus_tag="VIT_08s0007g08290"
FT                   /old_locus_tag="Vv08s0007g08290"
FT   gene            760077..761960
FT                   /locus_tag="VIT_08s0007g08280"
FT                   /old_locus_tag="Vv08s0007g08280"
FT   mRNA            join(760077..760281,760282..760905,761379..761570,
FT                   761571..761960)
FT                   /locus_tag="VIT_08s0007g08280"
FT                   /old_locus_tag="Vv08s0007g08280"
FT                   /product="unknown predicted protein"
FT   5'UTR           760077..760281
FT                   /locus_tag="VIT_08s0007g08280"
FT                   /old_locus_tag="Vv08s0007g08280"
FT   CDS_pept        join(760282..760905,761379..761570)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08280"
FT                   /old_locus_tag="Vv08s0007g08280"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR005516"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL05"
FT                   /protein_id="CCB55143.1"
FT                   /translation="MLSIDYRASTSNGDEDHDDEEIRDIHALTPPPPPPPPQVSRGRRR
FT                   EAWETSSHRSSSLSTTSEGASSENFTSMSREFNALLNMAGSAIGNNGNENDGGGAGNNL
FT                   GRIGEEEMPEETNPLAIVPDTSLLDPVPSPRHVAAGAGGLSTTSSHSEVSVQRVKKEEV
FT                   DAKISAWQTAKIAKINNRFKREDAIINGWESEEVQKTTSWMKKVERKLEEKRARALEKM
FT                   QNDVAKAHRKAEERRASAEAKRGTKVARVLELANLMRAVGRAPVKRSIF"
FT   3'UTR           761571..761960
FT                   /locus_tag="VIT_08s0007g08280"
FT                   /old_locus_tag="Vv08s0007g08280"
FT   gene            complement(761961..765385)
FT                   /locus_tag="VIT_08s0007g08270"
FT                   /old_locus_tag="Vv08s0007g08270"
FT   mRNA            complement(join(761961..761963,762290..762704,
FT                   762724..763014,763015..765384,765385..765385))
FT                   /locus_tag="VIT_08s0007g08270"
FT                   /old_locus_tag="Vv08s0007g08270"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(join(761961..761963,762290..762704,
FT                   762724..763014))
FT                   /locus_tag="VIT_08s0007g08270"
FT                   /old_locus_tag="Vv08s0007g08270"
FT   CDS_pept        complement(763015..765384)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08270"
FT                   /old_locus_tag="Vv08s0007g08270"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HL06"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL06"
FT                   /protein_id="CCB55144.1"
FT                   /translation="MFTLALTASTPGTGTGMATGSVILVPRAYAFSPFEAKPHSTEILN
FT                   SPAFSPLKARPANTGFNSYPGHNAQDPNSKTTHSSMVYCNSDSDQNPLFNDWPQLLQIS
FT                   IGSGDLMLGQAIHAFLAKLGYQNDAFRGNNLVNLYGKFNKLGDAQSVFDEMLVRNTITW
FT                   TTLIKGHLQVNDVESVFRIAREMYWVGEEFNEHTCSVILQACDSLENLVRGEQIHGFVI
FT                   KRGFDEDVFVGTSLISMYSRCGDLGAAEKVYSNLAYKDVRCLNFMISEYGKAGCGEKAI
FT                   GVFLHLLGSGLEPNDYTFTNVISACNGDIDVEVLRVLHGMCIKCGCGDEISVGNAIVSV
FT                   YVKHGMLEEAEKSFCGMGERNLVSWTALLSGYVKNGNGKKALEGFSQILELGVGFDSCC
FT                   FATLLDGCSECKNLGLGLQIHGFVVKLGYVHDVSVGTALIDLYAKCRKLRSARLVFHSL
FT                   LDKNIVSFNAILSGYIGADEEDAMALFSQLRLADIKPDSVTFARLLSLSADQACLVKGK
FT                   CLHAYIIKTGFEANPSVGNAVITMYAKCGSIGDACQLFYSMNYLDSISWNAVISAYALH
FT                   GQGRKALILFEEMKKEEFVPDEITILSVLQACSYSGLLEEGFCLFNDMESKYGIKPEIE
FT                   HFACMVDLLGRAGYLSEAMSFINRSPFSGSPLLWRTLVHVCKLHGDLNFGQIASKHLLD
FT                   LAPEEAGSYILVSNLYAGGGMLNEAARVRTVMNDLKVSKEAGSSWIEIDNKVHQFVASD
FT                   KDHPESKEIYAKLDLLKSEMKQNMIYNRTPADMSPM"
FT   5'UTR           765385..765385
FT                   /locus_tag="VIT_08s0007g08270"
FT                   /old_locus_tag="Vv08s0007g08270"
FT   gene            775671..779315
FT                   /locus_tag="VIT_08s0007g08260"
FT                   /old_locus_tag="Vv08s0007g08260"
FT   mRNA            join(775671..775775,775776..775781,775882..775915,
FT                   776502..776536,776707..776814,776905..776975,
FT                   777062..777191,777317..777679,777978..778099,
FT                   778182..778317,778412..778460,778587..778692,
FT                   778788..778911,778912..779315)
FT                   /locus_tag="VIT_08s0007g08260"
FT                   /old_locus_tag="Vv08s0007g08260"
FT                   /product="Predicted protein"
FT   5'UTR           775671..775775
FT                   /locus_tag="VIT_08s0007g08260"
FT                   /old_locus_tag="Vv08s0007g08260"
FT   CDS_pept        join(775776..775781,775882..775915,776502..776536,
FT                   776707..776814,776905..776975,777062..777191,
FT                   777317..777679,777978..778099,778182..778317,
FT                   778412..778460,778587..778692,778788..778911)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08260"
FT                   /old_locus_tag="Vv08s0007g08260"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7THY8"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7THY8"
FT                   /protein_id="CBI29864.3"
FT                   /translation="MPLLSGKFSDSASGSILNRRNNFSMGEAPAFFVDDLQQVFSNGFD
FT                   PKPKVSESETTVGDKIYAIGEAHEGLALSTRIFDNSTGEWVIPAVLGTKPEAGKGHSAV
FT                   LVNEDRILIIKRGSTPDDCIWFLEVDTEFVREQKKTLGTEVVAWSRGVIGDANKPIVIS
FT                   GPSGVGKGTLISKLMKEFPSMFGFSVSHTTRAPRDKEINGVHYHFTERSVMEKEIKDVK
FT                   FLEFANVHGNLYGTSIEAVEVVADAGKRCILDIDVQGARSVRASSLEAIFIFICPPSFE
FT                   ELEKRLRARGTETEEQIQKRLRNAEAELEQGQSSGLFDHILVNDDLDKCYENLKKLLDL
FT                   DGNVADTFSKPSPKPVELPIGHSVLKINEKVVISCRTQELEKASKNLIVLDVSSLKGGA
FT                   PGRTRGLKMRAMDSFSDVVNGINQLTHS"
FT   3'UTR           778912..779315
FT                   /locus_tag="VIT_08s0007g08260"
FT                   /old_locus_tag="Vv08s0007g08260"
FT   gene            complement(782454..788666)
FT                   /locus_tag="VIT_08s0007g08250"
FT                   /old_locus_tag="Vv08s0007g08250"
FT   mRNA            complement(join(782454..782870,782911..783085,
FT                   783086..783523,785026..785190,785851..785922,
FT                   786149..786267,787360..787630,787631..787672,
FT                   788577..788666))
FT                   /locus_tag="VIT_08s0007g08250"
FT                   /old_locus_tag="Vv08s0007g08250"
FT                   /product="Transcription factor"
FT   3'UTR           complement(join(782454..782870,782911..783085))
FT                   /locus_tag="VIT_08s0007g08250"
FT                   /old_locus_tag="Vv08s0007g08250"
FT   CDS_pept        complement(join(783086..783523,785026..785190,
FT                   785851..785922,786149..786267,787360..787630))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08250"
FT                   /old_locus_tag="Vv08s0007g08250"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7THZ0"
FT                   /db_xref="InterPro:IPR001289"
FT                   /db_xref="InterPro:IPR018362"
FT                   /db_xref="UniProtKB/TrEMBL:D7THZ0"
FT                   /protein_id="CBI29866.3"
FT                   /translation="MHKQTERKNQPESKADSNNPYSICSQPWWRGLGNDVISPDVLGES
FT                   SPNSASAEHPNGGVGTIAIKSRAKVVTDNGNDPEKEMKITLASQSDGSCGQEQKHPQQA
FT                   VSMMPMTMAEYHLAPPSQLELVGHSIACASYPYSEPYYTGVIPAYGPQGLVQSQFLGVN
FT                   VARMALPIEMAEEPVYVNAKQYHGILRRRQSRAKAELEKKLIKVRKPYLHESRHQHAMR
FT                   RARGCGGRFLNTKKLDSNASYDMPDKGSDPDVNLSTRPISSSVSESLPSNSSRNEDSPT
FT                   SHLDARGPSVQELHNRQIASHGNGNSCYPHNQGFQLSTYHSLKDDRVEEGDHAGRQHER
FT                   ILVNRAPHRALTIK"
FT   5'UTR           complement(788577..788666)
FT                   /locus_tag="VIT_08s0007g08250"
FT                   /old_locus_tag="Vv08s0007g08250"
FT   gene            complement(792479..795229)
FT                   /locus_tag="VIT_08s0007g08240"
FT                   /old_locus_tag="Vv08s0007g08240"
FT   mRNA            complement(join(792479..792606,792607..792947,
FT                   795169..795229))
FT                   /locus_tag="VIT_08s0007g08240"
FT                   /old_locus_tag="Vv08s0007g08240"
FT                   /product="Predicted protein"
FT   3'UTR           complement(792479..792606)
FT                   /locus_tag="VIT_08s0007g08240"
FT                   /old_locus_tag="Vv08s0007g08240"
FT   CDS_pept        complement(join(792607..792947,795169..795229))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08240"
FT                   /old_locus_tag="Vv08s0007g08240"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HL07"
FT                   /db_xref="InterPro:IPR040389"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL07"
FT                   /protein_id="CCB55145.1"
FT                   /translation="MKAKAEKCEGDFSRRWEQLTEGSTSASMASHATRKRLYERQHGEA
FT                   EAQERSPTSNKIEGEEEEEEEEEEASSRNGCCTPKGKRFRIPEILTCPPAPKKRRVTPN
FT                   CLTKRSPIAYFAPPDIELFFFFAFRNISA"
FT   gene            complement(795370..798642)
FT                   /locus_tag="VIT_08s0007g08230"
FT                   /old_locus_tag="Vv08s0007g08230"
FT   mRNA            complement(join(795370..795531,795532..797478,
FT                   798604..798642))
FT                   /locus_tag="VIT_08s0007g08230"
FT                   /old_locus_tag="Vv08s0007g08230"
FT                   /product="Predicted protein"
FT   3'UTR           complement(795370..795531)
FT                   /locus_tag="VIT_08s0007g08230"
FT                   /old_locus_tag="Vv08s0007g08230"
FT   CDS_pept        complement(join(795532..797478,798604..798642))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08230"
FT                   /old_locus_tag="Vv08s0007g08230"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HL08"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000858"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001480"
FT                   /db_xref="InterPro:IPR003609"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR036426"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL08"
FT                   /protein_id="CCB55146.1"
FT                   /translation="MSFHSEDWKKRADGVTVWTSKTSHLSVASAALGDNGNLVLMNSSK
FT                   DVVWQSFDTPADTLLPGQILSASQTLRPLSKSSVSSYYDLQLNVQGRLQLRWETNISYW
FT                   TVGGQSGSNLSAVLTSDGALQLLDRRSKSVWSVFGEDHDDPLVKFRFLRLDADGNLRLY
FT                   SWAKALRSWKSVWQAVENQCNVFATCYLSGVCLFNASGSHVCKCPFTSTAESSSECLVP
FT                   SQLGCDSGSTLVTYDHTFLYGIYPPNDSVSTISLEQCKTLCLNDPSCTAVSFTNDGIAQ
FT                   CHTRKTRFITGYSDPAVGSISFVKMCLDPVAAFPNLSISSPPQSRLKRSYAFSGQCLIG
FT                   ALSGTLVTFVTIQLGIGFCFYKRRNFYRKQAALALRDPNSQVLLMLSYNEIMDLTGNFG
FT                   YHLGPMVFKGMLPNDQPVAVKGLKTSIEERKFRASVSRIGGIHQKNLAKLEGYCCESDH
FT                   RFLVYEFVENGSVDHCIQDPKLSRRLTWRKRINICLSVARAISYLHAECREFVSHGNLK
FT                   CENVLLDENLDAKVTEFGLGRLHSDTLDESAENDVEGFGKMMVILVTGQTEADDVCEWA
FT                   YKEWISGHAEGIVDERIEGGVDSEEVERLLRLAFWCLQVDKRLRPSMGEVVKVFEGTLT
FT                   VDRPPPPFLCRMPLEEEEDYDEEKDN"
FT   gene            809363..810810
FT                   /locus_tag="VIT_08s0007g08220"
FT                   /old_locus_tag="Vv08s0007g08220"
FT   mRNA            join(809363..809512,809513..809552,810697..810746,
FT                   810747..810810)
FT                   /locus_tag="VIT_08s0007g08220"
FT                   /old_locus_tag="Vv08s0007g08220"
FT   5'UTR           809363..809512
FT                   /locus_tag="VIT_08s0007g08220"
FT                   /old_locus_tag="Vv08s0007g08220"
FT   CDS_pept        join(809513..809552,810697..810746)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08220"
FT                   /old_locus_tag="Vv08s0007g08220"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7THZ2"
FT                   /protein_id="CBI29868.3"
FT                   /translation="MVDLLFTFLAAKIAILQRMKACAVYHQTG"
FT   3'UTR           810747..810810
FT                   /locus_tag="VIT_08s0007g08220"
FT                   /old_locus_tag="Vv08s0007g08220"
FT   gene            810811..813634
FT                   /locus_tag="VIT_08s0007g08210"
FT                   /old_locus_tag="Vv08s0007g08210"
FT   mRNA            join(810811..812922,812923..813634)
FT                   /locus_tag="VIT_08s0007g08210"
FT                   /old_locus_tag="Vv08s0007g08210"
FT                   /product="unknown predicted protein"
FT   CDS_pept        810811..812922
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08210"
FT                   /old_locus_tag="Vv08s0007g08210"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HL09"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL09"
FT                   /protein_id="CCB55147.1"
FT                   /translation="MNHLTVVTEDAFASLLELAANNDFGRFKQSIEREPSGVDEIGQWY
FT                   GRQKGSKQMVLEYRTPLMVAATYGSIDVMKLILSLSDSDVNRFCGLDKSTALHCAASGG
FT                   SVNAVDVVKLLLLVGADPNSLDANGHRPVDVLVVPPKLQDVKATLEELLATNGSSVERN
FT                   LSISTVTSNSNSSPLSSSPENGSSSSDSDSPPSPMNVKLNDLPISCASEKKEYPVDPSL
FT                   PDIKNSIYATDEFRMFSFKVRPCSRAYSHDWTECPFVHPGENARRRDPRKFHYSCVPCP
FT                   DFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTNCNRRVCFFAHTTEELRPLYM
FT                   STGSAVPSPRPSSSTATAMDFATAMNLIPGSPSSVSVMSPSPFTPPLSPSANGVSHSSM
FT                   GWAQPNVPTLHLPGSNLQSSRLRSSLNARDIPAEDINLMLDFDIQQHQLLNELSCLSQP
FT                   CVNSNSLNRSGRSKTLTPSNLDELFSAESSSPRYSDQALASAVYSPTHKSAVLNQFQQQ
FT                   QSMLSPINTNFSPKNVDHPLLQASFASSGRMSPRSMEPISPMSSRASMFAQREKQQQQQ
FT                   FRSLSSRDLGSNSSAIVGSPINSWSKWGSSNVKPDWAMNANELGGHRRSNSFELGNNGE
FT                   EPDLSWVQSLVKESPTETKEKAATPALDTAEASSSSDGSNLNSQIESIDHAVLGAWLEQ
FT                   MQLDQLVAQ"
FT   3'UTR           812923..813634
FT                   /locus_tag="VIT_08s0007g08210"
FT                   /old_locus_tag="Vv08s0007g08210"
FT   gene            complement(817748..823530)
FT                   /locus_tag="VIT_08s0007g08200"
FT                   /old_locus_tag="Vv08s0007g08200"
FT   mRNA            complement(join(817748..817918,817919..817961,
FT                   818088..818209,818644..818739,818842..818958,
FT                   819039..819110,819349..819512,819980..820080,
FT                   820225..820321,821181..821316,822008..822192,
FT                   822333..822527,822689..822810,823084..823157,
FT                   823158..823282,823376..823530))
FT                   /locus_tag="VIT_08s0007g08200"
FT                   /old_locus_tag="Vv08s0007g08200"
FT                   /product="Predicted protein"
FT   3'UTR           complement(817748..817918)
FT                   /locus_tag="VIT_08s0007g08200"
FT                   /old_locus_tag="Vv08s0007g08200"
FT   CDS_pept        complement(join(817919..817961,818088..818209,
FT                   818644..818739,818842..818958,819039..819110,
FT                   819349..819512,819980..820080,820225..820321,
FT                   821181..821316,822008..822192,822333..822527,
FT                   822689..822810,823084..823157))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08200"
FT                   /old_locus_tag="Vv08s0007g08200"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7THZ4"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D7THZ4"
FT                   /protein_id="CBI29870.3"
FT                   /translation="MWNAVFHLWKNMGKVPLSVIFRDTRNVFKKDELGLEIAQIAFPAA
FT                   LALTADPIASLIDTAFIGHIGAVELAAVGVSIAVFNQVSRIAIFPLVSITTSFVAEEDT
FT                   VGRRTNENLEKGLAIDNEMEELIPHIDSMHNSPSRTVNNTKNMEFEHERRHIPSASSAL
FT                   VIGGVLGLIQALFLIFSAKSILNFMGVNSGSPMLAPAMQYLTLRSLGAPAVLLSLAMQG
FT                   VFRGFKDTKTPLYATILGDVANIILDPILMFVFRLGVSGAAIAHVISQYLISVILLWRL
FT                   MRKVDLLPPSIKDLQLGRFLRNGSLLLVRVIAVTFCVTLAASLAARLGSTSMAAFQVCL
FT                   QIWLATSLLADGLAVAGQAILASAFAKKDYDKATATASRVLQLGLVLGLVLSVFLLVVL
FT                   QYASRVFTKDVNVLQLMNLGIPFVAVTQPINALAFVFDGVNFGASDFAYSACSMVLVAI
FT                   VSILCLFILSSSLGFIGIWIALSIYMSLRTMSGFWRIWTGSGPWSFLRA"
FT   5'UTR           complement(823376..823530)
FT                   /locus_tag="VIT_08s0007g08200"
FT                   /old_locus_tag="Vv08s0007g08200"
FT   gene            complement(825119..827089)
FT                   /locus_tag="VIT_08s0007g08190"
FT                   /old_locus_tag="Vv08s0007g08190"
FT   mRNA            complement(join(825119..825133,825134..827089))
FT                   /locus_tag="VIT_08s0007g08190"
FT                   /old_locus_tag="Vv08s0007g08190"
FT                   /product="Predicted protein"
FT   3'UTR           complement(825119..825133)
FT                   /locus_tag="VIT_08s0007g08190"
FT                   /old_locus_tag="Vv08s0007g08190"
FT   CDS_pept        complement(825134..827089)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08190"
FT                   /old_locus_tag="Vv08s0007g08190"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HL10"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR032867"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL10"
FT                   /protein_id="CCB55148.1"
FT                   /translation="MFLRLPKRCRFDSAYVEVSPPSQIIAPAILPSNQKAGALMLHQIP
FT                   RSPFQPQTHTPPSKPLPITPQNPLNQSSVEHNYRNICNLLLSITHSRSLFKGLQLHGHI
FT                   VKSGFLTIHLVCHHLINFYSKSQLPHYSRQVFEETPVKSSTTWSSVISAFAQNELPSLA
FT                   IDFFRRMLDNGVRPDDHIFPSATKACGILSRCDIGQSVHSFAVKTGYDCDVFVGSSMVD
FT                   MYAKCGEIGDARKMFDEMPDRNVVSWSGMIYGYSQMGEDEEALRLFKQALIEDLDVNDF
FT                   TFSSVVRVCGNSTLLELGKQIHGLCLKTSYDSSSFVGSSLISLYSKCGVIEDAYLVFHE
FT                   IPIRNLGMWNAMLIACAQHAHTEKAFDLFKQMEGVGMKPNFITFLCVLYACSHAGLVEK
FT                   GQFYFELMKEYGIEPGAQHYASMVDLLGRAGKLKDAVSIIKKMPMEPTESVWGALLTGC
FT                   RIHGDTELASFVADRVFELGPVSSGIHVLVSNAYAAAGRYEEAARARKMLRDQGVKKET
FT                   GLSWVEEGNRIHTFAAGDRSHPYTKDIYKKLEELGEEMERAGYIADTSFVLQEVDGEEK
FT                   NQTIRYHSERLAIAFGLISFPPERPIRVMKNLRVCGDCHTAIKFMSKCCGRTIIVRDNN
FT                   RFHRFEDGNCSCRDYW"
FT   gene            829913..852506
FT                   /locus_tag="VIT_08s0007g08180"
FT                   /old_locus_tag="Vv08s0007g08180"
FT   mRNA            join(829913..830011,830012..830165,830307..830407,
FT                   831760..831970,832301..832382,832713..833013,
FT                   834742..834844,834938..835074,835581..835754,
FT                   838767..838972,839081..839224,839323..839411,
FT                   840641..840788,840945..840997,841711..841766,
FT                   842785..842948,843192..843382,847924..847981,
FT                   848051..848123,849618..849719,849867..849963,
FT                   850048..850176,850254..850495,850654..850794,
FT                   852130..852312,852313..852506)
FT                   /locus_tag="VIT_08s0007g08180"
FT                   /old_locus_tag="Vv08s0007g08180"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           829913..830011
FT                   /locus_tag="VIT_08s0007g08180"
FT                   /old_locus_tag="Vv08s0007g08180"
FT   CDS_pept        join(830012..830165,830307..830407,831760..831970,
FT                   832301..832382,832713..833013,834742..834844,
FT                   834938..835074,835581..835754,838767..838972,
FT                   839081..839224,839323..839411,840641..840788,
FT                   840945..840997,841711..841766,842785..842948,
FT                   843192..843382,847924..847981,848051..848123,
FT                   849618..849719,849867..849963,850048..850176,
FT                   850254..850495,850654..850794,852130..852312)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08180"
FT                   /old_locus_tag="Vv08s0007g08180"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D7THZ6"
FT                   /protein_id="CBI29872.3"
FT                   /translation="MEEEAVIWKSDTDSMASVLIGRAMSTLLTCRPRKLDEAISRLDSP
FT                   SKRGSIVSLEDSLWFLHRYIKEAADKEERLDEILVPMIEHSLKCKESKHGNQAMVLLNW
FT                   LFQDELLFQALARGLADIILRKEDRYIALGWCTLVRGLVEYEISMDQFSNNGIRKIYNA
FT                   MLKILCSCISRLTFIVCNGSTVQDGFQLPTRLSVAAADCILDLTKALTIKTSITDVSSR
FT                   RSKSSNSDVSNLPTTLVPAAVGEKKVKPTSKSAEFSNKLEMELLLWDHIDKLIILVQRL
FT                   LAWSRKSRPLHAKGLEQVLKWLQEIKEHYGCSQDEAGSKVPKAGVLLLSSCWKHYAMLL
FT                   HLEDKKFSQQYKDLLDQYLSAIQFYTDSDSKQHTKNTDTGIATRKFFLNCLSLLLGRLD
FT                   GKQIERTVTEYGMKISCALIPQLCCTDEDVIDGVVCIFKTVIFKMNYSSSRSSLSDTRQ
FT                   MDSVLPLLLPLLDERDGTAKAVVMLVAEYCSINPNGQCLDEVLERLASGNASQRRNAVD
FT                   VISELIHISSNSVTALSHSMWQDISKHLLECLGDEEEIINVQASNLLPKIDPLLVLPAL
FT                   VRLVYSSNERVQSSASDAMTALLKNHNQNYEVLSMLLDSLSNLSQSLGLPKTSGDIEEG
FT                   SKLDTEKVLGLIPEWSESVQDWNLLIGPLIDKMFAEPSNATLVRFLSYISEHLAEAADI
FT                   VFHRILLHMKGQKELDESFFTKWESKTYAADDSMKLQHSLFDRLCPLLVIRLLPMRVFN
FT                   DLNSSVIYGQLPDQVVVHGYGSIDINDHECVAMLLLNRALGKFEFEDVRKLAAELCGRI
FT                   HPQVLLPILSSHLELAADSQDIVKIKACLFSVCTSLVARGRDSLSQPAMLKIQKTIKTI
FT                   LLWPSLDGDEVSKAQHGCIDCLALMICTELQAPKSFIGSVSDKISIIGKNFHPGDSALG
FT                   DSVVTYVIHQLSLDAVEAASTSMLCSDNCASEPSVPLSFRLCMANVLISACQKISDSGK
FT                   KAFARRILPYLIHFVQVIKDSEIRVACVQVLFSAVYHLKSMILPYSSELLKLSLKSLEG
FT                   NSEKERMAGVKLMASLMASEDAIVENISEGLLEARLVLLSMYMADPSLEVQQMCQKLLA
FT                   CLTHS"
FT   3'UTR           852313..852506
FT                   /locus_tag="VIT_08s0007g08180"
FT                   /old_locus_tag="Vv08s0007g08180"
FT   gene            854082..854668
FT                   /locus_tag="VIT_08s0007g08170"
FT                   /old_locus_tag="Vv08s0007g08170"
FT   mRNA            join(854082..854144,854145..854345,854346..854668)
FT                   /locus_tag="VIT_08s0007g08170"
FT                   /old_locus_tag="Vv08s0007g08170"
FT                   /product="Predicted protein"
FT   5'UTR           854082..854144
FT                   /locus_tag="VIT_08s0007g08170"
FT                   /old_locus_tag="Vv08s0007g08170"
FT   CDS_pept        854145..854345
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08170"
FT                   /old_locus_tag="Vv08s0007g08170"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL11"
FT                   /protein_id="CCB55149.1"
FT                   /translation="MLQLLFAVAFSAVPLTLYVPPIRSLNLFVETVETLFRQTAVYTLG
FT                   AYLRVRLAFSRILSSFLHFGR"
FT   3'UTR           854346..854668
FT                   /locus_tag="VIT_08s0007g08170"
FT                   /old_locus_tag="Vv08s0007g08170"
FT   gap             858399..858498
FT                   /estimated_length=100
FT   gene            859768..864674
FT                   /locus_tag="VIT_08s0007g08160"
FT                   /old_locus_tag="Vv08s0007g08160"
FT   mRNA            join(859768..859864,859942..860129,860259..860366,
FT                   860475..862177,862609..862681,863043..863198,
FT                   863199..863223,864599..864674)
FT                   /locus_tag="VIT_08s0007g08160"
FT                   /old_locus_tag="Vv08s0007g08160"
FT                   /product="putative uncharacterized protein"
FT   CDS_pept        join(859768..859864,859942..860129,860259..860366,
FT                   860475..862177,862609..862681,863043..863198)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08160"
FT                   /old_locus_tag="Vv08s0007g08160"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7THZ7"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="UniProtKB/TrEMBL:D7THZ7"
FT                   /protein_id="CBI29873.3"
FT                   /translation="MAEKSCSVSSLPWLWVMETLASFERVDISLLKDLMIKAPEVSDNL
FT                   GRNVKEMIALRCLEALFSGITNDVHPVVHSKMGFDPSESCEDVLQCILRKVSASKLRMG
FT                   EPELLKWNVNPFIAHKRACLPKCALQELKDTILEGSHPSAVSLKERSGLRFESQCETRT
FT                   PNGDGDSGAVAPRVDEGTACGQVEAAKGDLIPLTAENENNLLPEDTTERILLPYKRGLD
FT                   DLPAKNLMGQFNPNVDSVNYGGDSHSNAKRRKHDAFCSITSIEPNPVSLHGKKLLEDSS
FT                   RPSINECDLAKESQLGDLEGSTMVSEDDHDKYVVSKRVEQITDVEHGEFEHNQTQIPFH
FT                   SNKMPQNMPRDESHHDISVDEAKDDDVEHWVEPNKSIGAASDGSQQKTAVDEAKDDGDC
FT                   RVEPNKSSGSSDESQKKNSVDEAKDDGDHSSQPKASNDKLPNEAHHKVFVDEAKDDTEH
FT                   CCEEEMLSDSTEYHDEEDGIAMERQNFLSSKCTFNHDSLSIAGWTEQNLCMKCTKDGQL
FT                   LVCSSSGCPLVVHENCLGCPPSFDNMGNFYCPFCAYSRAVSEYLESKKKVSLAKKELAS
FT                   FINAGMKHEPVKPKKKHRKKNEKLNESANLVKVCENGHVKEKRQTRANHGDAQVTDQLI
FT                   RRNVEKHDGVEEQGVANLGVQQEALQQQISDPLEDPASGTSGDENDKPSSSTYYIRFRR
FT                   QQQQYTFPPIHQLRRKKLAWTAKEEEILKVGVQKFSNDHDKSIPWKKIMEFGGTVFQRG
FT                   RTTIDLKDKWRNICKGSPKSK"
FT   3'UTR           join(863199..863223,864599..864674)
FT                   /locus_tag="VIT_08s0007g08160"
FT                   /old_locus_tag="Vv08s0007g08160"
FT   gene            865458..867088
FT                   /locus_tag="VIT_08s0007g08150"
FT                   /old_locus_tag="Vv08s0007g08150"
FT   mRNA            join(865458..866224,866225..867088)
FT                   /locus_tag="VIT_08s0007g08150"
FT                   /old_locus_tag="Vv08s0007g08150"
FT                   /product="unknown predicted protein"
FT   5'UTR           865458..866224
FT                   /locus_tag="VIT_08s0007g08150"
FT                   /old_locus_tag="Vv08s0007g08150"
FT   CDS_pept        866225..867088
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08150"
FT                   /old_locus_tag="Vv08s0007g08150"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5B053"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="InterPro:IPR036955"
FT                   /db_xref="UniProtKB/TrEMBL:A5B053"
FT                   /protein_id="CCB55150.1"
FT                   /translation="MENNRKSPLKPWKKGPTRGKGGPQNATCEYRGVRQRTWGKWVAEI
FT                   REPKKRTRLWLGSFATAEEAAMAYDEAARRLYGPDAYLNLPHLQSNFNPSNKSQKLKWF
FT                   PSKNFISMFPSCGLLNINAQPSVHVIHQRLQELKKNGVLNQSSSSSSSSCDSKTDAQNM
FT                   NDKAPNKTHESPRTNNKDVEFSSEQIPEEREEKPQIDLNEFLQQLGILKDECQSEGSNA
FT                   AEGFAAPESSLKDDDELVGFAEESFNWDALIEMRGIEDHQGTDASSFQGYGMYEEPAFP
FT                   PSIWNF"
FT   gene            complement(872322..884449)
FT                   /locus_tag="VIT_08s0007g08140"
FT                   /old_locus_tag="Vv08s0007g08140"
FT   mRNA            complement(join(872322..872519,872520..872696,
FT                   872805..872939,873116..873260,873593..873696,
FT                   873849..874055,875470..875727,879408..879461,
FT                   880438..880510,881517..881704,882732..882896,
FT                   883206..883289,883414..883503,883886..883954,
FT                   884170..884248,884334..884449))
FT                   /locus_tag="VIT_08s0007g08140"
FT                   /old_locus_tag="Vv08s0007g08140"
FT                   /product="Predicted protein"
FT   3'UTR           complement(872322..872519)
FT                   /locus_tag="VIT_08s0007g08140"
FT                   /old_locus_tag="Vv08s0007g08140"
FT   CDS_pept        complement(join(872520..872696,872805..872939,
FT                   873116..873260,873593..873696,873849..874055,
FT                   875470..875727,879408..879461,880438..880510,
FT                   881517..881704,882732..882896,883206..883289,
FT                   883414..883503,883886..883954,884170..884248,
FT                   884334..884449))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08140"
FT                   /old_locus_tag="Vv08s0007g08140"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7THZ9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004483"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:D7THZ9"
FT                   /protein_id="CBI29875.3"
FT                   /translation="MEGGKSNRKSSAISLQQFISTIAPLIDLEKAHSHSLSNLSGSLRN
FT                   LDTAQKRGSTILNLKCVDAQTGLMGKTLLEFQSTKGDVLPAHKFGTHDVVVLKPNKADL
FT                   GSPALGQGVVYRLKDSSITVAFDDIPEEGLNSPLRLEKVANEVTYRRMKDALVQLSKGV
FT                   HKGPTADLIPVLFGERPPTVSKKDVTFTPFNSNLDRSQKDAISKALSSKNVFLLHGPPG
FT                   TGKTTTVVEIILQEVKRGAKILACAASNIAVDNIVERLVPYRVKLVRLGHPARLLPQVL
FT                   ESALDAQVLRGDNTGLANDIRKEMKALNGKLLKTKDKNTRRDIRKELKTLSKEERKRQQ
FT                   LAVTDVIKNANVVLTTLTGAVSRKLENISFDLVIIDEAAQALEIACWIALLKGSRCILA
FT                   GDHLQLPPTIQSVEAEKKGLGRTLFERLADLYGDEVMSMLTVQYRMHELIMNWSSKELY
FT                   NSKITAHPSVAAHMLSDLEDVKKSSSTESTLLLIDTAGCDMEEKKDEEDSTMNEGEAEV
FT                   AISHAKRLVDSGVQASDIGIITPYAAQVVLLKMMKNNDDKLKDMEISTVDGFQGREKEA
FT                   IIISMARSNPKKEVGFLSDRRRMNVAVTRARRQCCLVCDTETVTSDKFLKRLIEYFEEN
FT                   GEYLSASEYGHE"
FT   gene            complement(885294..890020)
FT                   /locus_tag="VIT_08s0007g08130"
FT                   /old_locus_tag="Vv08s0007g08130"
FT   mRNA            complement(join(885294..885564,885565..885735,
FT                   885954..886265,886754..887446,889663..889956,
FT                   889957..890020))
FT                   /locus_tag="VIT_08s0007g08130"
FT                   /old_locus_tag="Vv08s0007g08130"
FT                   /product="IMP--aspartate ligase 2"
FT   3'UTR           complement(885294..885564)
FT                   /locus_tag="VIT_08s0007g08130"
FT                   /old_locus_tag="Vv08s0007g08130"
FT   CDS_pept        complement(join(885565..885735,885954..886265,
FT                   886754..887446,889663..889956))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08130"
FT                   /old_locus_tag="Vv08s0007g08130"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI00"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI00"
FT                   /protein_id="CBI29876.3"
FT                   /translation="MNISSLTLDSNPISRTFSAANPRTQRSPFIRHRNVVVCSVKSVPS
FT                   SPSLVAAPAGEGVNRIESLSQVSAVLGCQWGDEGKGKLVDILAKHFDIVARCQGGANAG
FT                   HTIYNSEGKKFALHLVPSGILNEETMCVIGNGVVVHLPGLFEEIDGLESNGVSCKGRIL
FT                   VSDRAHLLFDFHQVVDGLREAELAKSFIGTTKRGIGPCYSSKVIRNGIRVCDLRHMDTF
FT                   PQKLDLLLSDAASRFKGFEYGPNMLKEEVEKYKRFTERLEPFITDTVDFMNESISQKKK
FT                   ILVEGGQATMLDIDFGTYPFVTSSSPSAGGICTGLGIAPRVLGDLVGVVKAYNTRVGSG
FT                   PFPTENLGRVGDQLRFAGQEFGTTTGRPRRCGWLDIVALKYSCQINGFSSLNLTKLDVL
FT                   SDLSEIWLGVGYKEIDGKSIKSFPADLRALEQLQVEYEILPGWKTDISGFKNYSDLPKA
FT                   AQQYVERIEELVGVPIHYIGVGPGREALIYK"
FT   5'UTR           complement(889957..890020)
FT                   /locus_tag="VIT_08s0007g08130"
FT                   /old_locus_tag="Vv08s0007g08130"
FT   gene            complement(891315..900387)
FT                   /locus_tag="VIT_08s0007g08120"
FT                   /old_locus_tag="Vv08s0007g08120"
FT   mRNA            complement(join(891315..891800,891801..891902,
FT                   892667..892852,892946..893044,893793..894024,
FT                   894250..894330,894454..894701,894831..894944,
FT                   895316..895450,895543..895629,895716..895931,
FT                   896536..896794,896886..897072,897985..898078,
FT                   898313..898674,899774..899784,900332..900387))
FT                   /locus_tag="VIT_08s0007g08120"
FT                   /old_locus_tag="Vv08s0007g08120"
FT                   /product="Predicted protein"
FT   3'UTR           complement(891315..891800)
FT                   /locus_tag="VIT_08s0007g08120"
FT                   /old_locus_tag="Vv08s0007g08120"
FT   CDS_pept        complement(join(891801..891902,892667..892852,
FT                   892946..893044,893793..894024,894250..894330,
FT                   894454..894701,894831..894944,895316..895450,
FT                   895543..895629,895716..895931,896536..896794,
FT                   896886..897072,897985..898078,898313..898674,
FT                   899774..899784,900332..900387))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08120"
FT                   /old_locus_tag="Vv08s0007g08120"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI01"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR004263"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR040911"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI01"
FT                   /protein_id="CBI29877.3"
FT                   /translation="MLHHFPLIMVVNGHNSTNLSDKDKEANEMTFFLQKWKCSWSLLAT
FT                   VASVVALISVAHLFLFPLAPSLEYFSMGQGQKTCTPINASIRGVDHDGKNLQPSFDLDH
FT                   RFPADSHKSVVYRGAPWKAEIGRWFSGCDSIAAEVSIIEKIGGKDCKNDCSGQGICNHE
FT                   LGQCRCFHGFSGEGCSERLHLDCNYPSSPEQPYGPWVVSICPASCDTTRAMCFCGEGTK
FT                   YPHRPVAEACGFQMNLPTTPGDPKLVDWTKADLDNIFTTNDSKPGWCNVDPTEAYALKM
FT                   QYKEECDCKYDCLLGRFCEIPVLCTCVNQCSGHGHCRGGFCQCHRGWYGTDCSIPSVLS
FT                   SVREWPRWLRPAHVEVPDDMHLSGSLVNLDAVVKKKRPLIYVYDLPPEFNSLLLEGRHF
FT                   KFECVNRIYDDRNATYWTEQLYGAQMAIYESILASPHRTLDGEEADFFFVPVLDSCIIV
FT                   RADDAPHLNMHAHGGLRSSLTLEFYKTAYDHIVEQYPFWNRSSGRDHIWFFSWDEGACY
FT                   APKEIWDSMMLVHWGNTNSKHNHSTTAYWADNWDSVSSDRRGNHPCFDPYKDLVLPAWK
FT                   RPDVVSLSSKLWSRPREQRKTLFYFNGNLGPAYEGGRPETTYSMGIRQKVAEEFGSSPN
FT                   KEGKLGKQHAEDVIVTPLRSGNYHESLASSVFCGVMPGDGWSGRFEDSILQGCIPVVIQ
FT                   DGIFLPFENMLNYESFAVRIREDEIPNLIKILRGMNETEIEFKLENVRKIWQRFLYRDS
FT                   ILLEAERQKTAFGNVEDWAVQLLQLSEDDVFATLIQVLHYKLHNDPWRQQLAHLKKDFG
FT                   LAQECLIRTK"
FT   gene            908738..917254
FT                   /locus_tag="VIT_08s0007g08110"
FT                   /old_locus_tag="Vv08s0007g08110"
FT   mRNA            join(908738..908788,908789..908869,909594..909716,
FT                   911865..911904,912020..912093,912391..912450,
FT                   913608..913685,913815..913973,915513..915638,
FT                   916067..916159,916381..916467,916651..916893,
FT                   916894..917254)
FT                   /locus_tag="VIT_08s0007g08110"
FT                   /old_locus_tag="Vv08s0007g08110"
FT                   /product="Predicted protein"
FT   5'UTR           908738..908788
FT                   /locus_tag="VIT_08s0007g08110"
FT                   /old_locus_tag="Vv08s0007g08110"
FT   CDS_pept        join(908789..908869,909594..909716,911865..911904,
FT                   912020..912093,912391..912450,913608..913685,
FT                   913815..913973,915513..915638,916067..916159,
FT                   916381..916467,916651..916893)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08110"
FT                   /old_locus_tag="Vv08s0007g08110"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI02"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR032098"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI02"
FT                   /protein_id="CBI29878.3"
FT                   /translation="MAIAAAAVVVPLGLLFLTSGLVVNLIQAVCFILVRPLSKSTYRRI
FT                   NRVVAELLWLELVWLIDWWAGVKIQLYTDPETFRLMGKEHALLISNHRSDIDWLVGWVL
FT                   AQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYLFLERNWAKDESIIKSGLLRLKDYPQ
FT                   PFWLALFVEGTRFTQAKLLAAQEYATASGLPVPRNVLIPRTKGFVSAVSHMRSFVPAVY
FT                   DVTVAIPKTQPSPTMLRLFKGQPSAVHVHIKRHLMKELPETDDAAAQWCRDVFVAKDAL
FT                   LDKHKVEDTFGEGEFQDTGRPIKSLLVVISWACLLILGALKFLQWSSLLSSWKGISFTA
FT                   IGLAIVTVLMHILIKFSQSERSTPAKVAPAKPKNGGESSEPGRHKHH"
FT   3'UTR           916894..917254
FT                   /locus_tag="VIT_08s0007g08110"
FT                   /old_locus_tag="Vv08s0007g08110"
FT   gene            917938..918321
FT                   /locus_tag="VIT_08s0007g08100"
FT                   /old_locus_tag="Vv08s0007g08100"
FT   mRNA            join(917938..918042,918043..918321)
FT                   /locus_tag="VIT_08s0007g08100"
FT                   /old_locus_tag="Vv08s0007g08100"
FT   5'UTR           917938..918042
FT                   /locus_tag="VIT_08s0007g08100"
FT                   /old_locus_tag="Vv08s0007g08100"
FT   CDS_pept        918043..918321
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08100"
FT                   /old_locus_tag="Vv08s0007g08100"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL44"
FT                   /protein_id="CCB55151.1"
FT                   /translation="MVKLHKPFSRTPLQIPEMMFESNEENTTEIGGSSGGGNDSSSCSS
FT                   FIDSWLPSLPLVSFDYEVPGPIPDFNELLMDANDFLNFFADIPEIPD"
FT   gene            923013..943390
FT                   /locus_tag="VIT_08s0007g08090"
FT                   /old_locus_tag="Vv08s0007g08090"
FT   mRNA            join(923013..923030,923628..923797,925819..925978,
FT                   926167..926487,927964..928251,928400..928579,
FT                   929333..929495,929931..930121,931459..931722,
FT                   932772..932860,932963..933110,933232..933447,
FT                   933697..934038,934148..934289,935327..935532,
FT                   936387..936589,937034..937232,937317..937579,
FT                   938501..938641,941453..942227,942623..943219,
FT                   943220..943390)
FT                   /locus_tag="VIT_08s0007g08090"
FT                   /old_locus_tag="Vv08s0007g08090"
FT                   /product="DNA-directed RNA polymerase"
FT   CDS_pept        join(923013..923030,923628..923797,925819..925978,
FT                   926167..926487,927964..928251,928400..928579,
FT                   929333..929495,929931..930121,931459..931722,
FT                   932772..932860,932963..933110,933232..933447,
FT                   933697..934038,934148..934289,935327..935532,
FT                   936387..936589,937034..937232,937317..937579,
FT                   938501..938641,941453..942227,942623..943219)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08090"
FT                   /old_locus_tag="Vv08s0007g08090"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HL45"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR015699"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL45"
FT                   /protein_id="CCB55152.1"
FT                   /translation="MAHVIEGTTEFVEAVKFSFFTDEEVRKYSFKKITSPLMLDSVQRP
FT                   VPGGLYDPALGSIDENTPCQSCGQRSFYCPGHCGHIDLVSSVYNPLLFNLLHNLLQKTC
FT                   FFCHHFKTSSSLVQKYVSQLELISKGDVVGAKNLDSISPSESSYPEDSDGSHVSCSSTV
FT                   NSSARDNCSVHLKQQEWTSLQCIEAMSVMDNFLKLKHRDCKNCKAKSPQVTKPTFGWFH
FT                   MAGLSDAQTRANVIRGSKLERPLSRVAEEKSSSEVENVNDMFPWGDGVDTDETHSSIAP
FT                   TDGIQDTVTKRLERKGAQAPIEFIKQKSFFSGPLLPSEVRDIMERLWENEAELCSFISD
FT                   ILQERLGASGNKAGYSMFFLETILVPPIKFRPPSKGQISVMEHPQTVLLGKVLQANIAL
FT                   GNAHANNSERSKIISRWMDLQQSINVLFDGKTAAGQGQRDTGSGICQLLEKKEGVFRQK
FT                   MMGKRVNFACRSVISPDPYLAVNEIGIPPYFALRLTYPEKVTPWNVVKLRDAIINGPEI
FT                   HPGATHYVDKLSTVKLAVNKKMRISISRKLPSSRGVVAQPGRSSDNEFEGKIVYRHLQD
FT                   GDIVLVNRQPTLHKPSIMAHVVRVLKGEKTLRMHYANCSTYNADFDGDEMNVHFPQDEI
FT                   SRAEAYNIVNANNQYIVPSRGDPIRGLIQDHIVSAVLLTKKDTFLTREQYNQLLYSSGL
FT                   SSGSGSFIGKPGKKVSVLDSEDEMQPLLPAIWKPEPLWSGKQVITAVLNHITRGRKPFT
FT                   TEKDGKIPREYFGSEIDEKKSGKGKDPGSDRRKEKRIEKKHGEYKLLIHKNELVRGVID
FT                   KAQFDKYGLVHMVQELYGSNTAGILLSVLSRLFTVFLQMHGFTCGVDDLLISPNYDIAR
FT                   KIELDKSENIGELVHCKFIGSNHGKIDPVKLQVEVEKIILSNGEAAITRLDRMMKNELN
FT                   ELTSKVNKDLLLKGLVKPFPKNCLSLMTTTGAKGSTVNFSQISSFLGQQDLEGKRVPRM
FT                   VSGKTLPCFPPWDCAARAGGFISDRFLTGLHPQEYYFHCMAGREGLVDTAVKTSRSGYL
FT                   QRCLIKNLECLKVCYDYTVRDSDGSIVQFNYGDDGVDVHQTSFITEFEALAVNEEVVCE
FT                   KFGQDGKFNGYIQKLPKELRKKTKKFIEGFMEERQDFDNMKKQKDFVNLVKQKYISSLA
FT                   QPGEPVGVLAAQSVGEPSTQMTLNTFHLAGRGEVNVTLGIPRLQEILMTAANDIKTPIM
FT                   TCPLQMGRSKDDAERLAAKLKKVTVADITESMEVSIVPFTVQDHQTCSIYKLKMKLYEP
FT                   ALYPPHTGISLEDCEETLEAVFVRELEDAIQNHLLLLSKISGIKNFLPDSRSMASKETD
FT                   EDASGDGLAGGNGDEDDDGEDDGGAEDLGLDAQKRKQQASDEMDYGDSEGEPDEGEPSA
FT                   GLTEEIDLVEDEVEISNNEEVGISDPKDEDSKVPSKSKSSKNKKAKTEAKRKKRFRAIK
FT                   KDFDRAILVKAKGTYFEVHFRFTNEPHILLAQIAQKAANKVYIRSSGKIDLCQVIDCNK
FT                   DQVIYYGRDPKKRENIPGEEKKKLPALQTAGVDFTAFWKMQDELDVRYVYSNNVHAMLN
FT                   TFGVEAARATIIKEVFNVFNAYGVKVNIRHLSLIADFMTHSGGYRPMNRHGGIAESVSP
FT                   FSKMTFETASKFIVEAASHGMTDNLESASARICLGLPVKMGTGCFDLMQKIEI"
FT   3'UTR           943220..943390
FT                   /locus_tag="VIT_08s0007g08090"
FT                   /old_locus_tag="Vv08s0007g08090"
FT   gene            complement(943839..950398)
FT                   /locus_tag="VIT_08s0007g08080"
FT                   /old_locus_tag="Vv08s0007g08080"
FT   mRNA            complement(join(943839..944095,944096..944223,
FT                   945411..945470,945594..945673,945824..945918,
FT                   946003..946119,947296..947373,947576..947645,
FT                   947751..947863,948085..948186,949731..949847,
FT                   950000..950022,950236..950317,950318..950398))
FT                   /locus_tag="VIT_08s0007g08080"
FT                   /old_locus_tag="Vv08s0007g08080"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(943839..944095)
FT                   /locus_tag="VIT_08s0007g08080"
FT                   /old_locus_tag="Vv08s0007g08080"
FT   CDS_pept        complement(join(944096..944223,945411..945470,
FT                   945594..945673,945824..945918,946003..946119,
FT                   947296..947373,947576..947645,947751..947863,
FT                   948085..948186,949731..949847,950000..950022,
FT                   950236..950317))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08080"
FT                   /old_locus_tag="Vv08s0007g08080"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HL46"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR037588"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL46"
FT                   /protein_id="CCB55153.1"
FT                   /translation="MPLFLCNSPKPFQTLIPTTLPTIRIIQVFSAIKRRAIKMTQPSVI
FT                   LATASYDHTIRFWEAKSGRCYRTIQYPDSQVNRLEITPDKRQLAAAGNPHIRLFDVNSS
FT                   TTQPARSFDSHTNNVMAVGFQCDGKWMYSGSEDGTVKIWDMRARECQREYESRAAVNTV
FT                   VLHPNQTELISGDQNGNIRVWDLTANSCSCELVPEVDTAVRSLTVMWDGSLVVAANNHG
FT                   TCYVWRLLRGNQTMTNFEPLHKLQAHDGYILKCLLSPEFCEPHRYLATASSDHTVKIWN
FT                   VDGFTLEKTLVGHQRWVWDCVFSVDGAYLITASSDTTARLWSMSNGQDIKVYQGHHKAT
FT                   VCCALHDGAEPSAA"
FT   5'UTR           complement(950318..950398)
FT                   /locus_tag="VIT_08s0007g08080"
FT                   /old_locus_tag="Vv08s0007g08080"
FT   gene            959142..961426
FT                   /locus_tag="VIT_08s0007g08070"
FT                   /old_locus_tag="Vv08s0007g08070"
FT   mRNA            join(959142..959741,960960..961397,961398..961426)
FT                   /locus_tag="VIT_08s0007g08070"
FT                   /old_locus_tag="Vv08s0007g08070"
FT                   /product="Predicted protein"
FT   CDS_pept        join(959142..959741,960960..961397)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08070"
FT                   /old_locus_tag="Vv08s0007g08070"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HL47"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL47"
FT                   /protein_id="CCB55154.1"
FT                   /translation="MTDPYSKFFAGWFKFNPLHHFPSAEPPSQPPYGHSLYTNSFSSHS
FT                   NSIIYQTPPPSPPLREALPLLSLSPTRHEEDQQQQHSSCSSAMDVDRKKKAKEESFFSS
FT                   STNTNTATDDGDDDETVTVALHIGLPSPSAAEMASMLSSSSEITDKDGDGDVSGYPINR
FT                   LNKGQYWIPTPSQILIGPTQFSCPVCCKTFNRYNNMQMHMWGHGSQYRKGPESLRGTQP
FT                   TGMLRLPCYCCAPGCRNNIDHPRAKPLKDFRTLQTHYKRKHGIKPFMCRKCGKAFAVRG
FT                   DWRTHEKNCGKLWYCICGSDFKHKRSLKDHIKAFGNGHAAYGIDGFEEEDEPASEVEQD
FT                   DESMQ"
FT   3'UTR           961398..961426
FT                   /locus_tag="VIT_08s0007g08070"
FT                   /old_locus_tag="Vv08s0007g08070"
FT   gene            complement(979001..980783)
FT                   /locus_tag="VIT_08s0007g08060"
FT                   /old_locus_tag="Vv08s0007g08060"
FT   mRNA            complement(join(979001..979137,979138..979341,
FT                   979423..979532,980355..980457,980539..980640,
FT                   980641..980783))
FT                   /locus_tag="VIT_08s0007g08060"
FT                   /old_locus_tag="Vv08s0007g08060"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(979001..979137)
FT                   /locus_tag="VIT_08s0007g08060"
FT                   /old_locus_tag="Vv08s0007g08060"
FT   CDS_pept        complement(join(979138..979341,979423..979532,
FT                   980355..980457,980539..980640))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08060"
FT                   /old_locus_tag="Vv08s0007g08060"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI06"
FT                   /db_xref="InterPro:IPR007529"
FT                   /db_xref="InterPro:IPR039723"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI06"
FT                   /protein_id="CBI29882.3"
FT                   /translation="MDDDSGSLRRMSTRTRKVASRMAAALASTDNRNQAALARLEALEN
FT                   DNAGMETIDVNDDEDASLDDDDEGYAQKRQSKGTKRTTRQAKALENARKAPRTFLELVH
FT                   EANLESLPPHVPSYLRAAVGPPSSTSRRHFCTVCGFAANYTCVRCGTRFCSTRCQNIHN
FT                   DTRCLKFVA"
FT   5'UTR           complement(980641..980783)
FT                   /locus_tag="VIT_08s0007g08060"
FT                   /old_locus_tag="Vv08s0007g08060"
FT   gene            981272..986035
FT                   /locus_tag="VIT_08s0007g08050"
FT                   /old_locus_tag="Vv08s0007g08050"
FT   mRNA            join(981272..981276,981277..981621,981706..981787,
FT                   981870..982000,982150..982236,983679..983757,
FT                   984059..984147,984356..984391,984593..984712,
FT                   984877..984963,985077..985226,985401..985508,
FT                   985668..985916,985917..986035)
FT                   /locus_tag="VIT_08s0007g08050"
FT                   /old_locus_tag="Vv08s0007g08050"
FT                   /product="Peptidase S41 family protein"
FT   5'UTR           981272..981276
FT                   /locus_tag="VIT_08s0007g08050"
FT                   /old_locus_tag="Vv08s0007g08050"
FT   CDS_pept        join(981277..981621,981706..981787,981870..982000,
FT                   982150..982236,983679..983757,984059..984147,
FT                   984356..984391,984593..984712,984877..984963,
FT                   985077..985226,985401..985508,985668..985916)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08050"
FT                   /old_locus_tag="Vv08s0007g08050"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HL48"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL48"
FT                   /protein_id="CCB55155.1"
FT                   /translation="MESLSPISTKFSNPNSLPSLLSPFSTFNHRRKSRKCKAWTLSFPC
FT                   FSSYKTVATQCKVQLNDRDLVKFESDWRRSIGRGLFGVAAAAAAMFSVCCDSPALAESL
FT                   TVAFPVSRAREVNTVQRTLVETWGLIRETFIDPTFNHQDWDLKLQQTMVEMFPLRTADA
FT                   AYNKISGMLSTLGDPFTRIISPKEYQNFRIGSDGNLQGVGIFINAEPRTGHLIVLSCIE
FT                   GSPAARAGIHEGDELIEINGERLDGTDDETAAQKLRGRVGTTVTVKLHSGTDWGSDSGF
FT                   REVKLSRDFIKLSPISSAIIPHKTPDGHVSKLGYVKLSAFSQTAAAEMENCIHEMEAQD
FT                   VCSYILDLRNNPGGLVKVGLDVAQIWLDGDETLVNTIDRDGNMLPINMVDGHAITRDPL
FT                   VVLVNEGSASASEILAGALHDNGRAILVGHKTFGKGKIQSVTELHDGSALFVTVAKYLS
FT                   PALHDIDQVGITPDVQCSTEMLSSPKESLLKDKSSASSLEADSCIMVAEHELDVQESKG
FT                   TPS"
FT   3'UTR           985917..986035
FT                   /locus_tag="VIT_08s0007g08050"
FT                   /old_locus_tag="Vv08s0007g08050"
FT   gene            988280..988681
FT                   /locus_tag="VIT_08s0007g08040"
FT                   /old_locus_tag="Vv08s0007g08040"
FT   mRNA            join(988280..988426,988427..988633,988634..988681)
FT                   /locus_tag="VIT_08s0007g08040"
FT                   /old_locus_tag="Vv08s0007g08040"
FT   5'UTR           988280..988426
FT                   /locus_tag="VIT_08s0007g08040"
FT                   /old_locus_tag="Vv08s0007g08040"
FT   CDS_pept        988427..988633
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08040"
FT                   /old_locus_tag="Vv08s0007g08040"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL49"
FT                   /protein_id="CCB55156.1"
FT                   /translation="MREEAITAYGKGTENADPASGDGAGAGETSCVETVAAAEKIATTK
FT                   TSIKALTMLTCAISEGYRSAHQL"
FT   3'UTR           988634..988681
FT                   /locus_tag="VIT_08s0007g08040"
FT                   /old_locus_tag="Vv08s0007g08040"
FT   gene            991657..992132
FT                   /locus_tag="VIT_08s0007g08030"
FT                   /old_locus_tag="Vv08s0007g08030"
FT   mRNA            join(991657..991850,991851..992099,992100..992132)
FT                   /locus_tag="VIT_08s0007g08030"
FT                   /old_locus_tag="Vv08s0007g08030"
FT   5'UTR           991657..991850
FT                   /locus_tag="VIT_08s0007g08030"
FT                   /old_locus_tag="Vv08s0007g08030"
FT   CDS_pept        991851..992099
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08030"
FT                   /old_locus_tag="Vv08s0007g08030"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL50"
FT                   /protein_id="CCB55157.1"
FT                   /translation="MQYESLSRIGAHCFKRARRDRIRDEAMTAPERGMENAYPASGDGD
FT                   GAGEPSCAETVVAAEIIATAKTSIKALMMLTCAISER"
FT   3'UTR           992100..992132
FT                   /locus_tag="VIT_08s0007g08030"
FT                   /old_locus_tag="Vv08s0007g08030"
FT   gene            complement(994931..995387)
FT                   /locus_tag="VIT_08s0007g08020"
FT                   /old_locus_tag="Vv08s0007g08020"
FT   mRNA            complement(join(994931..995084,995085..995291,
FT                   995292..995387))
FT                   /locus_tag="VIT_08s0007g08020"
FT                   /old_locus_tag="Vv08s0007g08020"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(994931..995084)
FT                   /locus_tag="VIT_08s0007g08020"
FT                   /old_locus_tag="Vv08s0007g08020"
FT   CDS_pept        complement(995085..995291)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08020"
FT                   /old_locus_tag="Vv08s0007g08020"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL51"
FT                   /protein_id="CCB55158.1"
FT                   /translation="MAQVGMTKALMLVFAVVAIFSTAATVSAQDGALAPAPSPDVGSAF
FT                   SVPLSGAVMACSLVLSLLALLKP"
FT   5'UTR           complement(995292..995387)
FT                   /locus_tag="VIT_08s0007g08020"
FT                   /old_locus_tag="Vv08s0007g08020"
FT   gene            complement(999162..999602)
FT                   /locus_tag="VIT_08s0007g08010"
FT                   /old_locus_tag="Vv08s0007g08010"
FT   mRNA            complement(join(999162..999280,999281..999484,
FT                   999485..999602))
FT                   /locus_tag="VIT_08s0007g08010"
FT                   /old_locus_tag="Vv08s0007g08010"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(999162..999280)
FT                   /locus_tag="VIT_08s0007g08010"
FT                   /old_locus_tag="Vv08s0007g08010"
FT   CDS_pept        complement(999281..999484)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08010"
FT                   /old_locus_tag="Vv08s0007g08010"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HL52"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL52"
FT                   /protein_id="CCB55159.1"
FT                   /translation="MAQVSIAKAFVLLFVVAIFSVATTVSAQDNSPAPALSPDAGSAFS
FT                   LPLSGSVIVSSLVFSLLALLKY"
FT   5'UTR           complement(999485..999602)
FT                   /locus_tag="VIT_08s0007g08010"
FT                   /old_locus_tag="Vv08s0007g08010"
FT   gene            complement(1000731..1001142)
FT                   /locus_tag="VIT_08s0007g08000"
FT                   /old_locus_tag="Vv08s0007g08000"
FT   mRNA            complement(join(1000731..1000869,1000870..1001073,
FT                   1001074..1001142))
FT                   /locus_tag="VIT_08s0007g08000"
FT                   /old_locus_tag="Vv08s0007g08000"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(1000731..1000869)
FT                   /locus_tag="VIT_08s0007g08000"
FT                   /old_locus_tag="Vv08s0007g08000"
FT   CDS_pept        complement(1000870..1001073)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g08000"
FT                   /old_locus_tag="Vv08s0007g08000"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HL53"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL53"
FT                   /protein_id="CCB55160.1"
FT                   /translation="MAQVSIAKAFMLVFVVAIFSAAATVSALDNSPAPAPSPDAGSAFS
FT                   LPLSGAVVASSLVFSLLAFLKY"
FT   5'UTR           complement(1001074..1001142)
FT                   /locus_tag="VIT_08s0007g08000"
FT                   /old_locus_tag="Vv08s0007g08000"
FT   gene            complement(1005311..1005760)
FT                   /locus_tag="VIT_08s0007g07990"
FT                   /old_locus_tag="Vv08s0007g07990"
FT   mRNA            complement(join(1005311..1005447,1005448..1005651,
FT                   1005652..1005760))
FT                   /locus_tag="VIT_08s0007g07990"
FT                   /old_locus_tag="Vv08s0007g07990"
FT                   /product="Predicted protein"
FT   3'UTR           complement(1005311..1005447)
FT                   /locus_tag="VIT_08s0007g07990"
FT                   /old_locus_tag="Vv08s0007g07990"
FT   CDS_pept        complement(1005448..1005651)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07990"
FT                   /old_locus_tag="Vv08s0007g07990"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HL54"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL54"
FT                   /protein_id="CCB55161.1"
FT                   /translation="MAQVSIAKALMLVFVVAIFSAAATVSALDNSPAPAPSPDAGSAFS
FT                   LPLSGAVVASSLVFSLLAFLKY"
FT   5'UTR           complement(1005652..1005760)
FT                   /locus_tag="VIT_08s0007g07990"
FT                   /old_locus_tag="Vv08s0007g07990"
FT   gene            1012694..1013198
FT                   /locus_tag="VIT_08s0007g07980"
FT                   /old_locus_tag="Vv08s0007g07980"
FT   mRNA            join(1012694..1012791,1012792..1012977,1012978..1013198)
FT                   /locus_tag="VIT_08s0007g07980"
FT                   /old_locus_tag="Vv08s0007g07980"
FT                   /product="Predicted protein"
FT   5'UTR           1012694..1012791
FT                   /locus_tag="VIT_08s0007g07980"
FT                   /old_locus_tag="Vv08s0007g07980"
FT   CDS_pept        1012792..1012977
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07980"
FT                   /old_locus_tag="Vv08s0007g07980"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HL55"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL55"
FT                   /protein_id="CCB55162.1"
FT                   /translation="MDMKKISCAVLIAAASMSAAMASDEVMSPAPGPSNAAQATLPVLG
FT                   SLVGASVLSFFAFYLH"
FT   3'UTR           1012978..1013198
FT                   /locus_tag="VIT_08s0007g07980"
FT                   /old_locus_tag="Vv08s0007g07980"
FT   gene            complement(1013249..1017983)
FT                   /locus_tag="VIT_08s0007g07970"
FT                   /old_locus_tag="Vv08s0007g07970"
FT   mRNA            complement(join(1013249..1013446,1013447..1014150,
FT                   1014199..1014237,1014304..1014658,1014752..1014803,
FT                   1014925..1014998,1015128..1015177,1015262..1015343,
FT                   1015531..1015580,1015691..1015733,1015819..1015899,
FT                   1015992..1016037,1016265..1016311,1016448..1016513,
FT                   1016877..1016943,1017232..1017356,1017520..1017815,
FT                   1017944..1017983))
FT                   /locus_tag="VIT_08s0007g07970"
FT                   /old_locus_tag="Vv08s0007g07970"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(1013249..1013446)
FT                   /locus_tag="VIT_08s0007g07970"
FT                   /old_locus_tag="Vv08s0007g07970"
FT   CDS_pept        complement(join(1013447..1014150,1014199..1014237,
FT                   1014304..1014658,1014752..1014803,1014925..1014998,
FT                   1015128..1015177,1015262..1015343,1015531..1015580,
FT                   1015691..1015733,1015819..1015899,1015992..1016037,
FT                   1016265..1016311,1016448..1016513,1016877..1016943,
FT                   1017232..1017356,1017520..1017815,1017944..1017983))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07970"
FT                   /old_locus_tag="Vv08s0007g07970"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HL56"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL56"
FT                   /protein_id="CCB55163.1"
FT                   /translation="MNLQMQAKLCLFSILHLSFVAFLGFSLPSVSVSLSIYLYFCWPVI
FT                   AFSIIILVLCRFYLSLSSHLFLIYVVINIIYCGIKLYSSSSLPTYKTPQGFWNFISLKS
FT                   HPLEPFTPVFMETEESDTRLKMEDYEVIEQIGRGAFGSAFLVLNKTEKKKYVLKKIRVA
FT                   KQTEKFKRTAHQEMELIARLDNPYIVEYKDAWVDKGCSVCIVTGYCEGGDMAGAIKKAR
FT                   GALFPEEKLCKWLTQLLLAVDYLHSNRVLHRDLKCSNIFLTKESDIRLGDFGLAKLLST
FT                   EDLASSVVGTPNYMCPELLADIPYGYKSDIWSLGCCMFEIAAHQPAFRAPDMAGLINKI
FT                   NRSSISPLPIVYSSTLKQIIKSMLRKNPEHRPTAAELLRHPHLQPYLVRCRNTSSIFLP
FT                   VKSEHISKDKTPRKPSPIKHSAGKDNRDKEGRVLKMAGSVEPLEENANVQPRNLQNKAK
FT                   PTPIVQTEENLETKRVDPTSYPEEVSNAVESSKAQKESLDTETSTGKSAPKHFAQIQDG
FT                   DIKNVTSEDDAMESNTQVPAGAETESKSLQPGNHGAMATSSANSTDKGGSLDDESSNSS
FT                   SATQGIEYEPNAEPSCCLQKMESPDSQAEGGAQIDYISSESNDILPCKDEAGAKTDNTS
FT                   CSMVMAKDDMNTMNKAPSEVSLLSTLTAVGGDETKGEWDNPSQQRADALESLLELCARL
FT                   LQQDKLEELAGVLKPFGEEAVSSRETAIWLTKSLMTAQKFLGGA"
FT   gene            complement(1019752..1024599)
FT                   /locus_tag="VIT_08s0007g07960"
FT                   /old_locus_tag="Vv08s0007g07960"
FT   mRNA            complement(join(1019752..1019905,1019906..1020113,
FT                   1020203..1020293,1020695..1020777,1020857..1020963,
FT                   1021068..1021127,1021264..1021365,1021465..1021563,
FT                   1024443..1024568,1024569..1024599))
FT                   /locus_tag="VIT_08s0007g07960"
FT                   /old_locus_tag="Vv08s0007g07960"
FT                   /product="Predicted protein"
FT   3'UTR           complement(1019752..1019905)
FT                   /locus_tag="VIT_08s0007g07960"
FT                   /old_locus_tag="Vv08s0007g07960"
FT   CDS_pept        complement(join(1019906..1020113,1020203..1020293,
FT                   1020695..1020777,1020857..1020963,1021068..1021127,
FT                   1021264..1021365,1021465..1021563,1024443..1024568))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07960"
FT                   /old_locus_tag="Vv08s0007g07960"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI11"
FT                   /protein_id="CBI29887.3"
FT                   /translation="MGKKKKTRVSDNIAEEKEYVGQSSKEEEYVSQSSTNERSLYEVLG
FT                   VEKTASQQEIKKAYYKLALRLHPDKNPGDEEAKEKFQQLQKVISILGDEEKRALYDQTG
FT                   CVDDADLAGEVVQNLHEFFRTMYKKVTEADIEEFEANYRGSDSEKNDLIDLYKKCKGNM
FT                   NRLFCSMLCSDPKLDSHRFKDILDEAISAGELKATKVYQKWAKQVSEAKPPTSPLRKRG
FT                   KSNKESESDLLAIISQRRSERKDRFDSMFSSLVSKYGGSGQVSEPTEEEFEATQRKLES
FT                   LKASKKSKRK"
FT   5'UTR           complement(1024569..1024599)
FT                   /locus_tag="VIT_08s0007g07960"
FT                   /old_locus_tag="Vv08s0007g07960"
FT   gene            1026541..1028544
FT                   /locus_tag="VIT_08s0007g07950"
FT                   /old_locus_tag="Vv08s0007g07950"
FT   mRNA            join(1026541..1026633,1027707..1027718,1027719..1028237,
FT                   1028238..1028544)
FT                   /locus_tag="VIT_08s0007g07950"
FT                   /old_locus_tag="Vv08s0007g07950"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           1026541..1026633
FT                   /locus_tag="VIT_08s0007g07950"
FT                   /old_locus_tag="Vv08s0007g07950"
FT   CDS_pept        1027719..1028237
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07950"
FT                   /old_locus_tag="Vv08s0007g07950"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5BFH0"
FT                   /db_xref="InterPro:IPR000058"
FT                   /db_xref="InterPro:IPR002653"
FT                   /db_xref="InterPro:IPR035896"
FT                   /db_xref="UniProtKB/TrEMBL:A5BFH0"
FT                   /protein_id="CCB55164.1"
FT                   /translation="MESHDETGCQAPEGPILCINNCGFFGSAATMNMCSKCHKDLALKQ
FT                   EQAKLAASSIGSIVNGSSSGNGKEPIVAGTVDVQAGPVEVKAISAEASNDSSSNQIIES
FT                   KVKEGPNRCTACRKRVGLTGFNCKCGNLFCAVHRYSDKHDCPFDYRTAARDAIAKANPV
FT                   VKAEKLDKI"
FT   3'UTR           1028238..1028544
FT                   /locus_tag="VIT_08s0007g07950"
FT                   /old_locus_tag="Vv08s0007g07950"
FT   gene            1032417..1032716
FT                   /locus_tag="VIT_08s0007g07940"
FT                   /old_locus_tag="Vv08s0007g07940"
FT   mRNA            join(1032417..1032605,1032606..1032716)
FT                   /locus_tag="VIT_08s0007g07940"
FT                   /old_locus_tag="Vv08s0007g07940"
FT   5'UTR           1032417..1032605
FT                   /locus_tag="VIT_08s0007g07940"
FT                   /old_locus_tag="Vv08s0007g07940"
FT   CDS_pept        1032606..1032716
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07940"
FT                   /old_locus_tag="Vv08s0007g07940"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL58"
FT                   /protein_id="CCB55165.1"
FT                   /translation="MTAEKKGIRLTFKEGLFVSKFHSCPSHHLKLLYHLG"
FT   gene            1037053..1040025
FT                   /locus_tag="VIT_08s0007g07930"
FT                   /old_locus_tag="Vv08s0007g07930"
FT   mRNA            join(1037053..1037072,1037073..1039356,1039451..1039842,
FT                   1039843..1040025)
FT                   /locus_tag="VIT_08s0007g07930"
FT                   /old_locus_tag="Vv08s0007g07930"
FT                   /product="unknown predicted protein"
FT   5'UTR           1037053..1037072
FT                   /locus_tag="VIT_08s0007g07930"
FT                   /old_locus_tag="Vv08s0007g07930"
FT   CDS_pept        join(1037073..1039356,1039451..1039842)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07930"
FT                   /old_locus_tag="Vv08s0007g07930"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HL59"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013210"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL59"
FT                   /protein_id="CCB55166.1"
FT                   /translation="MASFCTYPLFFSLTFAFFIVASASSEAEILLTFKASIEDPMKYLS
FT                   TWSNTSETHHCNWTGVTCTTTPPLSVTSLNLQSLNLSGEISASLCGLHNLSYLNLADNL
FT                   FNQPIPLHLSQCSSLETLNLSNNLIWGTVPEQISQFGSLRTLDFSRNHVEGKIPETIGS
FT                   LKNLQVLNLGSNLLSGSVPSVFGNFTELLVLDLSQNRFLVSEIPGGIGKLEKLKQLLLQ
FT                   SSGFYGEIPQSFAGLQGLTILDLSQNNLTGGVPQTLGASLKNLVSFDVSQNNLLGSFPT
FT                   GICRGKGLINLSLHTNSFSGSIPNSISECLNLERFQVQNNGFSGDFPNGLWSLPKIKLI
FT                   RAENNRFSGEIPDSISVAAQLEQVQIDNNSFTSKIPQGLGSVRSLYRFSASLNGFYGEL
FT                   PPNFCDSPVMSIINLSHNSLSGLIPELKKCRKLVSLSLADNSLVGQIPASLAELPVLTY
FT                   LDLSDNNLTGSIPQELQNLKLALFNVSFNHLSGKVPFPLISGLPASFLQGNPELCGPGL
FT                   PNSCYDDEPIHKAGGLTKLACALISLALGAGILIIAAGFFVIYRTSQRKSQMGVWRSVF
FT                   FYPLRVTEHDLIMGMDEKSAVGSGGAFGRVYIISLPSGELVAVKKLLNPGSQSSKSLKN
FT                   EVKTLAKIRHKNIVKLLGFCHSSDSIFLIYEFLQKGSLGDLICRPDFQFQWSTRLRIAI
FT                   GVAQGLAYLHKDYVPHILHRNLKSKNILLDADLEPKLTDFALDRIVGETAFQSTMASES
FT                   AFSCYIAPENGYSKRATEQMDVYSFGVVLLELVTGRQAEQAESAESIDIVKWVRRKINI
FT                   TDGALQVLDPKISNSSQQEMLGALEMALRCTSVMPEKRPTMFEVVRALQSLSSKTPTSQ
FT                   IWSCPLELQMSIHQLQSDEH"
FT   3'UTR           1039843..1040025
FT                   /locus_tag="VIT_08s0007g07930"
FT                   /old_locus_tag="Vv08s0007g07930"
FT   gene            complement(1047734..1054140)
FT                   /locus_tag="VIT_08s0007g07920"
FT                   /old_locus_tag="Vv08s0007g07920"
FT   mRNA            complement(join(1047734..1047971,1047972..1048313,
FT                   1048983..1049096,1049200..1049400,1050328..1050501,
FT                   1050671..1050880,1051178..1051475,1051614..1052422,
FT                   1052423..1052459,1054027..1054140))
FT                   /locus_tag="VIT_08s0007g07920"
FT                   /old_locus_tag="Vv08s0007g07920"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(1047734..1047971)
FT                   /locus_tag="VIT_08s0007g07920"
FT                   /old_locus_tag="Vv08s0007g07920"
FT   CDS_pept        complement(join(1047972..1048313,1048983..1049096,
FT                   1049200..1049400,1050328..1050501,1050671..1050880,
FT                   1051178..1051475,1051614..1052422))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07920"
FT                   /old_locus_tag="Vv08s0007g07920"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL60"
FT                   /protein_id="CCB55167.1"
FT                   /translation="MVAKENKDEIKDNHSSDLEKEPKPGKEEESDSETRRDSVSSQGDS
FT                   QTADDEKVERASRVPKRIAKKDSSDNHSHASRVRSDRETHKSQSKPLHNTPKKSPKSNK
FT                   GPSKVTTKNSPNTNSKNMKVPPKPSSESSEGIDDKPIEEVKEADLLDGASNGVQSVGSD
FT                   DETVDTEENGEHEDKVALDQRIEEMEMRIEKLEEELREVAALEISLYSVVPEHGSSAHK
FT                   VHTPARRLSRLYIHASKHWAQHKRATIAKNTVSGLVLIAKSCGNDVPRLTFWMSNTVVL
FT                   REIISQAFGNSCQSSPVVRFSESNGSGKKSDGTSLTLKWKGSSGGKQVNKLGFVQFVDD
FT                   WQETRTFTSALEKVESWIFSRIVESVWWQTLTPHMQPPVKDSYTKKTIERLLGPALGDQ
FT                   QQGSFSINLWKNAFQDAFQRLCPVRAGGHECGCLPVIARMVMEQCVSRLDVAMFNAILR
FT                   ESAHEIPTDPISDPIVDSKVLPIPAGDLSFGSGAQLKNSVGTWSRWLTDLFGMDVDDSL
FT                   GEVQINGEDGESQGGHDEPKSFHLLNALSDLLMLPKDMLMDRSIRKEVCPSISLPLLKR
FT                   ILCNFTPDEFCPDPVPGAVLEAVNAESIVERRLSGDSASSFPYPATPVLYAPPSSADVA
FT                   EKVAEAGGKSQLARNASMVQKKGYTSDEELEELDSPLTSIIEKMPPSPSVVRNGNGKHS
FT                   EETGHNGLNARYELLREVWSS"
FT   5'UTR           complement(1054027..1054140)
FT                   /locus_tag="VIT_08s0007g07920"
FT                   /old_locus_tag="Vv08s0007g07920"
FT   gene            1058534..1058980
FT                   /locus_tag="VIT_08s0007g07910"
FT                   /old_locus_tag="Vv08s0007g07910"
FT   mRNA            join(1058534..1058761,1058762..1058980)
FT                   /locus_tag="VIT_08s0007g07910"
FT                   /old_locus_tag="Vv08s0007g07910"
FT   CDS_pept        1058534..1058761
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07910"
FT                   /old_locus_tag="Vv08s0007g07910"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI16"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI16"
FT                   /protein_id="CBI29892.3"
FT                   /translation="MTNPTPPFPKKKATKHKQKNKKHTKLLNQIHKVSYIYPSQNSFMA
FT                   TVQSTMLISALTAVCTSSFYQTREQIQNTR"
FT   3'UTR           1058762..1058980
FT                   /locus_tag="VIT_08s0007g07910"
FT                   /old_locus_tag="Vv08s0007g07910"
FT   gene            complement(1063767..1064408)
FT                   /locus_tag="VIT_08s0007g07900"
FT                   /old_locus_tag="Vv08s0007g07900"
FT   mRNA            complement(join(1063767..1063987,1063988..1064326,
FT                   1064327..1064408))
FT                   /locus_tag="VIT_08s0007g07900"
FT                   /old_locus_tag="Vv08s0007g07900"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(1063767..1063987)
FT                   /locus_tag="VIT_08s0007g07900"
FT                   /old_locus_tag="Vv08s0007g07900"
FT   CDS_pept        complement(1063988..1064326)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07900"
FT                   /old_locus_tag="Vv08s0007g07900"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL61"
FT                   /protein_id="CCB55168.1"
FT                   /translation="MPSAKPFTSAAGALRNRLLPSLRTRGGGESGPSRWTSPGHQDRPN
FT                   GYLFNRTPLPPGQTRQWEDWELPCYVTSFLTVIILGVGLSAKPDLTIETWAHQKALERL
FT                   ASESSGSE"
FT   5'UTR           complement(1064327..1064408)
FT                   /locus_tag="VIT_08s0007g07900"
FT                   /old_locus_tag="Vv08s0007g07900"
FT   gene            complement(1065135..1069956)
FT                   /locus_tag="VIT_08s0007g07890"
FT                   /old_locus_tag="Vv08s0007g07890"
FT   mRNA            complement(join(1065135..1065369,1067337..1068777,
FT                   1069473..1069956))
FT                   /locus_tag="VIT_08s0007g07890"
FT                   /old_locus_tag="Vv08s0007g07890"
FT                   /product="Predicted protein"
FT   CDS_pept        complement(join(1065135..1065369,1067337..1068777,
FT                   1069473..1069956))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07890"
FT                   /old_locus_tag="Vv08s0007g07890"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HL62"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR032867"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL62"
FT                   /protein_id="CCB55169.1"
FT                   /translation="MIWKITSLIFHRPKQVLSSISNPFSRQRILLSTFPANSPDLKTLC
FT                   SNRQLKEALLEMGIQGLEVEFQGYDSVLTECISQTAIREGQRVHAHMIKTCYEPPVYLR
FT                   TRLIVLYNKCRCLGDARRVLDEMPERNVVSWTAMISGYSQRGYASEALHLFVEMLMSGT
FT                   APNEFTFATVLTSCTSSSGFQLGRQIHSLVIKTSFESHIFVGSSLLDMYAKAGKICEAR
FT                   RVFDGLPERDVVSCTAIISGYAQLGLDEEALDLFRRLQREGMRSNYVTYASVLTALSGL
FT                   AALDHGRQVHSHVLRAKLPFYVVLQNSLIDMYSKCGSLTYSRRIFDSMPERTVISWNAM
FT                   LVGYSKHGLGREAVELFKLMKEENKVKPDSVTFLAVLSGCSHGGMEDRGLEIFYEMVNQ
FT                   KDGFEPEIEHYGCVVDLFGRAGRVEEAFEFIKKMPFEPTAAIWGSLLGACRVHQNVHIG
FT                   EFVARRLLEIESENAGNYVILSNLYASAGRWDDVRTVRELMKEKAVIKEPGRSWIELDQ
FT                   TLHTFHASDRSHPRKEEVFAKVRELSIKIKEAGYVPELSCVLYDVDDEQKEKILQGHSE
FT                   KLALAFGLICTPGGTPVRIIKNLRICVDCHNFAKFLSRVYGREVSLRDKNRFHHIVGGT
FT                   CSCGDYWGSIYSNIDHLFDVKDIWNFISNDTFLVRDKNVVNYFIYFDIENSMFEIDNNQ
FT                   SFQSELECFLFLFIFFFIVIEMLVI"
FT   gene            complement(1070137..1073860)
FT                   /locus_tag="VIT_08s0007g07880"
FT                   /old_locus_tag="Vv08s0007g07880"
FT   mRNA            complement(join(1070137..1070275,1070276..1070805,
FT                   1071083..1071414,1073163..1073746,1073747..1073860))
FT                   /locus_tag="VIT_08s0007g07880"
FT                   /old_locus_tag="Vv08s0007g07880"
FT                   /product="Predicted protein"
FT   3'UTR           complement(1070137..1070275)
FT                   /locus_tag="VIT_08s0007g07880"
FT                   /old_locus_tag="Vv08s0007g07880"
FT   CDS_pept        complement(join(1070276..1070805,1071083..1071414,
FT                   1073163..1073746))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07880"
FT                   /old_locus_tag="Vv08s0007g07880"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HL63"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL63"
FT                   /protein_id="CCB55170.1"
FT                   /translation="MAATLFHITLFFLLFSIVQSRLYTLPQPIIQLPHLPHLFSVADYG
FT                   AIGDGLHYDTAAIQATIDACHSAGGGQIRFPPGTYLTATVYIKSGVYLVVEEGAKILGG
FT                   TKLEDYPEESRRWYVLLAENATDVGITGGGVIDGHGMKFVKRFEEAKNVMVSWNETGAC
FT                   LGDECRPRLVGFLGCRNVRVWNIRLNEPAYWCLHLVGCNNTSIHDVSIYGDFNTPNNDG
FT                   IDIEDSNNTVITRCSISTGDDSICPKTSNGPLYNLTVTNCWLRSRSSAIKLGSGSFYDF
FT                   KGLVFDNITIDDSHRGLGMQIRDGGDVSDVTFSNMNIKTRYYEPVLWWGRAEPIYITTC
FT                   PRDSNSKEGSISNIRFINISATSENGVFLSGSKAGLLSNLRFQNVNFTYRRWTNFPDDL
FT                   VDYRPGCRGLVKHSPAGMIMEHIDGLELENVNMRWSGVIQNKRWNNPLDFLPSTVNNIS
FT                   FLNFQSGSDSVREIRAPREGSIV"
FT   5'UTR           complement(1073747..1073860)
FT                   /locus_tag="VIT_08s0007g07880"
FT                   /old_locus_tag="Vv08s0007g07880"
FT   gene            complement(1077280..1083151)
FT                   /locus_tag="VIT_08s0007g07870"
FT                   /old_locus_tag="Vv08s0007g07870"
FT   mRNA            complement(join(1077280..1077675,1077676..1077713,
FT                   1078284..1078494,1079436..1079507,1080097..1080165,
FT                   1081901..1081966,1082061..1082189,1082291..1082800,
FT                   1082801..1083151))
FT                   /locus_tag="VIT_08s0007g07870"
FT                   /old_locus_tag="Vv08s0007g07870"
FT                   /product="BHLH transcription factor PTF1"
FT   3'UTR           complement(1077280..1077675)
FT                   /locus_tag="VIT_08s0007g07870"
FT                   /old_locus_tag="Vv08s0007g07870"
FT   CDS_pept        complement(join(1077676..1077713,1078284..1078494,
FT                   1079436..1079507,1080097..1080165,1081901..1081966,
FT                   1082061..1082189,1082291..1082800))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07870"
FT                   /old_locus_tag="Vv08s0007g07870"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI19"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR024097"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI19"
FT                   /protein_id="CBI29895.3"
FT                   /translation="MERIAGTGGRSGSTGGEKEEIGAESFLFGEEIQRLMTGPPENGSS
FT                   FTALLGLPANQAMELLHSQESDTAPAELSGEAWRDNHMNPHKLYYCSPTFPANTTLIDR
FT                   AARFSVFAAGENSPETSSVPSNSSHKVKNEPTDTDSNPNSLPPLISNPTVENKNQRSTK
FT                   RKEREKKAKGSTKKCKNASNETSEEAEKLPYVHVRARRGQATDSHSLAERARREKINAR
FT                   MKLLQELVPGCNKISGTALVLDEIISHVQSLQRQVEFLSMRLAAVNPRIDFNLDSLLAP
FT                   ESGSLVDSNFPSMVMPLMWPDVQANENRQPYQQLWNDDTLHQPVWGREEDDPHNFIAPE
FT                   HSLLSYDSSANSGSLQSNQLKMEL"
FT   5'UTR           complement(1082801..1083151)
FT                   /locus_tag="VIT_08s0007g07870"
FT                   /old_locus_tag="Vv08s0007g07870"
FT   gene            complement(1096558..1100445)
FT                   /locus_tag="VIT_08s0007g07860"
FT                   /old_locus_tag="Vv08s0007g07860"
FT   mRNA            complement(join(1096558..1096573,1097915..1098037,
FT                   1099738..1099919,1100207..1100281,1100282..1100445))
FT                   /locus_tag="VIT_08s0007g07860"
FT                   /old_locus_tag="Vv08s0007g07860"
FT                   /product="Cornichon family protein"
FT   CDS_pept        complement(join(1096558..1096573,1097915..1098037,
FT                   1099738..1099919,1100207..1100281))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07860"
FT                   /old_locus_tag="Vv08s0007g07860"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HL64"
FT                   /db_xref="InterPro:IPR003377"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL64"
FT                   /protein_id="CCB55171.1"
FT                   /translation="MSWELILWIIFFFINIALLGSTFYQILCLSDLEADYMNPYESSSR
FT                   INSIVVPDFILQGVLCILFLLTWHWFLFLISVPITCYNAMLFMKRQHLIDVTEVFRTLS
FT                   AEKKYRVAKLAFYLFLFIIVIIRYHRY"
FT   5'UTR           complement(1100282..1100445)
FT                   /locus_tag="VIT_08s0007g07860"
FT                   /old_locus_tag="Vv08s0007g07860"
FT   gene            1103434..1117466
FT                   /locus_tag="VIT_08s0007g07850"
FT                   /old_locus_tag="Vv08s0007g07850"
FT   mRNA            join(1103434..1103478,1103768..1103872,1103975..1104118,
FT                   1104304..1104420,1111392..1111502,1111684..1111746,
FT                   1111853..1111979,1112375..1112457,1112881..1113097,
FT                   1114406..1114533,1116269..1116343,1116474..1116594,
FT                   1117176..1117279,1117280..1117466)
FT                   /locus_tag="VIT_08s0007g07850"
FT                   /old_locus_tag="Vv08s0007g07850"
FT                   /product="putative uncharacterized protein"
FT   CDS_pept        join(1103434..1103478,1103768..1103872,1103975..1104118,
FT                   1104304..1104420,1111392..1111502,1111684..1111746,
FT                   1111853..1111979,1112375..1112457,1112881..1113097,
FT                   1114406..1114533,1116269..1116343,1116474..1116594,
FT                   1117176..1117279)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07850"
FT                   /old_locus_tag="Vv08s0007g07850"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI21"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI21"
FT                   /protein_id="CBI29897.3"
FT                   /translation="MFLCFSFLFIFKHFIVIGLGKSGRAATKLALARGASVIAIDQNEN
FT                   LSLLELNPLFEKHGHLKTVLGHFDTKLLKDADMVVVSPGVPLESHGLSFLLQSGKRVLS
FT                   ELDFAAEILPRSIKILAVTGTNGKSTVATFSGQMLSHLGIEVFVGGNLGIPLSEAAIQC
FT                   LTCPSPKPVFQVAVVEVSSYQLEVPNKHFCPSVAVVLNLTSDHLERHKTMKNYAITKCR
FT                   LLSHMTNSKLGILPFGNKLLNEAMEELVNEVNLAWIGAFPGVKVDKEEKVASLRVPAIG
FT                   VVSELKLGALNVMGTHNYYNAAVAALSVLGLDMGIDTEAISSTIEKLRVPPHRMQIVHK
FT                   DSYGVTWIDDSKATNVEATYTGLLGLKEQKSVILLGGLAKVSNSQESNGFEQLVEPLKY
FT                   HRCVITFGFSGPLIQKTLSDDGLSIPCFEAANLEDAVNCARSVARYGDAVVLSPGCASF
FT                   DEFRNFEHRGKVFQELVFSSE"
FT   3'UTR           1117280..1117466
FT                   /locus_tag="VIT_08s0007g07850"
FT                   /old_locus_tag="Vv08s0007g07850"
FT   gene            1118050..1123095
FT                   /locus_tag="VIT_08s0007g07840"
FT                   /old_locus_tag="Vv08s0007g07840"
FT   mRNA            join(1118050..1118135,1119065..1119482,1119483..1119720,
FT                   1119864..1119985,1120391..1120431,1122272..1122370,
FT                   1122738..1122909,1122910..1123095)
FT                   /locus_tag="VIT_08s0007g07840"
FT                   /old_locus_tag="Vv08s0007g07840"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           1118050..1118135
FT                   /locus_tag="VIT_08s0007g07840"
FT                   /old_locus_tag="Vv08s0007g07840"
FT   CDS_pept        join(1119483..1119720,1119864..1119985,1120391..1120431,
FT                   1122272..1122370,1122738..1122909)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07840"
FT                   /old_locus_tag="Vv08s0007g07840"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HL65"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL65"
FT                   /protein_id="CCB55172.1"
FT                   /translation="MNVRLLVPKQGVLPKIKCNVGSVSWPQGCASAGLMFALLVCYSSS
FT                   EPVHAESAQKKEDKKGECYTNSHGKKVYTDYSITGIPGDGRCLFRSVVHGACLRSGKPA
FT                   PSASCQRELADELRAEVVDEFIRRRSETEWFIEGDFDTYVSQMRKPHVWGGEPELFMAS
FT                   HVLQMPITVYMYDKDSGGLIAIAEYGQEYGKENPIRVLYHGFGHYESLQIPGKKGAKSR
FT                   L"
FT   3'UTR           1122910..1123095
FT                   /locus_tag="VIT_08s0007g07840"
FT                   /old_locus_tag="Vv08s0007g07840"
FT   gene            1126247..1132448
FT                   /locus_tag="VIT_08s0007g07820"
FT                   /old_locus_tag="Vv08s0007g07820"
FT   mRNA            join(1126247..1126532,1126533..1127832,1131803..1132425,
FT                   1132426..1132448)
FT                   /locus_tag="VIT_08s0007g07820"
FT                   /old_locus_tag="Vv08s0007g07820"
FT                   /product="unknown predicted protein"
FT   5'UTR           1126247..1126532
FT                   /locus_tag="VIT_08s0007g07820"
FT                   /old_locus_tag="Vv08s0007g07820"
FT   CDS_pept        join(1126533..1127832,1131803..1132425)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07820"
FT                   /old_locus_tag="Vv08s0007g07820"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HL66"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013210"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL66"
FT                   /protein_id="CCB55173.1"
FT                   /translation="MLLFRAELGLASFLIFFTCLSSSLNSDGLSLLALKAAIVSDPTGV
FT                   LDTWSESDLVPCHWGGISCTHGRVTGVFLPNRSFTGYIPSELGALVNLRQLSLANNNFS
FT                   KPIPSRLFNATTLLSLDLSHNSLSGPLPTQVKALKYLVHLDLSSNLLNGSLPEELAELE
FT                   NLAGSLNLSHNRFSGEVPASYGKIPLMVSLDLRHNNLTGKIPQIGSLLNQGPTAFSGNP
FT                   SLCGFPLQTPCPEASNPKIFVNPENPRKPNPSFPNGAADEGEERQKIGGGSVAVPLISG
FT                   ISVVVGVVSVSVWLFRKKRSSGEGKIGREKLAKEVEDEGQKGKFVVVDEGFGLELEDLL
FT                   RASAYVVGKSRSGIVYRVVAGRVSGASPTVVAVRRLSEGDGTWRLKDFESEVEAIARVH
FT                   HQNIVRLRAYYYANDEKLLVSDFIRNGSLHTALHGGPSNTLPPLSWAARLKIAQGAARG
FT                   LMHIHECSPRKYVHGNIKSSKILLDDHLQPYVSGFGLTRLVSGASSKKQNSHQVSTNSV
FT                   LGSKASANSIAYLAPEARVSGTRFTQKCDVYSFGIVLMEVLTARLPDAGPENDGKGLES
FT                   LVRKVFRDERPLSEIIDPALLHEVYAKKQVLSAFHVALNCTELDPELRPRMRTVSESLD
FT                   RIKSQ"
FT   3'UTR           1132426..1132448
FT                   /locus_tag="VIT_08s0007g07820"
FT                   /old_locus_tag="Vv08s0007g07820"
FT   gene            1138749..1141512
FT                   /locus_tag="VIT_08s0007g07810"
FT                   /old_locus_tag="Vv08s0007g07810"
FT   mRNA            join(1138749..1139091,1139092..1139548,1140072..1140421,
FT                   1140518..1140688,1140810..1140875,1140971..1141039,
FT                   1141126..1141197,1141198..1141512)
FT                   /locus_tag="VIT_08s0007g07810"
FT                   /old_locus_tag="Vv08s0007g07810"
FT                   /product="Predicted protein"
FT   5'UTR           1138749..1139091
FT                   /locus_tag="VIT_08s0007g07810"
FT                   /old_locus_tag="Vv08s0007g07810"
FT   CDS_pept        join(1139092..1139548,1140072..1140421,1140518..1140688,
FT                   1140810..1140875,1140971..1141039,1141126..1141197)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07810"
FT                   /old_locus_tag="Vv08s0007g07810"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5AWW8"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/TrEMBL:A5AWW8"
FT                   /protein_id="CCB55174.1"
FT                   /translation="MSLMYSSNFKHSGEEETEKTRAVFMDSNTNYHHQQNQNQPPNSGL
FT                   LRFRSAPSSLLANFTDSGDGVHKGANLCDDFESERFMPCGGFQDSAMSCQSQLPPQYPR
FT                   QSSSTSSSAMDGSYGVVNSNNMEAKQGSSLVRQSSSPAGLFSHLSGQNGYAIMRGVGNF
FT                   RPGNVGNGEISPSTSRLKPQVSFSSGLPSSLGLLPQISEIGSECIQASSPNDRKLANSN
FT                   GDARFYSPGFPYGSWNDSAHFENFSGMKRDQDNDGKLYSGSNTSGIRNEEFGHRSQILS
FT                   HHLSLPKTSAEMAAMEKFLQFQDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQ
FT                   ELVPNMDKQTNTADMLDLAVEYIKDLQKQYNTLTDNRAHCKCLGKQKPVPNQTV"
FT   3'UTR           1141198..1141512
FT                   /locus_tag="VIT_08s0007g07810"
FT                   /old_locus_tag="Vv08s0007g07810"
FT   gene            1143050..1145013
FT                   /locus_tag="VIT_08s0007g07800"
FT                   /old_locus_tag="Vv08s0007g07800"
FT   mRNA            join(1143050..1143050,1143051..1143277,1144564..1145008,
FT                   1145009..1145013)
FT                   /locus_tag="VIT_08s0007g07800"
FT                   /old_locus_tag="Vv08s0007g07800"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           1143050..1143050
FT                   /locus_tag="VIT_08s0007g07800"
FT                   /old_locus_tag="Vv08s0007g07800"
FT   CDS_pept        join(1143051..1143277,1144564..1145008)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07800"
FT                   /old_locus_tag="Vv08s0007g07800"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5AWW7"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5AWW7"
FT                   /protein_id="CBI29902.3"
FT                   /translation="MSNLYGDFNQKIDYVFKVVLIGDSAVGKSQLLARFARNEFNVDSK
FT                   ATIGVEFQTKTLAIDQKAVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFD
FT                   HMARWLEELRGHADKNIVIMLIGNKSDLGSLRAVPTEDAQEFAERENLFFMETSALEAT
FT                   NVETAFLTVLTDIYKIISKKTLTANTDTDSTGSSTLLKGTKIIVPGGPDSAAQKGGCCG
FT                   S"
FT   3'UTR           1145009..1145013
FT                   /locus_tag="VIT_08s0007g07800"
FT                   /old_locus_tag="Vv08s0007g07800"
FT   gene            1146582..1147882
FT                   /locus_tag="VIT_08s0007g07790"
FT                   /old_locus_tag="Vv08s0007g07790"
FT   mRNA            join(1146582..1146992,1147112..1147501,1147502..1147882)
FT                   /locus_tag="VIT_08s0007g07790"
FT                   /old_locus_tag="Vv08s0007g07790"
FT                   /product="putative uncharacterized protein"
FT   CDS_pept        join(1146582..1146992,1147112..1147501)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07790"
FT                   /old_locus_tag="Vv08s0007g07790"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HL68"
FT                   /db_xref="InterPro:IPR034590"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL68"
FT                   /protein_id="CCB55175.1"
FT                   /translation="MPESRDRLSRPEDIAELFLRRRSGILGILADGSERSSNLFASPSR
FT                   RETTTRTTTLGARGATGILASRGGGVGRGGFGTPRIGTGRGRGRAVYRSPLFGRENTPA
FT                   TGSGRRGRGRSGNSVLPSWYPRTPLRDITHVVRAIERRRARLREIDGQQIDIPIPQDIS
FT                   DVHDPILPPSSAQLEQDISMISPSPTSGMKLVPKAVGKVPKILLDITDQTGGGSDFLTP
FT                   QKKLLNSIDTVEKAVMDELGKLKRTPSAKRAEQEKRVRTLMSMR"
FT   3'UTR           1147502..1147882
FT                   /locus_tag="VIT_08s0007g07790"
FT                   /old_locus_tag="Vv08s0007g07790"
FT   gene            1160256..1162796
FT                   /locus_tag="VIT_08s0007g07780"
FT                   /old_locus_tag="Vv08s0007g07780"
FT   mRNA            join(1160256..1160531,1160919..1161044,1161154..1161321,
FT                   1161564..1161771,1161872..1161953,1162085..1162193,
FT                   1162352..1162468,1162575..1162793,1162794..1162796)
FT                   /locus_tag="VIT_08s0007g07780"
FT                   /old_locus_tag="Vv08s0007g07780"
FT                   /product="Polygalacturonase"
FT   CDS_pept        join(1160256..1160531,1160919..1161044,1161154..1161321,
FT                   1161564..1161771,1161872..1161953,1162085..1162193,
FT                   1162352..1162468,1162575..1162793)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07780"
FT                   /old_locus_tag="Vv08s0007g07780"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HL69"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL69"
FT                   /protein_id="CCB55176.1"
FT                   /translation="MSLQRRFIPFLIVFLLSFPCYYGLQGNPPYDYLDDAYGYASSQAY
FT                   DKRPWRKFGSKIMGSKRIGEVGRSLASVTTVNVNDYGAKGDGSDATEAFKKAWEAACSS
FT                   QGSVLVVPKNNYLLKPITFEGPCKSSITVQIYGTLQASTDRSAYSNDLTRWLVFENVQN
FT                   LAVQGGGTINGNGKIWWENSCKVDDDLALTFYNCKNLVVKNLKIENAQQIHVSFEKCVG
FT                   VQASGLTVTAPGDSPNTDGIHVTDTQNIQISSSVIGTGDDCISIVSGTQNLQATGITCG
FT                   PGHGISIGSLGYGNSEALVSDITVNGATLSGTTNGVRIKTWPGGSGSASNIKFQNIEMH
FT                   DVDNPIIINQKYCDDDKPCESESQAVQVQNVLYQNIKGTSSSSEAIQLDCSSKFPCQGI
FT                   VLQDIDIETGGGKAATAVCNDAKVTEKGDVSPSCT"
FT   3'UTR           1162794..1162796
FT                   /locus_tag="VIT_08s0007g07780"
FT                   /old_locus_tag="Vv08s0007g07780"
FT   gene            1165460..1167977
FT                   /locus_tag="VIT_08s0007g07770"
FT                   /old_locus_tag="Vv08s0007g07770"
FT   mRNA            join(1165460..1165735,1166103..1166231,1166343..1166510,
FT                   1166626..1166646,1166748..1166955,1167056..1167137,
FT                   1167269..1167377,1167536..1167652,1167759..1167977)
FT                   /locus_tag="VIT_08s0007g07770"
FT                   /old_locus_tag="Vv08s0007g07770"
FT                   /product="Polygalacturonase"
FT   CDS_pept        join(1165460..1165735,1166103..1166231,1166343..1166510,
FT                   1166626..1166646,1166748..1166955,1167056..1167137,
FT                   1167269..1167377,1167536..1167652,1167759..1167977)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07770"
FT                   /old_locus_tag="Vv08s0007g07770"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI29"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI29"
FT                   /protein_id="CBI29905.3"
FT                   /translation="MSLQRRFIPFLIVFLLSFPCYYGLQGNPPYDYLDDAYGYDSSRAY
FT                   ESWPWRKFGSKIMGSKRICKVGRSLASVKTVSVNDYEAKGDGSDATEAFKKAWEAACSS
FT                   QGSVLVVPKNKNYLLKPITFEGPCKSSITVQIYGTVQASADRSAYSNDMTRWLVFENVQ
FT                   NLAVQGGGTINGNGKTWWENSCKVNDDLPCKDAPTALTFYNCKNLVVKNLKIQNAQQMH
FT                   VSFEKCVGVQASGLTVTAPGDSPNTDGIHVTDTQNIQISSSVIGTGDDCISIVSGTQNL
FT                   QATGITCGPGHGISIGSLGSGNSEAHVSDITVNGATLSGTTNGVRIKTWQGGSGSASNI
FT                   KFQNIEMHDVDNPIIINQKYCDDDKPCESESQAVQVQNVLYQNIKGTSSSSEAIQLDCS
FT                   SKFPCQGIVLQDIDIETGGGKAATAVCNDAKVTEKGDVSPSCT"
FT   gap             1168023..1168122
FT                   /estimated_length=100
FT   gene            1175242..1177821
FT                   /locus_tag="VIT_08s0007g07760"
FT                   /old_locus_tag="Vv08s0007g07760"
FT   mRNA            join(1175242..1175517,1175926..1176054,1176169..1176336,
FT                   1176568..1176775,1176885..1176966,1177098..1177206,
FT                   1177365..1177481,1177603..1177821)
FT                   /locus_tag="VIT_08s0007g07760"
FT                   /old_locus_tag="Vv08s0007g07760"
FT                   /product="Polygalacturonase"
FT   CDS_pept        join(1175242..1175517,1175926..1176054,1176169..1176336,
FT                   1176568..1176775,1176885..1176966,1177098..1177206,
FT                   1177365..1177481,1177603..1177821)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07760"
FT                   /old_locus_tag="Vv08s0007g07760"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HL70"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL70"
FT                   /protein_id="CCB55177.1"
FT                   /translation="MSLKRRFIPFLIVFLLSFPCYYGLQGNPPYDYLDDAYGYDSSRAY
FT                   EKWPWRKFGSKIMGSKRIGKVGRSLASVKTVSVNDYGAKGDGSDATEAFKKAWEAACSS
FT                   QGSVLVVPQTKNYLLKPITFQGPCKSSITVQIYGTVQASADRSAYSNDMTRWLVFENVQ
FT                   NLAVQGGGTINGNGKTWWENSCKVNDDLALTFYNCKNLVVKNLKIQNAQQMHVSFEKCV
FT                   GVQASGLTVTAPGDSPNTDGIHVTDTQNIQISSSVLGTGDDCISIVSGTQNLQATGITC
FT                   GPGHGISIGSLGSGNSEAHVSDITVNGATLSGTTNGVRIKTWQGGSGSASNIKFQNIEM
FT                   HNVKNPIIIDQKYCDQDKPCKSQSRAVQVQNVLYQNIKGTSSSNEAIQLDCSDKFPCQG
FT                   VVLQDIDIEIGGGRATKAVCNNAKVTEKGDVSPSCT"
FT   gene            1185756..1188286
FT                   /locus_tag="VIT_08s0007g07750"
FT                   /old_locus_tag="Vv08s0007g07750"
FT   mRNA            join(1185756..1186031,1186396..1186524,1186638..1186805,
FT                   1186912..1186932,1187036..1187243,1187344..1187425,
FT                   1187557..1187665,1187829..1187945,1188068..1188286)
FT                   /locus_tag="VIT_08s0007g07750"
FT                   /old_locus_tag="Vv08s0007g07750"
FT                   /product="Polygalacturonase"
FT   CDS_pept        join(1185756..1186031,1186396..1186524,1186638..1186805,
FT                   1186912..1186932,1187036..1187243,1187344..1187425,
FT                   1187557..1187665,1187829..1187945,1188068..1188286)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07750"
FT                   /old_locus_tag="Vv08s0007g07750"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI31"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI31"
FT                   /protein_id="CBI29907.3"
FT                   /translation="MSLQRRFIPFLIVFLLSFPCYYGLQGNPPYDYLDDAYAYDSSRAY
FT                   ESWPWRKFGSKIMGSKRIGKVGRSLASVKTVSVNDYGAKGDGSDATEAFKKAWEAACSS
FT                   QGSVLVVPKNKNYLLKPITFEGPCKSSITVQIYGTVQASADRSAYSNDMTRWLVFENVQ
FT                   NLAVQGGGTINGNGKTWWENSCKVNDDLSCKDAPTALTFYNCKNLVVKNLKIQNAQQMH
FT                   VSFEKCVGVQASGLTVTAPGDSPNTDGIHVTDTQNIQISSSVIGTGDDCISIVSGTQNL
FT                   QATGITCGPGHGISIGSLGSGNSEAHVSDITVNGATLSGTTNGVRIKTWPGGSGSASNI
FT                   KFQNIEMHNVKNPIIIDQKYCDGDKPCKSQSRAVQVQNVLYQNIKGTSSSSEAIQLDCS
FT                   DKFPCQGIVLQDIDIEIGGGKAAQAVCNNAKVTEKGDVSPSCT"
FT   gene            1193978..1195247
FT                   /locus_tag="VIT_08s0007g07740"
FT                   /old_locus_tag="Vv08s0007g07740"
FT   mRNA            join(1193978..1194505,1194609..1195247)
FT                   /locus_tag="VIT_08s0007g07740"
FT                   /old_locus_tag="Vv08s0007g07740"
FT                   /product="Predicted protein"
FT   CDS_pept        join(1193978..1194505,1194609..1195247)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07740"
FT                   /old_locus_tag="Vv08s0007g07740"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI32"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI32"
FT                   /protein_id="CBI29908.3"
FT                   /translation="MKKLSMTKLLGVQTLDKFVPVMREERHLFLQTLLGKAEAGEAVDV
FT                   KKEIMRLTNNLITKMIMRHRCSDSEDDATEVKELMTEMMKLIGSFNLSDFVWFCKNLDL
FT                   QGFKKRVKEARARFDAIMERVMKAREEERRKKRDMNDAGVAMNDFLDILLDIMENEKEE
FT                   MRLTRENVKGIILDIFGGGTETSGTAAIWAVAELINHPNIMEKARQEIDSVVGKDRLVE
FT                   ESDIANLPYLQAIVKEILRLHPPGALIARESTEDCTIGGYHIPAKTQLFVNRWAIGRDP
FT                   NYWENPLQFLPERFLTEDGSLKSHLDVRGQHFHLLPFGSGRRICPGVSLALQVIQTSLA
FT                   AMIQCFEWRVGDGGNGNVDMEEGPNAVLVHPLICVPVARVNPFPKYTM"
FT   gene            1197274..1201292
FT                   /locus_tag="VIT_08s0007g07730"
FT                   /old_locus_tag="Vv08s0007g07730"
FT   mRNA            join(1197274..1197332,1199455..1199568,1199569..1200480,
FT                   1200629..1201264,1201265..1201292)
FT                   /locus_tag="VIT_08s0007g07730"
FT                   /old_locus_tag="Vv08s0007g07730"
FT                   /product="Cytochrome P450"
FT   5'UTR           1197274..1197332
FT                   /locus_tag="VIT_08s0007g07730"
FT                   /old_locus_tag="Vv08s0007g07730"
FT   CDS_pept        join(1199569..1200480,1200629..1201264)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07730"
FT                   /old_locus_tag="Vv08s0007g07730"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HL71"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL71"
FT                   /protein_id="CCB55178.1"
FT                   /translation="MVDVQDYIILFLIWLVSVVVVHALFTKYRTRVRRPPGPLALPIIG
FT                   HFHLLGSKPHQSLHKLSLRYGPLFQLFLGSIPCVVVSSPEMAKEFLQTHDISFSNRPKL
FT                   SNADYLTYGSVDLAFSSYGPYWKFMKKLCMTKLLGLQTLEKFVPVMREERHLFLQTLLG
FT                   KAEAGETVDVKGEIMRLTNNLVTRILLRHRCSGNEDDASEVREFMKEIVQLTGSFNLAD
FT                   FIWFCKNLDLQGFKKRVKEARGRFDTMMERIMKAHEEERRKKRDPNNGGDTVNDLLDIL
FT                   LDIIEDEKEEMRLTRENVKAIILNIFGGGTDTSAAAAVWAVAELINHPNIMEKARQEID
FT                   SVVGKDRLVEESDIANLPYLQAIVKETLRLHPPGAVIARESIEDCTIRGYDIPTKTQLF
FT                   VNLWAIGRDPNYWENPLEFWPERFLREDGSLKSQLDVKGQHFHLLPFGSGRRICPGISL
FT                   ALQVVQTSLAAMIQCFEWRVGGGNGNVDMEEGPDAALAHPLVCVPVARLNPFPNYTM"
FT   3'UTR           1201265..1201292
FT                   /locus_tag="VIT_08s0007g07730"
FT                   /old_locus_tag="Vv08s0007g07730"
FT   gene            1205193..1206688
FT                   /locus_tag="VIT_08s0007g07720"
FT                   /old_locus_tag="Vv08s0007g07720"
FT   mRNA            join(1205193..1205717,1205901..1206524,1206525..1206688)
FT                   /locus_tag="VIT_08s0007g07720"
FT                   /old_locus_tag="Vv08s0007g07720"
FT                   /product="Cytochrome P450"
FT   CDS_pept        join(1205193..1205717,1205901..1206524)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07720"
FT                   /old_locus_tag="Vv08s0007g07720"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI34"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI34"
FT                   /protein_id="CBI29910.3"
FT                   /translation="MKKLCMTELLGMQTIHHFGPIRREERNRLLQRLLKKAKAGEAVDV
FT                   KAELLRLTGDIVSRMSMSRRCSDNEDEAAGVKKSILEMASMAMKLNVTDFIWFCKKLDI
FT                   QGFLKKAKAARDKYDSMIERIISEHEEARRKKEAGDGNGEVKDLIDMLLDTTEDEKAEM
FT                   RLTRENIKALMLNMIGGGTTSPAHAMEWALAELINRPNLMEKARHEIDSVVGKDRLVEE
FT                   SDITNLPYVEAIVRETLRLHPPGHFIVRESIEDCKVGGYDIPAKTQLIVNVWAIGRDPN
FT                   SWENPLEFQPERFLNEGGINRRLNVRGQQFHLLPFGSGRRLCPGTTLALQVLHTTIAAL
FT                   IQCFDWKVNGNIDMKEGFGSTRATPLVCVPVVRLNPLPIYTS"
FT   3'UTR           1206525..1206688
FT                   /locus_tag="VIT_08s0007g07720"
FT                   /old_locus_tag="Vv08s0007g07720"
FT   gene            1211029..1213355
FT                   /locus_tag="VIT_08s0007g07710"
FT                   /old_locus_tag="Vv08s0007g07710"
FT   mRNA            join(1211029..1211034,1211035..1211940,1212695..1213327,
FT                   1213328..1213355)
FT                   /locus_tag="VIT_08s0007g07710"
FT                   /old_locus_tag="Vv08s0007g07710"
FT                   /product="Cytochrome P450"
FT   5'UTR           1211029..1211034
FT                   /locus_tag="VIT_08s0007g07710"
FT                   /old_locus_tag="Vv08s0007g07710"
FT   CDS_pept        join(1211035..1211940,1212695..1213327)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07710"
FT                   /old_locus_tag="Vv08s0007g07710"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HL72"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL72"
FT                   /protein_id="CCB55179.1"
FT                   /translation="MADFQGYITLFLIWLVSTILIRAIFTKWRTTVHLPPSPLALPIIG
FT                   HLHLLAPIPHQAFHKLSHRYGPLIHLFLGSVPCVVASSPEMAKEFLKTHETSFSNRPKI
FT                   AAVDFLTYGSADFSFAPYGLYWKFMKKLCMSELLSGRRLDQFYHIRCTEIKWFMQSIME
FT                   KAEAGEEIDVREELIRVTNNVISTMTMSLRCSDSENEAGEVKRLVQEVAELTGKFNLSD
FT                   FIWFCKNLDLQGFGKRLKEVHERFDSMIEKIMREHEEARKKEMGGGGDAAKDVLDILLD
FT                   ISEDQSSEIKLTRENIKAFILDIFAAGTDTSAITTEWALAELINNPNIMEKARQEIDSV
FT                   VGKNKLVEESDIANLPYLQAIVKETLRLHPTGPLIVRESSEDCTIGGYDIPAGTRLFVN
FT                   VWAIGRDPNHWENPLEFQPERFVNEDGTLKSQLEVRGQHFYLLPFGSGRRGCPGTSLAL
FT                   QVVQTSLAAMIQCFEWKVRDGGNGTLNMEEGPGLTLPRAHPLICVPVARLHLFP"
FT   3'UTR           1213328..1213355
FT                   /locus_tag="VIT_08s0007g07710"
FT                   /old_locus_tag="Vv08s0007g07710"
FT   gene            1221940..1225827
FT                   /locus_tag="VIT_08s0007g07700"
FT                   /old_locus_tag="Vv08s0007g07700"
FT   mRNA            join(1221940..1222260,1222261..1222633,1224471..1224555,
FT                   1224672..1224841,1225051..1225325,1225505..1225681,
FT                   1225682..1225827)
FT                   /locus_tag="VIT_08s0007g07700"
FT                   /old_locus_tag="Vv08s0007g07700"
FT                   /product="Predicted protein"
FT   5'UTR           1221940..1222260
FT                   /locus_tag="VIT_08s0007g07700"
FT                   /old_locus_tag="Vv08s0007g07700"
FT   CDS_pept        join(1222261..1222633,1224471..1224555,1224672..1224841,
FT                   1225051..1225325,1225505..1225681)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07700"
FT                   /old_locus_tag="Vv08s0007g07700"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR019149"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5BLQ0"
FT                   /protein_id="CCB55180.1"
FT                   /translation="MVTVNLGMLHHILDHVYGAFMHRTKISPPFFSRGWGGAKLDLLER
FT                   MIKQLFPEAAENWPPSLIQPIWKTVWETKTACLREGVFKTPCDERLLSALPPESHTARV
FT                   AFLTPKFVPPQKMACVVHLAGTGDHTFERRLRLGGPLLKENIATMVLESPFYGQRRPVL
FT                   QRGAKLLCVSDLLLLGRATIEEARSLLHWLDSEAGFGKMGVCGLSMGGVHAAMVGSLHP
FT                   TPVATLPFLSPHSAVVAFCEGILKHATAWEALREDLAVQKAAMTLEDVRERMRNVLSLT
FT                   DVTRFPIPKNPNAVIFVAATDDGYIPKHSVLELQKAWPGSEVRWVTGGHVSSFILHNGE
FT                   FRRAIVDGLDRLQWKESPS"
FT   3'UTR           1225682..1225827
FT                   /locus_tag="VIT_08s0007g07700"
FT                   /old_locus_tag="Vv08s0007g07700"
FT   gene            1232220..1233562
FT                   /locus_tag="VIT_08s0007g07690"
FT                   /old_locus_tag="Vv08s0007g07690"
FT   mRNA            join(1232220..1232228,1232229..1233226,1233369..1233405,
FT                   1233406..1233562)
FT                   /locus_tag="VIT_08s0007g07690"
FT                   /old_locus_tag="Vv08s0007g07690"
FT                   /product="Polygalacturonase inhibiting protein"
FT   5'UTR           1232220..1232228
FT                   /locus_tag="VIT_08s0007g07690"
FT                   /old_locus_tag="Vv08s0007g07690"
FT   CDS_pept        join(1232229..1233226,1233369..1233405)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07690"
FT                   /old_locus_tag="Vv08s0007g07690"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR013210"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:F6HL98"
FT                   /protein_id="CCB55181.1"
FT                   /translation="METSKLFLLSSSLLLVLLATRPCPSLSERCNPKDKKVLLQIKKAL
FT                   DNPYILASWNPNTDCCGWYCVECDLTTHRINSLTIFSGQLSGQIPDAVGDLPFLETLIF
FT                   RKLSNLTGQIPPAIAKLKHLKMVRLSWTNLSGPVPAFFSELKNLTYLDLSFNNLSGPIP
FT                   GSLSLLPNLGALHLDRNHLTGPIPDSFGKFAGSTPGLHLSHNQLSGKIPYSFRGFDPNV
FT                   MDLSRNKLEGDLSIFFNANKSTQIVDFSRNLFQFDLSRVEFPKSLTSLDLSHNKIAGSL
FT                   PEMMTSLDLQFLNVSYNRLCGKIPVGGKLQSFDYDSYFHNRCLCGAPLQSCKITRNIIN
FT                   KKEK"
FT   3'UTR           1233406..1233562
FT                   /locus_tag="VIT_08s0007g07690"
FT                   /old_locus_tag="Vv08s0007g07690"
FT   gene            1241073..1247088
FT                   /locus_tag="VIT_08s0007g07680"
FT                   /old_locus_tag="Vv08s0007g07680"
FT   mRNA            join(1241073..1241200,1241201..1241497,1242032..1242304,
FT                   1246543..1246689,1246690..1247088)
FT                   /locus_tag="VIT_08s0007g07680"
FT                   /old_locus_tag="Vv08s0007g07680"
FT                   /product="unknown predicted protein"
FT   5'UTR           1241073..1241200
FT                   /locus_tag="VIT_08s0007g07680"
FT                   /old_locus_tag="Vv08s0007g07680"
FT   CDS_pept        join(1241201..1241497,1242032..1242304,1246543..1246689)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07680"
FT                   /old_locus_tag="Vv08s0007g07680"
FT                   /product="unknown"
FT                   /db_xref="GOA:Q107W9"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:Q107W9"
FT                   /protein_id="CCB55182.1"
FT                   /translation="MGVIKAAIGDGVLTFMWVFCVSTVGIFTSLISSALGVQALPLAAI
FT                   FITTVLIFVLVFVFSAIGDVLGGASFNPTATAALYAAGVTPDSLISMAFRFPAQAAGAV
FT                   GGALAIMEVMPTQYKHMLGGPSLKVDLHTGAIAEGILTFTISFLVLLVVLKGPKSPVLK
FT                   TWLLAMATVTLVVSGSAYTGPSMNPANAFGWAYINNWHNTWDQLYVYWICPFIGAILAA
FT                   WVFRFLFPAPTKQKKA"
FT   3'UTR           1246690..1247088
FT                   /locus_tag="VIT_08s0007g07680"
FT                   /old_locus_tag="Vv08s0007g07680"
FT   gene            1249267..1251366
FT                   /locus_tag="VIT_08s0007g07670"
FT                   /old_locus_tag="Vv08s0007g07670"
FT   mRNA            join(1249267..1249325,1249326..1249488,1249596..1249915,
FT                   1250314..1250838,1250839..1251366)
FT                   /locus_tag="VIT_08s0007g07670"
FT                   /old_locus_tag="Vv08s0007g07670"
FT                   /product="NAC domain protein NAC5"
FT   5'UTR           1249267..1249325
FT                   /locus_tag="VIT_08s0007g07670"
FT                   /old_locus_tag="Vv08s0007g07670"
FT   CDS_pept        join(1249326..1249488,1249596..1249915,1250314..1250838)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07670"
FT                   /old_locus_tag="Vv08s0007g07670"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLA0"
FT                   /db_xref="InterPro:IPR003441"
FT                   /db_xref="InterPro:IPR036093"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLA0"
FT                   /protein_id="CCB55183.1"
FT                   /translation="MDNPQSTLPPGFRFHPTDEELILHYLSKKVTSTPFPVSIIADVDI
FT                   YKFDPWELPGKAVFGEKEWYFFSPRDRKYPNGLRPNRAAASGYWKATGTDKTIVAASSI
FT                   GGGGHGHIGVKKALVFYQGRPPKGIKTNWIMHEYRLAQPPNPAINKPPLKLRDASMRLD
FT                   NWVLCRIYKKSNAVPPATAAAIDDDREQEDSFMEESLKSHPNQSTIQPQKPSSFSNILD
FT                   AMDSSTLGHLFSDIQYSDPTGFEPTPPAKYGSLGQSNDILPKLPYWKSVPSMENQLKRQ
FT                   RSSMDGDVPCPSKKLTSSCTFTTNPNQSDLPQSYFNQSLFNQALLLNPYFPFQG"
FT   3'UTR           1250839..1251366
FT                   /locus_tag="VIT_08s0007g07670"
FT                   /old_locus_tag="Vv08s0007g07670"
FT   gene            1254136..1256417
FT                   /locus_tag="VIT_08s0007g07660"
FT                   /old_locus_tag="Vv08s0007g07660"
FT   mRNA            join(1254136..1254254,1254255..1254869,1254985..1255107,
FT                   1255952..1256180,1256344..1256417)
FT                   /locus_tag="VIT_08s0007g07660"
FT                   /old_locus_tag="Vv08s0007g07660"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           1254136..1254254
FT                   /locus_tag="VIT_08s0007g07660"
FT                   /old_locus_tag="Vv08s0007g07660"
FT   CDS_pept        join(1254255..1254869,1254985..1255107,1255952..1256180,
FT                   1256344..1256417)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07660"
FT                   /old_locus_tag="Vv08s0007g07660"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLA1"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="InterPro:IPR040249"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLA1"
FT                   /protein_id="CCB55184.1"
FT                   /translation="MEFPFGHHHHTHHHRPEYGAGEEEEYLQPPPPPPLIHPPPPPPAY
FT                   FHGEDEPPPPAYFYGEDEPPPPRAQVHHISHADPPRPPPSSHVHHISHVEDQGFGRENY
FT                   THEGPPYARPPPVSYSASAPVRHVSHHLNPQQPQGTEQVETHHLHHLPGFLHHHNEAHG
FT                   VGSNLSNKPTVRVFCKAKPNHSLTILDGKVYLAPSNKTDMLQHWIKDEKYSTSVKDEEG
FT                   FPSFALVNKATGQAMKHSIGASHPVQLIPYNPDVLDESVLWTESKDLGDNFRSIRMINN
FT                   IHLNVDALHGDRSHGSVHDCTTIVLNKWKKGDNQLWKISLYFENPFPSQLTQSIPLSLN
FT                   LSLCEC"
FT   gene            1258457..1258660
FT                   /locus_tag="VIT_08s0007g07650"
FT                   /old_locus_tag="Vv08s0007g07650"
FT   mRNA            1258457..1258660
FT                   /locus_tag="VIT_08s0007g07650"
FT                   /old_locus_tag="Vv08s0007g07650"
FT   CDS_pept        1258457..1258660
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07650"
FT                   /old_locus_tag="Vv08s0007g07650"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI40"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI40"
FT                   /protein_id="CBI29916.3"
FT                   /translation="MVQIIGLILNVTFPPITMPNIYNALVVKGQDTINQQINMTCIVQQ
FT                   LLGNNRIRVVAMSSTYGLMRKG"
FT   gene            complement(1260875..1262593)
FT                   /locus_tag="VIT_08s0007g07640"
FT                   /old_locus_tag="Vv08s0007g07640"
FT   mRNA            complement(join(1260875..1260914,1260915..1261658,
FT                   1261862..1262142,1262241..1262427,1262428..1262593))
FT                   /locus_tag="VIT_08s0007g07640"
FT                   /old_locus_tag="Vv08s0007g07640"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(1260875..1260914)
FT                   /locus_tag="VIT_08s0007g07640"
FT                   /old_locus_tag="Vv08s0007g07640"
FT   CDS_pept        complement(join(1260915..1261658,1261862..1262142,
FT                   1262241..1262427))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07640"
FT                   /old_locus_tag="Vv08s0007g07640"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLA2"
FT                   /db_xref="InterPro:IPR003441"
FT                   /db_xref="InterPro:IPR036093"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLA2"
FT                   /protein_id="CCB55185.1"
FT                   /translation="MEEASLADQGDDLMDLPPGFRFHPTDEEIISYYLTERVMNSSFSA
FT                   RAIGEVDLNKCEPWDLPKKAKMGEKEWYFFCQRDRKYPTGMRTNRATESGYWKATGKDK
FT                   EIYKGKGCLVGMKKTLVFYRGRAPKGEKSNWVMHEYRLEGKFSYYNLPKAAKDEWVVCR
FT                   VFHKSAGIKRSLIPAPIRMNSFGDDLLDCSSLPPLIDPPYSNPNKNDSCFTNGEDEFKG
FT                   SSTRFSDGNHHYPYFSPTINGHQLQKQQDQKSFLLSPNNVHTTSNYQATLSNPTPNSIF
FT                   YPQVSPSNPLFPFQASPTPSYSHWQMGSSFPSFPGSGFKGSDPTSTVRAQTSGVQRQCK
FT                   VEQFSSNQSMVSLSQDTGLSTDMNTEISSVLSKHQDTGNNRSYEDLQGPSVGQIGDLDY
FT                   LLDY"
FT   5'UTR           complement(1262428..1262593)
FT                   /locus_tag="VIT_08s0007g07640"
FT                   /old_locus_tag="Vv08s0007g07640"
FT   gene            complement(1265702..1267911)
FT                   /locus_tag="VIT_08s0007g07630"
FT                   /old_locus_tag="Vv08s0007g07630"
FT   mRNA            complement(join(1265702..1265780,1266380..1267911))
FT                   /locus_tag="VIT_08s0007g07630"
FT                   /old_locus_tag="Vv08s0007g07630"
FT                   /product="Predicted protein"
FT   CDS_pept        complement(join(1265702..1265780,1266380..1267911))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07630"
FT                   /old_locus_tag="Vv08s0007g07630"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLA3"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLA3"
FT                   /protein_id="CCB55186.1"
FT                   /translation="MLLPRPLPPAKPNPSTTTRHLQLPTLTIPHNRTNKLIGVNPISTP
FT                   KSSHRLTLITGCTRDHNDIPISVTYGDHAAAPHEPPPVHRQTQGKNFWGAVSLIIGTAV
FT                   GPGMLGLPAATIRSGPLPSTISILLSWVYVISSIILVAELSFAAMEEDGVAEVSFTGLA
FT                   TKTLGNRFGAFVALVYASLSFSLLVACVSGIGSIVSQWFPWLNTIIAHALFPFAFGTVI
FT                   CFFPFKVIDAANRGLCVLMLFSISALVGIGLSIARNSIMGSFSRASWGLSSVLPAIPVT
FT                   VLTLGFHVITPFVCKIAGDTISEVRQAILIGGAVPLLMVLSWNLIVLGLAGTNPPTSGE
FT                   PISLLLSVHSSALSAVQGFAFSALATSLIGYAVSFPKQLVDTIELIFGTTFSDQQSCSQ
FT                   PQVGCYQEGIGRVGFAIYSSACDLGNVGKVSFFGSRCNPRSESKMMSRGVNFNSLNILV
FT                   IPLVLGVPVLLASFFHSTFSRALDFAGVYANCFLFGILPPVMTYIYQSRKISRLSILPG
FT                   GDFALLLLFGIAVVLGIWH"
FT   gap             1268246..1268345
FT                   /estimated_length=100
FT   gap             1269360..1269459
FT                   /estimated_length=100
FT   gene            1275394..1277341
FT                   /locus_tag="VIT_08s0007g07620"
FT                   /old_locus_tag="Vv08s0007g07620"
FT   mRNA            join(1275394..1275606,1275607..1275882,1276032..1276208,
FT                   1276334..1276498,1276725..1277036,1277037..1277341)
FT                   /locus_tag="VIT_08s0007g07620"
FT                   /old_locus_tag="Vv08s0007g07620"
FT                   /product="Predicted protein"
FT   5'UTR           1275394..1275606
FT                   /locus_tag="VIT_08s0007g07620"
FT                   /old_locus_tag="Vv08s0007g07620"
FT   CDS_pept        join(1275607..1275882,1276032..1276208,1276334..1276498,
FT                   1276725..1277036)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07620"
FT                   /old_locus_tag="Vv08s0007g07620"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI43"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI43"
FT                   /protein_id="CBI29919.3"
FT                   /translation="MAQILSKTSVFSPCHHHHRRCCVSAFPNNDYGHHRSAAPASARGF
FT                   PSLKLKHRNLRSLSSSSSNSDFHGGRIVLQEIGSMPKRRNAQASCTLMGLAIGKAQKWW
FT                   EKGLQPNMKEVTGAQDLVDSLLNAGDKLVVVDFFSPGCGGCRALHPKICQLAEMNPDVE
FT                   FLQVNYEEHKSMCYSLNVHVLPFFRFYRGAHGRLCSFSCTNATIKKFKDALAKHTPDRC
FT                   SLEPTKGLEEKELLALSANKDFSFNYSPKPVPTPAQEEIAVEATSAAAFSNEELPLPLP
FT                   LPLSLPLPSTSLKGFHDSEVKEKTVAMI"
FT   3'UTR           1277037..1277341
FT                   /locus_tag="VIT_08s0007g07620"
FT                   /old_locus_tag="Vv08s0007g07620"
FT   gene            1288457..1295554
FT                   /locus_tag="VIT_08s0007g07610"
FT                   /old_locus_tag="Vv08s0007g07610"
FT   mRNA            join(1288457..1288571,1291257..1291903,1291904..1291949,
FT                   1294202..1294242,1294335..1295342,1295343..1295554)
FT                   /locus_tag="VIT_08s0007g07610"
FT                   /old_locus_tag="Vv08s0007g07610"
FT                   /product="Predicted protein"
FT   5'UTR           1288457..1288571
FT                   /locus_tag="VIT_08s0007g07610"
FT                   /old_locus_tag="Vv08s0007g07610"
FT   CDS_pept        join(1291904..1291949,1294202..1294242,1294335..1295342)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07610"
FT                   /old_locus_tag="Vv08s0007g07610"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI44"
FT                   /protein_id="CBI29920.3"
FT                   /translation="MLKFNLGEFATSSMGGSRSEAFWLPHSNERRYTARASATSHSFGS
FT                   PSSLPESCQWELSTKQSLSLPNRNSSGRRSFMSKPVYPLVFRNPVSDCEAFGDAERPSL
FT                   GRLTPSDDRIPPSHWPDSNSSTEHKFHRSLTELQKLETSPDPSASSRREGFRWSSASSF
FT                   DMGFDGETFDMAEHMDVESQRSPVCPVGDQRCGICGKLLWQKSPWSSHRIMRGSDMPIA
FT                   GILPCSHVFHAECLEQMTPKAQIHDPPCPMCLKTIGTLEESPAVSEPLQMALRTVRRSR
FT                   GVVISGGQGNHRNDEASCNDNDKESVRRKWLWTVPRPNGGSGSLLKNHLKKHFKFKGKM
FT                   GQDFFNRKVFCRNGNGASSSTSVQ"
FT   3'UTR           1295343..1295554
FT                   /locus_tag="VIT_08s0007g07610"
FT                   /old_locus_tag="Vv08s0007g07610"
FT   gene            complement(1296982..1299109)
FT                   /locus_tag="VIT_08s0007g07600"
FT                   /old_locus_tag="Vv08s0007g07600"
FT   mRNA            complement(join(1296982..1296988,1296989..1297801,
FT                   1297880..1298341,1298718..1298945,1298946..1299109))
FT                   /locus_tag="VIT_08s0007g07600"
FT                   /old_locus_tag="Vv08s0007g07600"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(1296982..1296988)
FT                   /locus_tag="VIT_08s0007g07600"
FT                   /old_locus_tag="Vv08s0007g07600"
FT   CDS_pept        complement(join(1296989..1297801,1297880..1298341,
FT                   1298718..1298945))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07600"
FT                   /old_locus_tag="Vv08s0007g07600"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLA4"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLA4"
FT                   /protein_id="CCB55187.1"
FT                   /translation="MEGGGGWKRPKTKIVCTLGPASRSVEVIEKLLRAGMNVARFNFSH
FT                   GSHAYHQQTLDNLRTAMANTETLCAVMLDTKGPEIRTGFLKDGKPVQLKKGQEITISTD
FT                   YSIKGDDHMICMSYQKLAEDLRPQSVILCADGTITLTVLACDKELGLARCRCENSAVLG
FT                   ERKNVNLPGVVVDLPTLTEKDKEDILEWGVPNKIDMIALSFVRKGSDLVEVRMLLAEHA
FT                   KSILLMSKVENQEGVANFDEILANSDAFMVARGDLGMEIPIEKIFLAQKVMIYKCNIQG
FT                   KPVVTATQMLESMIKSPRPTRAEATDVANAVLDGTDCVMLSGETAAGAYPELAVQTMAR
FT                   ICLEAENSLNYGDVFKTIMETAPMPMSPIESLASSAVRAANGSKAALILVLTRGGTTAN
FT                   LVAKYRPSMPILSVVVPEITADSFDWSCSDESPARHGLIFRGLVPVLCSGSAKASDSES
FT                   TEEALEFSLQYAKTKEMCKPGDSVVALHRVGTASVIKILTVK"
FT   5'UTR           complement(1298946..1299109)
FT                   /locus_tag="VIT_08s0007g07600"
FT                   /old_locus_tag="Vv08s0007g07600"
FT   gene            complement(1300466..1305449)
FT                   /locus_tag="VIT_08s0007g07590"
FT                   /old_locus_tag="Vv08s0007g07590"
FT   mRNA            complement(join(1300466..1300631,1300632..1300756,
FT                   1301298..1301343,1302799..1302857,1305004..1305055,
FT                   1305169..1305219,1305322..1305393,1305394..1305449))
FT                   /locus_tag="VIT_08s0007g07590"
FT                   /old_locus_tag="Vv08s0007g07590"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(1300466..1300631)
FT                   /locus_tag="VIT_08s0007g07590"
FT                   /old_locus_tag="Vv08s0007g07590"
FT   CDS_pept        complement(join(1300632..1300756,1301298..1301343,
FT                   1302799..1302857,1305004..1305055,1305169..1305219,
FT                   1305322..1305393))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07590"
FT                   /old_locus_tag="Vv08s0007g07590"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI46"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI46"
FT                   /protein_id="CBI29922.3"
FT                   /translation="MAADSKPPNNSRCHHCAGPLSKDMETSAWTVPPFIRDSFSMIGTA
FT                   VGGIASAFYGFNYVMPIVQKRVKGPMWLHFLVGAPPVIVFSSTCAGLAGGAVPAVAQLA
FT                   SSSYHAVVMSRRLPPPSSQDDKMHKTGTAL"
FT   5'UTR           complement(1305394..1305449)
FT                   /locus_tag="VIT_08s0007g07590"
FT                   /old_locus_tag="Vv08s0007g07590"
FT   gene            1312236..1315377
FT                   /locus_tag="VIT_08s0007g07580"
FT                   /old_locus_tag="Vv08s0007g07580"
FT   mRNA            join(1312236..1312378,1312468..1312470,1312471..1312681,
FT                   1312775..1312851,1313232..1313289,1313438..1313510,
FT                   1313622..1313688,1314364..1314697,1314893..1315134,
FT                   1315135..1315377)
FT                   /locus_tag="VIT_08s0007g07580"
FT                   /old_locus_tag="Vv08s0007g07580"
FT                   /product="unknown predicted protein"
FT   5'UTR           1312236..1312378
FT                   /locus_tag="VIT_08s0007g07580"
FT                   /old_locus_tag="Vv08s0007g07580"
FT   CDS_pept        join(1312471..1312681,1312775..1312851,1313232..1313289,
FT                   1313438..1313510,1313622..1313688,1314364..1314697,
FT                   1314893..1315134)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07580"
FT                   /old_locus_tag="Vv08s0007g07580"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLA5"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="InterPro:IPR025756"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLA5"
FT                   /protein_id="CCB55188.1"
FT                   /translation="MYHHHHHQGKNIHPSSRTPITPERNLFLQGGNGPGDSGLVLSTDA
FT                   KPRLKWTPDLHERFIEAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNL
FT                   HGQANSATSKTVVGERMPEANGALMSSPNIGNQTNKSLHLSETLQMIEAQRRLHEQLEV
FT                   QRHLQLRIEAQGKYLQAVLEKAQETLGRQNLGAVGLEAAKVQLSELVSKVSTQCLHSAF
FT                   SELKELQSLCPQQTQTQPTDCSMDSCLTSCEGSQREQEIHNCGMGLRPYTNGNGSNSYS
FT                   EGRFKGRAEADNFVDRTNHGADSGNSVKQENEKMSHGYRLPCFGAKLDLNAHDENDVTL
FT                   SCKQFDLNGFSWN"
FT   3'UTR           1315135..1315377
FT                   /locus_tag="VIT_08s0007g07580"
FT                   /old_locus_tag="Vv08s0007g07580"
FT   gene            1317915..1334153
FT                   /locus_tag="VIT_08s0007g07570"
FT                   /old_locus_tag="Vv08s0007g07570"
FT   mRNA            join(1317915..1317921,1317922..1318014,1318085..1318216,
FT                   1320125..1320262,1320769..1320819,1321369..1321458,
FT                   1321539..1321685,1321911..1322021,1323332..1323382,
FT                   1323890..1324627,1325940..1326110,1327198..1327363,
FT                   1327872..1328014,1328184..1328462,1328554..1328688,
FT                   1328778..1328959,1333955..1334021,1334022..1334153)
FT                   /locus_tag="VIT_08s0007g07570"
FT                   /old_locus_tag="Vv08s0007g07570"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           1317915..1317921
FT                   /locus_tag="VIT_08s0007g07570"
FT                   /old_locus_tag="Vv08s0007g07570"
FT   CDS_pept        join(1317922..1318014,1318085..1318216,1320125..1320262,
FT                   1320769..1320819,1321369..1321458,1321539..1321685,
FT                   1321911..1322021,1323332..1323382,1323890..1324627,
FT                   1325940..1326110,1327198..1327363,1327872..1328014,
FT                   1328184..1328462,1328554..1328688,1328778..1328959,
FT                   1333955..1334021)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07570"
FT                   /old_locus_tag="Vv08s0007g07570"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI48"
FT                   /db_xref="InterPro:IPR007207"
FT                   /db_xref="InterPro:IPR007282"
FT                   /db_xref="InterPro:IPR012270"
FT                   /db_xref="InterPro:IPR038635"
FT                   /db_xref="InterPro:IPR040168"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI48"
FT                   /protein_id="CBI29924.3"
FT                   /translation="MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKVYDTDNANQKEKFE
FT                   ADLKKEIKKLQRYRDQIKTWIQSSEIKDKKVSASYEQALLDARKLIEREMERFKICEKE
FT                   TKTKAFSKEGLGQQPKTDPKEKAKSETRDWLNTVVGELESQIDSFEAEIEGLSVKKGKT
FT                   RPPRLTHLETSIARHKAHIMKLELILRLLDNDELSPEQVNDVKDFLDDYVERNQEDFEE
FT                   FSDVDDLYNSLPLDKVESLEDLVTIGAPGLVKGAPALSLKNSLTPTQIPATVTSPLQQS
FT                   TSIQEQSEETASQDSNSEIGPRTPPAKNSVIGSSASSTPTGSHATPIPLNVSAHNLSAS
FT                   PAPTILPSSTSVRGVLENAGTAISSPVNVSSSAKEEEIASFPGRRSSPALVETGLVRGI
FT                   GRGVPSSQPSTSVPLSSGITIPSNGGLGAVPSANDMSKRSTLGADERLGGGGMVQPLVS
FT                   PLSNRMILPQTAKTNDGTGLADSSSVGEAAVIAGRVFSPSVVPGMQWRPGSSFQNQNES
FT                   GQFRGRTEITLDQKEKFLQRLQQVQQQTQSTILGMPPLSGGNHKQFSAQQQNPLLQQFN
FT                   SQSSSVSPQVGLGVGVQAPGLNTVTSAAIQQQPGSIHQQSNQQALLSTGPKDADVGHVK
FT                   AEDQQQQQNVSDDSTMESAPSSLGKNLMNEDDLKAPYAMDTSAGVSGSLTEPSQVPRDT
FT                   DLSPGQPVQSNQPSGSLGVIGRRSISDLGAIGDTLSGSAVNSGGMHDQLYNLQMLEAAF
FT                   YKLPQPKDSERARNYTPRHPAVTPPSYPQVQAPIVNNPAFWERLGLDTFGTDTLFFAFY
FT                   YQQNTYQQYLAAKELKKQSWRYHRKYNTWFQRHEEPKVATDEFEQGTYVYFDFHIANDD
FT                   LQHGWCQRIKTEFTFEYNYLEDELIV"
FT   3'UTR           1334022..1334153
FT                   /locus_tag="VIT_08s0007g07570"
FT                   /old_locus_tag="Vv08s0007g07570"
FT   gene            1337280..1340881
FT                   /locus_tag="VIT_08s0007g07560"
FT                   /old_locus_tag="Vv08s0007g07560"
FT   mRNA            join(1337280..1337726,1337812..1337971,1337972..1338306,
FT                   1339709..1340813,1340814..1340881)
FT                   /locus_tag="VIT_08s0007g07560"
FT                   /old_locus_tag="Vv08s0007g07560"
FT                   /product="unknown predicted protein"
FT   5'UTR           1337280..1337726
FT                   /locus_tag="VIT_08s0007g07560"
FT                   /old_locus_tag="Vv08s0007g07560"
FT   CDS_pept        join(1337972..1338306,1339709..1340813)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07560"
FT                   /old_locus_tag="Vv08s0007g07560"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5BTD4"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR012946"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A5BTD4"
FT                   /protein_id="CBI29926.3"
FT                   /translation="MVRRLWFFSWVLLVGLFGCASVEGLGVNWGTMASHKLPPKVVVQM
FT                   LKDNGIQKVKLFDADSVTMSALAGSGIEVMVAIPNDQLAVMNDYDRAKAWVRRNVTRYN
FT                   FNGGVTIKYVGVGNEPFLSSYNGSFLNITLPALQNIQNALNEAGVGDSIKATVPLNADV
FT                   YNSPESNPVPSAGRFRTDISELMTQIVQFLNKNNAPFTVNIYPFLSLYGNDNFPFDYAF
FT                   FDGVSNPIVDNGISYTNVFDANFDTLVSALKAVGLGDMTILVGEVGWPTDGDKNANSNN
FT                   AYRFYNGLLPRLAGNIGTPLRPGYIEVYLFGLIDEDAKSIAPGNFERHWGIFKYDGQPK
FT                   YALDLSGQGQNKLLVAAKDVTYLPQKWCMFNPNAGDLSKLGDNINYACTFSDCTALGYG
FT                   SSCNGLDAQGNASYAFNMYFQVKNQDDLSCYFQGLAKVTTQNISQGSCNFIVQIESSSS
FT                   SLWQPSLVASAFVMVLAFLVL"
FT   3'UTR           1340814..1340881
FT                   /locus_tag="VIT_08s0007g07560"
FT                   /old_locus_tag="Vv08s0007g07560"
FT   gene            complement(1346777..1348343)
FT                   /locus_tag="VIT_08s0007g07550"
FT                   /old_locus_tag="Vv08s0007g07550"
FT   mRNA            complement(join(1346777..1346900,1346901..1347671,
FT                   1348099..1348227,1348228..1348343))
FT                   /locus_tag="VIT_08s0007g07550"
FT                   /old_locus_tag="Vv08s0007g07550"
FT                   /product="Predicted protein"
FT   3'UTR           complement(1346777..1346900)
FT                   /locus_tag="VIT_08s0007g07550"
FT                   /old_locus_tag="Vv08s0007g07550"
FT   CDS_pept        complement(join(1346901..1347671,1348099..1348227))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07550"
FT                   /old_locus_tag="Vv08s0007g07550"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLA6"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLA6"
FT                   /protein_id="CCB55189.1"
FT                   /translation="MDFYREVSVSGEYPQEQVPSTVCSKLGGLSAGSLDDLFSTQNTEV
FT                   DVSLEWLSIFVEDCLSSTGNCLPAPKNVASDSATPKPSKPLQSMQKPQQKPSSPLQNLV
FT                   IPGKARSKRKRATTITTSFSNWVHHLNPENQNLHITSSDPPLLQQAYWLADSELIVPKK
FT                   EESSSNNNNNNNSMVKEEEEVEEEEEEEEEEEETREEVEVEVEKGNKERWGNLEGSNGQ
FT                   PRRCTHCLAQRTPQWRAGPLGPKTLCNACGVRYKSGRLLPEYRPAKSPTFVSYKHSNSH
FT                   KKVMEMRMAVLSSIPSDQ"
FT   5'UTR           complement(1348228..1348343)
FT                   /locus_tag="VIT_08s0007g07550"
FT                   /old_locus_tag="Vv08s0007g07550"
FT   gene            complement(1351471..1358453)
FT                   /locus_tag="VIT_08s0007g07540"
FT                   /old_locus_tag="Vv08s0007g07540"
FT   mRNA            complement(join(1351471..1351678,1351679..1351804,
FT                   1352131..1352214,1354776..1354857,1356316..1356407,
FT                   1356584..1356658,1357164..1357218,1358065..1358114,
FT                   1358115..1358453))
FT                   /locus_tag="VIT_08s0007g07540"
FT                   /old_locus_tag="Vv08s0007g07540"
FT                   /product="Predicted protein"
FT   3'UTR           complement(1351471..1351678)
FT                   /locus_tag="VIT_08s0007g07540"
FT                   /old_locus_tag="Vv08s0007g07540"
FT   CDS_pept        complement(join(1351679..1351804,1352131..1352214,
FT                   1354776..1354857,1356316..1356407,1356584..1356658,
FT                   1357164..1357218,1358065..1358114))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07540"
FT                   /old_locus_tag="Vv08s0007g07540"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI52"
FT                   /protein_id="CBI29928.3"
FT                   /translation="MDELACFRGLVLDLSYRPVNVVCWRRAICLEFMEKADVLEYYDQT
FT                   VNSPSGSFYIPAVLRVPHLLQVVKRRRIKNNLSRKNIFYRDNFTCQYCSSGENLTVDHV
FT                   LPIARGGEWKWENLVTACAKCNSKKGQKTLEEANMKLSKVPKAPKDYDILAIPLTNTAI
FT                   RMLRMRKGTPEEWRQYLSKPSAEP"
FT   5'UTR           complement(1358115..1358453)
FT                   /locus_tag="VIT_08s0007g07540"
FT                   /old_locus_tag="Vv08s0007g07540"
FT   gene            complement(1358892..1359815)
FT                   /locus_tag="VIT_08s0007g07530"
FT                   /old_locus_tag="Vv08s0007g07530"
FT   mRNA            complement(join(1358892..1358962,1358963..1359739,
FT                   1359740..1359815))
FT                   /locus_tag="VIT_08s0007g07530"
FT                   /old_locus_tag="Vv08s0007g07530"
FT                   /product="Predicted protein"
FT   3'UTR           complement(1358892..1358962)
FT                   /locus_tag="VIT_08s0007g07530"
FT                   /old_locus_tag="Vv08s0007g07530"
FT   CDS_pept        complement(1358963..1359739)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07530"
FT                   /old_locus_tag="Vv08s0007g07530"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLA7"
FT                   /protein_id="CCB55190.1"
FT                   /translation="MATPLPLQDRIAIVTGASRGIGRATALHLASLGAKIVINYTSNKA
FT                   QAELVAAEINSSSSPSSPRAIICQADVSDPTQVKSLFDTAEQIFNSPPHILVNSAGVLD
FT                   AKYPTIANTSLEDFDKIFSINSRGAFLCCREAANRIKRGGAGRIILMSTSLVGSLKPGF
FT                   GAYAASKAAVETMAKIMAKELKGTGITVNCVAPGPIATDMFFSGKSEEDVKKAIEDSPL
FT                   SRLGETKDVASVVGFLASDGGEWVNGQVVRVNGGYV"
FT   5'UTR           complement(1359740..1359815)
FT                   /locus_tag="VIT_08s0007g07530"
FT                   /old_locus_tag="Vv08s0007g07530"
FT   gene            complement(1371449..1372888)
FT                   /locus_tag="VIT_08s0007g07520"
FT                   /old_locus_tag="Vv08s0007g07520"
FT   mRNA            complement(join(1371449..1371564,1371565..1372388,
FT                   1372552..1372567,1372568..1372597,1372676..1372888))
FT                   /locus_tag="VIT_08s0007g07520"
FT                   /old_locus_tag="Vv08s0007g07520"
FT                   /product="Predicted protein"
FT   3'UTR           complement(1371449..1371564)
FT                   /locus_tag="VIT_08s0007g07520"
FT                   /old_locus_tag="Vv08s0007g07520"
FT   CDS_pept        complement(join(1371565..1372388,1372552..1372567))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07520"
FT                   /old_locus_tag="Vv08s0007g07520"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLA8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLA8"
FT                   /protein_id="CCB55191.1"
FT                   /translation="MKKLFLVVVVAESGMDDPVPTSSSLPLEGRVAIVTGASRGIGRAI
FT                   AIHLRSLGARLVLNYASNSALADALASQLNSPDSSSSHPVAIAVQANVSDPDQVKMLFD
FT                   RAQQEFGSIHILVNCAGVLDPKYPSLANTTVEDWDNTFSINTRGSFLVCREAANRLIRG
FT                   GGGRIILITTSAVAALTPGYAAYAASKAAVETMTKILAKELKGTSVTANCVAPGPIATE
FT                   MFFEGKSEELIKRLVDACPMGRLGEPKDVTQLVGFLATDAGEWINGQIIRINGGFAV"
FT   5'UTR           complement(1372676..1372888)
FT                   /locus_tag="VIT_08s0007g07520"
FT                   /old_locus_tag="Vv08s0007g07520"
FT   gene            complement(1372889..1375858)
FT                   /locus_tag="VIT_08s0007g07510"
FT                   /old_locus_tag="Vv08s0007g07510"
FT   mRNA            complement(1372889..1375858)
FT                   /locus_tag="VIT_08s0007g07510"
FT                   /old_locus_tag="Vv08s0007g07510"
FT                   /product="Predicted protein"
FT   CDS_pept        complement(1372889..1375858)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07510"
FT                   /old_locus_tag="Vv08s0007g07510"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLA9"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR032867"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLA9"
FT                   /protein_id="CCB55192.1"
FT                   /translation="MEERGIRANVQTYLWLFEGCFNSGSLLDAKKLHARIFKSGFDGED
FT                   VLGSRLIDIYLAHGEVDNAIKLFDDIPSSNVSFWNKVISGLLAKKLASQVLGLFSLMIT
FT                   ENVTPDESTFASVLRACSGGKAPFQVTEQIHAKIIHHGFGSSPLVCNPLIDLYSKNGHV
FT                   DLAKLVFERLFLKDSVSWVAMISGLSQNGREDEAILLFCQMHKSAVIPTPYVFSSVLSA
FT                   CTKIELFKLGEQLHGFIVKWGLSSETFVCNALVTLYSRWGNLIAAEQIFSKMHRRDRIS
FT                   YNSLISGLAQRGFSDRALQLFEKMQLDCMKPDCVTVASLLSACASVGAGYKGKQLHSYV
FT                   IKMGMSSDLIIEGSLLDLYVKCFDIETAHEYFLTTETENVVLWNVMLVAYGQLGNLSES
FT                   YWIFLQMQIEGLMPNQYTYPSILRTCTSLGALDLGEQIHTQVIKSGFQFNVYVCSVLID
FT                   MYAKHGELDTARGILQRLREEDVVSWTAMIAGYTQHDLFAEALKLFQEMENQGIRSDNI
FT                   GFSSAISACAGIQALNQGQQIHAQSYISGYSEDLSIGNALVSLYARCGRAQDAYLAFEK
FT                   IDAKDNISWNALISGFAQSGHCEEALQVFSQMNQAGVEANLFTFGSAVSATANTANIKQ
FT                   GKQIHAMMIKTGYDSETEASNVLITLYSKCGSIEDAKREFFEMPEKNVVSWNAMITGYS
FT                   QHGYGSEAVSLFEEMKQLGLMPNHVTFVGVLSACSHVGLVNEGLSYFRSMSKEHGLVPK
FT                   PEHYVCVVDLLGRAALLCCAREFIEEMPIEPDAMIWRTLLSACTVHKNIEIGEFAARHL
FT                   LELEPEDSATYVLLSNMYAVSGKWDYRDRTRQMMKDRGVKKEPGRSWIEVKNSIHAFFV
FT                   GDRLHPLAEQIYEYIDDLNERAGEIGYVQDRYNLLNDVEQEQKDPTAYIHSEKLAVAFG
FT                   LLSLTNTMPIRVIKNLRVCNDCHNWIKFVSKISNRAIVVRDAYRFHHFEGGVCSCKDYW
FT                   "
FT   gene            1376569..1381781
FT                   /locus_tag="VIT_08s0007g07500"
FT                   /old_locus_tag="Vv08s0007g07500"
FT   mRNA            join(1376569..1376570,1376571..1376616,1376704..1376775,
FT                   1376876..1377066,1380061..1380124,1380524..1380780,
FT                   1380914..1380952,1381363..1381473,1381474..1381781)
FT                   /locus_tag="VIT_08s0007g07500"
FT                   /old_locus_tag="Vv08s0007g07500"
FT                   /product="Predicted protein"
FT   5'UTR           1376569..1376570
FT                   /locus_tag="VIT_08s0007g07500"
FT                   /old_locus_tag="Vv08s0007g07500"
FT   CDS_pept        join(1376571..1376616,1376704..1376775,1376876..1377066,
FT                   1380061..1380124,1380524..1380780,1380914..1380952,
FT                   1381363..1381473)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07500"
FT                   /old_locus_tag="Vv08s0007g07500"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI56"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR024610"
FT                   /db_xref="InterPro:IPR028651"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI56"
FT                   /protein_id="CBI29932.3"
FT                   /translation="MAIARTGVFVDDYLDYASTLPAELQRLLNTIRELDERSQSMINQT
FT                   RQQTKYCLGLSSQSSKKGNPEEDEVAFEKMRKDIEANQDNALSLCTEKVLLAQQAFDLI
FT                   DSHVKRLDEDLTNFAEDLKQEGKISPDEPAILPPLPIVPKNEKRKFLYGTPQPKRVDYR
FT                   DRDWDRERDRDFELMPPPGSHRKDFAAPLDVDQPIDPNEPTYCVCHQVSFGDMIACDNE
FT                   NCQGGEWFHYSCVGLTPETRFKGKWYCPTCRLLPQPC"
FT   3'UTR           1381474..1381781
FT                   /locus_tag="VIT_08s0007g07500"
FT                   /old_locus_tag="Vv08s0007g07500"
FT   gene            1383714..1385712
FT                   /locus_tag="VIT_08s0007g07490"
FT                   /old_locus_tag="Vv08s0007g07490"
FT   mRNA            join(1383714..1383723,1383724..1385061,1385203..1385712)
FT                   /locus_tag="VIT_08s0007g07490"
FT                   /old_locus_tag="Vv08s0007g07490"
FT                   /product="Predicted protein"
FT   5'UTR           1383714..1383723
FT                   /locus_tag="VIT_08s0007g07490"
FT                   /old_locus_tag="Vv08s0007g07490"
FT   CDS_pept        join(1383724..1385061,1385203..1385712)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07490"
FT                   /old_locus_tag="Vv08s0007g07490"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLB0"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLB0"
FT                   /protein_id="CCB55193.1"
FT                   /translation="MGRNLSPIVRRELANLDKDADSRKSAMKALKSYVKDLDSTAIPLF
FT                   LAQVSETKEPGSSYGEYTISLYELLARVHGPNIIPQIDNIMTTIIKTLSLRAASFALHQ
FT                   ACSKVLPAIARYGIDPTTPEDKKRHIIHSLCKPLSDCLLGSHESLSSGAALCLKALVDS
FT                   DNWRFASDDMVNEVCQNVAGALEDSPTQTNTHMSLVMALAKHNSLIVEAYARLLIQSGL
FT                   RILNAGIDEANSQKRLSAIQMVNFLMKCLDPRSIFSELGLIIKEMENCQSDQMAYVRGA
FT                   AYEALQTARRVVSEKGSKFDKDMGLFAGSNVVRGDHIQRKNLLSNGDQSPFSGSPESQT
FT                   LDSFVEYESLIESPISTRQVSRNLDYDRGSANRKLWRYGNGGVDVSLKDGLFSELSKGN
FT                   GVSAAFSEHSRHEDLTNKRGDYTDEFAGFVQRTPRNRVLRSTTPSPQRLRSQINVDNVN
FT                   IYTTPRKLVHSLQDSNFSEKQNRRLRSPSPSKYEWSPSVNYGQSGFSHDMNYEVGENGN
FT                   LSSGGGGDQSQGDSESVSSTEDVPTEANVQVSHEVIPGDTIDTQGVGMVGMVGMVGMKK
FT                   AGEKISFKLVYGLIFLLFATLVSLLWVDTQDGGYNLVPT"
FT   gene            complement(1386068..1387779)
FT                   /locus_tag="VIT_08s0007g07480"
FT                   /old_locus_tag="Vv08s0007g07480"
FT   mRNA            complement(join(1386068..1386163,1386164..1386358,
FT                   1386781..1387254,1387528..1387779))
FT                   /locus_tag="VIT_08s0007g07480"
FT                   /old_locus_tag="Vv08s0007g07480"
FT                   /product="Predicted protein"
FT   3'UTR           complement(1386068..1386163)
FT                   /locus_tag="VIT_08s0007g07480"
FT                   /old_locus_tag="Vv08s0007g07480"
FT   CDS_pept        complement(join(1386164..1386358,1386781..1387254,
FT                   1387528..1387779))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07480"
FT                   /old_locus_tag="Vv08s0007g07480"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI58"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI58"
FT                   /protein_id="CBI29934.3"
FT                   /translation="MGLENGSLASLMLPSGLITSYKAPMWHGGTLEVLHTTVTEEDSGA
FT                   VIQGGVSLALECESDGGISWSPSSWILQDVRGNAEELIQVEMVSSDSENMAEAKYIVTL
FT                   QQDIISSEIVISNLKSLPLQLTGSVISHLTVSNLDATYAIGLEGSNFFSRTPFLSNFGL
FT                   IPPDFGQKNEVGSSQLWGQPGIRRFLSGSNAKNQNNADQVERIKKEEMEGEEEDNYKQL
FT                   SSEMSRIYTSAPRNFTVIDRGRRNSVVVGRDGFKELYMFSPGSTHECYSKYTYICVGQS
FT                   AVLKPIILGPEDVWRGGQHLHNPNL"
FT   gene            complement(1388409..1390893)
FT                   /locus_tag="VIT_08s0007g07470"
FT                   /old_locus_tag="Vv08s0007g07470"
FT   mRNA            complement(join(1388409..1388571,1388572..1388766,
FT                   1389243..1389683,1390314..1390745,1390746..1390893))
FT                   /locus_tag="VIT_08s0007g07470"
FT                   /old_locus_tag="Vv08s0007g07470"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(1388409..1388571)
FT                   /locus_tag="VIT_08s0007g07470"
FT                   /old_locus_tag="Vv08s0007g07470"
FT   CDS_pept        complement(join(1388572..1388766,1389243..1389683,
FT                   1390314..1390745))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07470"
FT                   /old_locus_tag="Vv08s0007g07470"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI59"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI59"
FT                   /protein_id="CBI29935.3"
FT                   /translation="MASSLLSFSLPKSNLIKACSSPPTATSTLSIPDTLDQKFGRKGIK
FT                   FLESGNVPLVELTVRNGSSLRLRIPDGLVTSYKPKVNWKDDGFEEVLYTLPAAASDSTK
FT                   PKGGIGLVINDVSDPASKLSPLSTEWAVKDVDSDAIDALQVELSCTSGTLDITYVVSLY
FT                   PESMATAVLVNNNGRKPVSLTSAMLSHFKFKRRGGAAVQGLKGCSYCSHPPLSSPFEIL
FT                   SPAEAMKTESPGWFSFDSESEKKRGSWTVQDDPYIILKNKLSRVYTTPPTERLKEFYDT
FT                   PPSKYETIDQGRELFFRVIRIGYEDIYLSSPGSLSEKYGKDYFICTGPASILVPVVVNP
FT                   GEGWRAAQVIEHDNL"
FT   5'UTR           complement(1390746..1390893)
FT                   /locus_tag="VIT_08s0007g07470"
FT                   /old_locus_tag="Vv08s0007g07470"
FT   gene            complement(1391652..1398894)
FT                   /locus_tag="VIT_08s0007g07460"
FT                   /old_locus_tag="Vv08s0007g07460"
FT   mRNA            complement(join(1391652..1391935,1391936..1392001,
FT                   1392458..1392515,1393237..1393449,1394208..1394302,
FT                   1394438..1394560,1394673..1394750,1394828..1394900,
FT                   1395738..1395871,1396276..1396353,1397727..1397888,
FT                   1397981..1398127,1398228..1398490,1398681..1398828,
FT                   1398829..1398894))
FT                   /locus_tag="VIT_08s0007g07460"
FT                   /old_locus_tag="Vv08s0007g07460"
FT                   /product="Predicted protein"
FT   3'UTR           complement(1391652..1391935)
FT                   /locus_tag="VIT_08s0007g07460"
FT                   /old_locus_tag="Vv08s0007g07460"
FT   CDS_pept        complement(join(1391936..1392001,1392458..1392515,
FT                   1393237..1393449,1394208..1394302,1394438..1394560,
FT                   1394673..1394750,1394828..1394900,1395738..1395871,
FT                   1396276..1396353,1397727..1397888,1397981..1398127,
FT                   1398228..1398490,1398681..1398828))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07460"
FT                   /old_locus_tag="Vv08s0007g07460"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI60"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012721"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI60"
FT                   /protein_id="CBI29936.3"
FT                   /translation="MGFQMQPYGVQSMLKEGHKHLSGLEEAVLKNIDACKQLSVITRTS
FT                   LGPNGMNKMVINHLDKIFVTNDAATIVNELEVQHPAAKILVLASKAQQEEIGDGANLTI
FT                   SFAGELLQNAEELIRMGLHPSEIISGYSKAINKTVEILEELVEKGSEKMDVRNKEQVIS
FT                   RMKAAVASKQFGQEDILCPLIADACIQVCPKNPVNFNVDNVRVAKLLGGGLHNCTVVRG
FT                   MALKTDAVGSIKRVEKAKVAVFASGVDTSATETKGTVLIHSAEQLENYAKTEEAKIEEL
FT                   IKAVADSGAKVIVSGGAVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVAVLKLSQ
FT                   PNPDDLGYVDSVSVEEIGGVRVTIVKNEEGGNSVCTVVLRGSTDSILDDLERAVDDGVN
FT                   TYKAMCRDSRIVPGAAATEIELARKLKEFSFKETGLDQYAIAKFAESFEMVPKTLAENA
FT                   GLNAMEIISSLYAEHSTGNTKVGIDLDQGVVCKDVSTMNVWDLYITKYFALKYAADAAC
FT                   TVLRVDQIIMAKPAGGPKRDPAAGMDED"
FT   5'UTR           complement(1398829..1398894)
FT                   /locus_tag="VIT_08s0007g07460"
FT                   /old_locus_tag="Vv08s0007g07460"
FT   gene            complement(1401826..1406857)
FT                   /locus_tag="VIT_08s0007g07450"
FT                   /old_locus_tag="Vv08s0007g07450"
FT   mRNA            complement(join(1401826..1402268,1402269..1402511,
FT                   1402735..1402893,1402991..1403203,1403296..1403883,
FT                   1404340..1404921,1405815..1405864,1405948..1406092,
FT                   1406192..1406268,1406749..1406776,1406777..1406857))
FT                   /locus_tag="VIT_08s0007g07450"
FT                   /old_locus_tag="Vv08s0007g07450"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(1401826..1402268)
FT                   /locus_tag="VIT_08s0007g07450"
FT                   /old_locus_tag="Vv08s0007g07450"
FT   CDS_pept        complement(join(1402269..1402511,1402735..1402893,
FT                   1402991..1403203,1403296..1403883,1404340..1404921,
FT                   1405815..1405864,1405948..1406092,1406192..1406268,
FT                   1406749..1406776))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07450"
FT                   /old_locus_tag="Vv08s0007g07450"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI61"
FT                   /db_xref="InterPro:IPR007275"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI61"
FT                   /protein_id="CBI29937.3"
FT                   /translation="MATVAPPSDQAADLLQKLSLDPQAKSLEVSEQAKKFVSVDSGDLA
FT                   NGLGKPFERSATHLHQDFVDPNMCYLPNGYPSTYYFAPGYDGQMNEWGDGVEMPPGVYG
FT                   DIYHHGFGYPYGTYPPPGSPVPTMGHDGQLYGPQHYQYPTPYYQPQAPNGGPYAPSQVT
FT                   APQGDVSTSVAPDQVPLSVEAAKGNTNNLVNGGNVNGNNGPKALRPSHQNSSLSSNGSY
FT                   GRASLPTGVPSSGYQDPRFGFDGTRSLIPSADMFSEGQSKHVASVGFSSPVSHANNFPS
FT                   GRNQNFRPIPQLMHARAASGLGQASGFMSRMYPNNRMYDQYGNAFRTGSGFGSNGYDSR
FT                   TSGRGWLTVDSRYRNKSRANSVLGYGNENMDGLNELNRGPRAKGFKNQKGFGPVTLAVR
FT                   GQNLQLNGNNSNSDGNLTLVPDKEQYNSEDFPENYSDAKFFIIKSYSEDDVHKSIKYNM
FT                   WASTANGNKKLDAAYQEAQGKSGSCPIFLLFSVNASGQFVGVAEMVGSVDFNRSLEYWQ
FT                   QDKWTGCFPVKWHVIKDIPNSLLKHITLENNENKPVTNSRDTQEVKFEQGIQVLKIFKN
FT                   HSSKTTILDDFGFYEARQRTMQEKKAKQQLFQKQARILVRDVKPTDGVATDDKDRLHQS
FT                   VDVASSLIKEPTGPVKANGELKALEEIGSAAVADDAPKSAKPDVLSEKRVVPNGVANAC
FT                   "
FT   5'UTR           complement(1406777..1406857)
FT                   /locus_tag="VIT_08s0007g07450"
FT                   /old_locus_tag="Vv08s0007g07450"
FT   gene            1411047..1417030
FT                   /locus_tag="VIT_08s0007g07440"
FT                   /old_locus_tag="Vv08s0007g07440"
FT   mRNA            join(1411047..1411193,1411903..1412021,1412022..1413775,
FT                   1413862..1414024,1415774..1415937,1416034..1416292,
FT                   1416376..1416483,1416484..1417030)
FT                   /locus_tag="VIT_08s0007g07440"
FT                   /old_locus_tag="Vv08s0007g07440"
FT                   /product="unknown predicted protein"
FT   5'UTR           1411047..1411193
FT                   /locus_tag="VIT_08s0007g07440"
FT                   /old_locus_tag="Vv08s0007g07440"
FT   CDS_pept        join(1412022..1413775,1413862..1414024,1415774..1415937,
FT                   1416034..1416292,1416376..1416483)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07440"
FT                   /old_locus_tag="Vv08s0007g07440"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLB1"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033133"
FT                   /db_xref="InterPro:IPR033712"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLB1"
FT                   /protein_id="CCB55194.1"
FT                   /translation="MEEGKAEQEVDELEILLNLIPNATSGSWHPQNSIQKYSSTDFERN
FT                   HLHEKTRESFPPPPALSFGKQGNSFEGTCDGKIETYGRLDGDRLGLEGDHQTPIKIMDQ
FT                   EESNLPSEQSLSSSLAELSFKGEEAIKAANSQRLDHTFLLDDQFANLLKDSLPLSPQSH
FT                   SILTRTNTEDIPPNRFDQFNVEMNGKHNVDFLKLDDQVQGEKAVSCQLLAYQTNPSQVL
FT                   LTVSSPGTKVPDVPCSQSYFSSLQSPVLGMQSQEFTESHIPWLHAEEERYSIMHKKYLH
FT                   WHDLQNQRSEARNLIQASENAANVIRTWNIEKSYVNNPISYQYENFSEESFQSDGAIPR
FT                   RFGCSGSNLISSILCRYYAQGFCGRGENCPFTHGQRKKCPISFANPQPALSPKDFNVVQ
FT                   GFGKMGEQSYPEKILMRKNGLNSVKEINFIRESELFTNSSSNGRMISNGHFYHNAHIVG
FT                   TRSSPVDGRKYWPQPLDTKDSRHDNLRLQTRKYNSVDEVTGRIYLMAKDQSGCRFLQRK
FT                   MTEGNAEDIEKIFLEIVGHVVELMTHPFGNYLVQKLLEVCSEDQRTQIVFAITAKAGDL
FT                   LTVSINMHGTRSVQKVIETIKSPEQFLMVVASLKPGIVNLIKDLNGYHVAECCLQHLMP
FT                   GYIEFLFEAVSAHCVELATDCHGCRVLQKCLGHSDGEHRLRLLSAIIANALILSQDPFG
FT                   NYVVQYVFELEGSWARTEVLNQLEGYYRYLSMQKYSSNVVEKCLKYAGEERFARIIQEF
FT                   MDHPQLDQMMLDPYANYVIQTALNHSKGALHAALLEAIRPHIPALRTNPYGKKVLSSCG
FT                   LKK"
FT   3'UTR           1416484..1417030
FT                   /locus_tag="VIT_08s0007g07440"
FT                   /old_locus_tag="Vv08s0007g07440"
FT   gene            complement(1417536..1420088)
FT                   /locus_tag="VIT_08s0007g07430"
FT                   /old_locus_tag="Vv08s0007g07430"
FT   mRNA            complement(join(1417536..1417726,1417727..1417987,
FT                   1418879..1419169,1419632..1420078,1420079..1420088))
FT                   /locus_tag="VIT_08s0007g07430"
FT                   /old_locus_tag="Vv08s0007g07430"
FT                   /product="Galactose-1-phosphate uridylyltransferase"
FT   3'UTR           complement(1417536..1417726)
FT                   /locus_tag="VIT_08s0007g07430"
FT                   /old_locus_tag="Vv08s0007g07430"
FT   CDS_pept        complement(join(1417727..1417987,1418879..1419169,
FT                   1419632..1420078))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07430"
FT                   /old_locus_tag="Vv08s0007g07430"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5C6V7"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A5C6V7"
FT                   /protein_id="CCB55195.1"
FT                   /translation="MAGRDPEIRKDTVTNRWVVFSPARARRPSDFKSKDSANPNHTQSE
FT                   CPFCSGHEHECAPEIFRFPPDSTVDWKIRVIQNLYPALSRDVQLNPSSDGMVLTGFGFH
FT                   DVVIESPVHAVHLSDLSPSEVAEVLLAYKKRIHQLSFHQSVKYIQVFKNHGASAGASMS
FT                   HSHSQIMALPIVPPTVSSRLDCMKGYFEETGKCSVCEMSVKDLLIDESTHYISIIPFAA
FT                   TFPFEIWIVPRDHSPHFHEIDSEKAVDLGGLLKLMLQKMSLQLNSPPFNFMIHTSPLQV
FT                   TDSLLSYTHWFLQIVPQLTGIGGFELGTGCYINPVFPEDAAKVLREVNLPK"
FT   5'UTR           complement(1420079..1420088)
FT                   /locus_tag="VIT_08s0007g07430"
FT                   /old_locus_tag="Vv08s0007g07430"
FT   gene            1423903..1431778
FT                   /locus_tag="VIT_08s0007g07420"
FT                   /old_locus_tag="Vv08s0007g07420"
FT   mRNA            join(1423903..1424161,1424932..1424986,1424987..1425403,
FT                   1425787..1425912,1425999..1426072,1426165..1426234,
FT                   1426318..1426373,1426474..1426545,1426670..1426764,
FT                   1426983..1427049,1427130..1427259,1427347..1427565,
FT                   1427653..1427783,1429488..1429662,1429758..1429848,
FT                   1430579..1430736,1430847..1431035,1431402..1431461,
FT                   1431462..1431778)
FT                   /locus_tag="VIT_08s0007g07420"
FT                   /old_locus_tag="Vv08s0007g07420"
FT                   /product="unknown predicted protein"
FT   5'UTR           1423903..1424161
FT                   /locus_tag="VIT_08s0007g07420"
FT                   /old_locus_tag="Vv08s0007g07420"
FT   CDS_pept        join(1424987..1425403,1425787..1425912,1425999..1426072,
FT                   1426165..1426234,1426318..1426373,1426474..1426545,
FT                   1426670..1426764,1426983..1427049,1427130..1427259,
FT                   1427347..1427565,1427653..1427783,1429488..1429662,
FT                   1429758..1429848,1430579..1430736,1430847..1431035,
FT                   1431402..1431461)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07420"
FT                   /old_locus_tag="Vv08s0007g07420"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLB3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLB3"
FT                   /protein_id="CCB55196.1"
FT                   /translation="MPELRSGPRRSKRLDDLQPSPQPGDQAENWLLPAQNRPRRRVGGG
FT                   RGRGCNATPLAKGPSAAIATRPAAAGRGRGIRLIDLDPEPPCEVHPEAGALGVAEPAFN
FT                   RVDAVADKEIAMEGGSAEKIIGAEEEASTTPVPERVQVGNSPIYKIERKLGKGGFGQVY
FT                   VGRRVSGGTERTGPDALEVALKFEHRNSKGCNYGPPYEWQVYNTLNGCYGIPWVHYKGR
FT                   QGDYYILVMDMLGPSLWDLWNSVGQTMSPNMVACIAVEAISILEKLHMKGFVHGDVKPE
FT                   NFLLGQPGTADEKKLFLIDLGLASKWKDTTSGQHVDYDQRPDIFRGTIRYASVHAHLGR
FT                   TGSRRDDLESLAYTLIFLIKGRLPWQGYQGDNKSFLVCKKKMATSPELMCCFCPAPFKQ
FT                   FLEAVTNMKFDEEPNYPKLISLFENLIEPVQTRPIRIDGALKVVGQKRGRLLINLEEDE
FT                   QPKKKVRLGSPATQWISVYNARRPMKQRYHYNVADSRLPQHVEKGNEDGLHISCVASSS
FT                   NLWALIMDAGTGYSSQVYELSAVFLHKDWIMEQWEKNYYISSIAGAANGSSLVVMSKGT
FT                   PYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYTDQVVELDFLY
FT                   PSEGIHRRWECGYRITSMAATNDQAAFILSIPKRKMMDETQETLRTSAFPSTHVKEKWS
FT                   KNLYIAAICYGRTVC"
FT   3'UTR           1431462..1431778
FT                   /locus_tag="VIT_08s0007g07420"
FT                   /old_locus_tag="Vv08s0007g07420"
FT   gene            1433354..1435354
FT                   /locus_tag="VIT_08s0007g07410"
FT                   /old_locus_tag="Vv08s0007g07410"
FT   mRNA            join(1433354..1433403,1433404..1433536,1433694..1433842,
FT                   1433942..1434057,1435042..1435210,1435211..1435354)
FT                   /locus_tag="VIT_08s0007g07410"
FT                   /old_locus_tag="Vv08s0007g07410"
FT                   /product="unknown predicted protein"
FT   5'UTR           1433354..1433403
FT                   /locus_tag="VIT_08s0007g07410"
FT                   /old_locus_tag="Vv08s0007g07410"
FT   CDS_pept        join(1433404..1433536,1433694..1433842,1433942..1434057,
FT                   1435042..1435210)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07410"
FT                   /old_locus_tag="Vv08s0007g07410"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI65"
FT                   /db_xref="InterPro:IPR007504"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR038664"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI65"
FT                   /protein_id="CBI29941.3"
FT                   /translation="MRPPRGRGGGFRGRDGGRGGRFGGGRFGGGRGGFRDEGPPSEVVE
FT                   VSTFLHACEGDAVTRLTNAKIPYFNAPIYLQNKTQIGKVDEIFGPINESYFSIKMMEGI
FT                   VATSYSSGDKFFIDPAKLLPLERFLPQPKGHPQAAFRGGRGGGRGGGRGGGRGGGGFRG
FT                   RGGPRGGRGPPRGGRGGGFRGRGRS"
FT   3'UTR           1435211..1435354
FT                   /locus_tag="VIT_08s0007g07410"
FT                   /old_locus_tag="Vv08s0007g07410"
FT   gene            complement(1435851..1441627)
FT                   /locus_tag="VIT_08s0007g07400"
FT                   /old_locus_tag="Vv08s0007g07400"
FT   mRNA            complement(join(1435851..1436047,1436048..1436233,
FT                   1436490..1436576,1436657..1436732,1437317..1437567,
FT                   1437823..1437939,1438150..1438224,1438478..1438699,
FT                   1439067..1439180,1439967..1440100,1441125..1441302,
FT                   1441453..1441458,1441459..1441627))
FT                   /locus_tag="VIT_08s0007g07400"
FT                   /old_locus_tag="Vv08s0007g07400"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(1435851..1436047)
FT                   /locus_tag="VIT_08s0007g07400"
FT                   /old_locus_tag="Vv08s0007g07400"
FT   CDS_pept        complement(join(1436048..1436233,1436490..1436576,
FT                   1436657..1436732,1437317..1437567,1437823..1437939,
FT                   1438150..1438224,1438478..1438699,1439067..1439180,
FT                   1439967..1440100,1441125..1441302,1441453..1441458))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07400"
FT                   /old_locus_tag="Vv08s0007g07400"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLB4"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLB4"
FT                   /protein_id="CCB55197.1"
FT                   /translation="MTGFGDNLVGFCGTDSDSAAGFFTCNLYINIVCLWIRSRIWIWIW
FT                   IGLDYLSQPPDFSPIFGLYTVPRPTMNALVATNRNFKLAARLLGLDSKLEKSLLIPFRE
FT                   IKVECTIPKDDGTLASFVGFRVQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAV
FT                   ANIPYGGAKGGIGCNPGELSLSELERLTRVFTQKIHDLIGVSTDVPAPDMGTNPQTMAW
FT                   ILDEYSKFHGYSPAVVTGKPIDLGGSLGRDAATGRGVLFATEALLHEHGKSIAGQRFVI
FT                   QGFGNVGSWAAQLISEHGGKIVAVSDITGAIKNSKGIDIPSLLKHSVEHRGVKGFNGAD
FT                   PIDPKSILVEDCDVLIPAALGGVINRENANEIKAKFIIEAANHPTDPEADEILSKKGVV
FT                   ILPDIYANSGGVTVSYFEWVQNIQGFMWDEEKVNNELRTYMTRGFKDVKEMCRTHNCDL
FT                   RMGAFTLGVNRVARATVLRGWEA"
FT   5'UTR           complement(1441459..1441627)
FT                   /locus_tag="VIT_08s0007g07400"
FT                   /old_locus_tag="Vv08s0007g07400"
FT   gene            1445598..1446174
FT                   /locus_tag="VIT_08s0007g07390"
FT                   /old_locus_tag="Vv08s0007g07390"
FT   mRNA            join(1445598..1445667,1445668..1445835,1445923..1446024,
FT                   1446025..1446174)
FT                   /locus_tag="VIT_08s0007g07390"
FT                   /old_locus_tag="Vv08s0007g07390"
FT                   /product="Predicted protein"
FT   5'UTR           1445598..1445667
FT                   /locus_tag="VIT_08s0007g07390"
FT                   /old_locus_tag="Vv08s0007g07390"
FT   CDS_pept        join(1445668..1445835,1445923..1446024)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07390"
FT                   /old_locus_tag="Vv08s0007g07390"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLB5"
FT                   /protein_id="CCB55198.1"
FT                   /translation="MCPLRFILVFLSAVLAGYFAWSTVRSSQENALVSEDSCPQTTSSS
FT                   SKDKQELNFKTMVADGFWVFVDMASGRYLWRNLKGKCHEDVKNS"
FT   3'UTR           1446025..1446174
FT                   /locus_tag="VIT_08s0007g07390"
FT                   /old_locus_tag="Vv08s0007g07390"
FT   gene            complement(1446524..1449179)
FT                   /locus_tag="VIT_08s0007g07380"
FT                   /old_locus_tag="Vv08s0007g07380"
FT   mRNA            complement(join(1446524..1446639,1446640..1447257,
FT                   1447621..1447689,1448900..1449142,1449143..1449179))
FT                   /locus_tag="VIT_08s0007g07380"
FT                   /old_locus_tag="Vv08s0007g07380"
FT                   /product="Predicted protein"
FT   3'UTR           complement(1446524..1446639)
FT                   /locus_tag="VIT_08s0007g07380"
FT                   /old_locus_tag="Vv08s0007g07380"
FT   CDS_pept        complement(join(1446640..1447257,1447621..1447689,
FT                   1448900..1449142))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07380"
FT                   /old_locus_tag="Vv08s0007g07380"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLB6"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLB6"
FT                   /protein_id="CCB55199.1"
FT                   /translation="MQARLMVGPSSINGGGLISAAAKGMILLVDPRTRSHGHGRTAKCR
FT                   CRAAINGDQDHYAVLGLSRAASSVDIKRAYRLLARKYHPDVSKDSQAGEVFKSIRLAYE
FT                   ILSNEATRSQYDRALRFQEHTGWPWRGSQNYNHEFEDRIRTYRWADLRRKMQRERYWER
FT                   YNANGQNFSAYSETDEIFEEETPDEERGPFTEVLRSAFLSLFLMQTFGSQIALTFTALM
FT                   AFVDRKLDAGYKLGYLIAWILGGRGGILLTLCLSFASWVCGKTSSSVVTLVVVAMWVGS
FT                   NLARYAPLPQGALLTLLYMSIKLQVDLN"
FT   5'UTR           complement(1449143..1449179)
FT                   /locus_tag="VIT_08s0007g07380"
FT                   /old_locus_tag="Vv08s0007g07380"
FT   gene            1449329..1453676
FT                   /locus_tag="VIT_08s0007g07370"
FT                   /old_locus_tag="Vv08s0007g07370"
FT   mRNA            join(1449329..1449354,1450333..1450352,1450353..1450476,
FT                   1451234..1451383,1452027..1452145,1452246..1452330,
FT                   1453158..1453204,1453299..1453397,1453398..1453676)
FT                   /locus_tag="VIT_08s0007g07370"
FT                   /old_locus_tag="Vv08s0007g07370"
FT                   /product="Adenylyl-sulfate kinase"
FT   5'UTR           1449329..1449354
FT                   /locus_tag="VIT_08s0007g07370"
FT                   /old_locus_tag="Vv08s0007g07370"
FT   CDS_pept        join(1450353..1450476,1451234..1451383,1452027..1452145,
FT                   1452246..1452330,1453158..1453204,1453299..1453397)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07370"
FT                   /old_locus_tag="Vv08s0007g07370"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI69"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI69"
FT                   /protein_id="CBI29945.3"
FT                   /translation="MSTVGNSTNIFWQECPVGRAERQKLLNQKGCVLWITGLSGSGKST
FT                   LACTVGRELHSKGKLSYILDGDNLRHGLNRDLGFKAEDRTENIRRVGEVAKLFADAGLI
FT                   CIASLISPYRKDRDACRAMLPDANFIEVFMNMPLQLCEERDAKGLYKLARAGKIKGFTG
FT                   IDDPYEPPLNCEIEIQQKDGVCPSPNDMAGDVVTYLEEKGFLQY"
FT   3'UTR           1453398..1453676
FT                   /locus_tag="VIT_08s0007g07370"
FT                   /old_locus_tag="Vv08s0007g07370"
FT   gene            1454818..1455847
FT                   /locus_tag="VIT_08s0007g07360"
FT                   /old_locus_tag="Vv08s0007g07360"
FT   mRNA            join(1454818..1454921,1454922..1455137,1455138..1455847)
FT                   /locus_tag="VIT_08s0007g07360"
FT                   /old_locus_tag="Vv08s0007g07360"
FT                   /product="Predicted protein"
FT   5'UTR           1454818..1454921
FT                   /locus_tag="VIT_08s0007g07360"
FT                   /old_locus_tag="Vv08s0007g07360"
FT   CDS_pept        1454922..1455137
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07360"
FT                   /old_locus_tag="Vv08s0007g07360"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLB7"
FT                   /protein_id="CCB55200.1"
FT                   /translation="MVLNSTLIGRVAVVSADLCQYVACNPERLSPEHVLHLLFCFPFQQ
FT                   LRRLALCISAFFCSPSYPDDSDSHSD"
FT   3'UTR           1455138..1455847
FT                   /locus_tag="VIT_08s0007g07360"
FT                   /old_locus_tag="Vv08s0007g07360"
FT   gene            1455848..1462214
FT                   /locus_tag="VIT_08s0007g07350"
FT                   /old_locus_tag="Vv08s0007g07350"
FT   mRNA            join(1455848..1455868,1455992..1456054,1456561..1456647,
FT                   1457586..1457684,1458511..1458606,1458751..1458816,
FT                   1458912..1459002,1459241..1459308,1459404..1459469,
FT                   1460273..1460323,1460449..1460513,1461329..1461386,
FT                   1461387..1461411,1461922..1462214)
FT                   /locus_tag="VIT_08s0007g07350"
FT                   /old_locus_tag="Vv08s0007g07350"
FT                   /product="Predicted protein"
FT   CDS_pept        join(1455848..1455868,1455992..1456054,1456561..1456647,
FT                   1457586..1457684,1458511..1458606,1458751..1458816,
FT                   1458912..1459002,1459241..1459308,1459404..1459469,
FT                   1460273..1460323,1460449..1460513,1461329..1461386)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07350"
FT                   /old_locus_tag="Vv08s0007g07350"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLB8"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLB8"
FT                   /protein_id="CCB55201.1"
FT                   /translation="MAASAAQTASPGDVTTDAEVFQLIKDHQEKAARLPPLEEIRTVIN
FT                   HSVRGMLSTISQKYEGYPSGSMVDFACDQDGYPILAVSSLANHTKDLLANTKCSLLVAK
FT                   DPEDKTDLLITVHGDAVPVSEEDKGDIRTAYLTRHPNAFWVDFGDFQFMRIEPKVVRYV
FT                   SGIATALLGSEEFTKEAYTAAKVDPIAQFSKPVASHMNRDHAEDTKLIVQHVTSILVDS
FT                   AYMLDLDSLGFYVKATYRGNAFKLRIPFPRRAEDRKDVKTLVVEMLQAAKSQSN"
FT   3'UTR           join(1461387..1461411,1461922..1462214)
FT                   /locus_tag="VIT_08s0007g07350"
FT                   /old_locus_tag="Vv08s0007g07350"
FT   gene            complement(1467344..1469308)
FT                   /locus_tag="VIT_08s0007g07340"
FT                   /old_locus_tag="Vv08s0007g07340"
FT   mRNA            complement(join(1467344..1467678,1467679..1467729,
FT                   1467853..1467930,1468039..1468327,1468455..1468681,
FT                   1468682..1468683,1468839..1468975,1469104..1469308))
FT                   /locus_tag="VIT_08s0007g07340"
FT                   /old_locus_tag="Vv08s0007g07340"
FT                   /product="Predicted protein"
FT   3'UTR           complement(1467344..1467678)
FT                   /locus_tag="VIT_08s0007g07340"
FT                   /old_locus_tag="Vv08s0007g07340"
FT   CDS_pept        complement(join(1467679..1467729,1467853..1467930,
FT                   1468039..1468327,1468455..1468681))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07340"
FT                   /old_locus_tag="Vv08s0007g07340"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR012438"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI71"
FT                   /protein_id="CBI29947.3"
FT                   /translation="MEKEEKSQRTYKGPETDFFLQWGNRKRLRCVRVKDPNVSVRSNGA
FT                   IRRKITSRIDRSVVTGSEKESAHLQPSRFTRNTEGATLRSVTNENRKSGSSEKEDRYYT
FT                   TRGSAGMDDNGKVSVEGGGGGDDRGLVWPKLYISLSSKEKEEDFMAMKGCKLPQRPKKR
FT                   AKIIQRSLLLVSPGAWLSDMCQERYEVREKKTSKKRPRGLKAMGSMESDSE"
FT   5'UTR           complement(1469104..1469308)
FT                   /locus_tag="VIT_08s0007g07340"
FT                   /old_locus_tag="Vv08s0007g07340"
FT   gene            1472433..1472885
FT                   /locus_tag="VIT_08s0007g07330"
FT                   /old_locus_tag="Vv08s0007g07330"
FT   mRNA            join(1472433..1472480,1472481..1472663,1472664..1472885)
FT                   /locus_tag="VIT_08s0007g07330"
FT                   /old_locus_tag="Vv08s0007g07330"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           1472433..1472480
FT                   /locus_tag="VIT_08s0007g07330"
FT                   /old_locus_tag="Vv08s0007g07330"
FT   CDS_pept        1472481..1472663
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07330"
FT                   /old_locus_tag="Vv08s0007g07330"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLB9"
FT                   /db_xref="InterPro:IPR039281"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLB9"
FT                   /protein_id="CCB55202.1"
FT                   /translation="METMKMRVLLMGVVMVMMAASMVPNVAAADAPAPSPTSDTAAFVP
FT                   AALASVVALVFGFLF"
FT   3'UTR           1472664..1472885
FT                   /locus_tag="VIT_08s0007g07330"
FT                   /old_locus_tag="Vv08s0007g07330"
FT   gene            complement(1475828..1477021)
FT                   /locus_tag="VIT_08s0007g07320"
FT                   /old_locus_tag="Vv08s0007g07320"
FT   mRNA            complement(join(1475828..1476013,1476014..1476130,
FT                   1476247..1476930,1476942..1476971,1476972..1477021))
FT                   /locus_tag="VIT_08s0007g07320"
FT                   /old_locus_tag="Vv08s0007g07320"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(1475828..1476013)
FT                   /locus_tag="VIT_08s0007g07320"
FT                   /old_locus_tag="Vv08s0007g07320"
FT   CDS_pept        complement(join(1476014..1476130,1476247..1476930,
FT                   1476942..1476971))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07320"
FT                   /old_locus_tag="Vv08s0007g07320"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLC0"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLC0"
FT                   /protein_id="CCB55203.1"
FT                   /translation="MMGFLISVKTIFIRDSDPNSKGVFDMNYFICPTPKRETWVEPPPL
FT                   SPRLPKQLLPLQIRLDPPPIVDEEVVKHITKIPLQIEALPPPVIRVPSLEALKEADQDT
FT                   VSQVFFKKMKENEFVDMKMDSPKSGSRGILPQIEAGGFQFEEKDEKMENTHNPSKKNNL
FT                   GPAPGPDIKEDEEGSWTESSGRFNVWKWSLTGIGALCSFGVAATTICIIIFASSQRNKH
FT                   HQHNQRLRFQIITDDKRIKRVVHHATQLNEAFSAVRGVPLTRAHITFGGYYDGL"
FT   5'UTR           complement(1476972..1477021)
FT                   /locus_tag="VIT_08s0007g07320"
FT                   /old_locus_tag="Vv08s0007g07320"
FT   gene            1477022..1477314
FT                   /locus_tag="VIT_08s0007g07310"
FT                   /old_locus_tag="Vv08s0007g07310"
FT   mRNA            join(1477022..1477207,1477208..1477314)
FT                   /locus_tag="VIT_08s0007g07310"
FT                   /old_locus_tag="Vv08s0007g07310"
FT   CDS_pept        1477022..1477207
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07310"
FT                   /old_locus_tag="Vv08s0007g07310"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLE3"
FT                   /protein_id="CCB55204.1"
FT                   /translation="MEPGGAEETERGLKYELGVVNIHRSKKVGLECSVEFQATAMVTLV
FT                   TLGVKKIEATPLKGRG"
FT   3'UTR           1477208..1477314
FT                   /locus_tag="VIT_08s0007g07310"
FT                   /old_locus_tag="Vv08s0007g07310"
FT   gene            complement(1480396..1486170)
FT                   /locus_tag="VIT_08s0007g07300"
FT                   /old_locus_tag="Vv08s0007g07300"
FT   mRNA            complement(join(1480396..1480648,1480649..1481076,
FT                   1481353..1481477,1482343..1482524,1485940..1486101,
FT                   1486102..1486170))
FT                   /locus_tag="VIT_08s0007g07300"
FT                   /old_locus_tag="Vv08s0007g07300"
FT                   /product="Predicted protein"
FT   3'UTR           complement(1480396..1480648)
FT                   /locus_tag="VIT_08s0007g07300"
FT                   /old_locus_tag="Vv08s0007g07300"
FT   CDS_pept        complement(join(1480649..1481076,1481353..1481477,
FT                   1482343..1482524,1485940..1486101))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07300"
FT                   /old_locus_tag="Vv08s0007g07300"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLE4"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLE4"
FT                   /protein_id="CCB55205.1"
FT                   /translation="MATSVAWLLFLYIGAVSSLPGTLSSSVCPLQSDFLVAFLQSQCPL
FT                   SLSSHALLDVDGNFLDRALTSKQGNGFTSVLFHASWCPFSCKMRPKFEVLSSMFPQIEH
FT                   LAIKESSASPSMFSRYGIHSLPSILIVNQTSRMRYHGPKDLPSLVKFYRKTTGLEPVQY
FT                   FAEDQTISFEKSEGQSILQPWNGSYVKEIFTREPYLAFSILFFCLRVVLALFPGLLSQL
FT                   KAFWVLYVPHLNLEIFGETSQMLGRVLNMIDVQRVWAKLKLCKIRNFREGAKSARVWAS
FT                   SLASVSLGETSSSGSSS"
FT   5'UTR           complement(1486102..1486170)
FT                   /locus_tag="VIT_08s0007g07300"
FT                   /old_locus_tag="Vv08s0007g07300"
FT   gene            1487546..1492985
FT                   /locus_tag="VIT_08s0007g07290"
FT                   /old_locus_tag="Vv08s0007g07290"
FT   mRNA            join(1487546..1487584,1487585..1487731,1488572..1488667,
FT                   1488792..1488896,1489064..1489141,1492447..1492566,
FT                   1492649..1492780,1492781..1492985)
FT                   /locus_tag="VIT_08s0007g07290"
FT                   /old_locus_tag="Vv08s0007g07290"
FT                   /product="unknown predicted protein"
FT   5'UTR           1487546..1487584
FT                   /locus_tag="VIT_08s0007g07290"
FT                   /old_locus_tag="Vv08s0007g07290"
FT   CDS_pept        join(1487585..1487731,1488572..1488667,1488792..1488896,
FT                   1489064..1489141,1492447..1492566,1492649..1492780)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07290"
FT                   /old_locus_tag="Vv08s0007g07290"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI73"
FT                   /db_xref="InterPro:IPR001040"
FT                   /db_xref="InterPro:IPR019770"
FT                   /db_xref="InterPro:IPR023398"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI73"
FT                   /protein_id="CBI29949.3"
FT                   /translation="MEITEKKEAESKGLNPQSVTEATSFNSDKEAEDRERQARDLKAGL
FT                   HPLKHKFVFWYTRRTPGVRTQTSYEDNIKKIVDFSTVEGFWICYCHLARPSALPSPTDL
FT                   HLFKEGIRPLWEDSANCNGGKWIIRFKKVVSGRFWEDLVLALVGDQLDYGDNICGAVLS
FT                   IRFNEDILSVWNRNASDHQAVMALRDAIKRHLKLPHGYVMEYKAHDASLRDNSSYRNTW
FT                   LRG"
FT   3'UTR           1492781..1492985
FT                   /locus_tag="VIT_08s0007g07290"
FT                   /old_locus_tag="Vv08s0007g07290"
FT   gene            complement(1493678..1497141)
FT                   /locus_tag="VIT_08s0007g07280"
FT                   /old_locus_tag="Vv08s0007g07280"
FT   mRNA            complement(join(1493678..1493799,1493800..1493828,
FT                   1494008..1494061,1495648..1495723,1496031..1496062,
FT                   1496151..1496246,1496844..1496945,1497032..1497113,
FT                   1497114..1497141))
FT                   /locus_tag="VIT_08s0007g07280"
FT                   /old_locus_tag="Vv08s0007g07280"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(1493678..1493799)
FT                   /locus_tag="VIT_08s0007g07280"
FT                   /old_locus_tag="Vv08s0007g07280"
FT   CDS_pept        complement(join(1493800..1493828,1494008..1494061,
FT                   1495648..1495723,1496031..1496062,1496151..1496246,
FT                   1496844..1496945,1497032..1497113))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07280"
FT                   /old_locus_tag="Vv08s0007g07280"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI74"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI74"
FT                   /protein_id="CBI29950.3"
FT                   /translation="MGSVKAVAVIAGNANVRGSLHFIQDPAGSTHVKGRITGLTPGLHG
FT                   FHIHALGDTTNGCMSTGPHFNPLKKDHGAPTDKERHAGDLGNIVAGPDGVAEVSIKDMQ
FT                   ISLSGQHSILGRAVVVHADPDDLGRGGHELSKTTGNAGGRVGCGIIGLQSSA"
FT   5'UTR           complement(1497114..1497141)
FT                   /locus_tag="VIT_08s0007g07280"
FT                   /old_locus_tag="Vv08s0007g07280"
FT   gene            complement(1497937..1500856)
FT                   /locus_tag="VIT_08s0007g07270"
FT                   /old_locus_tag="Vv08s0007g07270"
FT   mRNA            complement(join(1497937..1498011,1498012..1498068,
FT                   1498442..1498656,1498910..1499271,1499889..1499950,
FT                   1500547..1500630,1500740..1500856))
FT                   /locus_tag="VIT_08s0007g07270"
FT                   /old_locus_tag="Vv08s0007g07270"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(1497937..1498011)
FT                   /locus_tag="VIT_08s0007g07270"
FT                   /old_locus_tag="Vv08s0007g07270"
FT   CDS_pept        complement(join(1498012..1498068,1498442..1498656,
FT                   1498910..1499271,1499889..1499950,1500547..1500630,
FT                   1500740..1500856))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07270"
FT                   /old_locus_tag="Vv08s0007g07270"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLE5"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLE5"
FT                   /protein_id="CCB55206.1"
FT                   /translation="MGEEKPKSKGVWPSVKPFVNGGASGMLATCVIQPVDMIKVRIQLG
FT                   QGSAVQVTKTMLQNEGIKAFYKGLSAGLLRQATYTTTRLGSFKVLTNKAVAANDGKPLP
FT                   LYQKALCGLTAGAVGATVGSPADLSLIRMQADATLPAAQRRNYKNAFDALYRIVADEGV
FT                   LALWKGAGPTVVRAMALNMGMLASYDQSVEFLKDSLGLGEASILVGASAVSGFFASAFS
FT                   LPFDYVKTQIQKMQPDASGKYPYTSSWDCAMKTLKSGGPLKFYTGFPVYCVRIAPHVML
FT                   TWIFLNQVQKLEESVGL"
FT   gene            1501727..1504332
FT                   /locus_tag="VIT_08s0007g07260"
FT                   /old_locus_tag="Vv08s0007g07260"
FT   mRNA            join(1501727..1501736,1501737..1501849,1502259..1502473,
FT                   1502545..1502744,1503413..1503921,1504027..1504330,
FT                   1504331..1504332)
FT                   /locus_tag="VIT_08s0007g07260"
FT                   /old_locus_tag="Vv08s0007g07260"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           1501727..1501736
FT                   /locus_tag="VIT_08s0007g07260"
FT                   /old_locus_tag="Vv08s0007g07260"
FT   CDS_pept        join(1501737..1501849,1502259..1502473,1502545..1502744,
FT                   1503413..1503921,1504027..1504330)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07260"
FT                   /old_locus_tag="Vv08s0007g07260"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI76"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR002452"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR023123"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI76"
FT                   /protein_id="CBI29952.3"
FT                   /translation="MREVISIHIGQAGIQVGNECWELFCLEHGIQSDGMMPSGTSNGAG
FT                   HDAFNTFFSETDAGKYVPRAVFVDLEPSVIDEVRTGVYKQLFHPEQLISGKEDAANNYA
FT                   RGHYTVGKDIVDLCLDRVRKLADVCSGLQGFLVFNAVGGGTGSGFGSLVLERLSADYGK
FT                   KSKLGFTIYPSPQVSTAVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDLERP
FT                   TYTNLNRLISQIISSITTSLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKV
FT                   YHEQLSVPEITTAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNASVANIKTKRT
FT                   VQFVDWCPTGFKCGINYQAPTAVPGAELAKVKRAVCMISNNTAVAEVFERITHKFDLMY
FT                   VKRAFVHWYVGEGMEEGEFSEAREDLATLEKDYEEVVAEAIDIEAEE"
FT   3'UTR           1504331..1504332
FT                   /locus_tag="VIT_08s0007g07260"
FT                   /old_locus_tag="Vv08s0007g07260"
FT   gene            complement(1504785..1505640)
FT                   /locus_tag="VIT_08s0007g07250"
FT                   /old_locus_tag="Vv08s0007g07250"
FT   mRNA            complement(join(1504785..1504785,1504786..1505568,
FT                   1505569..1505640))
FT                   /locus_tag="VIT_08s0007g07250"
FT                   /old_locus_tag="Vv08s0007g07250"
FT                   /product="unknown predicted protein"
FT   3'UTR           1504785..1504785
FT   CDS_pept        complement(1504786..1505568)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07250"
FT                   /old_locus_tag="Vv08s0007g07250"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI77"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="InterPro:IPR036955"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI77"
FT                   /protein_id="CBI29953.3"
FT                   /translation="MEIQFQQPKGAIPATKVRKFKGRNRSNSNNKFVGVRQRPSGRWVA
FT                   EIKDTTQKIRMWLGTFETAEEAARAYDEAACLLRGSNTRTNFIPNVSSNSPLASRIRTL
FT                   LDNKKGAKQPKQTSVDSSNISTTIVTPCASSCTSSGSNSLSSEKIQETQLFDDAYKPDL
FT                   SNCSEEVELGSSESGLSWGFAAGFDRFSFAQQVLDLPKNGGLQEAAEGEFSEFERMKVE
FT                   RQISASLYAMNGVQEYMDTVHDPSDALWDLPPLCSLFC"
FT   5'UTR           complement(1505569..1505640)
FT                   /locus_tag="VIT_08s0007g07250"
FT                   /old_locus_tag="Vv08s0007g07250"
FT   gene            complement(1507969..1517906)
FT                   /locus_tag="VIT_08s0007g07240"
FT                   /old_locus_tag="Vv08s0007g07240"
FT   mRNA            complement(join(1507969..1508498,1508499..1508663,
FT                   1509765..1509831,1509934..1510025,1510624..1510760,
FT                   1510851..1510917,1511012..1511078,1511173..1511258,
FT                   1512013..1512105,1512226..1512411,1512801..1512857,
FT                   1512975..1513102,1513197..1513266,1513356..1513491,
FT                   1513836..1513990,1514165..1514239,1514567..1514731,
FT                   1514824..1514889,1515081..1515185,1516167..1516370,
FT                   1516632..1517861,1517862..1517906))
FT                   /locus_tag="VIT_08s0007g07240"
FT                   /old_locus_tag="Vv08s0007g07240"
FT                   /product="Predicted protein"
FT   3'UTR           complement(1507969..1508498)
FT                   /locus_tag="VIT_08s0007g07240"
FT                   /old_locus_tag="Vv08s0007g07240"
FT   CDS_pept        complement(join(1508499..1508663,1509765..1509831,
FT                   1509934..1510025,1510624..1510760,1510851..1510917,
FT                   1511012..1511078,1511173..1511258,1512013..1512105,
FT                   1512226..1512411,1512801..1512857,1512975..1513102,
FT                   1513197..1513266,1513356..1513491,1513836..1513990,
FT                   1514165..1514239,1514567..1514731,1514824..1514889,
FT                   1515081..1515185,1516167..1516370,1516632..1517861))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07240"
FT                   /old_locus_tag="Vv08s0007g07240"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLE6"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR034085"
FT                   /db_xref="InterPro:IPR040122"
FT                   /db_xref="InterPro:IPR041653"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLE6"
FT                   /protein_id="CCB55207.1"
FT                   /translation="MASDPTPLQLNQIAAILGPDPVHFEALISHLMATANDQRSQAEAL
FT                   FNLCKQTHPDSLVLKLAILLQSSPHPEARAMAAILLRKQLTRDDSYLWPNLSATTQANL
FT                   KSILLDCVQRETAKTISKKLCDTVSELASGILPDGGWPELLPFMFQCVTSSNFKLQEAA
FT                   LLIFAQLSQYIGETLLPHLDTLHSVFLQSLASSMNSDVRIAALGAAINFIQCLSNAAER
FT                   DKFQDLLPLMMQTLTEALNSSQEATAQEALELLIELAGTEPRFLRRQLVEVVGSMLQIA
FT                   EAELLEEGTRHLAVEFVITLAEARERAPGMIRKLPQFIQRLFAILMKMLLDIEDDPVWH
FT                   SAEEEHEDAGETSNYSVGQECLDRLSISLGGNTIVPVASELLPAYLAAPEWQKHHAALI
FT                   ALAQIAEGCSKVMIKNLEQIVSMVLNSFQDPHPRVRWAAINAIGQLSTDLGPELQVKYH
FT                   QRLLPALAAAMDDFQNPRVQAHAASAVLNFSENCTPDILTPYLDGIVSKLLVLLQNGKQ
FT                   MVQEGALTALASVADSSQVHFQKYYDAVMPYLKAILVNANDKSNRMLRAKSMECISLVG
FT                   MAVGKEKFRDDAKQVMDVLMSLQGSQMEADDPTTSYMLQAWARLCKCLGQDFLPYMNVV
FT                   MPPLLQSAQLKPDVTITSADSDADIYDSDDDSIETITLGDKRIGIKTSVLEEKATACNM
FT                   LCCYADELKEGFFPWIDQVAPTLVPLLKFYFHEEVRKAAVSAMPELLRSAKLAVEKGQS
FT                   QGRNESYIKQLSDYIIPALVDALHKEPETEICASMLDSLNECIQISGPLLDEGQVRSIV
FT                   DEIKQVITASSSRKRERAERAKAEDFDAEEGELLKEENEQEEELFDQIGDCLGTLIKTF
FT                   KSSFLPFFDELSSYLMPMWGKDKTAEERRIAICIFDDVAEQCRESALKYYDTYLPFLLE
FT                   ACNDENPHVRQAAVYGIGVCAEFGGSAFKPLVGEALSRLDVVIRHSNARDSDNVMAYDN
FT                   AVSALGKICQFHRDSIDAVQIVPAWLSCLPLKGDLIEAKVVHDQLCSMVERSDRELLGP
FT                   NNQYLPKIVAVFAEVLCAGKDLATEETTSRMINLLRQLRQTLSPSALASTWSSLQPQQQ
FT                   LALQSILST"
FT   5'UTR           complement(1517862..1517906)
FT                   /locus_tag="VIT_08s0007g07240"
FT                   /old_locus_tag="Vv08s0007g07240"
FT   gene            1518885..1520413
FT                   /locus_tag="VIT_08s0007g07230"
FT                   /old_locus_tag="Vv08s0007g07230"
FT   mRNA            join(1518885..1519159,1519160..1519446,1519553..1520228,
FT                   1520229..1520413)
FT                   /locus_tag="VIT_08s0007g07230"
FT                   /old_locus_tag="Vv08s0007g07230"
FT                   /product="Predicted protein"
FT   5'UTR           1518885..1519159
FT                   /locus_tag="VIT_08s0007g07230"
FT                   /old_locus_tag="Vv08s0007g07230"
FT   CDS_pept        join(1519160..1519446,1519553..1520228)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07230"
FT                   /old_locus_tag="Vv08s0007g07230"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLE7"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLE7"
FT                   /protein_id="CCB55208.1"
FT                   /translation="MRNPASASTSKTPCCTKVGLKRGPWTPEEDELLANYVKREGEGRW
FT                   RTLPKRAGLLRCGKSCRLRWMNYLRPSVKRGQIAPDEEDLILRLHRLLGNRWSLIAGRI
FT                   PGRTDNEIKNYWNTHLSKKLISQGIDPRTHKPLNPKPNPSPDVNAPVSKSIPNANPNPS
FT                   SSRVGEIGSNHEVKEIESNENHKEPPNLDQYHSPLAADSNENWQSADGLVTGLQSTHGT
FT                   SNDDEDDIGFCNDDTFSSFLNSLINEDVFGNHNHHHQQQQQQQLQQLQQPSNVIAPLPH
FT                   PAISVQATFSSSPRTVWEPAALTSTSAPLVHDQKDSMSP"
FT   3'UTR           1520229..1520413
FT                   /locus_tag="VIT_08s0007g07230"
FT                   /old_locus_tag="Vv08s0007g07230"
FT   gene            complement(1524700..1528041)
FT                   /locus_tag="VIT_08s0007g07220"
FT                   /old_locus_tag="Vv08s0007g07220"
FT   mRNA            complement(join(1524700..1524902,1524903..1524957,
FT                   1525036..1525239,1525387..1525658,1527735..1527841,
FT                   1527981..1528041))
FT                   /locus_tag="VIT_08s0007g07220"
FT                   /old_locus_tag="Vv08s0007g07220"
FT                   /product="40S ribosomal protein S5"
FT   3'UTR           complement(1524700..1524902)
FT                   /locus_tag="VIT_08s0007g07220"
FT                   /old_locus_tag="Vv08s0007g07220"
FT   CDS_pept        complement(join(1524903..1524957,1525036..1525239,
FT                   1525387..1525658,1527735..1527841,1527981..1528041))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07220"
FT                   /old_locus_tag="Vv08s0007g07220"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLE8"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005716"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLE8"
FT                   /protein_id="CCB55209.1"
FT                   /translation="MYHIIVLCNNYDHVFAPLPIGLIRMAVEVADAAGGITNLQETTVK
FT                   LFNRWSFDEVQISDISLEDYIAVNPAKHATYVPHTAGRYSVKRFRKAQCPIVERLTNSL
FT                   MMHGRNNGKKLMAVRIIKHAMEIIHLLTEQNPIQVIVDAVINSGPREDATRIGSAGVVR
FT                   RQAVDISPLRRINQAIYLLTTGARESAFRNIKTIAECLADELINAAKGSSNSYAIKKKD
FT                   EIERVAKANR"
FT   gene            complement(1531831..1537307)
FT                   /locus_tag="VIT_08s0007g07210"
FT                   /old_locus_tag="Vv08s0007g07210"
FT   mRNA            complement(join(1531831..1532044,1532045..1532248,
FT                   1532929..1532978,1533540..1533611,1535827..1536025,
FT                   1537116..1537307))
FT                   /locus_tag="VIT_08s0007g07210"
FT                   /old_locus_tag="Vv08s0007g07210"
FT   3'UTR           complement(1531831..1532044)
FT                   /locus_tag="VIT_08s0007g07210"
FT                   /old_locus_tag="Vv08s0007g07210"
FT   CDS_pept        complement(join(1532045..1532248,1532929..1532978,
FT                   1533540..1533611,1535827..1536025,1537116..1537307))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07210"
FT                   /old_locus_tag="Vv08s0007g07210"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLE9"
FT                   /db_xref="InterPro:IPR000289"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR028626"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLE9"
FT                   /protein_id="CCB55210.1"
FT                   /translation="MTEVPRMFHLSRVAKGVISFTSSAYISKILGVSPSEAAVDLLNPH
FT                   VVVSLTGLFLLLFSSILRQCEMDAGVKHAVVVKVMGRTGSRGQVTQVRVKFLDDQNRFI
FT                   MRNVKGPVREGDILTLLESEREARRLRVPLLRSRRKCSKPLFFSSSSLFAEIAFLSGNS
FT                   SPASRTGLCKMESGVKHAVVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREG
FT                   DILTLLESEREARRLR"
FT   gene            1537716..1543257
FT                   /locus_tag="VIT_08s0007g07200"
FT                   /old_locus_tag="Vv08s0007g07200"
FT   mRNA            join(1537716..1537719,1537720..1537941,1539212..1539333,
FT                   1539441..1539587,1540080..1540305,1540551..1540624,
FT                   1541402..1541494,1541788..1541905,1542034..1542096,
FT                   1542720..1542752,1543029..1543103,1543104..1543257)
FT                   /locus_tag="VIT_08s0007g07200"
FT                   /old_locus_tag="Vv08s0007g07200"
FT                   /product="Predicted protein"
FT   5'UTR           1537716..1537719
FT                   /locus_tag="VIT_08s0007g07200"
FT                   /old_locus_tag="Vv08s0007g07200"
FT   CDS_pept        join(1537720..1537941,1539212..1539333,1539441..1539587,
FT                   1540080..1540305,1540551..1540624,1541402..1541494,
FT                   1541788..1541905,1542034..1542096,1542720..1542752,
FT                   1543029..1543103)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07200"
FT                   /old_locus_tag="Vv08s0007g07200"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI83"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI83"
FT                   /protein_id="CBI29959.3"
FT                   /translation="MELAFSPSSSLRISATTPHCDSSYLHRRIPINPACKSSVWLLKSP
FT                   ENPSSIGFHHRTGFPKPVSSTHFRRFSIWASTQVGAAGSDPPLNKFSVFKDACWRFLRP
FT                   HTIRGTALGSTALVARALIENPNLIKWSLLFKAFSGLLALICGNGYIVGINQIYDISID
FT                   KVNKPYLPIAAGDLSVQSAWFLVLFFAVAGVLIVGSNFGSFITSLYCLGLVLGTIYSVP
FT                   PFRMKRFPVAAFLIIATVRGFLLNFGVYYATRAALGLPFMWSAPVVFITTFVTLFALVI
FT                   AITKDLPDVEGDRKYQISTLATKLGVRNIAFLGSGLLLVNYIGSILAAIYMPQAFRLSL
FT                   MIPAHAILAAGLIFQARVLEQANYTKEAISDFYRFIWNLFYVEYIIFPFI"
FT   3'UTR           1543104..1543257
FT                   /locus_tag="VIT_08s0007g07200"
FT                   /old_locus_tag="Vv08s0007g07200"
FT   gene            complement(1544980..1547783)
FT                   /locus_tag="VIT_08s0007g07190"
FT                   /old_locus_tag="Vv08s0007g07190"
FT   mRNA            complement(join(1544980..1545362,1545567..1545596,
FT                   1545681..1545723,1545802..1545903,1546008..1546247,
FT                   1546332..1546422,1546523..1546611,1546692..1546872,
FT                   1547246..1547688,1547689..1547783))
FT                   /locus_tag="VIT_08s0007g07190"
FT                   /old_locus_tag="Vv08s0007g07190"
FT                   /product="unknown predicted protein"
FT   CDS_pept        complement(join(1544980..1545362,1545567..1545596,
FT                   1545681..1545723,1545802..1545903,1546008..1546247,
FT                   1546332..1546422,1546523..1546611,1546692..1546872,
FT                   1547246..1547688))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07190"
FT                   /old_locus_tag="Vv08s0007g07190"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI84"
FT                   /protein_id="CBI29960.3"
FT                   /translation="MGMVASCPFADDLDRDFEAALLRSLSFGAHDVKNALRSFSFNGHD
FT                   SERPTMKSFPSGKMIFEGSLSFKRTELDTRISLKAPCPDSIKSKDTNEQVPKSDSLLEK
FT                   IPPLTLPERGNRTFQAALKLQKVYKSFRTRRQLADCAVLVEQRWWKVLDFAELKRSSIS
FT                   FFDIERTESVFSRWSRARTRAAKVGKGLSKDEKARKLALQHWLEAIDPRHRYGHNLQFY
FT                   YVKWLHCESRQPFFYWLDIGEGKEVNLVDRCPRSKLQQQCIKYLGPIERKAYEVIVENG
FT                   KFLYKQTRTLIDTVSGPKDTKWIFVLSTSKKLYIGKKSKGTFQHSSFLAGGATLSAGRL
FT                   VVEEGVLKAVWPHSGHYLPTEENFQEFMLFLRENDVDLTNVTQYASEEEETGNKKVVET
FT                   DSRNQDSMNLFNEDQEEENAKPIPKEKIMMRINSHKGMKSYQLAQQLSSKWTTGAGPRI
FT                   GCMRDYPSELQFRVLEQVNFSPRSAVATPSSTPKPTRFGAKVLTPAPHRRETNTSQSAL
FT                   ASEQGDIATDSNTSSQ"
FT   5'UTR           complement(1547689..1547783)
FT                   /locus_tag="VIT_08s0007g07190"
FT                   /old_locus_tag="Vv08s0007g07190"
FT   gene            1559651..1564213
FT                   /locus_tag="VIT_08s0007g07180"
FT                   /old_locus_tag="Vv08s0007g07180"
FT   mRNA            join(1559651..1559691,1560142..1560187,1560278..1560315,
FT                   1560316..1560342,1560447..1562261,1562987..1563985,
FT                   1563986..1564213)
FT                   /locus_tag="VIT_08s0007g07180"
FT                   /old_locus_tag="Vv08s0007g07180"
FT                   /product="putative translation-initiation factor 3 subunit"
FT   5'UTR           1559651..1559691
FT                   /locus_tag="VIT_08s0007g07180"
FT                   /old_locus_tag="Vv08s0007g07180"
FT   CDS_pept        join(1560316..1560342,1560447..1562261,1562987..1563985)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07180"
FT                   /old_locus_tag="Vv08s0007g07180"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLF0"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR008905"
FT                   /db_xref="InterPro:IPR027516"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLF0"
FT                   /protein_id="CCB55211.1"
FT                   /translation="MSSRFWTAQGDSDTEEEESDYEDGVERGGAAGESAPHAGSRYLQA
FT                   NASDSDDSDGQKRVVRSAKDKRFEEMSATVDQMKNAMKINDWVSLQESFDKINKQLEKV
FT                   MRVTESDKVPTLYIKALVMLEDFLSQALANKDAKKKMSSSNAKALNSMKQKLKKNNKQY
FT                   EDLINKYREHPESEEEGDEDEEMEEDEDSGSEFEEDPSKIAMRSDSEEDEEDGEDREDS
FT                   AAEAGGGWEKKMSKKDKLMDKQFMKDPSEITWDTVNKKFKEIVAVRGRKGTGRIEQVEQ
FT                   LTFLTRVAKTPAQKLEILFSVVSAQFDVNPSLSGHMPINVWKKCVQNMLVILDILVQHS
FT                   NILVDDVVEPEENETQKGADYKGTIRVWGNLVAFLERIDVEFFKSLQCIDPHTREYVER
FT                   LRDEPLFLVLAQNVQDYLERVGDFKAASKVALRRVELIYYKPQEVYDAMKNLAEQTEDT
FT                   ENGESEAGEEPRVEESRGPPAFVVTPEVVPRKPTFPENSRTLMDILVSLIYNHGDERTK
FT                   ARAMLCDIYHHAILDEFSTARDLLLMSHLQDNVQHMDISTQILFNRAMAQLGLCAFRVG
FT                   LIAEGHGCLSELYSGGRVKELLAQGVSQSRYHEKTPEQERIERRRQMPYHMHINLELLE
FT                   GVHLICAMLLEVPNMAANTHDAKRKVISKTFRRLLEVSERQTFTGPPENVRDHVMAATR
FT                   ALSKGDFQKAFDVIKSLDFWKLLRNREDVLEMLRAKIKEEALRTYLFTYSLSYNTLSLD
FT                   QLTKMFDLSETLTHSIISKMMVMEELHASWDQPTRCIVFHDVEHTRLQALSFQLTDKLT
FT                   ILAENNERAYEAKIGGGGLDLPLRRRDGQDYAGAASVGGKWQDNFSFSQGRQGGVRTGY
FT                   GVGGRPLGPGSSAGTFSRDRGGQSRGTGGYSGGYQSTRYQDAAYGRTAYQTSSAVRGSQ
FT                   MDTSTRMVSLNRGVRA"
FT   3'UTR           1563986..1564213
FT                   /locus_tag="VIT_08s0007g07180"
FT                   /old_locus_tag="Vv08s0007g07180"
FT   gene            complement(1564928..1567243)
FT                   /locus_tag="VIT_08s0007g07170"
FT                   /old_locus_tag="Vv08s0007g07170"
FT   mRNA            complement(join(1564928..1565106,1565107..1565283,
FT                   1566313..1567236,1567237..1567243))
FT                   /locus_tag="VIT_08s0007g07170"
FT                   /old_locus_tag="Vv08s0007g07170"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(1564928..1565106)
FT                   /locus_tag="VIT_08s0007g07170"
FT                   /old_locus_tag="Vv08s0007g07170"
FT   CDS_pept        complement(join(1565107..1565283,1566313..1567236))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07170"
FT                   /old_locus_tag="Vv08s0007g07170"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI86"
FT                   /db_xref="InterPro:IPR001293"
FT                   /db_xref="InterPro:IPR008974"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI86"
FT                   /protein_id="CBI29962.3"
FT                   /translation="MDLPAIDVGVIPEKFEDVKVEGPSFPCDFFDTEIVHKIAQALLPG
FT                   LASACVDNTTGDLFRSPASVAVDIRKEMVEYLTQRSESFVAESVILEDGPDTEVSDHPF
FT                   DIISDFVDDFASSKRNLFSRVSGWLLSERREDKIDDFVQEMEINSFWLLDRRAAIAQTL
FT                   LKNADFKNTFHCNMNFSSAEELDEHRSNCSFRSMNCMNEGCNSSFCAAHMEKHDSVCPF
FT                   KIIPCEQQCSENLMRREMDRHCITVCPMKLVNCPFYSIGCQSTVHHCMVEQHQSDNLDS
FT                   HLLCVLQVTHKDVSVEDLKQRVEQLKELSSPSELAEAKNVRSLTSAVKNLESKLGPLEV
FT                   TVPKTVSEKNTETSDSVAQIPVEAES"
FT   5'UTR           complement(1567237..1567243)
FT                   /locus_tag="VIT_08s0007g07170"
FT                   /old_locus_tag="Vv08s0007g07170"
FT   gene            1568412..1572248
FT                   /locus_tag="VIT_08s0007g07160"
FT                   /old_locus_tag="Vv08s0007g07160"
FT   mRNA            join(1568412..1568473,1568622..1568646,1568647..1568781,
FT                   1569122..1569191,1570171..1570337,1570436..1570509,
FT                   1572023..1572083,1572084..1572248)
FT                   /locus_tag="VIT_08s0007g07160"
FT                   /old_locus_tag="Vv08s0007g07160"
FT                   /product="Predicted protein"
FT   5'UTR           1568412..1568473
FT                   /locus_tag="VIT_08s0007g07160"
FT                   /old_locus_tag="Vv08s0007g07160"
FT   CDS_pept        join(1568647..1568781,1569122..1569191,1570171..1570337,
FT                   1570436..1570509,1572023..1572083)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07160"
FT                   /old_locus_tag="Vv08s0007g07160"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI87"
FT                   /db_xref="InterPro:IPR009244"
FT                   /db_xref="InterPro:IPR037212"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI87"
FT                   /protein_id="CBI29963.3"
FT                   /translation="MATATYPPPPPYYRLYKDYIQNPKSAPEPPPPIEGTYALFGATYT
FT                   TDDVLPSLEEQGVRQLYPKGSNVDFKKELRSLNRELQLHLLELADVLVERPSQYARRVE
FT                   DISLIFKNLHHLLNSLRPHQARATLIHILELQIQRRKQAVEDIKRRREEAQRLLKEAVG
FT                   TLEGQ"
FT   3'UTR           1572084..1572248
FT                   /locus_tag="VIT_08s0007g07160"
FT                   /old_locus_tag="Vv08s0007g07160"
FT   gene            1572978..1593278
FT                   /locus_tag="VIT_08s0007g07150"
FT                   /old_locus_tag="Vv08s0007g07150"
FT   mRNA            join(1572978..1572992,1572993..1573154,1576780..1576914,
FT                   1577069..1577148,1577302..1577385,1578110..1578197,
FT                   1578346..1578506,1578651..1580310,1580413..1580673,
FT                   1582003..1582313,1582710..1583025,1583126..1583281,
FT                   1583452..1583593,1583992..1584068,1585357..1585496,
FT                   1592100..1592217,1593000..1593200,1593201..1593278)
FT                   /locus_tag="VIT_08s0007g07150"
FT                   /old_locus_tag="Vv08s0007g07150"
FT                   /product="Predicted protein"
FT   5'UTR           1572978..1572992
FT                   /locus_tag="VIT_08s0007g07150"
FT                   /old_locus_tag="Vv08s0007g07150"
FT   CDS_pept        join(1572993..1573154,1576780..1576914,1577069..1577148,
FT                   1577302..1577385,1578110..1578197,1578346..1578506,
FT                   1578651..1580310,1580413..1580673,1582003..1582313,
FT                   1582710..1583025,1583126..1583281,1583452..1583593,
FT                   1583992..1584068,1585357..1585496,1592100..1592217,
FT                   1593000..1593200)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07150"
FT                   /old_locus_tag="Vv08s0007g07150"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI88"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI88"
FT                   /protein_id="CBI29964.3"
FT                   /translation="MAVAEEECSSTKSRSASNNDSHYLAKCVLKGSVVLHVVHGRIRSP
FT                   SFSDIVFGKETSLELVIIGEDGIVQSVCEQAVFGTIKDLAVLRWNERFHHQNLQMQGRD
FT                   LLVVVSDSGKLSFLRFCNEMHRFFPVTHVQLSSPGNLRNQLGQMLAIDSNGCFIATSAY
FT                   EDRLAMFSISMATDSDIIDKRIFYPPEIEGDSGVARSVHRTSISGTIWSMCFISKDLNQ
FT                   PSGGYNPVLAIILNRRGAVLTELVLLEWIIIENAVRVISQYAEAGHVAHSIVEVPHSYG
FT                   FAFLFRIGDALLMDLRDAHNPCCVYKTSLNILPTSVEQNFAEESCRVHDGDEDGIFNVA
FT                   ASALLELKDYVAKGDDPMNVDGDSGMVKSTSKHVCALSWEPGNEKNSRMIFCVDTGELF
FT                   MIEISFDSDGPKVNLSDCLYRGLSCKALLWFAGGFLAALVEMGDGMVLKLEQGRLVYRS
FT                   PIQNIAPILDMSVVDCHDEEHDQMFACCGVTPEGSLRIIRSGISVEKLLRTAPIYQGIT
FT                   GTWTVKMKVIDSYHSFLVLSFVEETRVLSVGLSFTDVTDSVGFQPDVSTLACGVVDDGL
FT                   LVQIHKNGVKLCLPTTVAHPEGIPLASPICTSWFPENISISLGAVGYNLIVVATSSPCF
FT                   LFILGVRSVSAYQYEIYEMQHVRLQNEVSCISIPHKHFDKKPSTFLSNLVDNSSAAALL
FT                   IGVNIGRIFVIGTHKPSVEILSFLPDEGLRILASGAISLTNTLGTAVSGCVPQDARLVL
FT                   VDRFYVLSGLRNGMLLRFELPAASMVFSSELSSHSPSTNINSPVNLQLIAIRRIGITPV
FT                   FLVPLSDSLEADIIALSDRPWLLQSARHSLSYTSISFQPSTHVTPVCSMECPMGILFVA
FT                   ENSLHLVEMVHSKRLNVQKFYLGGTPRKVLYHSESRLLLVMRTELSQDTYSSDICCVDP
FT                   LSGSVLSSFKLELGETGKSMELVRVVNEQVLVIGTSLSSGPAMMPSGEAESTKGRLIVL
FT                   CLEHMQNSDSGSMTFCSKAGSSSQRTSPFREIVGYAAEQLSGSSLCSSPDDTSCDGVRL
FT                   EESEAWQLRLAYTATWPGMVLAICPYLDRYFLASAGNSFYVCGFPNDNPQRVRRFAVGR
FT                   TRFMIMSLTAHFTRIAVGDCRDGVVFYSYHEDSRKLEQLYCDPEQRLVADCILMDVDTA
FT                   VVSDRKGSIAVLSCSNHLEDNASPECNLTLNCSYYMGEIAMSIKKGSFSYKLPADDVLK
FT                   GCDGSNTIIDFSENSIMAGTLLGSIIMLIPISREEHELLEAVQARLAVHQLTAPILGND
FT                   HNEFRSRENSVRKAGVSKILDGDMLAQFLELTSMQQEAVLALPLGSLETVTSSSKQTLL
FT                   SPISVNRVVQLLERVHYALN"
FT   3'UTR           1593201..1593278
FT                   /locus_tag="VIT_08s0007g07150"
FT                   /old_locus_tag="Vv08s0007g07150"
FT   gene            1596370..1597516
FT                   /locus_tag="VIT_08s0007g07140"
FT                   /old_locus_tag="Vv08s0007g07140"
FT   mRNA            join(1596370..1596749,1596904..1597336,1597337..1597516)
FT                   /locus_tag="VIT_08s0007g07140"
FT                   /old_locus_tag="Vv08s0007g07140"
FT                   /product="unknown predicted protein"
FT   CDS_pept        join(1596370..1596749,1596904..1597336)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07140"
FT                   /old_locus_tag="Vv08s0007g07140"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI89"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI89"
FT                   /protein_id="CBI29965.3"
FT                   /translation="MDMLSESGGGIIEALNATVHGNGTRTLVLSHGFGFDQSVWHYLIP
FT                   YLACYFKVVVFDLIFVNPNLYDPKKYSNFDSYAQDLVCLLDQLNVKKTIYLGHSMSAMI
FT                   GCIAATKRPDLFEHLILLGGSPRYLNAEGYYGGFERSDIDKIFEAINENFPVWVQNFVP
FT                   MAVGINNSAAIAEFEYSLGRMKPEIVLSVAKTVFLSDLRLVLPQVKVPCTIIQSREDIV
FT                   APTFIACYMKENLGDDATVKILETQGHFPQLTAFPLLLDALNQVLSIP"
FT   3'UTR           1597337..1597516
FT                   /locus_tag="VIT_08s0007g07140"
FT                   /old_locus_tag="Vv08s0007g07140"
FT   gene            complement(1599615..1631646)
FT                   /locus_tag="VIT_08s0007g07130"
FT                   /old_locus_tag="Vv08s0007g07130"
FT   mRNA            complement(join(1599615..1599785,1599786..1599893,
FT                   1599998..1600081,1600157..1600387,1600469..1600624,
FT                   1600704..1600800,1601331..1601507,1601602..1601945,
FT                   1602103..1602201,1602378..1602561,1602651..1602796,
FT                   1603710..1604383,1605061..1605211,1605367..1605441,
FT                   1605542..1605695,1605939..1606039,1606139..1606222,
FT                   1606623..1606762,1606851..1607019,1614205..1614306,
FT                   1614392..1614466,1614566..1614646,1614834..1614940,
FT                   1616055..1616120,1616210..1616355,1617678..1617812,
FT                   1619233..1619369,1621624..1621698,1621882..1622067,
FT                   1624103..1624225,1624321..1624434,1625520..1625612,
FT                   1626350..1626421,1626543..1626665,1626772..1626884,
FT                   1629244..1629343,1630008..1630181,1630403..1630543,
FT                   1631048..1631259,1631417..1631582,1631583..1631646))
FT                   /locus_tag="VIT_08s0007g07130"
FT                   /old_locus_tag="Vv08s0007g07130"
FT                   /product="Pre-rRNA processing protein RRP5"
FT   3'UTR           complement(1599615..1599785)
FT                   /locus_tag="VIT_08s0007g07130"
FT                   /old_locus_tag="Vv08s0007g07130"
FT   CDS_pept        complement(join(1599786..1599893,1599998..1600081,
FT                   1600157..1600387,1600469..1600624,1600704..1600800,
FT                   1601331..1601507,1601602..1601945,1602103..1602201,
FT                   1602378..1602561,1602651..1602796,1603710..1604383,
FT                   1605061..1605211,1605367..1605441,1605542..1605695,
FT                   1605939..1606039,1606139..1606222,1606623..1606762,
FT                   1606851..1607019,1614205..1614306,1614392..1614466,
FT                   1614566..1614646,1614834..1614940,1616055..1616120,
FT                   1616210..1616355,1617678..1617812,1619233..1619369,
FT                   1621624..1621698,1621882..1622067,1624103..1624225,
FT                   1624321..1624434,1625520..1625612,1626350..1626421,
FT                   1626543..1626665,1626772..1626884,1629244..1629343,
FT                   1630008..1630181,1630403..1630543,1631048..1631259,
FT                   1631417..1631582))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07130"
FT                   /old_locus_tag="Vv08s0007g07130"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLF1"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR008847"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLF1"
FT                   /protein_id="CCB55212.1"
FT                   /translation="MAPPSKKSHPKKSKRDDKLRGASKKPFKPRMRQNEAVPSESLALQ
FT                   MEDDVPDFPRGGGSLLSRQEHDAIRAEVDAEFEAGERKTKKKNKNAKKTKKNYALEDDM
FT                   GSLFGDGITGKLPRFANKITLKNISPGMKLWGVVAEVNEKDLGISLPGGLRGLVRASEA
FT                   FDPLFSNEIKDAEGIFLPRIFHIGQLVSCVVLQLDDDKKEKGKRRIWLSLRLSLLHKGF
FT                   TLDALQEGMVLTAYVKSIEDHGYILHFGLPSFTGFLPKSSQAENIEINTGQILQGVIRS
FT                   IDKAHKVVYLSSDPDTISKCVTKDLKGISIDLLIPGMMVNARVQSTFENGVMLSFLTYF
FT                   TGTVDIFHLQTTFPSSNWKDDYNQNKKVNARILFIDPSTRAVGLTLNPHLVNNKAPPCP
FT                   VKTGDIYDHSKVIRVDRGLGLLLEVPSTPASTPTYVTLFDVADEEVRKMEKKYKEGSHV
FT                   RVRILGFRNLEGLAMGTLKASAFEGSVFTHSDVKPGMVVKAKVIAVDSFGAIVQFPSGV
FT                   KALCPLRHMSEFDIVKPRKKFKVGAELIFRVLGCKSKRITVTHKKTLLKSKLGIISSYT
FT                   DATEGLITHGWITKIEKHGCFIRFYNGVQGFAPSSELGLEPGCNTSLMYHVGQVVKCRV
FT                   KGSVPASRRINLSFIIKPTRISEDDMVKLGSVVGGVVDRVTPHAIIVNVSAKGYLKGTI
FT                   STEHLADHQGHAALMKSTLKPGYEFDQLLVLDVEGNNFILSAKYSLINSAQQLPLDLTQ
FT                   IHPNSVVHGYICNIIETGCFVRFLGRLTGFSPRNKVMDDQRAVPSEAFFIGQSVRSNIL
FT                   DVNSETGRITLSLKQSCCSSTDASFIQEYFLLEEKIAKLQLSDSEHSELKWAEGFNIGT
FT                   VIEGKIHDAKDFGVVISFEKYNDVFGFITHYQLTAERGSTVQAVVLDVAKTERLVDLSL
FT                   KPEFLDRHKEDSSNSQAGKKKRRREAYKELQPHQTVNAIVEIVKENYLVLSLPEYNYAI
FT                   GYASVSDYNTQKFAQKQFLHGQSVIASVMALPSPSTVGRLLLVLKSVSEATETSSSKRA
FT                   KKKSSYNVGSLVQAEITEIKPLELRLKFGIGFHGRVHITEVCDENVIENPFSNFRIGQT
FT                   VSARIVAKANKSENNGKNHQWELSIKPEMLTGSIEVENKLVDAEFRISTGQRVTGYVYK
FT                   VENEWIWLTISRHIKAQLFLLDTSCEPNELQEFQKRFEVGKAVSGYVLSANKEKKLLRM
FT                   VLHQFSVSNGTLDGKVLNIDNQHCNPPIENLIPHIHKGDTLGGRISKILPGVGGLLVQI
FT                   GPHLYGKVHFTELKDSWVSDPLSGYHEGQFVKCKVLEIGHSEKGTVHVDLSLWSSLNGM
FT                   HSPNSRVEKIDNLHSDMLVQGYVKNVTSKGCFILLSRKLDARILLANLSDGYVEKPERE
FT                   FPIGKLVSGRVLSVEPLSRRVEVTLKTSSATSVQKSEVNDFSSILVGDIIFGTIKRVES
FT                   YGLFITIDDTNMVGLCHISELSDDHISNIETKYKAGERVAAKILKVDEERHRISLGMKN
FT                   SYIKETTQNNGFVDDTQLSTFLENNSREIQNLDVEYEDEEYPVLSQVESRASILPLEVD
FT                   LDDVNHSNLDDAVGQNHIYTNETNTIDEKSKRRAKKKAKEEKEQEIRAAEERLMLNDVP
FT                   RTADEFEKLVRGSPNSSFLWIKYMALMLSLADIEKARSIAERALRTINIREESEKLNIW
FT                   MAYFNLENEYGNPPEEAVVKVFQRALQYCDPKKVHLALLGMYERTEQHKLADELLEKMT
FT                   KKFKHSCKVWLRRVQNVLKQHQDGVQPVINRALLCLPRHKHIKFISQTAILEFKSGVPD
FT                   RGRSMFEGMLREYPKRTDLWSVYLDQEIRLGDIDIIRALFERAINLSLEPRKMKFLFKK
FT                   YLEYEKSQGDEERIESVKRKAMEYANSTLA"
FT   5'UTR           complement(1631583..1631646)
FT                   /locus_tag="VIT_08s0007g07130"
FT                   /old_locus_tag="Vv08s0007g07130"
FT   gene            complement(1634607..1635826)
FT                   /locus_tag="VIT_08s0007g07120"
FT                   /old_locus_tag="Vv08s0007g07120"
FT   mRNA            complement(join(1634607..1634761,1634762..1635793,
FT                   1635794..1635826))
FT                   /locus_tag="VIT_08s0007g07120"
FT                   /old_locus_tag="Vv08s0007g07120"
FT                   /product="F-box family protein"
FT   3'UTR           complement(1634607..1634761)
FT                   /locus_tag="VIT_08s0007g07120"
FT                   /old_locus_tag="Vv08s0007g07120"
FT   CDS_pept        complement(1634762..1635793)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07120"
FT                   /old_locus_tag="Vv08s0007g07120"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLF2"
FT                   /protein_id="CCB55213.1"
FT                   /translation="MAQFTELIPGLPEEIALECFTRLPYTSHRVAAQVCRRWGELLQGK
FT                   EFYYLRKQTGFTHKAACLVQALPVLSESDGRKPVRPPSYGISVFDSVSRTWERIAPVPK
FT                   YPDGLPLFCQVTSSEGKLVVMGGWDPESYDPVKDVFVYDFTTRRWKQGRDMPSKRSFFA
FT                   AGELEGRIFVAGGHDDSKNALSTAWVYDVRRDEWSELTRMSDERDECQGVVIGSEFWVV
FT                   SGYGTESQGGFVKSAESLDLETGRWSRVDEAWGTNQCPRSCVGVGKDGKLFSWAESDTA
FT                   VGVGACAVDLGDWTLLTGSAYQGAPQGFFLVERKEGQNGKLERIEVGDGFSGFVQSGCC
FT                   VEI"
FT   5'UTR           complement(1635794..1635826)
FT                   /locus_tag="VIT_08s0007g07120"
FT                   /old_locus_tag="Vv08s0007g07120"
FT   gene            1650712..1657586
FT                   /locus_tag="VIT_08s0007g07110"
FT                   /old_locus_tag="Vv08s0007g07110"
FT   mRNA            join(1650712..1650714,1650715..1650927,1651033..1651380,
FT                   1652771..1653294,1653747..1654020,1654127..1654182,
FT                   1655733..1655859,1656166..1656235,1656335..1656514,
FT                   1657294..1657365,1657464..1657582,1657583..1657586)
FT                   /locus_tag="VIT_08s0007g07110"
FT                   /old_locus_tag="Vv08s0007g07110"
FT                   /product="Predicted protein"
FT   5'UTR           1650712..1650714
FT                   /locus_tag="VIT_08s0007g07110"
FT                   /old_locus_tag="Vv08s0007g07110"
FT   CDS_pept        join(1650715..1650927,1651033..1651380,1652771..1653294,
FT                   1653747..1654020,1654127..1654182,1655733..1655859,
FT                   1656166..1656235,1656335..1656514,1657294..1657365,
FT                   1657464..1657582)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07110"
FT                   /old_locus_tag="Vv08s0007g07110"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR006873"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI91"
FT                   /protein_id="CBI29967.3"
FT                   /translation="MNRLAPLSEEPTNDEEEDNNNSSKKVSSWRNWLKSHFSLLFNKKS
FT                   DLKILLSVLGCPLFPISPHAGQPNTHVSSSAEYIIQHFTAATGCRKLEGKVKNVFATGK
FT                   VRMAMVDELGSSGSSTAVGPTGVSQKGCFVMWQMVPDKWLIELVVGGHKVVAGSDGNVA
FT                   WRHTPWIGAHAAKGGVRPLRRVLQGLDPLAVSAVFSSAQYMGEKRIMGVDCFVLKLSAD
FT                   HTDLADRSDNTAEMIKHVIFGYFSQRSGLLVYLEDSYLTRIQSPGSRPTYWETTMATKI
FT                   EDYRTVEGVMIAHGGQSSAIITRFGDNLKVGPAITRMEETWTIDDLAFNVPGLSMDCFI
FT                   PPEEVQKDYPEENLDWRSPLHRTPTPPENEKLASPGPPPIRVSITEMAGRGVFATRRIG
FT                   SGDLIHTAKPLVSHPSLSSIHSVCYFCLRKLKPVTSSEDCNVRFCSQECEEQSKVFVAV
FT                   ERKADWSAYDDYCRTRGLKYPLLVKRLACMVVSGVASADCLDILQPASLSSEMISEMGE
FT                   GFSLLQSAFMKAKARDECMAFLTEQWYINVLARFRINSFRIELAGGSYEDLHSLAAASV
FT                   ETEAAVGNAVYMLPSFYNHDCDPNVHIIWIDNVNARLKALREIEAGEELRICYIDASMD
FT                   HDARQTILFQGFGFRCSCLRCSSGD"
FT   3'UTR           1657583..1657586
FT                   /locus_tag="VIT_08s0007g07110"
FT                   /old_locus_tag="Vv08s0007g07110"
FT   gene            1661462..1664958
FT                   /locus_tag="VIT_08s0007g07100"
FT                   /old_locus_tag="Vv08s0007g07100"
FT   mRNA            join(1661462..1661502,1662062..1662519,1662639..1662742,
FT                   1662819..1663018,1663117..1663217,1663307..1663517,
FT                   1663922..1664083,1664170..1664251,1664327..1664712,
FT                   1664794..1664947,1664948..1664958)
FT                   /locus_tag="VIT_08s0007g07100"
FT                   /old_locus_tag="Vv08s0007g07100"
FT                   /product="Predicted protein"
FT   CDS_pept        join(1661462..1661502,1662062..1662519,1662639..1662742,
FT                   1662819..1663018,1663117..1663217,1663307..1663517,
FT                   1663922..1664083,1664170..1664251,1664327..1664712,
FT                   1664794..1664947)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07100"
FT                   /old_locus_tag="Vv08s0007g07100"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TI92"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR026055"
FT                   /db_xref="InterPro:IPR033640"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI92"
FT                   /protein_id="CBI29968.3"
FT                   /translation="MILIYGITSLITNFSNTPPSPFPPAHLSQTSCPFLFSNLFFSYFL
FT                   LAVMGALFFSSPSFATKRVVKFSGWCDHLKRRKSVVHCQTSGNGVRSSGVSSVLSERSM
FT                   LASKDHSAGSLVLSPNGKDLVPYGPPSPSTTPFVEMNDGIGIDNFLRGKSFLITGATGF
FT                   LAKVLIEKILRTEPDVGKIYLLIKAKNQEAAMERLKNEIINAEVFDCLQQAYGKSYQAF
FT                   MLSKLVPVAGDVCGSSLGLEKDFAEAIAKEVDVIVNSAANTTFDERYDIAIDINTKGPC
FT                   HLMNFAKNCKKLKLFLQVSTAYVNGQRQGRIMEKPFCIGDSIARESNISEAPPRLLPTL
FT                   NIEAEIKLALDSKEAFKGSTLAQKMKELGLERAKKHGWQDTYVFTKAMGEMVIDQMRGE
FT                   IPVVIIRPSVIESTCREPFPGWMEGNRMMDPIVLYYGKGQLTGFVADPNGVLDVVPADM
FT                   VVNATLAAMARHGGSGKAETNIYQIASSVVNPLIFQDLTSHFYEHFKSSPCLDNKGNPI
FT                   HVPIMKLFSSIEDFSSHLWRDAILRSGLSAMPSQTGKLLRKLEKTVKQAKYLADIYQPY
FT                   TFYGGRFDNSNTQRLMDCMCEEEKSKFGFDVGSIDWKDYISNVHIPGLRRHVMKGR"
FT   3'UTR           1664948..1664958
FT                   /locus_tag="VIT_08s0007g07100"
FT                   /old_locus_tag="Vv08s0007g07100"
FT   gene            1669444..1674339
FT                   /locus_tag="VIT_08s0007g07090"
FT                   /old_locus_tag="Vv08s0007g07090"
FT   mRNA            join(1669444..1669467,1669468..1669629,1669730..1669825,
FT                   1669957..1670031,1670232..1670362,1671379..1671482,
FT                   1671592..1671720,1672427..1672542,1673665..1674075,
FT                   1674076..1674339)
FT                   /locus_tag="VIT_08s0007g07090"
FT                   /old_locus_tag="Vv08s0007g07090"
FT                   /product="Predicted protein"
FT   5'UTR           1669444..1669467
FT                   /locus_tag="VIT_08s0007g07090"
FT                   /old_locus_tag="Vv08s0007g07090"
FT   CDS_pept        join(1669468..1669629,1669730..1669825,1669957..1670031,
FT                   1670232..1670362,1671379..1671482,1671592..1671720,
FT                   1672427..1672542,1673665..1674075)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07090"
FT                   /old_locus_tag="Vv08s0007g07090"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLF3"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLF3"
FT                   /protein_id="CCB55214.1"
FT                   /translation="MESIPMWQGVSICVIVSWIVISSTLNVTQKLRSFTQPWVSRHVLT
FT                   GTPLILQIQKFQHGFLDALFSGLSCVVSVPFYTAFLPLLFWSGHVRLARQMTLLMAFCD
FT                   YLGNCIKDSVSAPRPSCPPVRRVTATKDEKENAMEYGLPSSHTLNTVCLSGYLLHYVLS
FT                   YAHNRDAVMILAGVSMVCLLVALIGTGRIYLGMHSLVDIIGGLAIGLAILAFWLTMHEY
FT                   VDNFIVSGQNVTPFWAALSLVLLFAYPTPEFPTPSYEFHTAFNGVALGIVSGIQQTYHQ
FT                   FHHEDVSRIFTPQLSIPAFIGRMLIGIPTILLVKFCSKALAKWILPVVSNTLGIPIRST
FT                   IYVPSLKGSVSGKKSDESKQLGYIQKLLFFSHQDSFDVDTGIRFLQYAGLAWSVVDLVP
FT                   SMFSQLNL"
FT   3'UTR           1674076..1674339
FT                   /locus_tag="VIT_08s0007g07090"
FT                   /old_locus_tag="Vv08s0007g07090"
FT   gene            complement(1677137..1677758)
FT                   /locus_tag="VIT_08s0007g07080"
FT                   /old_locus_tag="Vv08s0007g07080"
FT   mRNA            complement(join(1677137..1677205,1677453..1677474,
FT                   1677685..1677758))
FT                   /locus_tag="VIT_08s0007g07080"
FT                   /old_locus_tag="Vv08s0007g07080"
FT   CDS_pept        complement(join(1677137..1677205,1677453..1677474,
FT                   1677685..1677758))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07080"
FT                   /old_locus_tag="Vv08s0007g07080"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI94"
FT                   /protein_id="CBI29970.3"
FT                   /translation="MSTFQLCYTCLLTTRFSQLIFPPWVAFSNWWKVPDTYYLFMGDYL
FT                   DDGDYSSYD"
FT   gene            1690399..1696918
FT                   /locus_tag="VIT_08s0007g07070"
FT                   /old_locus_tag="Vv08s0007g07070"
FT   mRNA            join(1690399..1690585,1690902..1691047,1691048..1691815,
FT                   1691920..1692003,1694785..1695027,1695640..1695807,
FT                   1696010..1696123,1696333..1696824,1696825..1696918)
FT                   /locus_tag="VIT_08s0007g07070"
FT                   /old_locus_tag="Vv08s0007g07070"
FT                   /product="Predicted protein"
FT   5'UTR           1690399..1690585
FT                   /locus_tag="VIT_08s0007g07070"
FT                   /old_locus_tag="Vv08s0007g07070"
FT   CDS_pept        join(1691048..1691815,1691920..1692003,1694785..1695027,
FT                   1695640..1695807,1696010..1696123,1696333..1696824)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07070"
FT                   /old_locus_tag="Vv08s0007g07070"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLF4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLF4"
FT                   /protein_id="CCB55215.1"
FT                   /translation="MRTSWADSVANSTSDNLVSGSSDNSGFGAGAPSRSGRSSYVPPHL
FT                   RNRPPSSDPPAPSYTSQASAGYGGPPGGTRWGGGSRADFGRSGVTTGVTSGGRVGGSSG
FT                   WNTRSGGWDRGRDREVNPFGDDDNAEPAFSEQENTGINFDAYEDIPVETSGDNVPPPVN
FT                   TFAEIDLGEALNQNIRRCKYVKPTPVQRHAIPISLSGKDLMACAQTGSGKTAAFCFPII
FT                   SGIMTGQFAQRPRGARTVYPLALILSPTRELSCQIHDEARKFSYQTGVKVVVAYGGAPI
FT                   NQQLRELERGVDILVATPGRLVDLLERARVSLQMIRYLALDEADRMLDMGFEPQIRKIV
FT                   EQMDMPPPGVRQTMLFSATFPKEIQRLASDFLSSYIFLAVGRVGSSTDLIVQRVEFVHE
FT                   SDKRSHLMDLLHAQRANGAHGKQSLTLVFVETKKGADSLEHWLCMNGFPATTIHGDRTQ
FT                   QEREHALRSFKSGNTPILVATDVAARGLDIPHVAHVVNFDLPNDIDDYVHRIGRTGRAG
FT                   KTGLATAFFNENNSSLARPLADLMQEANQEVPAWLTRYASRASYGGGKNRRSGGGRFGG
FT                   RDFRKDTSFNRGGGATDYYGGNTSSGYGIPGSYGGGYGPGVTSAWD"
FT   3'UTR           1696825..1696918
FT                   /locus_tag="VIT_08s0007g07070"
FT                   /old_locus_tag="Vv08s0007g07070"
FT   gene            complement(1696919..1701627)
FT                   /locus_tag="VIT_08s0007g07060"
FT                   /old_locus_tag="Vv08s0007g07060"
FT   mRNA            complement(join(1696919..1697667,1699748..1700120,
FT                   1700121..1701398,1701399..1701463,1701528..1701627))
FT                   /locus_tag="VIT_08s0007g07060"
FT                   /old_locus_tag="Vv08s0007g07060"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(join(1696919..1697667,1699748..1700120))
FT                   /locus_tag="VIT_08s0007g07060"
FT                   /old_locus_tag="Vv08s0007g07060"
FT   CDS_pept        complement(1700121..1701398)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07060"
FT                   /old_locus_tag="Vv08s0007g07060"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR021099"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLF5"
FT                   /protein_id="CCB55216.1"
FT                   /translation="MNLRSAIHYGFSSIIPKFLHHHHLQCRGIVRVRLKWVKNRSLDHI
FT                   IDTETDLKAVCLLKDAIKRSSSGFLASNSVANWQKLLGLTVPVLRFMRRYPTLFHEFPH
FT                   PKYPSLPCFRLTDTALMLHSQEESIHQTHEADTVERLCKVLMMMKTSMVPLQSLSPLKW
FT                   DLGLPDDYHRTLIPKYPDHFRVIKASNGVPCLRLGGWREEFAVSALQKSHERGELDGGE
FT                   YREFKRGKSALAFPMSFPRGYGAQKKVKAWMEEFQKLPYISPYEDSRLIDPNSELMEKR
FT                   VVGVLHEFLSLTIHKKTKRNYLRSLREELNLPHKFTRIFTRYPGIFYLSLKCKTTTVAI
FT                   REGYRRGKLASPHPLARIREKYNYVMRTGVLYRGKGTNMMPQEDVLLDDGEDTTEQEES
FT                   VEEEPDIDDECNKEDTSEEDLDSDED"
FT   5'UTR           complement(1701528..1701627)
FT                   /locus_tag="VIT_08s0007g07060"
FT                   /old_locus_tag="Vv08s0007g07060"
FT   gene            complement(1702380..1705333)
FT                   /locus_tag="VIT_08s0007g07050"
FT                   /old_locus_tag="Vv08s0007g07050"
FT   mRNA            complement(join(1702380..1702558,1702559..1702603,
FT                   1704751..1705203,1705204..1705333))
FT                   /locus_tag="VIT_08s0007g07050"
FT                   /old_locus_tag="Vv08s0007g07050"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(1702380..1702558)
FT                   /locus_tag="VIT_08s0007g07050"
FT                   /old_locus_tag="Vv08s0007g07050"
FT   CDS_pept        complement(join(1702559..1702603,1704751..1705203))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07050"
FT                   /old_locus_tag="Vv08s0007g07050"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR007493"
FT                   /db_xref="InterPro:IPR036758"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI97"
FT                   /protein_id="CBI29973.3"
FT                   /translation="MSRCSETLAFTLFLSSLLFSLSAANDEVHKLLLDHGLPAGILPDA
FT                   VSSFNISAGGDFSVELYGPCYIKFDYMVYYDRVISGNLKYGSITSLKGVQVQKFLLWLN
FT                   VDEIRVDLPPSDYIYFHVGMINKKLDVKQFKKARSCRKPASFQEIWEVPASVNEIPMLL
FT                   TE"
FT   5'UTR           complement(1705204..1705333)
FT                   /locus_tag="VIT_08s0007g07050"
FT                   /old_locus_tag="Vv08s0007g07050"
FT   gene            1710181..1710895
FT                   /locus_tag="VIT_08s0007g07040"
FT                   /old_locus_tag="Vv08s0007g07040"
FT   mRNA            join(1710181..1710546,1710547..1710697,1710769..1710866,
FT                   1710867..1710895)
FT                   /locus_tag="VIT_08s0007g07040"
FT                   /old_locus_tag="Vv08s0007g07040"
FT   5'UTR           1710181..1710546
FT                   /locus_tag="VIT_08s0007g07040"
FT                   /old_locus_tag="Vv08s0007g07040"
FT   CDS_pept        join(1710547..1710697,1710769..1710866)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07040"
FT                   /old_locus_tag="Vv08s0007g07040"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI98"
FT                   /protein_id="CBI29974.3"
FT                   /translation="MILQISCGQRQGFSVGDGTALSRCRSSEGDDVRWKNISPVAYMGR
FT                   ARQRQLNWLIFLLNSSPSPTWGGFRDSLSLSLWDIKA"
FT   3'UTR           1710867..1710895
FT                   /locus_tag="VIT_08s0007g07040"
FT                   /old_locus_tag="Vv08s0007g07040"
FT   gene            1713119..1717605
FT                   /locus_tag="VIT_08s0007g07030"
FT                   /old_locus_tag="Vv08s0007g07030"
FT   mRNA            join(1713119..1713289,1713373..1713432,1714212..1714295,
FT                   1714455..1714585,1714706..1714781,1715744..1715814,
FT                   1716178..1716264,1716359..1716431,1716517..1716584,
FT                   1716660..1716728,1717443..1717605)
FT                   /locus_tag="VIT_08s0007g07030"
FT                   /old_locus_tag="Vv08s0007g07030"
FT                   /product="Predicted protein"
FT   CDS_pept        join(1713119..1713289,1713373..1713432,1714212..1714295,
FT                   1714455..1714585,1714706..1714781,1715744..1715814,
FT                   1716178..1716264,1716359..1716431,1716517..1716584,
FT                   1716660..1716728,1717443..1717605)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07030"
FT                   /old_locus_tag="Vv08s0007g07030"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:D7TI99"
FT                   /protein_id="CBI29975.3"
FT                   /translation="MEETEARAGGDLKWSRETIPKVLRIVGTRLPQRDLISLLLVSPWI
FT                   HRTLVSCSSLWLVLDFRETNNAGNRLVAALSLFRYQHVKQINLEFAQDIEDKHLDLLKT
FT                   KCLDSLQELESLNLNVCQKISDRGVETITSACPKLKVFSIYWNVRVTDIGMTHLVKNCK
FT                   HIVDLNLSGCKNITDKSLQLIADNYPDLELLNLTRCIKLTDGGLQQILLKCSSLQSLNL
FT                   YALSSFTDEAYKKISLLTDLRFLDLCGAQNLSDQGLCCIAKCKNLVSLNLTWCVRVTDV
FT                   GVIAIAQGCTSLEFLSLFGIVGVTDKCLEALSRSCSNMITTLDVNGCIGIKVHDIFSRK
FT                   KLQGRGFLFT"
FT   gene            1728074..1737399
FT                   /locus_tag="VIT_08s0007g07020"
FT                   /old_locus_tag="Vv08s0007g07020"
FT   mRNA            join(1728074..1728203,1728204..1728361,1732235..1732988,
FT                   1733751..1733837,1733924..1734007,1734087..1734173,
FT                   1734272..1734358,1735453..1735506,1735622..1735713,
FT                   1735851..1735965,1736109..1736256,1736385..1736530,
FT                   1736531..1736538,1737116..1737399)
FT                   /locus_tag="VIT_08s0007g07020"
FT                   /old_locus_tag="Vv08s0007g07020"
FT                   /product="unknown predicted protein"
FT   5'UTR           1728074..1728203
FT                   /locus_tag="VIT_08s0007g07020"
FT                   /old_locus_tag="Vv08s0007g07020"
FT   CDS_pept        join(1728204..1728361,1732235..1732988,1733751..1733837,
FT                   1733924..1734007,1734087..1734173,1734272..1734358,
FT                   1735453..1735506,1735622..1735713,1735851..1735965,
FT                   1736109..1736256,1736385..1736530)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07020"
FT                   /old_locus_tag="Vv08s0007g07020"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIA0"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR031615"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIA0"
FT                   /protein_id="CBI29976.3"
FT                   /translation="MLSVLRVHLPSDIPIVGCELTPYVLLRRPDKNLTTEDVPESAPIE
FT                   GHFLRYKWYRIQSDRKVAVCSVHPSEHATLQCLGCVKAKIPVAKSYHCSPKCFSDAWQH
FT                   HRVLHDRAASAVNENGNEEEELFGRFNSTGSGSINTSLAPSASSASLANGSAPLYPAAV
FT                   TQRSGGETWFEVGRSKTYTPTADDIGHVLKFECVVVDAETKLTVGHGSNILTSRVIPAP
FT                   SPTPRHLISVSGVDMVGHLDSDGRISSAGTFTVLSYNILSDVFATSELYSYCPSWALSW
FT                   PYRKQNLLREIVGYRADIVCLQEIQSDHFEEFFAPELDKHGYQALYKRKTNEVYTGNIH
FT                   TIDGCATFFRRDRFSHVKKYEVEFNKAAQSLTDAVVPSAQKKTALNRLVKDNVALIAVL
FT                   EAKFSYQGADIPGKRQLLCVANTHINVHQELKDVKLWQVHTLLKGLEKIAASADIPMLV
FT                   CGDFNSVPGSAPHALLAMGKVDPMHPDLAIDPLGILRPASKLTHQLPLVSAYSSFARMG
FT                   VGIGLEQQRRRLDPSTNEPLFTHCTRDFIGTLDYIFYTADSLTVESLLELLDEDSLRKD
FT                   TALPSPEWSSDHIALLAEFRCKPRTRR"
FT   3'UTR           join(1736531..1736538,1737116..1737399)
FT                   /locus_tag="VIT_08s0007g07020"
FT                   /old_locus_tag="Vv08s0007g07020"
FT   gene            complement(1741163..1743368)
FT                   /locus_tag="VIT_08s0007g07010"
FT                   /old_locus_tag="Vv08s0007g07010"
FT   mRNA            complement(join(1741163..1741345,1741346..1741603,
FT                   1743078..1743314,1743315..1743368))
FT                   /locus_tag="VIT_08s0007g07010"
FT                   /old_locus_tag="Vv08s0007g07010"
FT                   /product="Os03g0141000 protein"
FT   3'UTR           complement(1741163..1741345)
FT                   /locus_tag="VIT_08s0007g07010"
FT                   /old_locus_tag="Vv08s0007g07010"
FT   CDS_pept        complement(join(1741346..1741603,1743078..1743314))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07010"
FT                   /old_locus_tag="Vv08s0007g07010"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5AKQ7"
FT                   /db_xref="InterPro:IPR001147"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018259"
FT                   /db_xref="InterPro:IPR036948"
FT                   /db_xref="UniProtKB/TrEMBL:A5AKQ7"
FT                   /protein_id="CBI29977.3"
FT                   /translation="MPAGHGLRSRTRDLFARPFRKKGYIPLTTYLRTFRIGEYVDIKVN
FT                   GAIHKGMPHKFYHGRTGKVWNVTKRAIGVEVNKQVGNRIIKKRIHVRVEHVQPSRCTEE
FT                   FRLRKLKNDELKTAAKKNGEIISTKRQPEGPKPGFMVEGATLETVTPIPYDVVNDLKGG
FT                   Y"
FT   5'UTR           complement(1743315..1743368)
FT                   /locus_tag="VIT_08s0007g07010"
FT                   /old_locus_tag="Vv08s0007g07010"
FT   gene            1746414..1747150
FT                   /locus_tag="VIT_08s0007g07000"
FT                   /old_locus_tag="Vv08s0007g07000"
FT   mRNA            join(1746414..1746980,1746981..1747150)
FT                   /locus_tag="VIT_08s0007g07000"
FT                   /old_locus_tag="Vv08s0007g07000"
FT                   /product="Predicted protein"
FT   CDS_pept        1746414..1746980
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g07000"
FT                   /old_locus_tag="Vv08s0007g07000"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLF6"
FT                   /db_xref="InterPro:IPR004265"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLF6"
FT                   /protein_id="CCB55217.1"
FT                   /translation="MAKTLTYFAFLFFSTVAAAVGDGHTFSRNLSPESLDLKREKLSHL
FT                   HFYFHDVITGPNPTVVRVAEAAVTNKSATLFGGVAVLDDPLTVGPEPSSKLVGRAQGMY
FT                   AAASQKEFGLLMVMNFAFMEGKYNGSTLSVLGRNTIFSKVREMPIIGGSGVFRYARGYV
FT                   EARTYSFNVKSGDAVVEYNVYAFHY"
FT   3'UTR           1746981..1747150
FT                   /locus_tag="VIT_08s0007g07000"
FT                   /old_locus_tag="Vv08s0007g07000"
FT   gene            1751355..1751990
FT                   /locus_tag="VIT_08s0007g06990"
FT                   /old_locus_tag="Vv08s0007g06990"
FT   mRNA            1751355..1751990
FT                   /locus_tag="VIT_08s0007g06990"
FT                   /old_locus_tag="Vv08s0007g06990"
FT                   /product="putative uncharacterized protein"
FT   CDS_pept        1751355..1751990
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06990"
FT                   /old_locus_tag="Vv08s0007g06990"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLF7"
FT                   /db_xref="InterPro:IPR004265"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLF7"
FT                   /protein_id="CCB55218.1"
FT                   /translation="MRTRSAEKSMMLFSFFHLRFFSTMARSLILFTIFLSTIAADAAAS
FT                   GASGESHRFSRNLSPKSIGLKHEKLSHLHFYFHDIVTDPNPTTVRVAEATMSNTLVTTF
FT                   GDVFVMDDPLTVGPEPSSKLVGRAQGIYASAWQEEVGLLMVMNFAFMEGKYNGSTLSVL
FT                   GRNTIFSEVREMPIIGGSGLFRFARGYVEARTHSFNVKSGNAVVEYNV"
FT   gap             1752399..1770954
FT                   /estimated_length=18556
FT   gene            complement(1779412..1780456)
FT                   /locus_tag="VIT_08s0007g06980"
FT                   /old_locus_tag="Vv08s0007g06980"
FT   mRNA            complement(join(1779412..1779615,1779616..1779784,
FT                   1780269..1780456))
FT                   /locus_tag="VIT_08s0007g06980"
FT                   /old_locus_tag="Vv08s0007g06980"
FT   3'UTR           complement(1779412..1779615)
FT                   /locus_tag="VIT_08s0007g06980"
FT                   /old_locus_tag="Vv08s0007g06980"
FT   CDS_pept        complement(join(1779616..1779784,1780269..1780456))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06980"
FT                   /old_locus_tag="Vv08s0007g06980"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLF8"
FT                   /protein_id="CCB55219.1"
FT                   /translation="MAILSRARKTLLKTLNHHNNPFKASISTFTFLSLEAQLAEPSLPP
FT                   PSPTPLPPNPASGSPLYKWIARGENARGHVLLSVDEGLVVSTLGTAGRTYSSTLVDASW
FT                   AILRDHCVKRRHLN"
FT   gene            1780647..1780832
FT                   /locus_tag="VIT_08s0007g06970"
FT                   /old_locus_tag="Vv08s0007g06970"
FT   mRNA            join(1780647..1780724,1780725..1780832)
FT                   /locus_tag="VIT_08s0007g06970"
FT                   /old_locus_tag="Vv08s0007g06970"
FT   CDS_pept        1780647..1780724
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06970"
FT                   /old_locus_tag="Vv08s0007g06970"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIA4"
FT                   /protein_id="CBI29980.3"
FT                   /translation="MDHLLIFGPSWAQNTILPNVYALHY"
FT   3'UTR           1780725..1780832
FT                   /locus_tag="VIT_08s0007g06970"
FT                   /old_locus_tag="Vv08s0007g06970"
FT   gene            1782523..1783209
FT                   /locus_tag="VIT_08s0007g06960"
FT                   /old_locus_tag="Vv08s0007g06960"
FT   mRNA            join(1782523..1782531,1782532..1783101,1783102..1783209)
FT                   /locus_tag="VIT_08s0007g06960"
FT                   /old_locus_tag="Vv08s0007g06960"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           1782523..1782531
FT                   /locus_tag="VIT_08s0007g06960"
FT                   /old_locus_tag="Vv08s0007g06960"
FT   CDS_pept        1782532..1783101
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06960"
FT                   /old_locus_tag="Vv08s0007g06960"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIA5"
FT                   /db_xref="InterPro:IPR004265"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIA5"
FT                   /protein_id="CBI29981.3"
FT                   /translation="MAKLLILFTIFFSTIAAVAASGSSGESHRFSRNLSPESMGLKEEK
FT                   LSHLHFYFHDIISGPKPTAVRVAEAAMTNKSATMFGAVLMMDDPLTVGPEPSSKLVGRA
FT                   QGIYASASQEEMGLLMVLNFAFMEGKYNGSTLSVLGRNTIFSKVREMPIVGGSGLFRFA
FT                   RGYAQARTRTFNLDVVVEYNVYVFHY"
FT   3'UTR           1783102..1783209
FT                   /locus_tag="VIT_08s0007g06960"
FT                   /old_locus_tag="Vv08s0007g06960"
FT   gene            1783210..1795773
FT                   /locus_tag="VIT_08s0007g06950"
FT                   /old_locus_tag="Vv08s0007g06950"
FT   mRNA            join(1783210..1783218,1783380..1784086,1786170..1786368,
FT                   1795079..1795087,1795088..1795666,1795667..1795773)
FT                   /locus_tag="VIT_08s0007g06950"
FT                   /old_locus_tag="Vv08s0007g06950"
FT                   /product="Predicted protein"
FT   5'UTR           1783210..1783218
FT                   /locus_tag="VIT_08s0007g06950"
FT                   /old_locus_tag="Vv08s0007g06950"
FT   CDS_pept        1795088..1795666
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06950"
FT                   /old_locus_tag="Vv08s0007g06950"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLF9"
FT                   /db_xref="InterPro:IPR004265"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLF9"
FT                   /protein_id="CCB55220.1"
FT                   /translation="MAKLLILFTIFFSTIAAVAASGSSGESHRFSRNLSPESIGLKEEK
FT                   LSHLHFYFHDIISGPKPTAVRVAEAAMTNKSATVFGAVLMMDDPLTVGPEPSSKLVGRA
FT                   QGIYASASQEEMGFLMVLNFAFMEGKYNGSTLSVLGRNTIFSKVREMSIVGGSGLFRFA
FT                   RGYAQARTHTFNPKTGDVVVEYNVYVFHY"
FT   3'UTR           1795667..1795773
FT                   /locus_tag="VIT_08s0007g06950"
FT                   /old_locus_tag="Vv08s0007g06950"
FT   gene            complement(1799293..1802900)
FT                   /locus_tag="VIT_08s0007g06940"
FT                   /old_locus_tag="Vv08s0007g06940"
FT   mRNA            complement(join(1799293..1799804,1802828..1802900))
FT                   /locus_tag="VIT_08s0007g06940"
FT                   /old_locus_tag="Vv08s0007g06940"
FT   CDS_pept        complement(join(1799293..1799804,1802828..1802900))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06940"
FT                   /old_locus_tag="Vv08s0007g06940"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLG0"
FT                   /protein_id="CCB55221.1"
FT                   /translation="MGEMRSTESGKRLASFGMPMKSILWLTSRVIGCPRIWNVRPTAAD
FT                   DQHLPHLSEDGVSAQNIKSTIVILALHENKIQHHQQAYFRLQRRCVLGFSHHLGVRFGS
FT                   LGQEIVHHEHRRRLVGHGGLSNSHGDGFRGADNVVEVEVEVAELLFVETHRYGRNFFGE
FT                   TVGFLAGATAAAMVEKKIVKMMRGFAMVEKN"
FT   gene            1811689..1812324
FT                   /locus_tag="VIT_08s0007g06930"
FT                   /old_locus_tag="Vv08s0007g06930"
FT   mRNA            join(1811689..1812267,1812268..1812324)
FT                   /locus_tag="VIT_08s0007g06930"
FT                   /old_locus_tag="Vv08s0007g06930"
FT                   /product="putative uncharacterized protein"
FT   CDS_pept        1811689..1812267
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06930"
FT                   /old_locus_tag="Vv08s0007g06930"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLG1"
FT                   /db_xref="InterPro:IPR004265"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLG1"
FT                   /protein_id="CCB55222.1"
FT                   /translation="MAKLLILITIFFSTIAAVAASGSSEESHRFSRNLSPESMGLKEEK
FT                   LSHLHFYFHDIISSPKPTAVRVAEAAMTNKSATVFGAVFMMDDLLTVGPEPSSKLVGRA
FT                   QGIYASASQEEMGLLMVLNFAFMEGKYNGSTLSVLGRNTIFSKVREMPIVGGSGLFRFA
FT                   RGYAQARTHTFNLKTGDAVVEYNVYVFHY"
FT   3'UTR           1812268..1812324
FT                   /locus_tag="VIT_08s0007g06930"
FT                   /old_locus_tag="Vv08s0007g06930"
FT   gene            complement(1813241..1816244)
FT                   /locus_tag="VIT_08s0007g06920"
FT                   /old_locus_tag="Vv08s0007g06920"
FT   mRNA            complement(join(1813241..1813749,1816199..1816244))
FT                   /locus_tag="VIT_08s0007g06920"
FT                   /old_locus_tag="Vv08s0007g06920"
FT   CDS_pept        complement(join(1813241..1813749,1816199..1816244))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06920"
FT                   /old_locus_tag="Vv08s0007g06920"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLG2"
FT                   /protein_id="CCB55223.1"
FT                   /translation="MTNGLIILVNKRWCDEFPKLPFKKKTWALHALYENKIQHHQQAHF
FT                   RLQHRCVYSLGSSHHLGVRVESLSEEIVHHEHHAEHHRQLVGHGGLNNSHSGGFRAIDD
FT                   VVEVEVEVVELLFLEAHRYGIKISGETVGILTGVGGRGGRGGCNGGEEDSEKDERFHHG
FT                   GEELNRCGKKNCVYLLNHTFL"
FT   gene            1822087..1823125
FT                   /locus_tag="VIT_08s0007g06910"
FT                   /old_locus_tag="Vv08s0007g06910"
FT   mRNA            join(1822087..1822282,1822507..1823012,1823013..1823125)
FT                   /locus_tag="VIT_08s0007g06910"
FT                   /old_locus_tag="Vv08s0007g06910"
FT                   /product="putative uncharacterized protein"
FT   CDS_pept        join(1822087..1822282,1822507..1823012)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06910"
FT                   /old_locus_tag="Vv08s0007g06910"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLG3"
FT                   /db_xref="InterPro:IPR004265"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLG3"
FT                   /protein_id="CCB55224.1"
FT                   /translation="MASSILSYLIQRSITDNVFAVGRKGKDKKKKERKRIEKKRERHLP
FT                   PRSYGHHWPVATPSLGRAFRGKSHKFSEKLSPEKLGFKHEKLTHLNFFFHDIVTGQNPT
FT                   AVRVAEAAMTNTSKTLFGSVMIIDDPLTEGPEMESKLVGRAQGMYASAGQNEPGLLMAM
FT                   TFHFVEGKFNGSNLSFLGRNSVFSEVRELPIVGGSGLFRFARGYAEARTRTLDMKTGNA
FT                   VVEYNVYVFHY"
FT   3'UTR           1823013..1823125
FT                   /locus_tag="VIT_08s0007g06910"
FT                   /old_locus_tag="Vv08s0007g06910"
FT   gene            1824066..1824811
FT                   /locus_tag="VIT_08s0007g06900"
FT                   /old_locus_tag="Vv08s0007g06900"
FT   mRNA            join(1824066..1824641,1824642..1824811)
FT                   /locus_tag="VIT_08s0007g06900"
FT                   /old_locus_tag="Vv08s0007g06900"
FT                   /product="unknown predicted protein"
FT   CDS_pept        1824066..1824641
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06900"
FT                   /old_locus_tag="Vv08s0007g06900"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLG4"
FT                   /db_xref="InterPro:IPR004265"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLG4"
FT                   /protein_id="CCB55225.1"
FT                   /translation="MEKMLTRLTTMSLIFFFFFFSTLVAGKSQGFSRSLSPEALGLKKE
FT                   KLSHLHFFLHDIVEGEKATAVRVAEAWMTNTSKTGFGFLAIMDDPLTEGPDLGSKTVGR
FT                   AQGMYASAAENEFALLMVLNFAFIEGKYKGSNLSLLGRNEVFSEVREMPIIGGSGVFRF
FT                   ARGYAQAKTHKITVESSIVEYNVFVYHY"
FT   3'UTR           1824642..1824811
FT                   /locus_tag="VIT_08s0007g06900"
FT                   /old_locus_tag="Vv08s0007g06900"
FT   gene            complement(1826200..1828448)
FT                   /locus_tag="VIT_08s0007g06890"
FT                   /old_locus_tag="Vv08s0007g06890"
FT   mRNA            complement(join(1826200..1826379,1826380..1826640,
FT                   1828182..1828418,1828419..1828448))
FT                   /locus_tag="VIT_08s0007g06890"
FT                   /old_locus_tag="Vv08s0007g06890"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(1826200..1826379)
FT                   /locus_tag="VIT_08s0007g06890"
FT                   /old_locus_tag="Vv08s0007g06890"
FT   CDS_pept        complement(join(1826380..1826640,1828182..1828418))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06890"
FT                   /old_locus_tag="Vv08s0007g06890"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5C0T5"
FT                   /db_xref="InterPro:IPR001147"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018259"
FT                   /db_xref="InterPro:IPR036948"
FT                   /db_xref="UniProtKB/TrEMBL:A5C0T5"
FT                   /protein_id="CBI29984.3"
FT                   /translation="MPAGHGLRSRTRDLFARPFRKKGYIPLTTYLRTFRIGDYVDIKVN
FT                   GAVHKGMPHKFYHGRTGKVWNVTKRAIGVEVNKQVGNRIIKKRIHVRVEHVQPSRCTEE
FT                   FRLRKLKNDELKAEAKKNGGQIISTKRQPEGPKPGFMVEGATLETVTPIPYDVVNDLKG
FT                   GY"
FT   5'UTR           complement(1828419..1828448)
FT                   /locus_tag="VIT_08s0007g06890"
FT                   /old_locus_tag="Vv08s0007g06890"
FT   gene            1829786..1834622
FT                   /locus_tag="VIT_08s0007g06880"
FT                   /old_locus_tag="Vv08s0007g06880"
FT   mRNA            join(1829786..1829801,1829802..1829927,1830060..1830110,
FT                   1830971..1831022,1831099..1831157,1831326..1831371,
FT                   1834256..1834398,1834399..1834622)
FT                   /locus_tag="VIT_08s0007g06880"
FT                   /old_locus_tag="Vv08s0007g06880"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           1829786..1829801
FT                   /locus_tag="VIT_08s0007g06880"
FT                   /old_locus_tag="Vv08s0007g06880"
FT   CDS_pept        join(1829802..1829927,1830060..1830110,1830971..1831022,
FT                   1831099..1831157,1831326..1831371,1834256..1834398)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06880"
FT                   /old_locus_tag="Vv08s0007g06880"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIA9"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIA9"
FT                   /protein_id="CBI29985.3"
FT                   /translation="MGTREVYEQKLRSGNLHHDPTINPGLGSPRCPRCLSLINPNSKSG
FT                   EWTITSVLHDATAVAGAGIGGMLSAVYGINTGIPYIQNRVRGPKWLPFIIGMPPLLMFS
FT                   ATCAAFGGYALPKFAQLTVTSYYAASSASHYGISLLTRHIEEVHTAQSHREKLR"
FT   3'UTR           1834399..1834622
FT                   /locus_tag="VIT_08s0007g06880"
FT                   /old_locus_tag="Vv08s0007g06880"
FT   gene            complement(1841075..1841872)
FT                   /locus_tag="VIT_08s0007g06870"
FT                   /old_locus_tag="Vv08s0007g06870"
FT   mRNA            complement(join(1841075..1841155,1841156..1841872))
FT                   /locus_tag="VIT_08s0007g06870"
FT                   /old_locus_tag="Vv08s0007g06870"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(1841075..1841155)
FT                   /locus_tag="VIT_08s0007g06870"
FT                   /old_locus_tag="Vv08s0007g06870"
FT   CDS_pept        complement(1841156..1841872)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06870"
FT                   /old_locus_tag="Vv08s0007g06870"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLH0"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLH0"
FT                   /protein_id="CCB55226.1"
FT                   /translation="MDKATERETHDFMNVESFSQLPFIRPAPVKEKGIRLFGKEFGGHH
FT                   DPEEQSESVETNMCEDVKDSENGESGRRFECHYCCRNFPTSQALGGHQNAHKRERQHAK
FT                   RAHLQSAMVHSGLSDAHMYGLVNYRLGSAPTPPITYPSWGSQAISSNGRFYGSHGSFSQ
FT                   PPINGNPLALWRIPASVQTTPTFSRDRSSHHPLPLFAGDDLKPSSHVGGSTSQSRYVYE
FT                   STKPGVQDHVSLDLHL"
FT   gap             1856198..1856297
FT                   /estimated_length=100
FT   gene            1868801..1869843
FT                   /locus_tag="VIT_08s0007g06860"
FT                   /old_locus_tag="Vv08s0007g06860"
FT   mRNA            join(1868801..1868813,1868814..1869047,1869123..1869375,
FT                   1869467..1869843)
FT                   /locus_tag="VIT_08s0007g06860"
FT                   /old_locus_tag="Vv08s0007g06860"
FT                   /product="unknown predicted protein"
FT   5'UTR           1868801..1868813
FT                   /locus_tag="VIT_08s0007g06860"
FT                   /old_locus_tag="Vv08s0007g06860"
FT   CDS_pept        join(1868814..1869047,1869123..1869375,1869467..1869843)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06860"
FT                   /old_locus_tag="Vv08s0007g06860"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIB0"
FT                   /db_xref="InterPro:IPR001906"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR036965"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIB0"
FT                   /protein_id="CBI29986.3"
FT                   /translation="MELTLKSLSPLAYGALNCRKNFAMASPRMRIKQGRSELPNLTITS
FT                   KIDELQVTERRSANYHPSIWDPKFIESLSTPYTNEGYSNQLEDLKEEAKRVIKDARDTS
FT                   SRLEFIDSMQRLGVAYHLEEEIKEAIDLVHLDDTTTDDLSTTALRFRLLRQHGYPVSSE
FT                   VFDQFRSKDGRFMDGISQDIAGPLSLYEASHLGVEGEDDLEEARRFSTIHLKSLVGNLE
FT                   SNLADQVQQSLEVPLHWRMPRLEARNFIDIYQRRNTKNSALLELAKLDYNLVQSSYQTE
FT                   LKELTR"
FT   gene            1875128..1878405
FT                   /locus_tag="VIT_08s0007g06850"
FT                   /old_locus_tag="Vv08s0007g06850"
FT   mRNA            join(1875128..1875227,1875338..1875378,1877387..1877396,
FT                   1877397..1877456,1878158..1878259,1878388..1878405)
FT                   /locus_tag="VIT_08s0007g06850"
FT                   /old_locus_tag="Vv08s0007g06850"
FT                   /product="Predicted protein"
FT   5'UTR           1875128..1875227
FT                   /locus_tag="VIT_08s0007g06850"
FT                   /old_locus_tag="Vv08s0007g06850"
FT   CDS_pept        join(1877397..1877456,1878158..1878259,1878388..1878405)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06850"
FT                   /old_locus_tag="Vv08s0007g06850"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIB1"
FT                   /db_xref="InterPro:IPR034595"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIB1"
FT                   /protein_id="CBI29987.3"
FT                   /translation="MKEKNTTSTLKRILVNCASQAKDYGSCVAAKVPEVERDMCLKEFL
FT                   ALKNCMQNVLRGKV"
FT   gene            1878456..1878597
FT                   /locus_tag="VIT_08s0007g06840"
FT                   /old_locus_tag="Vv08s0007g06840"
FT   mRNA            join(1878456..1878482,1878580..1878597)
FT                   /locus_tag="VIT_08s0007g06840"
FT                   /old_locus_tag="Vv08s0007g06840"
FT   CDS_pept        join(1878456..1878482,1878580..1878597)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06840"
FT                   /old_locus_tag="Vv08s0007g06840"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIB2"
FT                   /protein_id="CBI29988.3"
FT                   /translation="MLNGSERIVCFLRL"
FT   gene            1878686..1885912
FT                   /locus_tag="VIT_08s0007g06830"
FT                   /old_locus_tag="Vv08s0007g06830"
FT   mRNA            join(1878686..1878853,1878960..1879219,1879935..1880088,
FT                   1880664..1880773,1880858..1880945,1882395..1882739,
FT                   1882818..1882892,1883123..1883739,1884301..1884409,
FT                   1884510..1884689,1885361..1885537,1885538..1885912)
FT                   /locus_tag="VIT_08s0007g06830"
FT                   /old_locus_tag="Vv08s0007g06830"
FT                   /product="putative uncharacterized protein"
FT   CDS_pept        join(1878686..1878853,1878960..1879219,1879935..1880088,
FT                   1880664..1880773,1880858..1880945,1882395..1882739,
FT                   1882818..1882892,1883123..1883739,1884301..1884409,
FT                   1884510..1884689,1885361..1885537)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06830"
FT                   /old_locus_tag="Vv08s0007g06830"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLH1"
FT                   /db_xref="InterPro:IPR009755"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR040371"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLH1"
FT                   /protein_id="CCB55227.1"
FT                   /translation="MFGKASSSQLSVSLGGSGALSHVYIQHPPLRCSIPGSKGLFYDDG
FT                   NKLILSPTSDQVFSWKTVPFASHVAPTSDSISEGPVLSIRYSLDSKLLAIQRSNHEIQF
FT                   WNRETGETFSQRCRSETESILGFFWTDCPKCDIVFVKTSGMDLFSYDSETKSLHLVETK
FT                   KMNVSWYVYTHESRLILLASGMQCKSFTGFQLSSAGMIRLPKFEMAMAKSEANNKPVLA
FT                   AEDVHIITVYGRIYCLQVDRVAMLLHSYRFYRDAVVQQGSLPIYSDKIAISVVDNVLLV
FT                   HQVDAKVVILYDIFADSRAPISAPLPLLLRGFPRASSSSSRTGNKDTDGSEANDRSDHE
FT                   TIIYGDNWIFLVPDLICDVAKRLLWKIHLDLEASFAISASSSEVPSVLEFLQRRKLEAN
FT                   KAKQLCLAIVRTVILERRPVSMVTRAIDVLVTSYSNSIKTGSYFKGIKAEKPPTSDVSN
FT                   VNPPTSVVDESIRREDALGKSIKHGSASGVENESINRSPAFSVSDSEENVSFENSNHLR
FT                   SLGAKADRENFKVAESSQSEVQKLSLQSQLLGPSNSPLNANYSENLESQVTSAAISPDE
FT                   MYSCVFASVEEEMAGDPAYFVTIVIEFLRSANVERIKVHPNIYVLTVQLLARHERYAEL
FT                   GLFIINKILEPSKEVALQLLESGRQNIQTRKLGLDMLRQLSLHHDYVLLLVQDGYYLEA
FT                   LRYARKNKVTTVRPSLFLEAAFASTDPQHLAAVLRFFSDFIPGFKNTADHIAYCRILNE
FT                   MNSSITA"
FT   3'UTR           1885538..1885912
FT                   /locus_tag="VIT_08s0007g06830"
FT                   /old_locus_tag="Vv08s0007g06830"
FT   gene            1892869..1911157
FT                   /locus_tag="VIT_08s0007g06820"
FT                   /old_locus_tag="Vv08s0007g06820"
FT   mRNA            join(1892869..1892873,1892874..1893121,1893209..1893306,
FT                   1895021..1895110,1895865..1895917,1901215..1901280,
FT                   1901367..1901420,1902369..1902428,1902939..1903017,
FT                   1903529..1903596,1903695..1903757,1904024..1904128,
FT                   1904508..1904612,1904782..1904889,1904962..1905105,
FT                   1905414..1905596,1905793..1905951,1907185..1907403,
FT                   1909062..1909202,1909291..1909416,1909509..1909559,
FT                   1909839..1909886,1909992..1910129,1910383..1910973,
FT                   1910974..1911157)
FT                   /locus_tag="VIT_08s0007g06820"
FT                   /old_locus_tag="Vv08s0007g06820"
FT                   /product="unknown predicted protein"
FT   5'UTR           1892869..1892873
FT                   /locus_tag="VIT_08s0007g06820"
FT                   /old_locus_tag="Vv08s0007g06820"
FT   CDS_pept        join(1892874..1893121,1893209..1893306,1895021..1895110,
FT                   1895865..1895917,1901215..1901280,1901367..1901420,
FT                   1902369..1902428,1902939..1903017,1903529..1903596,
FT                   1903695..1903757,1904024..1904128,1904508..1904612,
FT                   1904782..1904889,1904962..1905105,1905414..1905596,
FT                   1905793..1905951,1907185..1907403,1909062..1909202,
FT                   1909291..1909416,1909509..1909559,1909839..1909886,
FT                   1909992..1910129,1910383..1910973)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06820"
FT                   /old_locus_tag="Vv08s0007g06820"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIB4"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIB4"
FT                   /protein_id="CBI29990.3"
FT                   /translation="MASRQGSKSKRTGSSTLKAANSPSSSTTSSSKHFLETSIDGLSSP
FT                   ASSSARSKPQYFYSESLPLDTERSKENVTVTVRFRPLSQREIRQGEEIAWYADGETIVR
FT                   NEHNPSIAYAYDRVFGPTTTTRHVYDVAAQHIVGGAMEGINGTIFAYGVTSSGKTHTMH
FT                   GDQRSPGIIPLAVKDAFSIIQETPSREFLLRVSYLEIYNEVVNDLLNPAGQNLRIREDL
FT                   QGTFVEGIKEEVVLSPAHALSLIAAGEEHRHVGSTNFNLLSSRSHTIFTLTIESSPCGE
FT                   NSEGEAVNLSQLNLIDLAGSESSRAETTGVRRKEGSYINKSLLTLGTVISKLTDGRATH
FT                   IPYRDSKLTRLLQSSLSGHGRVSLICTVTPSSSNSEETHNTLKFAHRAKHIEIQAAQNK
FT                   IIDEKSLIKKYQNEIRSLKEELDQLKRGIVVPRLTNKGEDDLVLLKQKLEDGQVRLQSR
FT                   LEQEEEAKAALLGRIQRLTKLILVSTKTSQPSRLPQRPGPRRRHSFGEEELAYLPYKRR
FT                   DLILDDENIDLYVSLEGNAETPDDTLKEEKKTRKHGLLNWLKLRKRDSGTGSPSDKSSG
FT                   IKSISTPSTPQADSVNLPTESRLSHSLLTEGSPIDLFSETRQDREVPVDDFLGQETPLT
FT                   SIKTMDQIDLLREQQKILSGEVALHSSALKRLSEEAAKNPRKEQIHVEMRKLNDEIKGK
FT                   NEQIALLEKQIADSIAASHNKMDKLEISQSISELVGQLNEKSFELEVKVADNRIIQEQL
FT                   NQKSHECEGLQETVASLKQQLSEALESRNVSPVIGHELHTETKNTVQAQAAEIEDLKQK
FT                   LTEVTESKEQLEFRNQKLAEESSYAKGLASAAAVELKALSEEVAKLMNQNERLAAELAA
FT                   QKNSPNNRRAISAPRNGRRDSHIKRADQGVSPADVKRELALSRERELSYEASLLERDQR
FT                   EAELQIKVEESKQREAYLENELANMWVLVAKLKKSQGAESGVSDSTRETQRVDSFGIWN
FT                   ESMVTKGFQ"
FT   3'UTR           1910974..1911157
FT                   /locus_tag="VIT_08s0007g06820"
FT                   /old_locus_tag="Vv08s0007g06820"
FT   gene            complement(1924208..1930104)
FT                   /locus_tag="VIT_08s0007g06800"
FT                   /old_locus_tag="Vv08s0007g06800"
FT   mRNA            complement(join(1924208..1924413,1924414..1924585,
FT                   1924672..1924775,1924863..1924932,1925002..1925045,
FT                   1925122..1925226,1925325..1925446,1925680..1925767,
FT                   1925873..1925959,1926043..1926111,1926188..1926517,
FT                   1926649..1926715,1926827..1926885,1927742..1927999,
FT                   1928089..1928154,1928270..1928487,1928587..1928686,
FT                   1928808..1928927,1929016..1929123,1929587..1929689,
FT                   1929807..1929838,1929943..1930104))
FT                   /locus_tag="VIT_08s0007g06800"
FT                   /old_locus_tag="Vv08s0007g06800"
FT                   /product="Cytosine-specific methyltransferase"
FT   3'UTR           complement(1924208..1924413)
FT                   /locus_tag="VIT_08s0007g06800"
FT                   /old_locus_tag="Vv08s0007g06800"
FT   CDS_pept        complement(join(1924414..1924585,1924672..1924775,
FT                   1924863..1924932,1925002..1925045,1925122..1925226,
FT                   1925325..1925446,1925680..1925767,1925873..1925959,
FT                   1926043..1926111,1926188..1926517,1926649..1926715,
FT                   1926827..1926885,1927742..1927999,1928089..1928154,
FT                   1928270..1928487,1928587..1928686,1928808..1928927,
FT                   1929016..1929123,1929587..1929689,1929807..1929838,
FT                   1929943..1930104))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06800"
FT                   /old_locus_tag="Vv08s0007g06800"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIB5"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR001025"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="InterPro:IPR023779"
FT                   /db_xref="InterPro:IPR023780"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIB5"
FT                   /protein_id="CBI29991.3"
FT                   /translation="MAKRKGASEEAAPLQPCVVKKTKKSRAAAEASVVGAPISVNEARQ
FT                   KWPQRYISTFRKGSDSRTKDESIEAEDILQARRHFTEAVVDGCIYKLYDYAYVKAEDGQ
FT                   PDFIAKIVELFETIDREPYFTAQWFFRAEDTVIKDHAHLVDQKRVFYSDMRDDNPLDCI
FT                   VSKVEIVQVAPNVDLAEKEKTIPPCDLYYDMSYSLKHLTFANLLTENSRTESDESSTIS
FT                   SEIGLNSTTDGINSAIGESSQVHKFQGSGMTLLDLYSGCGAMSTGLCLGASLSGLKLVT
FT                   RWAVDINPHACESLKLNHPETEVRNEAAEDFLSLLKEWATLCEDFSLLGSRRPEVVNPI
FT                   SNRSGSDDEEDADGDDGSPVPRGEFEVKKLVAICYGDPNEINKPGLYFKVRWKGYGPSD
FT                   DTWEPIEGLSKCKKSVKEFVKKGYRSSILPLPGDVDFICGGPPCQGVSGFNRFRNTEAP
FT                   LDDPKNHQLVVFMDIVNYLKPKYVLMENVVDILKFAGGFLGRYAMGRLVSMNYQARLGM
FT                   MAAGSYGVPQYRMRVFLWGAHPMEKLPPYPLPTHDVIGRGVVPNEFEEITVGYDKSELC
FT                   KLEKALFLGDAISDLPPVTNYNGQDEMPYNKAAHTEFQRYIRLRKHDMVYCSDAEKDAS
FT                   EPPMLYDHRPLQLNEDDNERVCRIPKKKGANFRDLPGVMVGSDNRVEWDPSMERVLLPS
FT                   GKPLVPDYAMSFVRGKSTKPFARLWWDEIVATVVTRAEPHNQAIIHPTQDRVLTIRENA
FT                   RFQGFPDCYKLCGPVKERYIQVGNAVAVPVALALGYSFGMASQGLCDDHPLATLPFKFP
FT                   ECLAKPSSTPRNPGS"
FT   gene            complement(1933356..1934298)
FT                   /locus_tag="VIT_08s0007g06790"
FT                   /old_locus_tag="Vv08s0007g06790"
FT   mRNA            complement(join(1933356..1933560,1933561..1934142,
FT                   1934143..1934298))
FT                   /locus_tag="VIT_08s0007g06790"
FT                   /old_locus_tag="Vv08s0007g06790"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(1933356..1933560)
FT                   /locus_tag="VIT_08s0007g06790"
FT                   /old_locus_tag="Vv08s0007g06790"
FT   CDS_pept        complement(1933561..1934142)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06790"
FT                   /old_locus_tag="Vv08s0007g06790"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIB6"
FT                   /db_xref="InterPro:IPR002809"
FT                   /db_xref="InterPro:IPR008559"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIB6"
FT                   /protein_id="CBI29992.3"
FT                   /translation="MAPSALLSGSKYSDSLAVVGISICTAIICEAISWLLIYRTTSYKT
FT                   LRSSIDRAAKKLETMKTTSDAQKFTKKSKTKKMDRVETSLKESSRDLSLFKFKSGAVVA
FT                   LVLFAVFGLLNSLFEGKSVAKLPFVPISIVMKMSHRGLNGNDPTDCSMAFLYFLCSISI
FT                   RTNLQKFLGFSPPRGAAGAGLFPMPDPKTN"
FT   5'UTR           complement(1934143..1934298)
FT                   /locus_tag="VIT_08s0007g06790"
FT                   /old_locus_tag="Vv08s0007g06790"
FT   gene            1938189..1940962
FT                   /locus_tag="VIT_08s0007g06780"
FT                   /old_locus_tag="Vv08s0007g06780"
FT   mRNA            join(1938189..1938284,1939220..1939426,1939427..1940027,
FT                   1940622..1940836,1940837..1940962)
FT                   /locus_tag="VIT_08s0007g06780"
FT                   /old_locus_tag="Vv08s0007g06780"
FT                   /product="Predicted protein"
FT   5'UTR           1938189..1938284
FT                   /locus_tag="VIT_08s0007g06780"
FT                   /old_locus_tag="Vv08s0007g06780"
FT   CDS_pept        join(1939427..1940027,1940622..1940836)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06780"
FT                   /old_locus_tag="Vv08s0007g06780"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLH2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLH2"
FT                   /protein_id="CCB55228.1"
FT                   /translation="MNALFFSSSPLLATPSRKAPPFIPLRHHCYSHYSSYHRGNYPSFP
FT                   LLSSSIHRLTVGAATPSNEEAVSVIDFEDFMEKDWSFLDSDGTNSEEEHKQKTDWIISK
FT                   GNIGENSRVLVSTGAEEFVDQLVDSSPCQLLLVVHDSLFVLAGIKEKYDKVKCWQGELI
FT                   YVPEKWTPFDVVFLYFLPALPFELDRIFGELAKRCLPGARVVISHLQGREVLEQQRRQY
FT                   PDVIISDLPDKMTLQKVAADHSFEMTEFVEEPSFYLAVLNFREVRNSKD"
FT   3'UTR           1940837..1940962
FT                   /locus_tag="VIT_08s0007g06780"
FT                   /old_locus_tag="Vv08s0007g06780"
FT   gene            complement(1942424..1952117)
FT                   /locus_tag="VIT_08s0007g06770"
FT                   /old_locus_tag="Vv08s0007g06770"
FT   mRNA            complement(join(1942424..1942710,1942711..1945023,
FT                   1945143..1945271,1946202..1946333,1946455..1946826,
FT                   1946989..1947130,1950456..1950715,1950815..1951183,
FT                   1951980..1952117))
FT                   /locus_tag="VIT_08s0007g06770"
FT                   /old_locus_tag="Vv08s0007g06770"
FT                   /product="Predicted protein"
FT   3'UTR           complement(1942424..1942710)
FT                   /locus_tag="VIT_08s0007g06770"
FT                   /old_locus_tag="Vv08s0007g06770"
FT   CDS_pept        complement(join(1942711..1945023,1945143..1945271,
FT                   1946202..1946333,1946455..1946826,1946989..1947130,
FT                   1950456..1950715,1950815..1951183,1951980..1952117))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06770"
FT                   /old_locus_tag="Vv08s0007g06770"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLH3"
FT                   /protein_id="CCB55229.1"
FT                   /translation="MPGLAQRNSNDHHHHQHNQFSNAQSTVYNGFWSKHRDDISFNQLQ
FT                   KFWSELSPQARQELLRIDKQTLFEQARKNMYCSRCNGLLLEGFLQIVMYGKSLQQEGAG
FT                   GQLPNHRSGALKIQNDGVLSTTNGCQDEAQDPSVHPWGGLTTTRDGALTLLDSFLFSHS
FT                   LKGLQNVFDSARGRERERELLYPDACGGGGRGWISQGMAGYGRGHGTRETCALHTARLS
FT                   CDTLVDFWSALGEETRQSLLRMKEEDFIERLMYRFDSKRFCRDCRRNVIREFKELKELK
FT                   RMRKEPRCTTWFCVADTAFQYEVSDNTIQADWHQTFTDTVGTYHHFEWAVGTGEGKSDI
FT                   LEFENVGMNGSVRVNGLDLGSLGACYITLRAWKLDGRCSELSVKAHALKGQQCVHCRLV
FT                   VGDGFVTITRGESIRRFFEHAEEAEEEEDDDSMDKDGNELDGECSRPQKHAKSPELARE
FT                   FLLDAATVIFKEQVEKAFREGTARQNAHSIFVCLALKLLEERVHVACKEIITLEKQMKL
FT                   LEEEEKEKREEEERKERRRTKEREKKLRRKERLKEKERDKEKKCSESTQSSVDPEVSKD
FT                   ESSLSVDEEPNNIIMNSDSVSETGDTVLSESLSPYIQDEHFLNGYITSKMQNHSYDSAD
FT                   GECTNLKDGTGSFAMEHSKFSRRRMKFRKDFQLDPALKWSDRRRYAVVSESGAIVNKND
FT                   LRFHGDNFETPSRTVNGLNRQSRINATKPNARNCGHKFGEKFHCSNNRMSDRYDSHSCS
FT                   CNQHSDYRAKVEPQLSTIRLGRDTKSVSKSESALDISKQFYRGNKYSQTDYIRESCGRP
FT                   KSKTIAGSNPHGNLLHTKKVWEPMESQKYPRSNSDSDVTLRSSSFRIEEMEEPDNLIKS
FT                   SDSTFSGEINCADNHLNESSNSSSIMDTDCQNGFHVGEKEPYYSTEAADEVTGLSSMTN
FT                   PCLDETSEPTMSSTSNSDNCSSCLSEGDSNTASSNPLNLESSSTSDSEDASQQSEGRET
FT                   SVCIQNGFPECHEVVVEKKQIENGKEAFRSKMSAGFSPDSARNSLPANAPTKTAQNLDS
FT                   GKPNVSMGSQHQGMLPTMHKQNLHYPMFQAPSTMSYYHQNPVSWPAASANGLMPFPHPN
FT                   HYLFTSPLGYGLNGSSRLCMQYSALQHLTPPVLNPGQLPVYHPITKANGVNSEEQEKIF
FT                   KTGGAQEAFNEAKKERVPSAGPRPTDAPPNGDDGQNGNSAKLHTGNQSFSLFHFGGPVA
FT                   LSTGNKVNPVPSKEGNVGDYSSKFSADHVDGDHACNKKETTIEEYNLFAASNGMKFSFF
FT                   "
FT   gene            complement(1960966..1965032)
FT                   /locus_tag="VIT_08s0007g06760"
FT                   /old_locus_tag="Vv08s0007g06760"
FT   mRNA            complement(join(1960966..1961119,1961120..1961299,
FT                   1961835..1961968,1962810..1962960,1963077..1963255,
FT                   1963761..1963959,1964238..1964410,1964837..1965032))
FT                   /locus_tag="VIT_08s0007g06760"
FT                   /old_locus_tag="Vv08s0007g06760"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(1960966..1961119)
FT                   /locus_tag="VIT_08s0007g06760"
FT                   /old_locus_tag="Vv08s0007g06760"
FT   CDS_pept        complement(join(1961120..1961299,1961835..1961968,
FT                   1962810..1962960,1963077..1963255,1963761..1963959,
FT                   1964238..1964410,1964837..1965032))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06760"
FT                   /old_locus_tag="Vv08s0007g06760"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIC0"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIC0"
FT                   /protein_id="CBI29996.3"
FT                   /translation="MDPVKTPLLSTKGEKPNQHERIRGRDSVTALKRDFFSQLPEKIRS
FT                   QLDPETPFELDLSKTNGLVEGEREYYEKQFATLRSFEEVDSLASSHVTSEEQDREQQTQ
FT                   HERAMKTSNWANIFLLVFKIYATVRSGSLAIAASTLDSLLDLLAGGILWFAHLSMKNIN
FT                   IYKYPIGKLRVQPVGIIVFAAVMATLGFLVLIQAVEELIKNEPSEKMTSEKLVWLYAIM
FT                   LTATVVKLALWFYCRSSGNKIVRAYAKDHYFDVITNIVGLIAAVLGDKFFWWIDPVGAI
FT                   ILAVYTISNWSRTVLDNAVSLVGQSASPEVLQKLTYLVIRHDPKIKRVDTVRAYTFGAL
FT                   HFVEVDIELPEDLPLKEAHAIGESLQIKIEELLEVERAFVHLDFECDHKPEHSVPSKIP
FT                   NSPR"
FT   gene            complement(1972614..1974586)
FT                   /locus_tag="VIT_08s0007g06750"
FT                   /old_locus_tag="Vv08s0007g06750"
FT   mRNA            complement(join(1972614..1972739,1973011..1973097,
FT                   1973184..1973316,1973421..1973694,1973778..1973904,
FT                   1974121..1974377,1974496..1974586))
FT                   /locus_tag="VIT_08s0007g06750"
FT                   /old_locus_tag="Vv08s0007g06750"
FT                   /product="Predicted protein"
FT   CDS_pept        complement(join(1972614..1972739,1973011..1973097,
FT                   1973184..1973316,1973421..1973694,1973778..1973904,
FT                   1974121..1974377,1974496..1974586))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06750"
FT                   /old_locus_tag="Vv08s0007g06750"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIC1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIC1"
FT                   /protein_id="CBI29997.3"
FT                   /translation="MFCCGGEEEENHGQPANQYTAPPRGGNAYGGGGTGEPRNSNTAKS
FT                   GAPQKILPIETPAMSLDELNRLTSNFGSKALIGEGSYGRVFYAKLSSGEGAAIKKLDTS
FT                   SSQEPDSDFAAQLSIVSRLTHENFVGLLGYCLEADNKILVYQFATMGSLHDMLHGRKGV
FT                   QGAEPGPVLSWNQRVKIAYGAAKGLEYLHEKVQPSIVHRDVRSSNVLLFDDFLAKIADF
FT                   NLSNQSSDTAARLHSTRVLGTFGYHAPEYAMTGQITQKSDVYSFGVVLLELLTGRKPVD
FT                   HTMPKGQQSLVTWATPRLSEDKVKQCVDPKLNNDYPAKAIAKMAAVAALCVQYEADFRP
FT                   NMTIVVKALQPLLNPKPAGPDSNA"
FT   gene            complement(1977021..1980904)
FT                   /locus_tag="VIT_08s0007g06740"
FT                   /old_locus_tag="Vv08s0007g06740"
FT   mRNA            complement(join(1977021..1977183,1977184..1977528,
FT                   1977989..1978375,1979071..1979286,1979287..1979390,
FT                   1980581..1980904))
FT                   /locus_tag="VIT_08s0007g06740"
FT                   /old_locus_tag="Vv08s0007g06740"
FT                   /product="Predicted protein"
FT   3'UTR           complement(1977021..1977183)
FT                   /locus_tag="VIT_08s0007g06740"
FT                   /old_locus_tag="Vv08s0007g06740"
FT   CDS_pept        complement(join(1977184..1977528,1977989..1978375,
FT                   1979071..1979286))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06740"
FT                   /old_locus_tag="Vv08s0007g06740"
FT                   /product="unknown"
FT                   /db_xref="GOA:Q9XGC3"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR008974"
FT                   /db_xref="InterPro:IPR013010"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018121"
FT                   /db_xref="UniProtKB/TrEMBL:Q9XGC3"
FT                   /protein_id="CBI29998.3"
FT                   /translation="MAPGGSTYKEVLESHSTVTDYDIAMTKADTNLTPAKTTAGLSGKK
FT                   GISSPNGVHELLECPVCTSLMYPPIYQCPSGHTLCSNCKSRVHNCCPTCRHELGDIRCL
FT                   ALEKVAESLELPCRYQSLGCHDIFPYYSKLKHEQQCRFHPYNCPYAGFECSVTGDIPTL
FT                   VEHLKGDHKVDMHDGCTFNHRYVKSNPQEVENATWMLTVFNCFGKQFCLHFEAFQLGTA
FT                   PVYMAFLRFMGDDNEAKKFSYSLEVGGNSRKLIWQGVPRSIRDSHRKVRDSQDGLIIQR
FT                   NLALYFSGGDRQELKLRVTGRIWKESELWKDNGC"
FT   5'UTR           complement(1980581..1980904)
FT                   /locus_tag="VIT_08s0007g06740"
FT                   /old_locus_tag="Vv08s0007g06740"
FT   gene            1984853..1988112
FT                   /locus_tag="VIT_08s0007g06730"
FT                   /old_locus_tag="Vv08s0007g06730"
FT   mRNA            join(1984853..1984970,1984971..1987240,1987369..1987663,
FT                   1987664..1987830,1987929..1988112)
FT                   /locus_tag="VIT_08s0007g06730"
FT                   /old_locus_tag="Vv08s0007g06730"
FT                   /product="unknown predicted protein"
FT   5'UTR           1984853..1984970
FT                   /locus_tag="VIT_08s0007g06730"
FT                   /old_locus_tag="Vv08s0007g06730"
FT   CDS_pept        join(1984971..1987240,1987369..1987663)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06730"
FT                   /old_locus_tag="Vv08s0007g06730"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLH4"
FT                   /db_xref="InterPro:IPR007259"
FT                   /db_xref="InterPro:IPR040457"
FT                   /db_xref="InterPro:IPR041470"
FT                   /db_xref="InterPro:IPR042241"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLH4"
FT                   /protein_id="CCB55230.1"
FT                   /translation="MEEEHRVTDLIKELVLRLLSQNPQNPSSSIDTQKSLRYAIRILSS
FT                   LMTPSIAPDSAAIAESIKRQLATQGKSSQALAFADLYTKFASKNGPGSIENKWAVLYLL
FT                   KVISEDRKNQKSRSDSRVSSGFSASVGLPALFDAESGGYSGVSRNRETLEKGWNNGVLL
FT                   VSKDPENIREIAVREFANLVKEENEVSEEVLVRDVLYACQGIDGKYVKFDKSVDGYLLR
FT                   DSIKVPRATRITVQKLCELGWLFRKVKGYISESMDRFPAEDVGTVGQAFCAALQDELSH
FT                   YYKLLAVLEAQSMNPIPLVSETANSGTYLSLRRLSVWFAEPMVKMRLMAVLVDKCRVLR
FT                   GGAMAGAIHLHAQHGDPLVHEFMRQLLCRVCSPLFEMVRSWVLEGELEDIFAEFFVLGQ
FT                   PVKAESLWREGYRLHAGMLPSFISQSLAQRILRTGKSINFLRVCCEDRGWADAATEAAA
FT                   AAGTTTRRGGLGYGETDALESLVIEAAKRIDKHLLDVMYKQYKFKEHCLAIKRYLLLGQ
FT                   GDFVQYLMDIVGPELSEPANTISSFKLAGLLESAIRSSNAQYDDRDILDRLRVKMMPHG
FT                   TGDRGWDVFSLEYDARVPLNTVFTESVMARYLRIFNFLWKLRRVEHALIGAWKTMKPNC
FT                   ITSNSFIKLQSAVKLQLLSTLRRCQVLWDEMNHFVSNLQYYIMFEVLEVSWSNFSNEME
FT                   AAKDLDDLLAAHDKYLNSIVEKSLLGERSQNLYKTLFVLFDLILRFRSHVDRLYEGIHE
FT                   LQSRTMESLSPSRDKTRSRRLLNDKTAEPGAWISDGRKALTQRAGEFLRNMGQDLDAIA
FT                   KEYSSLLEGFISQLPVQQHIDLKFLLFRLDFTEFYCQLHPNM"
FT   3'UTR           join(1987664..1987830,1987929..1988112)
FT                   /locus_tag="VIT_08s0007g06730"
FT                   /old_locus_tag="Vv08s0007g06730"
FT   gene            complement(1992542..1997205)
FT                   /locus_tag="VIT_08s0007g06720"
FT                   /old_locus_tag="Vv08s0007g06720"
FT   mRNA            complement(join(1992542..1992600,1992601..1992776,
FT                   1992857..1992914,1994651..1994721,1995431..1995554,
FT                   1995701..1995772,1996369..1996701,1996702..1996812,
FT                   1997166..1997205))
FT                   /locus_tag="VIT_08s0007g06720"
FT                   /old_locus_tag="Vv08s0007g06720"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(1992542..1992600)
FT                   /locus_tag="VIT_08s0007g06720"
FT                   /old_locus_tag="Vv08s0007g06720"
FT   CDS_pept        complement(join(1992601..1992776,1992857..1992914,
FT                   1994651..1994721,1995431..1995554,1995701..1995772,
FT                   1996369..1996701))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06720"
FT                   /old_locus_tag="Vv08s0007g06720"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIC4"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIC4"
FT                   /protein_id="CBI30000.3"
FT                   /translation="MKRTYRFKRVTKPKKSIQPDDSIHTSEKSITIGARPKSQSQPQPG
FT                   ILSISNPTLSFNELKILPPDLFQMDALDLVLKILPPDFFQIDALDLAPCLLGKLLRRDD
FT                   VILRITEVEAYRPNDSACHGRFGRTPRTAPVFGPGGHAYVYLCYGLHTMLNVVADKEEV
FT                   GAAVLVRSCEPVCGLETIQQRRGQITEKPVLLTGPGKVCQALGISTEWSNHRLYTPGGL
FT                   ELLDGPEPEKILVGPRVGIQYALPDDVNAPWRFAIAGSPWISAPKKTLTLPSSEI"
FT   gap             1996818..1996917
FT                   /estimated_length=100
FT   5'UTR           complement(1997166..1997205)
FT                   /locus_tag="VIT_08s0007g06720"
FT                   /old_locus_tag="Vv08s0007g06720"
FT   gene            1997564..1999016
FT                   /locus_tag="VIT_08s0007g06710"
FT                   /old_locus_tag="Vv08s0007g06710"
FT   mRNA            join(1997564..1997574,1997575..1998444,1998545..1998624,
FT                   1998733..1998826,1998827..1999016)
FT                   /locus_tag="VIT_08s0007g06710"
FT                   /old_locus_tag="Vv08s0007g06710"
FT                   /product="unknown predicted protein"
FT   5'UTR           1997564..1997574
FT                   /locus_tag="VIT_08s0007g06710"
FT                   /old_locus_tag="Vv08s0007g06710"
FT   CDS_pept        join(1997575..1998444,1998545..1998624,1998733..1998826)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06710"
FT                   /old_locus_tag="Vv08s0007g06710"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLH5"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR015310"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="InterPro:IPR036338"
FT                   /db_xref="InterPro:IPR039981"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLH5"
FT                   /protein_id="CCB55231.1"
FT                   /translation="MAKYGEGDKRWIVEDRPDGANVHNWHWAEKNCLEWSRTLLSKLLS
FT                   ELTILDGEGNLYIKTKTLEKLEGEAYVNVRKGKIIPGYEIALTLSWEGEAKDPDGKSVI
FT                   KCDGTVEIPYIADENADEDPEVKILVKDEGPLGKRLKEAMVAKGKPVILEKVRVYVQSM
FT                   AKGGPAKDELEVKKAPGSAAKSSVSSAAAASNVGAQKEVKKEEKKGFKTITLTEKFSCR
FT                   AKDMFEIMMDENRWKGFTQSNAKISKEVGGEISIFDGSVTGVNMELVEGKLIVQKWRFG
FT                   SWPDGVNSTVRIAFDEPEPGLTVVKLTQTGIPEEDRYGNATVVENTERGWRDLIFHKIR
FT                   AVFGFGI"
FT   3'UTR           1998827..1999016
FT                   /locus_tag="VIT_08s0007g06710"
FT                   /old_locus_tag="Vv08s0007g06710"
FT   gene            complement(2002000..2005604)
FT                   /locus_tag="VIT_08s0007g06700"
FT                   /old_locus_tag="Vv08s0007g06700"
FT   mRNA            complement(join(2002000..2002182,2002183..2002281,
FT                   2002382..2002399,2002518..2002584,2003001..2003075,
FT                   2003190..2003488,2003489..2003707,2005306..2005604))
FT                   /locus_tag="VIT_08s0007g06700"
FT                   /old_locus_tag="Vv08s0007g06700"
FT                   /product="Predicted protein"
FT   3'UTR           complement(2002000..2002182)
FT                   /locus_tag="VIT_08s0007g06700"
FT                   /old_locus_tag="Vv08s0007g06700"
FT   CDS_pept        complement(join(2002183..2002281,2002382..2002399,
FT                   2002518..2002584,2003001..2003075,2003190..2003488))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06700"
FT                   /old_locus_tag="Vv08s0007g06700"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLH6"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLH6"
FT                   /protein_id="CCB55232.1"
FT                   /translation="MSILAANTHIVYREVLLRDPQNQLSGGGSCLFWSRSPGFGVDGRR
FT                   GEWRKTKKRDFRVEAFWPDMTRPNVIEMQPIKDCDQLDQILARAQELPQPIIIDWMAAW
FT                   CRKCIYLKPKLEKLAAEYDTKIKFYSVDVNNVSQALVKRGNITKMPTIQLWKDGEMKAE
FT                   VIGGHKAWIVIDEVREMIKKFV"
FT   5'UTR           complement(2005306..2005604)
FT                   /locus_tag="VIT_08s0007g06700"
FT                   /old_locus_tag="Vv08s0007g06700"
FT   gene            complement(2005605..2007147)
FT                   /locus_tag="VIT_08s0007g06690"
FT                   /old_locus_tag="Vv08s0007g06690"
FT   mRNA            complement(join(2005605..2006179,2006288..2006325,
FT                   2006641..2006714,2006888..2007115,2007116..2007147))
FT                   /locus_tag="VIT_08s0007g06690"
FT                   /old_locus_tag="Vv08s0007g06690"
FT                   /product="putative uncharacterized protein"
FT   CDS_pept        complement(join(2005605..2006179,2006288..2006325,
FT                   2006641..2006714,2006888..2007115))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06690"
FT                   /old_locus_tag="Vv08s0007g06690"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLH7"
FT                   /db_xref="InterPro:IPR014977"
FT                   /db_xref="InterPro:IPR031137"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLH7"
FT                   /protein_id="CCB55233.1"
FT                   /translation="MRIRGRGAPPLPSDLPSSPPPSQLHHGNDQSVQSPARNQSPPPPA
FT                   DDRRTSDLRVQTDGLICSEGEGVGAKKVSSKDHEIGVGEEEGGSEEMGLASPSNRRSSN
FT                   SSPSPETSAVMEHWREEDRAVPLKKRRATFEMETMMEIKDEKAKKRMMRVRRNRPKKWV
FT                   EEDEGEENGMAKNNGKKGRSGAGIILEGSRCSRVNGRGWRCHQQTLVGYSLCEHHLGKG
FT                   RLKSMTSVKSSPLTAPVLHKPTKPETNTEDEEESDGYEGTMVAKKGKKIGAVKARSMSS
FT                   LLGQTVASPLPVTLQLSNGNCDI"
FT   5'UTR           complement(2007116..2007147)
FT                   /locus_tag="VIT_08s0007g06690"
FT                   /old_locus_tag="Vv08s0007g06690"
FT   gene            2018541..2021622
FT                   /locus_tag="VIT_08s0007g06680"
FT                   /old_locus_tag="Vv08s0007g06680"
FT   mRNA            join(2018541..2018724,2018725..2019707,2019939..2020131,
FT                   2020234..2020427,2020507..2020665,2020774..2021152,
FT                   2021153..2021622)
FT                   /locus_tag="VIT_08s0007g06680"
FT                   /old_locus_tag="Vv08s0007g06680"
FT                   /product="Predicted protein"
FT   5'UTR           2018541..2018724
FT                   /locus_tag="VIT_08s0007g06680"
FT                   /old_locus_tag="Vv08s0007g06680"
FT   CDS_pept        join(2018725..2019707,2019939..2020131,2020234..2020427,
FT                   2020507..2020665,2020774..2021152)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06680"
FT                   /old_locus_tag="Vv08s0007g06680"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLH8"
FT                   /db_xref="InterPro:IPR025846"
FT                   /db_xref="InterPro:IPR026057"
FT                   /db_xref="InterPro:IPR029962"
FT                   /db_xref="InterPro:IPR029989"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLH8"
FT                   /protein_id="CCB55234.1"
FT                   /translation="MARTRRTMFFVYGFMFAFIVFTVFLAFSPANASSPWFTNIFATGT
FT                   GSGSSSTSDDSYRSQFSSFFSFWFPNSSQEQVHNFTSVPTPTTGTNATRSNDAATFQSP
FT                   QKSKDPSGAKNETKVEALTPNRTAIAPPKPLVSANQSAISSVKSPPSEKGGSGKDDKGV
FT                   ASNSTAKSPSTEKSGSETKDKGVAEKRVASNSTVKSPPTEKNGSETKDKGVAEKSGVKS
FT                   PPTEKSGSGKEDKGVAEKGVVSNYTASLLKKQSNGTDSKQRTGDWLESLMNCNLFEGQW
FT                   VKDDSYPLYKPGSCSLIDEQFNCFLNGRPDKDYMKLKWKPKGCDLPRLNGSHMLELLRG
FT                   KRLVFVGDSLNRNMWESLVCILRNSVKDRTKVYEASGRHHFRTEASYSFIFEEYHCSVE
FT                   FFVSPFLVQEWEMPDKNGSKKETLRLDKIPTSSDKYKTADIIIFNTGHWWTHDKTSKGK
FT                   DYYQEGSHVYGELNVMEAFRKALTTWARWVDANVNPAKSLVFFRGYSSSHFSGGQWNSG
FT                   GQCDGETEPIRNETYIPDYPPKMIVLEKILRGMKTQVTYLNITRITDYRKDGHPSIYRK
FT                   QNLSDEERRSPLRFQDCSHWCLPGVPDAWNELLYAEILIRQKQQQQQQQQKLQQLQKRP
FT                   "
FT   3'UTR           2021153..2021622
FT                   /locus_tag="VIT_08s0007g06680"
FT                   /old_locus_tag="Vv08s0007g06680"
FT   gene            complement(2027019..2028430)
FT                   /locus_tag="VIT_08s0007g06670"
FT                   /old_locus_tag="Vv08s0007g06670"
FT   mRNA            complement(join(2027019..2027057,2027058..2027376,
FT                   2027503..2027582,2027705..2028039,2028169..2028430))
FT                   /locus_tag="VIT_08s0007g06670"
FT                   /old_locus_tag="Vv08s0007g06670"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(2027019..2027057)
FT                   /locus_tag="VIT_08s0007g06670"
FT                   /old_locus_tag="Vv08s0007g06670"
FT   CDS_pept        complement(join(2027058..2027376,2027503..2027582,
FT                   2027705..2028039,2028169..2028430))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06670"
FT                   /old_locus_tag="Vv08s0007g06670"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLH9"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR003106"
FT                   /db_xref="InterPro:IPR006712"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLH9"
FT                   /protein_id="CCB55235.1"
FT                   /translation="MELALSLGDASKPFTFLDKTQKMVNKDAGFCMGLGTGIIGKGQGH
FT                   GGEEDERKVSSDPPVQLDLLPFSPVPRHHPSSQLRFPWLADNLMSEPGSSDGSGRALDV
FT                   NRFPVAVAAAEDADDGGALSSPNSTVSSFQMDFSIYRSGNGGRSKRDLEATVNEVETSR
FT                   ASDDDENGSTRKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQN
FT                   RRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKTSQPFYMQLPATTLTMC
FT                   PSCERVATTSTSSSAAAAAPTSTSATLARTRLFPFSQAHVHQAPAHQAAS"
FT   gene            complement(2041710..2043755)
FT                   /locus_tag="VIT_08s0007g06660"
FT                   /old_locus_tag="Vv08s0007g06660"
FT   mRNA            complement(join(2041710..2042002,2042003..2043208,
FT                   2043209..2043517,2043603..2043755))
FT                   /locus_tag="VIT_08s0007g06660"
FT                   /old_locus_tag="Vv08s0007g06660"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(2041710..2042002)
FT                   /locus_tag="VIT_08s0007g06660"
FT                   /old_locus_tag="Vv08s0007g06660"
FT   CDS_pept        complement(2042003..2043208)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06660"
FT                   /old_locus_tag="Vv08s0007g06660"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLI0"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLI0"
FT                   /protein_id="CCB55236.1"
FT                   /translation="MNLDLNLGPGPEPGSGSNDPVSLNDWVQEPVHRIRESLRLRTRQR
FT                   WRWRQVQIPLEARNISMELMANTGNGSRPQEGEGSVAAEERDNEVPKMCENKTTHVEDE
FT                   GLGGKDDIEKGSSGEGSFFDCNICLDLARDPVVTCCGHLFCWPCLYRWLHVHSDAKECP
FT                   VCKGEVTVKNVTPIYGRGNNIHEPEEDSSLKVPLRPHARRIESFRQTIQRNVGFPVEEM
FT                   IRRLGSRIDLTRDLVQNQDQDGARDTLERSNSLINRLLTSRGIRREQNVTVPTDDVVDL
FT                   TQSGTNNSEAVESRRIPSLFPRRSQAHRSSTLSSFSSAFEAYLRSQPIGRQEQPPPVDD
FT                   RDSFSSIAAVIHSESQTVDTAVEIDSMVSLSTSSSRRRNDASRVSDVDSGDSRAPRRRR
FT                   LN"
FT   5'UTR           complement(2043603..2043755)
FT                   /locus_tag="VIT_08s0007g06660"
FT                   /old_locus_tag="Vv08s0007g06660"
FT   gene            complement(2045206..2046589)
FT                   /locus_tag="VIT_08s0007g06650"
FT                   /old_locus_tag="Vv08s0007g06650"
FT   mRNA            complement(join(2045206..2045314,2045315..2045745,
FT                   2045831..2045996,2046081..2046272,2046369..2046587,
FT                   2046588..2046589))
FT                   /locus_tag="VIT_08s0007g06650"
FT                   /old_locus_tag="Vv08s0007g06650"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(2045206..2045314)
FT                   /locus_tag="VIT_08s0007g06650"
FT                   /old_locus_tag="Vv08s0007g06650"
FT   CDS_pept        complement(join(2045315..2045745,2045831..2045996,
FT                   2046081..2046272,2046369..2046587))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06650"
FT                   /old_locus_tag="Vv08s0007g06650"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TID0"
FT                   /db_xref="InterPro:IPR000823"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="InterPro:IPR033905"
FT                   /db_xref="UniProtKB/TrEMBL:D7TID0"
FT                   /protein_id="CBI30006.3"
FT                   /translation="MASSPSHFFVLIATIFISSLFHPSTAQLNSSFYSCTCPNAYTIVR
FT                   SIVHQAMASDTRIGASLVRLHFHDCFANGCDASILLDDSPSIQSEKHAAPNFKSARGFE
FT                   VVDRIKAALECSCRGVVSCADILALASEASVSLSGGPSWTVLLGRRDSTTANQAGANTS
FT                   IPSPSEGLANISNKFSAVGLEITDLVALSGAHTFGKAQCRTFSERLYNFKGTGGPDPTL
FT                   NATYLAVLQQICPEDGNGGFGLANLDPTNTSDGHDFDNNYFSNLQSLQGLLQSDQELFS
FT                   TPNAKIIAIVNSFSGDQSAFFQSFAQSMVKMGNISPLTGKDGEIRLNCRKVNAG"
FT   5'UTR           complement(2046588..2046589)
FT                   /locus_tag="VIT_08s0007g06650"
FT                   /old_locus_tag="Vv08s0007g06650"
FT   gene            2055746..2057568
FT                   /locus_tag="VIT_08s0007g06640"
FT                   /old_locus_tag="Vv08s0007g06640"
FT   mRNA            join(2055746..2055765,2056420..2056487,2056596..2057254,
FT                   2057255..2057568)
FT                   /locus_tag="VIT_08s0007g06640"
FT                   /old_locus_tag="Vv08s0007g06640"
FT                   /product="Predicted protein"
FT   CDS_pept        join(2055746..2055765,2056420..2056487,2056596..2057254)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06640"
FT                   /old_locus_tag="Vv08s0007g06640"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLI1"
FT                   /db_xref="InterPro:IPR014977"
FT                   /db_xref="InterPro:IPR031137"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLI1"
FT                   /protein_id="CCB55237.1"
FT                   /translation="MGAGADGKGSIFGAETGSGVVPFSSSSDQVGRWCEGEKAFPLKKR
FT                   RGSFERGGGVVPMNQETIMEKEKKMKTKMKTKMNKKCVQENDDEEHGSERETKQGFDSS
FT                   TTTTTAAASSAKKRSRGGALMEGSRCSRVNGRGWRCCQQTLVGYSLCEHHLGKGRLRSM
FT                   SSVRSRAIARNQTQELFNPLSQLPQKNQEQEHPLQEDRADVADDEKPFTGGAKKRVKIG
FT                   MVKARSLSSLLGQPSSAVAVAADDNK"
FT   3'UTR           2057255..2057568
FT                   /locus_tag="VIT_08s0007g06640"
FT                   /old_locus_tag="Vv08s0007g06640"
FT   gene            complement(2060377..2063985)
FT                   /locus_tag="VIT_08s0007g06630"
FT                   /old_locus_tag="Vv08s0007g06630"
FT   mRNA            complement(join(2060377..2061131,2063916..2063985))
FT                   /locus_tag="VIT_08s0007g06630"
FT                   /old_locus_tag="Vv08s0007g06630"
FT                   /product="Predicted protein"
FT   CDS_pept        complement(join(2060377..2061131,2063916..2063985))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06630"
FT                   /old_locus_tag="Vv08s0007g06630"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR004146"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLI2"
FT                   /protein_id="CCB55238.1"
FT                   /translation="MKATFPSKCEIKTLLQKVLKHLPTSGWVYGCNTCNYFLHKPCSKM
FT                   PEILNHPFDPDHTLLLFPNPVYPGGAFICDACREIGTGFSYHCTECQIDLHNLCAFLPT
FT                   SVDHSSHHHTLDLWSGSPYKNEEFLCDICQDPGSKQWLYRCNSCQFDAHMSCALVDIQS
FT                   QHTSKVQKRERQQLGKPQNTPTKSSEPIHRFASWSQSGMRSPWIQTQYSIPRTRDGVMG
FT                   RYHYGRDPIPRFTHTTRDGVMGHVVKGMVDGMAQQAGMAVLQGFLGGFLGGF"
FT   gene            2065241..2066130
FT                   /locus_tag="VIT_08s0007g06620"
FT                   /old_locus_tag="Vv08s0007g06620"
FT   mRNA            join(2065241..2065261,2065262..2066020,2066021..2066130)
FT                   /locus_tag="VIT_08s0007g06620"
FT                   /old_locus_tag="Vv08s0007g06620"
FT                   /product="At2g42060"
FT   5'UTR           2065241..2065261
FT                   /locus_tag="VIT_08s0007g06620"
FT                   /old_locus_tag="Vv08s0007g06620"
FT   CDS_pept        2065262..2066020
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06620"
FT                   /old_locus_tag="Vv08s0007g06620"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR004146"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLI3"
FT                   /protein_id="CCB55239.1"
FT                   /translation="MEYKHFNHEHNLAIFELQAGNGIHCSGCRTLCSNSAYACWKCDFF
FT                   LHLECGNANRAMEHPSHELHHLTLVPYPTYSAGSFVCNACGAPGSSFSYCCSLCEFDLH
FT                   IRCALLPAIISHRAHPHELSLTYGLGPQAKVSSPPNACDICHKLVDNKFWTYSCGPCKF
FT                   QLHTSCATPEMVPISYQADGVSGNAAVEAGPGFYKEENGSGSSQNGSKPAEVEDPVLAT
FT                   QLELMRLQQELELSNQLAKMMASYNLSSLV"
FT   3'UTR           2066021..2066130
FT                   /locus_tag="VIT_08s0007g06620"
FT                   /old_locus_tag="Vv08s0007g06620"
FT   gene            2067068..2069026
FT                   /locus_tag="VIT_08s0007g06610"
FT                   /old_locus_tag="Vv08s0007g06610"
FT   mRNA            2067068..2069026
FT                   /locus_tag="VIT_08s0007g06610"
FT                   /old_locus_tag="Vv08s0007g06610"
FT                   /product="unknown predicted protein"
FT   CDS_pept        2067068..2069026
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06610"
FT                   /old_locus_tag="Vv08s0007g06610"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLI4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000985"
FT                   /db_xref="InterPro:IPR001220"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR019825"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLI4"
FT                   /protein_id="CCB55240.1"
FT                   /translation="MGFSAMVKSLLLATLLLGAIAQARCFTFNFPSFNEDNEKDLILEY
FT                   SVIKHDAIQVTDDVTDASLLKNLSGRALYKSPFRFGSKSKDKASFNSTFVLNISNKTNQ
FT                   GGEGLAFILTGRTDLPQNSHGQWLGIVNESTNGSATAKIVAVEFDTRKSYPEDLDDNHV
FT                   GLDVNSIYSITQQSLQSIKLVSGDNITVKVEYDGELLKVFVGENASTLVISETIDLVTR
FT                   LPEKVYVGFSASTGNDTQLNCVKSWEFSGLDLYKEDPNLLWVWIIVPAVLVLFFVFVFL
FT                   YWKWKCKGEVPVEEVEDDREVEICIQGSSTAPRKFRLEELKAATENFKNKLGEGGFGTV
FT                   YEGFLENKAVAVKRFSRDAREGKQDFIAEVTTIGNLNHKNLVKLLGWCSERNELILVYE
FT                   FMPNKSLDKFIFCNQNPGPETDQITLNWGKRYRIINGVAQALDYLHNGCEKRVLHRDIK
FT                   ASNIMLDSEFNARLGDFGLARTIHCSDQTHHSTKEVAGTPGYMAPESILTWRATVETDI
FT                   YAFGVLVLEVVSGRSPGDQSKKNKYTSLVDWAWENYSRERILDVVDLHLNGDFNKEEAE
FT                   CVLILALACCHPNPYQRPSTKTALRVLTGEVAPPLIPKAKPSFMWPAMEPPSFNEDSKD
FT                   YTFGGDQPSPFAEPSGR"
FT   gene            2073329..2078385
FT                   /locus_tag="VIT_08s0007g06600"
FT                   /old_locus_tag="Vv08s0007g06600"
FT   mRNA            join(2073329..2073504,2077203..2077218,2077219..2077495,
FT                   2078325..2078385)
FT                   /locus_tag="VIT_08s0007g06600"
FT                   /old_locus_tag="Vv08s0007g06600"
FT   CDS_pept        join(2073329..2073504,2077203..2077218)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06600"
FT                   /old_locus_tag="Vv08s0007g06600"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLI5"
FT                   /protein_id="CCB55241.1"
FT                   /translation="MSHQACLALKMSDDLRDLVKGVVRVCLLISCGNGSGESQVSYEPS
FT                   CPEKLNRRLQILSGNLVK"
FT   3'UTR           join(2077219..2077495,2078325..2078385)
FT                   /locus_tag="VIT_08s0007g06600"
FT                   /old_locus_tag="Vv08s0007g06600"
FT   gene            2078386..2078892
FT                   /locus_tag="VIT_08s0007g06590"
FT                   /old_locus_tag="Vv08s0007g06590"
FT   mRNA            2078386..2078892
FT                   /locus_tag="VIT_08s0007g06590"
FT                   /old_locus_tag="Vv08s0007g06590"
FT                   /product="Os04g0584050 protein"
FT   CDS_pept        2078386..2078892
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06590"
FT                   /old_locus_tag="Vv08s0007g06590"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLI6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLI6"
FT                   /protein_id="CCB55242.1"
FT                   /translation="MAPESLLVGRATVQTDVYAFGILVLEVVCGRKPGNQSLPNNYNNS
FT                   IVDWVWENYKRGSILDVVDLQLNEVFVKEEAECVLMLALACCHPNPNHRPSMRIALRVR
FT                   AGEVAPPVIPMDKPAFVWPPAMPPSSNEDLEDYSFSGDQNTPSSKLIGRGKSCQIFKLK
FT                   GAHLL"
FT   gene            2091790..2093184
FT                   /locus_tag="VIT_08s0007g06580"
FT                   /old_locus_tag="Vv08s0007g06580"
FT   mRNA            2091790..2093184
FT                   /locus_tag="VIT_08s0007g06580"
FT                   /old_locus_tag="Vv08s0007g06580"
FT                   /product="Predicted protein"
FT   CDS_pept        2091790..2093184
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06580"
FT                   /old_locus_tag="Vv08s0007g06580"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLI7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001220"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLI7"
FT                   /protein_id="CCB55243.1"
FT                   /translation="MDVKVRIRYDGEVLRVFVGEDTSSPAISDSLNFSIYLRHKVYVGF
FT                   SASTGNYSQLNYVRSWEFSVLDLDDHQMPQWIWIIVAAVIALFIGFAFSLYWKWKYYVR
FT                   KGDDPGFELQIQGLSTAPRKFRLKELESATENFNSDNLLGRGGFGTVYKGVSINREVAV
FT                   KRFSRNSHEGKQDFIAEITTISNLHHRNLVKLLGWCHERDELLLVYEFMPNKSLDKLIF
FT                   CNQNHGAETNPVTLNWERRHGVIYGVTQALDYLHNGCEKRVLHRDIKASNVMLDSEFNA
FT                   RLGDFGLARTINPSDQTHHSTKAIAGTPGYMAPESFLIGRATVQTDVYAFGVLVLEVVC
FT                   GRKPGRQSTQNNYNNSIVDWVWENYRGGSILDVVDLQLNGIFSKEQAECVLVLALACCH
FT                   PNPYQRPSMRTVLRVLAGEVAPPVIPMDRPAFVWPPAMPPSLNEDLQDYTFSGDRNTPS
FT                   SELIGR"
FT   gene            2093987..2095951
FT                   /locus_tag="VIT_08s0007g06570"
FT                   /old_locus_tag="Vv08s0007g06570"
FT   mRNA            2093987..2095951
FT                   /locus_tag="VIT_08s0007g06570"
FT                   /old_locus_tag="Vv08s0007g06570"
FT                   /product="unknown predicted protein"
FT   CDS_pept        2093987..2095951
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06570"
FT                   /old_locus_tag="Vv08s0007g06570"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLI8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000985"
FT                   /db_xref="InterPro:IPR001220"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLI8"
FT                   /protein_id="CCB55244.1"
FT                   /translation="MLSHDFLRFNAVALATVLVGAVTQAECFNFSYPIFKPQKGDDLTF
FT                   FGDSYMASDTIQLTQNVLNNGGCGRVFYTRPLKLWSTGRGTLPFNSTFVINITPLTYPG
FT                   GEGLAFILTGHADIPANSVGKWLGIISENTMGSSTRGAVAVEFDTRNSYPEDLDDNHVG
FT                   LDLNSIYSRKQESLSVNLSSGIDIKVKVQYDGQGLSIFVGENRSVPVIFESLNLYDYLP
FT                   QKVYVGFSASTGVYAQINYVKSWEFSGLELYDDAPNLLWVWITVPGAIGLVIGFSAFLY
FT                   WKWQRKTKDHVEEEDDPGWFELQIQGSSTAPRKFKLKELEAATENFNSDNLLGRGGFGT
FT                   VYKGVLVNREVAVKRFSRNSHEGKRDFIAEITTISNLHHRNLVKLLGWCHERDELLLVY
FT                   EFMPNKSLDMLIFCNQNHGVETNPVTLNWERRHAVIYGVAQALDYLHNGCEKRVLHRDI
FT                   KASNVMLDSEFNARLGDFGLARTINPSDQTHHSTKAIAGTPGYMAPESFLIGRATVQTD
FT                   VYAFGVLVLEVVCGRKPGRQSMQNNYNSSIVDWVWENYRGGSILDVVDLQLNGVFSKEQ
FT                   AECVLVLALASCHPNPFQRPSMRTALRVLAGEVAPPVIPMDRPAFVWPPAMPPSLNEDL
FT                   EDYPFSGDQNTPSSQLIGR"
FT   gene            2098066..2100158
FT                   /locus_tag="VIT_08s0007g06560"
FT                   /old_locus_tag="Vv08s0007g06560"
FT   mRNA            join(2098066..2098193,2098194..2100158)
FT                   /locus_tag="VIT_08s0007g06560"
FT                   /old_locus_tag="Vv08s0007g06560"
FT                   /product="unknown predicted protein"
FT   5'UTR           2098066..2098193
FT                   /locus_tag="VIT_08s0007g06560"
FT                   /old_locus_tag="Vv08s0007g06560"
FT   CDS_pept        2098194..2100158
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06560"
FT                   /old_locus_tag="Vv08s0007g06560"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLI9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001220"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR019825"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLI9"
FT                   /protein_id="CCB55245.1"
FT                   /translation="MAFYHFPGSSAVVGALLLATFLVGAVDRAGCFSFNYSTFEKANES
FT                   DFTLYNSYIILGAIQVTPDVTKEDYLANQSGRALFKRPFRLRNNTSFSSTFVLNISNKT
FT                   NPGGEGLAFILTGSTDLPPSSHGQWLGIVNQATNGTAKAQIVAVEFDTRKSYPEDLDDN
FT                   HVGLNVNSINSITQKNLSLKLSIGKDVTVKVEYDGGVLKVFVEENASTPVISEPIDLST
FT                   YLPEKIYVGFSASTGNEIELNCVRSWEFDGLDIYEEKSLVWVWITVPSVVFLSVTIALL
FT                   YWRCTREDEGRVEDDDDPEVELQIQGSSMAPKRFRLKELQAATANFNSKNQLGEGGFGK
FT                   VYKGVLEKKEVAVKRFSRNSHQGKQDFIAEVTTIGNLHHKNLVKLAGWCYERSELLLVY
FT                   EFMPNKSLDKLIFSNQKQSTETNPIALDWEKRHSIIRGVAQALDYLHNGCQDRVLHRDI
FT                   KTSNIMLDSEFNARLGDFGLARTIHPNDQTHHSTQVLAGTHGYMAPESFHNSRATVETD
FT                   VYAFGVLLLEVVCARKPGTQSMENDYNNSIVDWVWAHHRRDRLFEVVDFRLNGDFNREQ
FT                   VECVLMLALACCHPNPYERPSMRTALRVLTGEVDPPLIPFDKPVFMWPATAPPSFNEDL
FT                   EYCSVSGGQMTPLSELSGR"
FT   gene            complement(2101779..2112030)
FT                   /locus_tag="VIT_08s0007g06550"
FT                   /old_locus_tag="Vv08s0007g06550"
FT   mRNA            complement(join(2101779..2101994,2101995..2102096,
FT                   2102243..2102332,2102426..2102576,2102705..2102743,
FT                   2102940..2103009,2104425..2104513,2109488..2109564,
FT                   2110474..2110513,2110840..2110948,2111427..2111826,
FT                   2111827..2112030))
FT                   /locus_tag="VIT_08s0007g06550"
FT                   /old_locus_tag="Vv08s0007g06550"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(2101779..2101994)
FT                   /locus_tag="VIT_08s0007g06550"
FT                   /old_locus_tag="Vv08s0007g06550"
FT   CDS_pept        complement(join(2101995..2102096,2102243..2102332,
FT                   2102426..2102576,2102705..2102743,2102940..2103009,
FT                   2104425..2104513,2109488..2109564,2110474..2110513,
FT                   2110840..2110948,2111427..2111826))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06550"
FT                   /old_locus_tag="Vv08s0007g06550"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TID5"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:D7TID5"
FT                   /protein_id="CBI30011.3"
FT                   /translation="MENSGSSDQWNKEFGFGTSDRRFAYSRQASFHQLQEPHTPISIIS
FT                   NDHKKPLLCRTVSSIDIPPTIYPLEENEKFSIEGKDFPEKASFLLVVLWVFRVVRSGNR
FT                   PMRKLFVMISLNVAYSTAELMIGLFTGRAGLVSDAFHLTFGCGLLTFSLFAIAVSRNKP
FT                   DQVYTYGFKRVEVLSAFTNALFLLFMSFSLAVEALHAFIQDESEHKHYLIVSAVTNLLV
FT                   NLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVLADSIRSAGLILASWFLTLGVKNAEV
FT                   LCLGLVSVAVFMLVMPLFKTTGGILLQMAPPSIPPSALSKCRRQITAHEDVLEVSQACF
FT                   WELVPGHVVGSVTLQVKDGIDDCPMLQYVHDLYHDLGVKELTVQADCS"
FT   gap             2106327..2106426
FT                   /estimated_length=100
FT   5'UTR           complement(2111827..2112030)
FT                   /locus_tag="VIT_08s0007g06550"
FT                   /old_locus_tag="Vv08s0007g06550"
FT   gene            complement(2112650..2120528)
FT                   /locus_tag="VIT_08s0007g06540"
FT                   /old_locus_tag="Vv08s0007g06540"
FT   mRNA            complement(join(2112650..2113325,2113326..2113386,
FT                   2113627..2113688,2113792..2113932,2114033..2114168,
FT                   2114301..2114377,2115273..2115404,2120171..2120275,
FT                   2120276..2120528))
FT                   /locus_tag="VIT_08s0007g06540"
FT                   /old_locus_tag="Vv08s0007g06540"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(2112650..2113325)
FT                   /locus_tag="VIT_08s0007g06540"
FT                   /old_locus_tag="Vv08s0007g06540"
FT   CDS_pept        complement(join(2113326..2113386,2113627..2113688,
FT                   2113792..2113932,2114033..2114168,2114301..2114377,
FT                   2115273..2115404,2120171..2120275))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06540"
FT                   /old_locus_tag="Vv08s0007g06540"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TID6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR029401"
FT                   /db_xref="UniProtKB/TrEMBL:D7TID6"
FT                   /protein_id="CBI30012.3"
FT                   /translation="MRCFRAFRASTIRAESNPDAPSSSSASSSASVQSTGSTLKINFCQ
FT                   WCGGPTKHDIPEGEEKIRAICTLCGKITYQNPKMVVGCLIAHENKVLLCQRKIQPSYGR
FT                   WTLPAGYLEIGESAAEGAIRETWEEAGADVEVQSPFAQLDIPLIGQTYIIFLGKLKKPH
FT                   FSPGPESLDCRLFALDDIPFDSLAFSSMLVTLKLYIEDVKSTGRPKFHYGTINKRPGTS
FT                   PSDIQSYTLDFHLQS"
FT   5'UTR           complement(2120276..2120528)
FT                   /locus_tag="VIT_08s0007g06540"
FT                   /old_locus_tag="Vv08s0007g06540"
FT   gene            complement(2122932..2127580)
FT                   /locus_tag="VIT_08s0007g06530"
FT                   /old_locus_tag="Vv08s0007g06530"
FT   mRNA            complement(join(2122932..2123155,2123156..2123230,
FT                   2123410..2123464,2123586..2123877,2124197..2124326,
FT                   2125389..2125478,2126560..2126589,2127416..2127529,
FT                   2127530..2127580))
FT                   /locus_tag="VIT_08s0007g06530"
FT                   /old_locus_tag="Vv08s0007g06530"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(2122932..2123155)
FT                   /locus_tag="VIT_08s0007g06530"
FT                   /old_locus_tag="Vv08s0007g06530"
FT   CDS_pept        complement(join(2123156..2123230,2123410..2123464,
FT                   2123586..2123877,2124197..2124326,2125389..2125478,
FT                   2126560..2126589,2127416..2127529))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06530"
FT                   /old_locus_tag="Vv08s0007g06530"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D7TID7"
FT                   /protein_id="CBI30013.3"
FT                   /translation="MAMKAALINRNPNCTNLRTALFHSTPVLDRRRRTHWNFGGGASRN
FT                   SSQRFNYYARSRKLHAKQTLLRNVSAYAEYLFQSGQSDHDEDDGFSSKGPSWFRKQYWD
FT                   KGSKRDQGNAGPQSRSWRGFQFCEDDTEVETILRSAFGGSRTFYWSFINEENPQWGSSS
FT                   GYRNNYRSSWNWRDRMDEEYGYSTDSDSSESDLASHRMALGLSVSGPLKLEEVKNAYRT
FT                   CALKWHPDRHQGASKAIAEEKFKLCSAAYQSLCDKLAVD"
FT   5'UTR           complement(2127530..2127580)
FT                   /locus_tag="VIT_08s0007g06530"
FT                   /old_locus_tag="Vv08s0007g06530"
FT   gene            2133889..2135602
FT                   /locus_tag="VIT_08s0007g06520"
FT                   /old_locus_tag="Vv08s0007g06520"
FT   mRNA            join(2133889..2133894,2133895..2133954,2134055..2134448,
FT                   2134764..2135377,2135530..2135595,2135596..2135602)
FT                   /locus_tag="VIT_08s0007g06520"
FT                   /old_locus_tag="Vv08s0007g06520"
FT                   /product="Actin"
FT   5'UTR           2133889..2133894
FT                   /locus_tag="VIT_08s0007g06520"
FT                   /old_locus_tag="Vv08s0007g06520"
FT   CDS_pept        join(2133895..2133954,2134055..2134448,2134764..2135377,
FT                   2135530..2135595)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06520"
FT                   /old_locus_tag="Vv08s0007g06520"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5B0L2"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR004001"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniProtKB/TrEMBL:A5B0L2"
FT                   /protein_id="CCB55246.1"
FT                   /translation="MAETEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGV
FT                   MVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHP
FT                   VLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSH
FT                   TVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEKLAYIA
FT                   LDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIHETTY
FT                   NSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYS
FT                   VWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF"
FT   3'UTR           2135596..2135602
FT                   /locus_tag="VIT_08s0007g06520"
FT                   /old_locus_tag="Vv08s0007g06520"
FT   gene            complement(2136518..2141612)
FT                   /locus_tag="VIT_08s0007g06510"
FT                   /old_locus_tag="Vv08s0007g06510"
FT   mRNA            complement(join(2136518..2136816,2137793..2137858,
FT                   2137859..2138122,2138214..2138450,2139725..2140089,
FT                   2140990..2141296,2141297..2141612))
FT                   /locus_tag="VIT_08s0007g06510"
FT                   /old_locus_tag="Vv08s0007g06510"
FT                   /product="Predicted protein"
FT   3'UTR           complement(join(2136518..2136816,2137793..2137858))
FT                   /locus_tag="VIT_08s0007g06510"
FT                   /old_locus_tag="Vv08s0007g06510"
FT   CDS_pept        complement(join(2137859..2138122,2138214..2138450,
FT                   2139725..2140089,2140990..2141296))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06510"
FT                   /old_locus_tag="Vv08s0007g06510"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TID9"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D7TID9"
FT                   /protein_id="CBI30015.3"
FT                   /translation="MFSWLARLALACWGPLARRYAPMSKDDDNSGSGANDALIWCRDLE
FT                   KHSFGEFSFAVVQANEVIEDHSQVETGRDATFVGVYDGHGGPEASRFISDHLFLHLMRL
FT                   ARENGTMSEDILRSAFSATEDGFLTLVRRTCGIKPVIAAIGSCCLVGVIWRGTLYVANL
FT                   GDSRAVIGCLGRSNKIIAEQLSREHNASMEEVRQELRSLHPDDSHIVVMKHGVWRIKGI
FT                   IQVSRSIGDAYLKRPEFSLDPSFPRFHLPEPIRRPVLTAEPSICTRVLQPNDKFLIFAS
FT                   DGLWEHLTNQQAVEIVHNNPRAGIARRLLTTALNEAARKREMRYDDLKKVGKGVRRFFH
FT                   DDITVVVIYLDHEVLRKNFSVPELSVRGFIDTVGPSNFNTLQGIDSKTMS"
FT   5'UTR           complement(2141297..2141612)
FT                   /locus_tag="VIT_08s0007g06510"
FT                   /old_locus_tag="Vv08s0007g06510"
FT   gene            complement(2142689..2143477)
FT                   /locus_tag="VIT_08s0007g06500"
FT                   /old_locus_tag="Vv08s0007g06500"
FT   mRNA            complement(join(2142689..2142868,2142869..2142958,
FT                   2143126..2143446,2143447..2143477))
FT                   /locus_tag="VIT_08s0007g06500"
FT                   /old_locus_tag="Vv08s0007g06500"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(2142689..2142868)
FT                   /locus_tag="VIT_08s0007g06500"
FT                   /old_locus_tag="Vv08s0007g06500"
FT   CDS_pept        complement(join(2142869..2142958,2143126..2143446))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06500"
FT                   /old_locus_tag="Vv08s0007g06500"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIE0"
FT                   /protein_id="CBI30016.3"
FT                   /translation="MEESAKVQHVTKASSDQLLRKFAQAGGDDAPAKELRVVKRRKKSR
FT                   RSREGHNRESPPNGSSGVVEKRSLLPPATRRSAALLLQLGIGRSQLRVRDLRNKSILGA
FT                   IEKTWRRTIKGASKVLIERHYNQHKRLINEAM"
FT   5'UTR           complement(2143447..2143477)
FT                   /locus_tag="VIT_08s0007g06500"
FT                   /old_locus_tag="Vv08s0007g06500"
FT   gene            complement(2143872..2151106)
FT                   /locus_tag="VIT_08s0007g06490"
FT                   /old_locus_tag="Vv08s0007g06490"
FT   mRNA            complement(join(2143872..2144340,2144439..2144445,
FT                   2144446..2144505,2145324..2145391,2145483..2145584,
FT                   2145842..2145969,2146055..2146146,2146232..2146303,
FT                   2146395..2146463,2146799..2146882,2146986..2147101,
FT                   2147869..2147976,2149133..2149259,2149341..2149447,
FT                   2150471..2150600,2151041..2151106))
FT                   /locus_tag="VIT_08s0007g06490"
FT                   /old_locus_tag="Vv08s0007g06490"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(join(2143872..2144340,2144439..2144445))
FT                   /locus_tag="VIT_08s0007g06490"
FT                   /old_locus_tag="Vv08s0007g06490"
FT   CDS_pept        complement(join(2144446..2144505,2145324..2145391,
FT                   2145483..2145584,2145842..2145969,2146055..2146146,
FT                   2146232..2146303,2146395..2146463,2146799..2146882,
FT                   2146986..2147101,2147869..2147976,2149133..2149259,
FT                   2149341..2149447,2150471..2150600,2151041..2151106))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06490"
FT                   /old_locus_tag="Vv08s0007g06490"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLJ1"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="InterPro:IPR024826"
FT                   /db_xref="InterPro:IPR040663"
FT                   /db_xref="InterPro:IPR041863"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLJ1"
FT                   /protein_id="CCB55247.1"
FT                   /translation="MEAMEIDAEKHLQRKQSLYESLDEKFRIEKETYRGQQYSQIYFAR
FT                   LHMMRTLIYSLIPNWKPHLPVCTVLGLEEGKECIIVGTLYKHMKLKPCILDEYSKERSV
FT                   APLVKPHNFMHSDDSLVLEDESGRVKLGGTMLLPSVYVTGTVVGLHGKETSAGEFLVQD
FT                   ILDADLPPQIELPLKSREDKYVVFVSGLSVGSSTSNPLQFQLLVDHITGHLGDEKEQGI
FT                   AAQIVHVVIAGNSVAVPRGLLNGQNLASKDQSRLSEPIKELDILLTQIAAGLPLDIMPG
FT                   PDDPANFSLPQQPLHRCLFPGSSAYNSFRSCTNPHSFELENIRFLGTSGQNVDDLEKYS
FT                   EAKDKLEFMERTLRWRHLAPTAPNTLGCYPFTDRDPFLIESCPHVYFVGNQDKYETRLI
FT                   KGSEGQVVRLICIPKFCETGVAVVLNMRNLECHALSFGTEFSS"
FT   gene            2153018..2157923
FT                   /locus_tag="VIT_08s0007g06480"
FT                   /old_locus_tag="Vv08s0007g06480"
FT   mRNA            join(2153018..2153054,2153055..2153330,2153906..2154027,
FT                   2154109..2154192,2154348..2154444,2155082..2155298,
FT                   2156441..2156493,2157750..2157845,2157846..2157923)
FT                   /locus_tag="VIT_08s0007g06480"
FT                   /old_locus_tag="Vv08s0007g06480"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           2153018..2153054
FT                   /locus_tag="VIT_08s0007g06480"
FT                   /old_locus_tag="Vv08s0007g06480"
FT   CDS_pept        join(2153055..2153330,2153906..2154027,2154109..2154192,
FT                   2154348..2154444,2155082..2155298,2156441..2156493,
FT                   2157750..2157845)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06480"
FT                   /old_locus_tag="Vv08s0007g06480"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR006843"
FT                   /db_xref="InterPro:IPR039633"
FT                   /db_xref="UniProtKB/TrEMBL:A5B0L5"
FT                   /protein_id="CCB55248.1"
FT                   /translation="MALVQGIAPATSAIRTPRSLLYSPHSASLIASLVSVSAPLENGRR
FT                   VLVGRRFGRISEARVCRAMVQQAAQGAPATYAKEMERLSAKESLLLAFKDSGGFEALVT
FT                   GKTTEMQSIDVNERITGLERLNPTPRPTTSPYLEGQWNLEWFGTGKPGSLAARFLFQIF
FT                   PSALAHLSKVDVVIKDSYGKTTVNLKLLNSVESKIVLNSRLSVEGPLRLKEEYVEAVLE
FT                   SPKVVEESVPEQLKGAFGQAVSTAQQLPVPVKDAISSGLKIPLNGRFQRMLMISYLDEE
FT                   ILILRDTTGIPEVLSRLDVPPSTMAEPATEYES"
FT   3'UTR           2157846..2157923
FT                   /locus_tag="VIT_08s0007g06480"
FT                   /old_locus_tag="Vv08s0007g06480"
FT   gene            complement(2159854..2160526)
FT                   /locus_tag="VIT_08s0007g06470"
FT                   /old_locus_tag="Vv08s0007g06470"
FT   mRNA            complement(join(2159854..2159982,2159983..2160456,
FT                   2160457..2160526))
FT                   /locus_tag="VIT_08s0007g06470"
FT                   /old_locus_tag="Vv08s0007g06470"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(2159854..2159982)
FT                   /locus_tag="VIT_08s0007g06470"
FT                   /old_locus_tag="Vv08s0007g06470"
FT   CDS_pept        complement(2159983..2160456)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06470"
FT                   /old_locus_tag="Vv08s0007g06470"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLJ3"
FT                   /db_xref="InterPro:IPR008889"
FT                   /db_xref="InterPro:IPR039607"
FT                   /db_xref="InterPro:IPR039834"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLJ3"
FT                   /protein_id="CCB55249.1"
FT                   /translation="MEEMMAGREGCNPNSTPSPLPMHNHSHTISKVKPKIRIIHIFAPE
FT                   IIKTDVENFRELVQRLTGKPSAADKGCRKKNMARGVVCNKGVGKKKMAEFRGLESRERI
FT                   KGEEHIWGGENSGGFLSGFGDLDGFMQEFGEFPLLPLDVSATHMHGFGEAQLS"
FT   5'UTR           complement(2160457..2160526)
FT                   /locus_tag="VIT_08s0007g06470"
FT                   /old_locus_tag="Vv08s0007g06470"
FT   gene            2166215..2168337
FT                   /locus_tag="VIT_08s0007g06460"
FT                   /old_locus_tag="Vv08s0007g06460"
FT   mRNA            join(2166215..2166307,2166402..2166553,2166643..2166887,
FT                   2166966..2167094,2167178..2168101,2168206..2168336,
FT                   2168337..2168337)
FT                   /locus_tag="VIT_08s0007g06460"
FT                   /old_locus_tag="Vv08s0007g06460"
FT                   /product="unknown predicted protein"
FT   CDS_pept        join(2166215..2166307,2166402..2166553,2166643..2166887,
FT                   2166966..2167094,2167178..2168101,2168206..2168336)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06460"
FT                   /old_locus_tag="Vv08s0007g06460"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIE4"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR017761"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034285"
FT                   /db_xref="InterPro:IPR034288"
FT                   /db_xref="InterPro:IPR034289"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIE4"
FT                   /protein_id="CBI30020.3"
FT                   /translation="MLGGSLLLFIICFLGIVSFPVEAALKKYQFDVQVKNVSRLCHAKP
FT                   IVTVNGMFPGPTIYAREGDRVVINVTNHAQYNISIHWHGLKQNRNGWADGPAYITQCPI
FT                   KTGHSYSYDFNVTGQRGTLWWHAHILWLRATVYGALVIMPKEETPFPFPQPYSETNVVL
FT                   GEWWNSDVEVLVNQANKLGLPPQMSDAHTINGKPGPLFPCSEKHTFAMEVDFGKTYLLR
FT                   IVNAALNDELFFAIAGHNMTVVEVDAVYTKPFTTQAILIAPGQTTNVLVKADQSPSRYF
FT                   MATRAFMDAPIPVDNKTATAILQYKGILNSVLPVLPQLPAPNDTGFALNYNKRLKSLNS
FT                   PQYPANVPLKVDRHLLYTIGLGQNLCSTCQNGTQLTASLNNITFVMPRIGLLQAHYHNI
FT                   KGVFRTDFPDRPPVPFNYTGAPLTANLGTSLATRLSKVAFNSTIELVLQDTNLLTVESH
FT                   PFHLHGYNFFVVGTGIGNFDAAKDPATFNLVDPPERNTVGVPTGGWSAIRFRADNPGVW
FT                   FMHCHLELHTMWGLKMAFVVENGKSPEESILPPPKDLPPC"
FT   3'UTR           2168337..2168337
FT                   /locus_tag="VIT_08s0007g06460"
FT                   /old_locus_tag="Vv08s0007g06460"
FT   gene            complement(2168482..2178958)
FT                   /locus_tag="VIT_08s0007g06450"
FT                   /old_locus_tag="Vv08s0007g06450"
FT   mRNA            complement(join(2168482..2168632,2168633..2169792,
FT                   2172517..2172554,2178936..2178958))
FT                   /locus_tag="VIT_08s0007g06450"
FT                   /old_locus_tag="Vv08s0007g06450"
FT                   /product="Omega-6 fatty acid desaturase"
FT   3'UTR           complement(2168482..2168632)
FT                   /locus_tag="VIT_08s0007g06450"
FT                   /old_locus_tag="Vv08s0007g06450"
FT   CDS_pept        complement(join(2168633..2169792,2172517..2172554,
FT                   2178936..2178958))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06450"
FT                   /old_locus_tag="Vv08s0007g06450"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLJ4"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLJ4"
FT                   /protein_id="CCB55250.1"
FT                   /translation="MNQFTKIEEREGVVKGRAASGRGTMGAGGRMSAPPSAKKSEADIV
FT                   QRAPHSKPQFTLSQLKKAIPPHCFQRSVLHSFSYVISDLTWASLLYYIATNYFHLLPHP
FT                   LSYLAWPIYWAFQGCILTGVWVIAHECGHHAFSDYQWLDDTVGLILHSSLLVPYFSWKY
FT                   SHRRHHSNTGSLEKDEVFVPKTKSKLGWYSKYLNNPLGRFVTLTIQLTLGWPLYLMFNV
FT                   SGRRYSRFACHFDPHGPIYSDRERLQIYISDAGVLAITYGLYRLAVSKGLTWVLCVYGC
FT                   PLLIVNGFLVLITYLQHTHPSLPHYDSSEWDWLRGALATMDRDYGILNKVFHHITDTHV
FT                   AHHLFSTLPHYHAMEATKAIKPVLGDYYQFDGTPFYKAMWREAKECVYVQSDGDKSKGV
FT                   FWYQNKF"
FT   gene            2181575..2182561
FT                   /locus_tag="VIT_08s0007g06440"
FT                   /old_locus_tag="Vv08s0007g06440"
FT   mRNA            join(2181575..2181594,2181595..2181702,2181795..2182301,
FT                   2182302..2182474,2182507..2182561)
FT                   /locus_tag="VIT_08s0007g06440"
FT                   /old_locus_tag="Vv08s0007g06440"
FT                   /product="Seed maturation protein"
FT   5'UTR           2181575..2181594
FT                   /locus_tag="VIT_08s0007g06440"
FT                   /old_locus_tag="Vv08s0007g06440"
FT   CDS_pept        join(2181595..2181702,2181795..2182301)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06440"
FT                   /old_locus_tag="Vv08s0007g06440"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIE6"
FT                   /db_xref="InterPro:IPR005513"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIE6"
FT                   /protein_id="CBI30022.3"
FT                   /translation="MQTGKNAGEAVKEKVNNVTASARAGLEKTKATLEEKAEKMTTRDP
FT                   LKKELATERKEERKTEAEIEKQRAREYNTAQRQAGTTGIHGSHPTGHTGYGGTTGYSSH
FT                   PAGDTGYGGTTVYSSHPTGDTGYGGTTVYSSHPTGDTGYGGTTGYGATTTDAAGYGGAA
FT                   AGDTEYGKGGTTTGEAGYGDTVTTTGYRTRGTHPGHGTGGT"
FT   3'UTR           join(2182302..2182474,2182507..2182561)
FT                   /locus_tag="VIT_08s0007g06440"
FT                   /old_locus_tag="Vv08s0007g06440"
FT   gene            2184151..2184836
FT                   /locus_tag="VIT_08s0007g06430"
FT                   /old_locus_tag="Vv08s0007g06430"
FT   mRNA            join(2184151..2184276,2184277..2184309,2184441..2184728,
FT                   2184729..2184836)
FT                   /locus_tag="VIT_08s0007g06430"
FT                   /old_locus_tag="Vv08s0007g06430"
FT                   /product="Seed maturation protein"
FT   5'UTR           2184151..2184276
FT                   /locus_tag="VIT_08s0007g06430"
FT                   /old_locus_tag="Vv08s0007g06430"
FT   CDS_pept        join(2184277..2184309,2184441..2184728)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06430"
FT                   /old_locus_tag="Vv08s0007g06430"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIE7"
FT                   /db_xref="InterPro:IPR005513"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIE7"
FT                   /protein_id="CBI30023.3"
FT                   /translation="MEKTKATAQEKKERMTAHDPMEKEIATEKKDVLKTQAEMDKQMAQ
FT                   EHNAAAREAAATGGQGRVPLHTTGGATGIHHPGYGTGGTDATGGAATRDMNYGGTTNGS
FT                   GI"
FT   3'UTR           2184729..2184836
FT                   /locus_tag="VIT_08s0007g06430"
FT                   /old_locus_tag="Vv08s0007g06430"
FT   gene            2186596..2187205
FT                   /locus_tag="VIT_08s0007g06420"
FT                   /old_locus_tag="Vv08s0007g06420"
FT   mRNA            join(2186596..2186631,2186632..2186718,2186784..2187116,
FT                   2187117..2187205)
FT                   /locus_tag="VIT_08s0007g06420"
FT                   /old_locus_tag="Vv08s0007g06420"
FT                   /product="Seed maturation protein LEA 4"
FT   5'UTR           2186596..2186631
FT                   /locus_tag="VIT_08s0007g06420"
FT                   /old_locus_tag="Vv08s0007g06420"
FT   CDS_pept        join(2186632..2186718,2186784..2187116)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06420"
FT                   /old_locus_tag="Vv08s0007g06420"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5BCB0"
FT                   /db_xref="InterPro:IPR005513"
FT                   /db_xref="UniProtKB/TrEMBL:A5BCB0"
FT                   /protein_id="CBI30024.3"
FT                   /translation="MESVKEKAANVAASAKAGMEKTKATVQEKVEKLTAHGEMEKQIAT
FT                   QKKEEKKADAEIKKQEAYENNAAGRQAAAVGGEAHYTAGPGQAAVPAGTTYSAATGVPG
FT                   RPIGINPGTGGALAQNPRVEGGGAKTGYGTGGNYT"
FT   3'UTR           2187117..2187205
FT                   /locus_tag="VIT_08s0007g06420"
FT                   /old_locus_tag="Vv08s0007g06420"
FT   gene            2189610..2195196
FT                   /locus_tag="VIT_08s0007g06410"
FT                   /old_locus_tag="Vv08s0007g06410"
FT   mRNA            join(2189610..2191235,2194482..2194654,2195151..2195196)
FT                   /locus_tag="VIT_08s0007g06410"
FT                   /old_locus_tag="Vv08s0007g06410"
FT                   /product="Predicted protein"
FT   CDS_pept        join(2189610..2191235,2194482..2194654,2195151..2195196)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06410"
FT                   /old_locus_tag="Vv08s0007g06410"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLJ5"
FT                   /db_xref="InterPro:IPR004330"
FT                   /db_xref="InterPro:IPR018289"
FT                   /db_xref="InterPro:IPR031052"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLJ5"
FT                   /protein_id="CCB55251.1"
FT                   /translation="MDGTDIGTSSTLAEDDMEVKPLSSQVLEFDIVIPSVDNAQPNISL
FT                   EEEAGMDMVPKIGMEFESDDQAYEFYSNYARLTGFTVRNNHLDKSEMNGEVLARRFPCS
FT                   KESFVQNDKYGANARKRRKERKTGCLAQMVVSRQSNGKYAVIHFEAKHNHEVRAPDEAC
FT                   SVPPEGRLTDAQAAGVDSEDSFRRHSESAFDYNNHLHSRRRREMKEGEEIILLDCLQKR
FT                   QLEDPSFFYEVQHDIDDYITNIFWADKQMIVDYGQFGDVVCFDTTFRTNKDCQPLVPFV
FT                   GVNHHKQVVIFGAALLYDDTIGSFEVLFQTFMTAMSGQKPKTILTDQHAAISEAINLVM
FT                   PETNHRICIWNIYHNALLHLSHAFDGPGSFSRDFSSCIYDHEDKEDFIQAWKVMLDTHN
FT                   LRKNKWLKGIFDEREKWAIAYGRHTFYADLKNSELINSFNRNLMDHLNPDLDILQTFEH
FT                   FERMVSDLRCKELEASYDIFEQLPSLLGNVILLKHARDVYTPEVFEVFQREYEKCLNLV
FT                   VNECGSSGSLFEYKVNIYEHSREHKVAENSGRFDGDGDVYFRDEPAFPGGSSMSTSDFI
FT                   STGFTTSPDYLMLQHGAMAPRAQGPSAMLVGFGIRRNT"
FT   gene            complement(2196679..2203763)
FT                   /locus_tag="VIT_08s0007g06400"
FT                   /old_locus_tag="Vv08s0007g06400"
FT   mRNA            complement(join(2196679..2196963,2196964..2197723,
FT                   2202627..2202687,2203573..2203645,2203646..2203763))
FT                   /locus_tag="VIT_08s0007g06400"
FT                   /old_locus_tag="Vv08s0007g06400"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(2196679..2196963)
FT                   /locus_tag="VIT_08s0007g06400"
FT                   /old_locus_tag="Vv08s0007g06400"
FT   CDS_pept        complement(join(2196964..2197723,2202627..2202687,
FT                   2203573..2203645))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06400"
FT                   /old_locus_tag="Vv08s0007g06400"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLJ6"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLJ6"
FT                   /protein_id="CCB55252.1"
FT                   /translation="MDTRKRGRPGGALNANGGFKKSKQEVESLSTGIGSKSKPCTKFFS
FT                   TSGCPFGESCHFLHYVPGGYNAVAQMTNQAPILPPASRNMAGPPPPVPNGSSMPAVKSK
FT                   MCNKFNTAEGCKFGDKCHFAHGEWELGKPLAPYHDDPRAMGSIPGRLAGRIEPSPTGPA
FT                   ASFGASATAKISVDASLAGAIIGKGGVNSKQICRQTGAKLSIREHDSDPNLRNIELEGT
FT                   FEQIKEASAMVRELIVNISAMPGHARTTAMPGGGQAPPASNYKTKLCDNFTKGSCTFGE
FT                   RCHFAHGAGELRKSAI"
FT   5'UTR           complement(2203646..2203763)
FT                   /locus_tag="VIT_08s0007g06400"
FT                   /old_locus_tag="Vv08s0007g06400"
FT   gene            2205284..2209482
FT                   /locus_tag="VIT_08s0007g06390"
FT                   /old_locus_tag="Vv08s0007g06390"
FT   mRNA            join(2205284..2205540,2206140..2206453,2206985..2207094,
FT                   2207224..2207279,2207366..2207450,2207550..2207597,
FT                   2207953..2208027,2208119..2208230,2208387..2208438,
FT                   2208532..2208583,2208696..2208753,2209020..2209122,
FT                   2209241..2209412,2209413..2209482)
FT                   /locus_tag="VIT_08s0007g06390"
FT                   /old_locus_tag="Vv08s0007g06390"
FT                   /product="Predicted protein"
FT   CDS_pept        join(2205284..2205540,2206140..2206453,2206985..2207094,
FT                   2207224..2207279,2207366..2207450,2207550..2207597,
FT                   2207953..2208027,2208119..2208230,2208387..2208438,
FT                   2208532..2208583,2208696..2208753,2209020..2209122,
FT                   2209241..2209412)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06390"
FT                   /old_locus_tag="Vv08s0007g06390"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLJ7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLJ7"
FT                   /protein_id="CCB55253.1"
FT                   /translation="MGLFLEFWTCYFQIYSLFGFPEKCSGKGGKILNPVIQLIYGAPAK
FT                   PSRESPMTHTFNFFVFSTFPLEPDLLFVMVILISYIVFFKRYIYSCFVIRLLKMAATAN
FT                   PSMHMATANPCISSSRKIIKPSTASFVTKVKRAAWSRLTSSSHLSSARLFFQNSTSTPA
FT                   RFEKVVTKAMADASENKPLPGLPVDLRGKRAFIAGVADDNGYGWAIAKSLAAAGAEILI
FT                   GTWVPALNIFESSLRRGKFDESRKLPDGSLMEITKVYPLDAVFDSLDDVPEDVKTNKRY
FT                   AGSSNWTVQEVAESVKQDFGSIDILVHSLANGPEVTKPLLETSRKGYLAAISASSYSFV
FT                   SLLKHFLPIMNPGGASISLTYIASERIIPGYGGGMSSAKASLESDTRVLAFEAGRKHKI
FT                   RVNTISAGPLGSRAAKAIGFIDMMINYSLANAPLQKELHAGKLIINGTEEVGNAAAFLV
FT                   SPLASAITGAVVYVDNGLNAMGVGVDSPIFENLDIPKDH"
FT   3'UTR           2209413..2209482
FT                   /locus_tag="VIT_08s0007g06390"
FT                   /old_locus_tag="Vv08s0007g06390"
FT   gene            complement(2210117..2213250)
FT                   /locus_tag="VIT_08s0007g06380"
FT                   /old_locus_tag="Vv08s0007g06380"
FT   mRNA            complement(join(2210117..2210343,2210344..2210607,
FT                   2210861..2210952,2211080..2211296,2211917..2212007,
FT                   2212110..2212362,2212522..2212602,2212696..2212840,
FT                   2212841..2213250))
FT                   /locus_tag="VIT_08s0007g06380"
FT                   /old_locus_tag="Vv08s0007g06380"
FT                   /product="Predicted protein"
FT   3'UTR           complement(2210117..2210343)
FT                   /locus_tag="VIT_08s0007g06380"
FT                   /old_locus_tag="Vv08s0007g06380"
FT   CDS_pept        complement(join(2210344..2210607,2210861..2210952,
FT                   2211080..2211296,2211917..2212007,2212110..2212362,
FT                   2212522..2212602,2212696..2212840))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06380"
FT                   /old_locus_tag="Vv08s0007g06380"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLJ8"
FT                   /db_xref="InterPro:IPR014854"
FT                   /db_xref="InterPro:IPR027786"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLJ8"
FT                   /protein_id="CCB55254.1"
FT                   /translation="MVRAVKREVGSSSRANANEAGADNSGHQGVTERRVLRSRYLAVKN
FT                   QICDGREDITKVDSDKFKSIINEVESLHQQVQKPREQVADAEALLDITNTLVTSVKAHG
FT                   NEGITPSDFVSCLLQEFGQNPGVSTSAEDAGNSIVWKDIGLVVSHIFKRASGCCTMLGP
FT                   MNTEMKQRKPVVHNKRVRPTESARPEELDDTVVEEKSDTDKNMSIMFDILRKNRRVRLE
FT                   NLILNRNSFAQTVENLFALSFLVKDGRAEITVDGRGCHLVSPRNAPAANAVVSGEVCYN
FT                   HFVFRFDFKDWKLMATSVGAGEELMPQRNSVNLPNNSQTDSVAEECEAAAAPTTPIRKL
FT                   SRNRGLVLQEQAVVEDSPESDDAGTRAAVIRKGKGKRKLR"
FT   5'UTR           complement(2212841..2213250)
FT                   /locus_tag="VIT_08s0007g06380"
FT                   /old_locus_tag="Vv08s0007g06380"
FT   gene            complement(2215119..2236400)
FT                   /locus_tag="VIT_08s0007g06370"
FT                   /old_locus_tag="Vv08s0007g06370"
FT   mRNA            complement(join(2215119..2215529,2215530..2215953,
FT                   2216604..2217136,2217768..2218554,2219830..2219900,
FT                   2220006..2220070,2220521..2223599,2223686..2223748,
FT                   2223906..2223974,2226157..2226195,2227994..2228128,
FT                   2228214..2228287,2228364..2228447,2228695..2228830,
FT                   2234026..2234087,2234207..2234325,2234464..2234552,
FT                   2234657..2234737,2234887..2234994,2235144..2235224,
FT                   2236317..2236376,2236377..2236400))
FT                   /locus_tag="VIT_08s0007g06370"
FT                   /old_locus_tag="Vv08s0007g06370"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(2215119..2215529)
FT                   /locus_tag="VIT_08s0007g06370"
FT                   /old_locus_tag="Vv08s0007g06370"
FT   CDS_pept        complement(join(2215530..2215953,2216604..2217136,
FT                   2217768..2218554,2219830..2219900,2220006..2220070,
FT                   2220521..2223599,2223686..2223748,2223906..2223974,
FT                   2226157..2226195,2227994..2228128,2228214..2228287,
FT                   2228364..2228447,2228695..2228830,2234026..2234087,
FT                   2234207..2234325,2234464..2234552,2234657..2234737,
FT                   2234887..2234994,2235144..2235224,2236317..2236376))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06370"
FT                   /old_locus_tag="Vv08s0007g06370"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLJ9"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014012"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLJ9"
FT                   /protein_id="CCB55255.1"
FT                   /translation="MASKGPRSKLDHETRARRQKALEAPREPRRPKTHWDHVLDEMVWL
FT                   SKDFESERKWKLAQAKKVALRASKGMLDQATRGEKRVKEEEQRLRKVALTISKDVKKFW
FT                   IKIEKLVLYKHQMELDEKKKKALDKQLEFLLGQTERYSTMLAENLADTYQPTQQYLPKE
FT                   RCSIQYKEVDDPGFKEVPQSGIADVDEDYDMQSEEELEDDEHTIEEDEALITEEERQEE
FT                   LEALHNEIDLPLEELLKRYAMKKVLSVSSGSSQDKDEEEAEPTSVGDDHFGGEGQDLSD
FT                   TCKIDKNSSLTVIGRRCGESNGSLSISEHHLLEVDTCQAKNVSEISRESDEESKVYDFN
FT                   DEQEDGDFVLATGEEKDDETTLLEEEELAKEESNDPIDEIALLQKESEIPLEELLARYK
FT                   KDADEDVEDDSDYASASEDFLDSPAHQDTELNQQPGCVDDDDDEPGGRQPFVQSVTEEH
FT                   AEGSEKQSDEARESENRIADAAAAARSAQPTGNTFSTTKVRTKFPFLLKHSLREYQHIG
FT                   LDWLVTMYEKRLNGILADEMGLGKTIMTIALLAHLACEKGIWGPHLIVVPTSVMLNWET
FT                   EFLKWCPAFKILTYFGSAKERKFKRQGWLKPNSFHVCITTYRLVIQDSKVFKRKKWKYL
FT                   ILDEAHLIKNWKSQRWQTLLNFNSKRRILLTGTPLQNDLMELWSLMHFLMPHIFQSHQE
FT                   FKDWFCNPISGMVEGQEKVNKEVIDRLHNVLRPFLLRRLKRDVEKQLPMKFEHVIYCRL
FT                   SKRQRNLYEDFIASSETQATLASANFFGMISVIMQLRKVCNHPDLFEGRPIVSSFDMGG
FT                   IDIQLSSSVCSMLSPGPFSTVDLRDLGFLFTHLDFSMASWESDEVQAIATPTSLIKGRA
FT                   DPDNLAEIGFGFKHQRKSQGTNIFEEIRKAILEVRLTEAKERAASIAWWNSLRCRKKPM
FT                   YSTTLRDLVTVKHPVHDIHRQKSDRLSYMYSSKLADIVLSPVELFKRMIGQVECFMFAI
FT                   PAARAPTPVCWCSKTNHSVFLQPTYKEKCTETLSPLLSPIRPAIVRRQVYFPDRRLIQF
FT                   DCGKLQELAVLLRKLKSEGHRALIFTQMTKMLDVLEAFINLYGYTYMRLDGSTQPEERQ
FT                   TLMQRFNTNPKIFIFILSTRSGGVGINLVGADTVIFYDSDWNPAMDQQAQDRCHRIGQT
FT                   REVHIYRLISESTIEENILKKANQKRALDDLVIQSGGYNTEFFKKLDPMELFSGHRALP
FT                   NKNMQKEKNHNIGIEGSVSVADVEAALKYAEDEADYMALKKVEQEEAVENQEFTEDAIG
FT                   RVEDDELVNEDDMKPDEAVEQVGCTTSSKDSGLMLIGSDPNEERALTFAGKEDDVDMLA
FT                   DVKQMAAAAAAAGQAISSFESQLRPIDRYAIRFLELWDPIIDKAAMESQATFEEAEWEL
FT                   DRIEKFKEDMEAEIDNDEEPFVYERWDSDFATEAYRQQVEALAQHQLMEELECEAKEKD
FT                   DADDENNGSTRNDMASDPKPKSKKKPKKAKFKSLKKGSLASDSKAVKEEPLMEPMSIDD
FT                   EDIFHGMVTFSDMMSSHSSMQKKRKKAEATADGEEDRIMKKRSKKFKKAPEIGPLSFET
FT                   NLSNKQHDESKESNPCESAVVDLELKSASRGKMGGKISITVMPVKRILMIKPEKLKKGN
FT                   IWSRDCVPSPDFWFPQEDAVLCAVVHEYGPHWSLVSETLYGMTAGGFYRGRYRHPVHCC
FT                   ERFRELVQRYVLSAPENPNNEKVSNTGSGKALLKVTEDNIRMLLDVAIDLPDSELLLQK
FT                   HFTALLTSVWRMTSRVHHRQNHLPYRNGQYSTGRFFSSTVNQISWNSVREPTERTNWNN
FT                   FGYSSSRLVAAALHDANNKQHDDSAFLSNRREEVSTVPEQLEIRLEIERDFCDSMIPLP
FT                   SVINLSILGSEPPSAVNNPIEESQILKSSQDMAENRFRAASRACFDGTLDWASSAFPTS
FT                   DIKPRSAIKSHSLGKHKICTSDSIRPSKSKFKKVAVEPSEMHHLILSPLPKPTVAFNDS
FT                   NPRFDLGSPVSLDAGISTPSFNEELCWEPESLELFSHHYSPNLISDLDDFSLLPEYIDI
FT                   G"
FT   5'UTR           complement(2236377..2236400)
FT                   /locus_tag="VIT_08s0007g06370"
FT                   /old_locus_tag="Vv08s0007g06370"
FT   gene            2247505..2248869
FT                   /locus_tag="VIT_08s0007g06360"
FT                   /old_locus_tag="Vv08s0007g06360"
FT   mRNA            join(2247505..2247526,2247527..2248630,2248631..2248869)
FT                   /locus_tag="VIT_08s0007g06360"
FT                   /old_locus_tag="Vv08s0007g06360"
FT                   /product="Predicted protein"
FT   5'UTR           2247505..2247526
FT                   /locus_tag="VIT_08s0007g06360"
FT                   /old_locus_tag="Vv08s0007g06360"
FT   CDS_pept        2247527..2248630
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06360"
FT                   /old_locus_tag="Vv08s0007g06360"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLK0"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLK0"
FT                   /protein_id="CCB55256.1"
FT                   /translation="MKASLKFREDQKPLFRAKVPINVLGLPFQSGVVAGESKELTLSLA
FT                   SFFDSGPSLKLAYRPNDSWNPFSLIVKTGSGPFGSPNSSSMMMTAEFNMLGRGNPSFFL
FT                   HFKPRFGDFCIKKSQSSAFVNHILKSEPNGVVSDEEDGTVEVVEKSEGYFPVNGVFSGN
FT                   KIGVSPPEGVSAASVINGLFSGVDLSANTVLPMRKGAVLSFRWGLRVPAEVKTALTENG
FT                   AKNSTSAISFRKIPFLVMNKIGIEHVDSGDSKEDAKPSPPSNLTGNADMVETSMMVKRH
FT                   LEVLQAENGLLKKSIDDLRSEFATSPFTPHRPIDSGKYRESDRTGSKPYAGKTDRRSSS
FT                   GDKKGQSNEGDFIHLNDELKKPTGIGA"
FT   3'UTR           2248631..2248869
FT                   /locus_tag="VIT_08s0007g06360"
FT                   /old_locus_tag="Vv08s0007g06360"
FT   gene            complement(2254548..2267987)
FT                   /locus_tag="VIT_08s0007g06350"
FT                   /old_locus_tag="Vv08s0007g06350"
FT   mRNA            complement(join(2254548..2254790,2254791..2254969,
FT                   2255493..2255556,2255648..2255716,2256082..2256333,
FT                   2256961..2257029,2257420..2257641,2257741..2257996,
FT                   2258106..2258215,2258312..2258514,2267735..2267762,
FT                   2267763..2267987))
FT                   /locus_tag="VIT_08s0007g06350"
FT                   /old_locus_tag="Vv08s0007g06350"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(2254548..2254790)
FT                   /locus_tag="VIT_08s0007g06350"
FT                   /old_locus_tag="Vv08s0007g06350"
FT   CDS_pept        complement(join(2254791..2254969,2255493..2255556,
FT                   2255648..2255716,2256082..2256333,2256961..2257029,
FT                   2257420..2257641,2257741..2257996,2258106..2258215,
FT                   2258312..2258514,2267735..2267762))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06350"
FT                   /old_locus_tag="Vv08s0007g06350"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIF5"
FT                   /db_xref="InterPro:IPR005491"
FT                   /db_xref="InterPro:IPR033485"
FT                   /db_xref="InterPro:IPR036142"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIF5"
FT                   /protein_id="CBI30031.3"
FT                   /translation="MDYELSDSSGTDDDLPPSHQNRGSRGGRVAGNGRSVVGSAPYPRL
FT                   HSDMETQIHHLEQEAYSSVLRAFKAQSDAITWDKEGLITELRKELRVSDDEHRELLARV
FT                   NADNIIQRIREWRQAGGHQTAMLSMSQHAHDQIPSPTVSASRKKQKLSQSVPSLSFGVS
FT                   SQALHPQSVAPASVQPSPSTMKRGPTLGGRGKKFKPGQPFPGLSSVKSMQYHSSITAGR
FT                   GQFRTSSGTLTTNEPAEPGTYDPLIGRKVMTLWPEDNNFYEAVITDYNPLEGLHALVYD
FT                   INTTNETWEWVDLKEISPEDIQWEGEDPGISRQGGRGGQGRGVKRSTSRGVALPSAGRG
FT                   RGSTKVQSNREFPPSQNGIGKKVSDSDDIEIFHTDTLIKEVERVFGASHPDPVELEKAK
FT                   KMLKEHEQALVDAISRLGDASDGESDEEQPLSRGQRMDREQGWRTGGGGEMAGGMPDGS
FT                   EGGERMAGVGRTASDDQQDNDIDDI"
FT   5'UTR           complement(2267763..2267987)
FT                   /locus_tag="VIT_08s0007g06350"
FT                   /old_locus_tag="Vv08s0007g06350"
FT   gap             2278125..2278224
FT                   /estimated_length=100
FT   gene            complement(2285264..2286376)
FT                   /locus_tag="VIT_08s0007g06340"
FT                   /old_locus_tag="Vv08s0007g06340"
FT   mRNA            complement(join(2285264..2285737,2285738..2286307,
FT                   2286308..2286376))
FT                   /locus_tag="VIT_08s0007g06340"
FT                   /old_locus_tag="Vv08s0007g06340"
FT                   /product="Predicted protein"
FT   3'UTR           complement(2285264..2285737)
FT                   /locus_tag="VIT_08s0007g06340"
FT                   /old_locus_tag="Vv08s0007g06340"
FT   CDS_pept        complement(2285738..2286307)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06340"
FT                   /old_locus_tag="Vv08s0007g06340"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR008480"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLK1"
FT                   /protein_id="CCB55257.1"
FT                   /translation="MVGPSHLKAPHSFHVFSMKSPSSTFQQSMKLKTLIHTLIFSHLCR
FT                   IARALARAKSILIDVLKENHLMHMKKKKQKKIFGSIRLHYNWCSSHVMPVSTPVLDGFS
FT                   TSHLYYDSTWNSIIPPECEDMAERQLSGYLHWLEEKKVHDNSTVEPDMNEIDKLADMFI
FT                   ANSHEKFRLEKQESYRRFQEMLARSM"
FT   5'UTR           complement(2286308..2286376)
FT                   /locus_tag="VIT_08s0007g06340"
FT                   /old_locus_tag="Vv08s0007g06340"
FT   gene            2304028..2306100
FT                   /locus_tag="VIT_08s0007g06310"
FT                   /old_locus_tag="Vv08s0007g06310"
FT   mRNA            join(2304028..2304179,2304180..2304665,2304768..2304960,
FT                   2305041..2305117,2305212..2305251,2305363..2305417,
FT                   2305525..2305594,2305687..2305899,2305900..2306100)
FT                   /locus_tag="VIT_08s0007g06310"
FT                   /old_locus_tag="Vv08s0007g06310"
FT                   /product="Predicted protein"
FT   5'UTR           2304028..2304179
FT                   /locus_tag="VIT_08s0007g06310"
FT                   /old_locus_tag="Vv08s0007g06310"
FT   CDS_pept        join(2304180..2304665,2304768..2304960,2305041..2305117,
FT                   2305212..2305251,2305363..2305417,2305525..2305594,
FT                   2305687..2305899)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06310"
FT                   /old_locus_tag="Vv08s0007g06310"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLK2"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="InterPro:IPR025756"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLK2"
FT                   /protein_id="CCB55258.1"
FT                   /translation="MNTQKIDCQARIQQNHGVIPDYGIEFGPRSSQFLGAWNMGICSQQ
FT                   PLATDGGSQLQTLGPAKPSSTIMSRFDSPASAFYATERFMGFSQYDHQASNPLLYSQSS
FT                   TSCDSKLDNFSVDSNSTPPADPNFQFRNTFQSVMRASSENPNTIQCPSIPFDGNQDIRV
FT                   CSYLYGSPLAQQAQCARSSSSGGVSVAPANPVSPILHSKARIRWTPDLHERFVECVNRL
FT                   GGAEKATPKAILKLMDSEGLTIFHVKSHLQKYRIAKYMPESAEGKSEKRASTNDLPHLD
FT                   NKTGMQFKEALQMQLDVQRRLHEQLEIQRNLQLRIEEQGRQLKMMFEQQQQTNRSFMEA
FT                   DEDLDIMSLEDPSTSLDQVENLSAQGSGNTRFPSKIS"
FT   3'UTR           2305900..2306100
FT                   /locus_tag="VIT_08s0007g06310"
FT                   /old_locus_tag="Vv08s0007g06310"
FT   gene            2307757..2312540
FT                   /locus_tag="VIT_08s0007g06300"
FT                   /old_locus_tag="Vv08s0007g06300"
FT   mRNA            join(2307757..2307802,2307803..2307930,2308851..2308971,
FT                   2309197..2309340,2310280..2310476,2310677..2310752,
FT                   2311913..2312275,2312276..2312540)
FT                   /locus_tag="VIT_08s0007g06300"
FT                   /old_locus_tag="Vv08s0007g06300"
FT                   /product="Predicted protein"
FT   5'UTR           2307757..2307802
FT                   /locus_tag="VIT_08s0007g06300"
FT                   /old_locus_tag="Vv08s0007g06300"
FT   CDS_pept        join(2307803..2307930,2308851..2308971,2309197..2309340,
FT                   2310280..2310476,2310677..2310752,2311913..2312275)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06300"
FT                   /old_locus_tag="Vv08s0007g06300"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIF7"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIF7"
FT                   /protein_id="CBI30033.3"
FT                   /translation="MEDLKKRKLEEASNGQISSSPEELKLLLDPLSKSQLVDLLSKLGS
FT                   QYPSIAEEIKSVASADPVHRKLFVRGLAWNTTSETLCAAFRLHGEIEEGAVIVDKTTGK
FT                   SRGYGFITYKHMESTQSALQAPSKLIDGRMAVCNLACEGLSGASTTPDQAQRKLYIGGL
FT                   APDVTSEVLLSFFGRHGEIEEGSVAYDKETNESRGFGFVTYKTVEAAKKAIDDPQKFLG
FT                   GRSIIVKLADSHKGKMIQAQLSTAVVPIALPLAAGYPQQPGKPPASATPVAYTYPQAGA
FT                   TYPAYPGPPTGPAPYSSTAPAPYPSQPQMPYSSATVMKDPLGLPPTPTVGMGGYPYYFA
FT                   KQ"
FT   3'UTR           2312276..2312540
FT                   /locus_tag="VIT_08s0007g06300"
FT                   /old_locus_tag="Vv08s0007g06300"
FT   gene            2313510..2315282
FT                   /locus_tag="VIT_08s0007g06290"
FT                   /old_locus_tag="Vv08s0007g06290"
FT   mRNA            join(2313510..2315279,2315280..2315282)
FT                   /locus_tag="VIT_08s0007g06290"
FT                   /old_locus_tag="Vv08s0007g06290"
FT                   /product="Predicted protein"
FT   CDS_pept        2313510..2315279
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06290"
FT                   /old_locus_tag="Vv08s0007g06290"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5BGN8"
FT                   /db_xref="InterPro:IPR003690"
FT                   /db_xref="InterPro:IPR038538"
FT                   /db_xref="UniProtKB/TrEMBL:A5BGN8"
FT                   /protein_id="CBI30034.3"
FT                   /translation="MNRFQKLRTKSVFKWVSLNFSENLLKSSKAPFLGAGSFRIRQNPR
FT                   FYGRKTSAESENFQSPVETSTVDFENVGHISRTTRAQAQAALLEYLHCTRSLQFMDAEN
FT                   MSKNSPFFLEKILGKVKNEAEIGKSITRFLRYHPINEFEPFFESLGLTPSEFTNLLPRN
FT                   LMFLCDDQVLLENYYILCNYGIARNKIGKIYKEAPEVFRYDSGILRLKLQAYLELGLSQ
FT                   STMIKAIASSPYLLIGDANMDFVKAMEKLKSVGIESNWIEKHLSEGNYYDWSQMVGLLC
FT                   LFSKMGFNGEQLGELIRQHPGILLECSGNLAHSLVGLLLKFGFTTNEIYIFFLQFPPIE
FT                   FGKFYRNFRHCYLFLIEIELEVEEIGRIVRSHTVLLGSCALKRVNSLLANLNIGKKRLC
FT                   GIIKDNPQELKKWVLGSRVGPLPNLGEDLRSQLQKTKFLSDLGYVENTKEIEKARKLFR
FT                   GKGMELQERFDFLMKAGLDRKDVSEMIKVAPQILNQSTDVIEMKIDYLIHALGYPISSL
FT                   VTFPSYLSYTTERVELRMSMYNWLKDQGVAEPNLALSTIIACSDNYFIDRYVNRHPKGA
FT                   EIWEKLKQKIYSN"
FT   3'UTR           2315280..2315282
FT                   /locus_tag="VIT_08s0007g06290"
FT                   /old_locus_tag="Vv08s0007g06290"
FT   gene            2319405..2321364
FT                   /locus_tag="VIT_08s0007g06280"
FT                   /old_locus_tag="Vv08s0007g06280"
FT   mRNA            join(2319405..2319550,2319551..2319568,2319675..2319765,
FT                   2320649..2321115,2321116..2321364)
FT                   /locus_tag="VIT_08s0007g06280"
FT                   /old_locus_tag="Vv08s0007g06280"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           2319405..2319550
FT                   /locus_tag="VIT_08s0007g06280"
FT                   /old_locus_tag="Vv08s0007g06280"
FT   CDS_pept        join(2319551..2319568,2319675..2319765,2320649..2321115)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06280"
FT                   /old_locus_tag="Vv08s0007g06280"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLK3"
FT                   /protein_id="CCB55259.1"
FT                   /translation="MAFSYEEVEILNLGFLIVWDLRNRETSTNATISFAWEIFFSCLSF
FT                   SLTDSPIMGRGRGKGKKQTVIATRDDPGSGEDEKIPAYKRRGRPQKPVKDDVEEEEEAE
FT                   KVAIEEDGENEKGPITSKDAKNQATTENGRKRKRSLQTKENSDSVKEENGTETKSNNND
FT                   LKSVGFRQNGSRRKNKPRRAAEAGVECK"
FT   3'UTR           2321116..2321364
FT                   /locus_tag="VIT_08s0007g06280"
FT                   /old_locus_tag="Vv08s0007g06280"
FT   gene            2334795..2339332
FT                   /locus_tag="VIT_08s0007g06270"
FT                   /old_locus_tag="Vv08s0007g06270"
FT   mRNA            join(2334795..2335073,2335074..2335456,2338251..2338390,
FT                   2338527..2339143,2339144..2339332)
FT                   /locus_tag="VIT_08s0007g06270"
FT                   /old_locus_tag="Vv08s0007g06270"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           2334795..2335073
FT                   /locus_tag="VIT_08s0007g06270"
FT                   /old_locus_tag="Vv08s0007g06270"
FT   CDS_pept        join(2335074..2335456,2338251..2338390,2338527..2339143)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06270"
FT                   /old_locus_tag="Vv08s0007g06270"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLK4"
FT                   /db_xref="InterPro:IPR004333"
FT                   /db_xref="InterPro:IPR036893"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLK4"
FT                   /protein_id="CCB55260.1"
FT                   /translation="MERGSSSLTVSSSSANSSESLNGLKFGQKIYFEDLGVGAPAKSGT
FT                   GSSSSSSAAGSGGRPPPAPPKKVRGSGVVQGGQPPRCQVEGCKVDLSDAKAYYSRHKVC
FT                   GMHSKSPTVIVAGLEQRFCQQCSRFHQLAEFDQGKRSCRRRLAGHNERRRKPPPGSLLS
FT                   SRYGRLSSSIFENSSRVGGGFLMDFAAYPRHPERDTWPTTRASDRVPGNQTTAMGRFLP
FT                   HPWQSNSENPLFLQGSAGGTSFHGPGIPSGECFTGASDSSCALSLLSNQPWSSRNRASG
FT                   LGANSFMNPEGASMAQPTAPHSAAINHFPSTSWDFKGNEGSSSSQEMPPDLGLGQISQP
FT                   INSQFSGGGELPQQSGRQYMELEHSRAYDSSTQQMHWSL"
FT   3'UTR           2339144..2339332
FT                   /locus_tag="VIT_08s0007g06270"
FT                   /old_locus_tag="Vv08s0007g06270"
FT   gene            complement(2339827..2341927)
FT                   /locus_tag="VIT_08s0007g06260"
FT                   /old_locus_tag="Vv08s0007g06260"
FT   mRNA            complement(join(2339827..2340237,2340238..2340297,
FT                   2340390..2340455,2341001..2341540,2341802..2341927))
FT                   /locus_tag="VIT_08s0007g06260"
FT                   /old_locus_tag="Vv08s0007g06260"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(2339827..2340237)
FT                   /locus_tag="VIT_08s0007g06260"
FT                   /old_locus_tag="Vv08s0007g06260"
FT   CDS_pept        complement(join(2340238..2340297,2340390..2340455,
FT                   2341001..2341540,2341802..2341927))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06260"
FT                   /old_locus_tag="Vv08s0007g06260"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLK5"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="InterPro:IPR025239"
FT                   /db_xref="InterPro:IPR039249"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLK5"
FT                   /protein_id="CCB55261.1"
FT                   /translation="MADSFSTKTAQDDDNEDEDYMGDLSQFIPPETAQPPKAQFKKMSN
FT                   NKVVVSQSPWKQSKALNWQEQRRVSRERQRREEDLRTLANTEAPIPQSNIGFKMLKQMG
FT                   YTPGSALGKEGSGRAEPVGLEIRRTRAGIGREDPIKEKMRREEAWTEKKRKNEAALMAE
FT                   FGCRQKSQWQSRRVVVNFKKAKGALDQLENKEIVEPKKKEDEDSEEGEEEEEEEEITEE
FT                   DLQNILMKLRDEFRYCLFCGCQYESVEALLSNCPGPNEDDH"
FT   gene            2342996..2348137
FT                   /locus_tag="VIT_08s0007g06250"
FT                   /old_locus_tag="Vv08s0007g06250"
FT   mRNA            join(2342996..2343089,2343820..2343988,2344073..2344144,
FT                   2344239..2344304,2344391..2344462,2344555..2344626,
FT                   2344853..2344924,2345037..2345102,2345185..2345250,
FT                   2345350..2345669,2346064..2346317,2346437..2346702,
FT                   2346992..2347139,2347427..2347566,2347639..2347795,
FT                   2347955..2348137)
FT                   /locus_tag="VIT_08s0007g06250"
FT                   /old_locus_tag="Vv08s0007g06250"
FT                   /product="unknown predicted protein"
FT   CDS_pept        join(2342996..2343089,2343820..2343988,2344073..2344144,
FT                   2344239..2344304,2344391..2344462,2344555..2344626,
FT                   2344853..2344924,2345037..2345102,2345185..2345250,
FT                   2345350..2345669,2346064..2346317,2346437..2346702,
FT                   2346992..2347139,2347427..2347566,2347639..2347795,
FT                   2347955..2348137)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06250"
FT                   /old_locus_tag="Vv08s0007g06250"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLK6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013210"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLK6"
FT                   /protein_id="CCB55262.1"
FT                   /translation="MTKQHLRLFLIVIVFSVFITLQASAITDPRDDYRIIPSFLLSAVA
FT                   ALQDLYKELNYPPQLEKWRSYAGDPCDESWKGISCSGSTVIFIQLPGLNLGGHLGGQLH
FT                   NLHNLKQLDVSSNNIQGEIPYGLPPNATHINLACNKFSQNIPNSLTFMKNLRHLNLSHN
FT                   SLSGPIGNVFTGLQNLKEMDLSHNHFTGDLPSSFGTLKNLTRLFLQNNKFTGSVIFLAD
FT                   LPLSHLNIQSNHFSGIIPRQFQLIPNLWFGGNRFHPGGNYPPWDFPLETEQNINSPPTT
FT                   ESSAVENYPSRKAHERKKKRLGPGGIALMVGGGTLLVSCAALLLTVRINRARAQTHKSL
FT                   EGSESALHCIPTTTVEAEESPQILALSPPTFMSRPIPTARNVRFEKICSRRSFSKKSRI
FT                   PANAKLYTVAELQLATNSFSEENLLGEGSLGSVYKGEFPDGQVMAVKNINTVSLSLHEE
FT                   EQFLDVIWTAARLRHPNIVTLLGYCVEHGQHLLVYKFVRNLSLDDALHCEVYKPLSWSL
FT                   RLQIALGIARALNYLHSVCSPPIAHCNLKAANILLDEELTPHICDTGLAVLRPLTSNTV
FT                   KLKASEMAIGNCGYIAPEHGQPGIDNKKSDVYAFGVLLLELLTGRRPFDSSRSREEQSL
FT                   VKWASARLHDNDSLGQMVDSGIKGTFSSKALSQYADIVSLCIQPEKEFRPPMTEVVESV
FT                   RRLLQKTRSRLIEGGEVEVEGFDKSFHSTNTRFVGSPSMSIMSA"
FT   gene            complement(2348748..2352521)
FT                   /locus_tag="VIT_08s0007g06240"
FT                   /old_locus_tag="Vv08s0007g06240"
FT   mRNA            complement(join(2348748..2348780,2348781..2348912,
FT                   2349455..2349587,2349833..2350041,2350230..2350796,
FT                   2350887..2351036,2351141..2351276,2351379..2351473,
FT                   2351558..2351652,2352152..2352286,2352393..2352453,
FT                   2352454..2352521))
FT                   /locus_tag="VIT_08s0007g06240"
FT                   /old_locus_tag="Vv08s0007g06240"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(2348748..2348780)
FT                   /locus_tag="VIT_08s0007g06240"
FT                   /old_locus_tag="Vv08s0007g06240"
FT   CDS_pept        complement(join(2348781..2348912,2349455..2349587,
FT                   2349833..2350041,2350230..2350796,2350887..2351036,
FT                   2351141..2351276,2351379..2351473,2351558..2351652,
FT                   2352152..2352286,2352393..2352453))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06240"
FT                   /old_locus_tag="Vv08s0007g06240"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLK7"
FT                   /db_xref="InterPro:IPR008491"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLK7"
FT                   /protein_id="CCB55263.1"
FT                   /translation="MQNPDDIRNLPIDITFSRLGEWLVDRKRVPADWRKRLTSIRARIS
FT                   TAFASLPKEIDPYFQTLDPEGIGYIEAKQIYDILLRSTPESRNIFGRLSGAAGVWEAIV
FT                   RAFEKDHIFLGEAAQIMVQNVNYEIPYQKKQVQKIQQQLAELERKEADIKRNAALSAAK
FT                   YAEACQELGLQGNNVRLELLETTKTLPSIFSKFLEVISSDCVLRAMEYYSNFVRDAHTE
FT                   KDKMSRTVLINLGDVRENPPCLNVSAGSDVLDSMNVQPSSHETNNMTEVMDVPADYIDW
FT                   DISVDSSQIDWDIGTVEETDDTGNGLGPYEIVNASEILQNISPTAAVESDQTLLKKEED
FT                   GLVPGMSASDISWDICVENPQVDEVEDVIFPNEDMKTQASVLDTKTRTPEIKEDRSQLL
FT                   ETEYRNKILDDLFEMKAFLNQRLVELRNEETLSLQHQVQAVAPFVLQQYTPDAIQAMLS
FT                   DVSSAISLLTNRKMQDLIMILNSKRFLDRLVSTLEEKKHHEAKLKEGLKDLTIRRMELQ
FT                   NSLSSSWPKQEAALAKTRELKKLCESSLSSMFDGRPVNIIGEINTLLNSSITV"
FT   5'UTR           complement(2352454..2352521)
FT                   /locus_tag="VIT_08s0007g06240"
FT                   /old_locus_tag="Vv08s0007g06240"
FT   gene            2356037..2360400
FT                   /locus_tag="VIT_08s0007g06230"
FT                   /old_locus_tag="Vv08s0007g06230"
FT   mRNA            join(2356037..2356076,2356209..2356559,2360046..2360191,
FT                   2360192..2360400)
FT                   /locus_tag="VIT_08s0007g06230"
FT                   /old_locus_tag="Vv08s0007g06230"
FT                   /product="unknown predicted protein"
FT   CDS_pept        join(2356037..2356076,2356209..2356559,2360046..2360191)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06230"
FT                   /old_locus_tag="Vv08s0007g06230"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLK8"
FT                   /db_xref="InterPro:IPR039175"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLK8"
FT                   /protein_id="CCB55264.1"
FT                   /translation="MIQTIRSNFFCLFLPSQRRVMDPSELRYLEDEDTSTMKVIKGATS
FT                   GLVIGTIWGTIVASWHDVPRVEKHVALPGLIRTLKMMGSYGMTFAAIGGVYMGVEQLLE
FT                   NYRMKRDLYNGAVGGFVAGATILGYKGRSINTAMKAGATLAATSAFIDSGGRTARVDNG
FT                   KEYFAYTTKKKSTIE"
FT   3'UTR           2360192..2360400
FT                   /locus_tag="VIT_08s0007g06230"
FT                   /old_locus_tag="Vv08s0007g06230"
FT   gene            complement(2360940..2361504)
FT                   /locus_tag="VIT_08s0007g06220"
FT                   /old_locus_tag="Vv08s0007g06220"
FT   mRNA            complement(join(2360940..2361057,2361058..2361201,
FT                   2361202..2361504))
FT                   /locus_tag="VIT_08s0007g06220"
FT                   /old_locus_tag="Vv08s0007g06220"
FT   3'UTR           complement(2360940..2361057)
FT                   /locus_tag="VIT_08s0007g06220"
FT                   /old_locus_tag="Vv08s0007g06220"
FT   CDS_pept        complement(2361058..2361201)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06220"
FT                   /old_locus_tag="Vv08s0007g06220"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLK9"
FT                   /protein_id="CCB55265.1"
FT                   /translation="MGETQEFSFSNQLVRVFIEDADLKSSLHPFHYASSPLLSVCISQC
FT                   NL"
FT   5'UTR           complement(2361202..2361504)
FT                   /locus_tag="VIT_08s0007g06220"
FT                   /old_locus_tag="Vv08s0007g06220"
FT   gene            2369385..2371628
FT                   /locus_tag="VIT_08s0007g06200"
FT                   /old_locus_tag="Vv08s0007g06200"
FT   mRNA            join(2369385..2369471,2369472..2369512,2370163..2370413,
FT                   2370525..2370675,2370915..2371000,2371095..2371199,
FT                   2371302..2371372,2371373..2371628)
FT                   /locus_tag="VIT_08s0007g06200"
FT                   /old_locus_tag="Vv08s0007g06200"
FT                   /product="Predicted protein"
FT   5'UTR           2369385..2369471
FT                   /locus_tag="VIT_08s0007g06200"
FT                   /old_locus_tag="Vv08s0007g06200"
FT   CDS_pept        join(2369472..2369512,2370163..2370413,2370525..2370675,
FT                   2370915..2371000,2371095..2371199,2371302..2371372)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06200"
FT                   /old_locus_tag="Vv08s0007g06200"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIG5"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIG5"
FT                   /protein_id="CBI30041.3"
FT                   /translation="MAGLCCCMPLSSRSNFRTSRLMLETRHGRTMVGKSLGRRNLQIKA
FT                   EVNFVNAEEGKKLIAVEGYAILDVRDKSQYDRAHIKSCYHVPLFIENQDNDLGTIIKRT
FT                   VHNNFSGLFFGLPFTKVNPDFVQSVKSQFSPESKLLLVCQEGLRSAAAASKLEQAGFAN
FT                   IACITSGLQTVKPGMFDSVGSTELQDAGKAGLVTIQGKISAVLGTVLICAFLFITFFPE
FT                   QAEKLLQMAPSG"
FT   3'UTR           2371373..2371628
FT                   /locus_tag="VIT_08s0007g06200"
FT                   /old_locus_tag="Vv08s0007g06200"
FT   gene            complement(2371882..2388866)
FT                   /locus_tag="VIT_08s0007g06190"
FT                   /old_locus_tag="Vv08s0007g06190"
FT   mRNA            complement(join(2371882..2372134,2372135..2372178,
FT                   2372796..2372907,2373052..2373144,2373621..2373824,
FT                   2374439..2374579,2375119..2375223,2376480..2376860,
FT                   2386665..2386805,2388316..2388801,2388802..2388866))
FT                   /locus_tag="VIT_08s0007g06190"
FT                   /old_locus_tag="Vv08s0007g06190"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(2371882..2372134)
FT                   /locus_tag="VIT_08s0007g06190"
FT                   /old_locus_tag="Vv08s0007g06190"
FT   CDS_pept        complement(join(2372135..2372178,2372796..2372907,
FT                   2373052..2373144,2373621..2373824,2374439..2374579,
FT                   2375119..2375223,2376480..2376860,2386665..2386805,
FT                   2388316..2388801))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06190"
FT                   /old_locus_tag="Vv08s0007g06190"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLL0"
FT                   /db_xref="InterPro:IPR006599"
FT                   /db_xref="InterPro:IPR012945"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR017901"
FT                   /db_xref="InterPro:IPR039589"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLL0"
FT                   /protein_id="CCB55266.1"
FT                   /translation="MSDAIEASTSSSSSPRESVFIHPRREPFEHGLLPIPKLIFTDPNA
FT                   TLAPLRDKLVAAAADHPTRRVDSKALSDALQISLDHARLVVDTLTSVLHDDADPLVRAK
FT                   SSEIDAVGADVYDLILFLYIQSYKRLLPRTHKDSAAVADVWPSTSAFDGYLSALSPLQL
FT                   VRSNSRRFMPSQADEEAHQLSYLQKHLANILSLLAEPVEGEGEESLVLTMERFEHLGFL
FT                   IQFGEKGSEGVTLSQAAPFFANSDPDMPAVPVPAAQVHDWVLQNIASALEHISERVSAK
FT                   ENGPPNATDQDVAMADACASSMKSPKSARGPSFIEGISKSSYVKQAPDLKGSSLKVLNC
FT                   HDSVIYILAPLRFATIYGCSDATIVLGAVGKAVRVEHCERVHVIAAAKRICIANCRECV
FT                   FFLGVNQQPLIVGDNHKLQVAPYNTFYSQLEEHMNQVGIEPTVNKWDELLALGVVDPHD
FT                   SLSHPAGVSDIQAESATRLDPDQFTNFLIPNWFGGESAGTTKDNPFPLPDAYMASQQRN
FT                   HKNLGEIKQILRETPLEENRKRELSCALHVFFKDWLYASGNIRQLYCLQGD"
FT   gap             2381162..2384554
FT                   /estimated_length=3393
FT   5'UTR           complement(2388802..2388866)
FT                   /locus_tag="VIT_08s0007g06190"
FT                   /old_locus_tag="Vv08s0007g06190"
FT   gene            complement(2390595..2391624)
FT                   /locus_tag="VIT_08s0007g06180"
FT                   /old_locus_tag="Vv08s0007g06180"
FT   mRNA            complement(join(2390595..2390663,2390762..2390838,
FT                   2390919..2391111,2391307..2391379,2391482..2391624))
FT                   /locus_tag="VIT_08s0007g06180"
FT                   /old_locus_tag="Vv08s0007g06180"
FT                   /product="Transcription factor"
FT   CDS_pept        complement(join(2390595..2390663,2390762..2390838,
FT                   2390919..2391111,2391307..2391379,2391482..2391624))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06180"
FT                   /old_locus_tag="Vv08s0007g06180"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIG7"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIG7"
FT                   /protein_id="CBI30043.3"
FT                   /translation="MRQKGHISTCSYTPHDFPQKVNIWIVSIAGKSEKGASSSDVPHLD
FT                   NEDGMQIREALQLQLDLQRRLHEQYSEVYGYLCKSSPLAQQAQCATSSSEGVSIASADP
FT                   VSPVLHSKPRIRWTPDLHEHFVECVNRLGGAEKATPKAILKLMDSEGLTIFHVKRHLQK
FT                   YRIAKHKPGFAGGKPLFDVDS"
FT   gene            2402172..2404809
FT                   /locus_tag="VIT_08s0007g06170"
FT                   /old_locus_tag="Vv08s0007g06170"
FT   mRNA            join(2402172..2402177,2402178..2404511,2404512..2404809)
FT                   /locus_tag="VIT_08s0007g06170"
FT                   /old_locus_tag="Vv08s0007g06170"
FT                   /product="Anthranilate phosphoribosyltransferase-like
FT                   protein"
FT   5'UTR           2402172..2402177
FT                   /locus_tag="VIT_08s0007g06170"
FT                   /old_locus_tag="Vv08s0007g06170"
FT   CDS_pept        2402178..2404511
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06170"
FT                   /old_locus_tag="Vv08s0007g06170"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLL1"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR013583"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLL1"
FT                   /protein_id="CCB55267.1"
FT                   /translation="MHRPPPDDFSLKETSPHLGGGKVTGDKLTSTYDLVEQMQYLYVRV
FT                   VKAKDLPSKDVTGSCDPYVEVKLGNYKGTTPHFEKKTNPEWNRVFAFSKDRMQASMLEV
FT                   IVKDKDFVKDDYIGRVVFDLNEVPKRVPPDSPLAPQWYRLEDRKGDKVKGGELMLAVWM
FT                   GTQADEAFPDAWHSDAAAVSGSDGLANMRSKVYLSPKLWYLRVNVIEAQDLQPTDRGRY
FT                   PEVFVKAILGNQALRTRISQIKSINPMWNEDLMFVASEPFEEPLILSVEDRVGNNKDEV
FT                   LGRCAIPLQYVDRRFDHKIMNSRWFNLEKHIVVDGEQKKKEIKFASRIHLRICLEGGYH
FT                   VLDESTHYSSDLRPTEKRLWKSSIGVLELGILNAQGLLPMKTKDGRGTTDAYCVAKYGQ
FT                   KWVRTRTIIDSSTPKWNEQYTWEVYDPCTVITIGVFDNCHLHGGDKAGGATKDSRIGKV
FT                   RIRLSTLETDRVYTHSYPLLVLHPTGVKKMGEIHLAVRFTCSSLLNMMHMYSQPLLPKM
FT                   HYLHPLTVNQLDSLRHQATQIVSMRLSRAEPPLRKEVVEYMLDVGSHMWSMRRSKANFF
FT                   RIMGVLGGLIAVGKWFDQICNWKNSITTVLIHILFFILVMYPELILPTIFLYLFLIGVW
FT                   YFRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDVVRMRYDRLRSIAGRIQT
FT                   VVGDLATQGERLQSLLSWRDPRATALFVLFCLVAAIVLYVTPFQVVALLTGFYVLRHPR
FT                   FRHKLPSVPLNFFRRLPARTDCML"
FT   3'UTR           2404512..2404809
FT                   /locus_tag="VIT_08s0007g06170"
FT                   /old_locus_tag="Vv08s0007g06170"
FT   gene            2417600..2422212
FT                   /locus_tag="VIT_08s0007g06160"
FT                   /old_locus_tag="Vv08s0007g06160"
FT   mRNA            join(2417600..2417820,2417931..2418028,2418634..2418707,
FT                   2418811..2418939,2419039..2419107,2419240..2419299,
FT                   2419405..2419482,2419588..2419672,2419781..2420052,
FT                   2420680..2420919,2421882..2422031,2422032..2422212)
FT                   /locus_tag="VIT_08s0007g06160"
FT                   /old_locus_tag="Vv08s0007g06160"
FT                   /product="TGA10 transcription factor"
FT   CDS_pept        join(2417600..2417820,2417931..2418028,2418634..2418707,
FT                   2418811..2418939,2419039..2419107,2419240..2419299,
FT                   2419405..2419482,2419588..2419672,2419781..2420052,
FT                   2420680..2420919,2421882..2422031)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06160"
FT                   /old_locus_tag="Vv08s0007g06160"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLL2"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR025422"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLL2"
FT                   /protein_id="CCB55268.1"
FT                   /translation="MRFSRAAAEEEIEAKLLVSPFMATASKPTNHTSHLELQHQQQQQQ
FT                   QHQQVLDHHQMSYGMMQSSSSSAMPGNFLSKDPGAYDLGELDQALFLYLDGHDPSAIQE
FT                   QRHNSDIRPPTLNIFPSQPMHVEPPIKASLGLVSPSTSGSKRPSEPSMELANPKNDANV
FT                   SGPDQPAKAVKREGNRKGPTSSSEQEGPKTPDPKTLRRLAQNREAARKSRLRKKAYVQQ
FT                   LESSRIKLTQLEQELQRARAQGLIFTGGGLLGGGGGDQNAPVAVTNLSSDAAVFDMEYG
FT                   RWLEEHHRLMCELRAAVQEHLPENDLRLFVDNCIAHFDGMMNLKSMVAKSDVFHLVSGM
FT                   WKTPAERCFMWMGGFRPSEVIKIILNQIEPLTEQQILGICGLQQSTQEAEEALSQGLEA
FT                   LNQSLSDTIASDSLSAPPNMANYMGQMAIAMNKLSTLEGFVRQADNLRHQTIHRLQQVL
FT                   TTRQAARCLLAMAEYFHRLRALSSLWMARPRQE"
FT   3'UTR           2422032..2422212
FT                   /locus_tag="VIT_08s0007g06160"
FT                   /old_locus_tag="Vv08s0007g06160"
FT   gene            2425499..2428975
FT                   /locus_tag="VIT_08s0007g06150"
FT                   /old_locus_tag="Vv08s0007g06150"
FT   mRNA            join(2425499..2425544,2425545..2425798,2425942..2426048,
FT                   2428429..2428607,2428715..2428870,2428871..2428975)
FT                   /locus_tag="VIT_08s0007g06150"
FT                   /old_locus_tag="Vv08s0007g06150"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           2425499..2425544
FT                   /locus_tag="VIT_08s0007g06150"
FT                   /old_locus_tag="Vv08s0007g06150"
FT   CDS_pept        join(2425545..2425798,2425942..2426048,2428429..2428607,
FT                   2428715..2428870)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06150"
FT                   /old_locus_tag="Vv08s0007g06150"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLL3"
FT                   /db_xref="InterPro:IPR000915"
FT                   /db_xref="InterPro:IPR005568"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041997"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLL3"
FT                   /protein_id="CCB55269.1"
FT                   /translation="MAPRKTPRTSRNPDLIRGVGKFSRSKMYHKRGLWAIKAKNGGVFP
FT                   CHEKKPVAPAPLEKLPKFYPADDVKKPLINKHKAKPTKLRASITPGTVLIILAGRFKGK
FT                   RVVFLKQLSSGLLLITGPFKINGVPLRRVNQAYVIATSTKVDISKVNVEKFDDKYFAKE
FT                   VQKKKKGEGEFFEAEKEEKKDLPQEKKDDQKAVDASLIASIEGVPELKVYLAARFSLKS
FT                   GMKPHELVF"
FT   3'UTR           2428871..2428975
FT                   /locus_tag="VIT_08s0007g06150"
FT                   /old_locus_tag="Vv08s0007g06150"
FT   gene            complement(2429848..2432235)
FT                   /locus_tag="VIT_08s0007g06140"
FT                   /old_locus_tag="Vv08s0007g06140"
FT   mRNA            complement(join(2429848..2429850,2429851..2432235))
FT                   /locus_tag="VIT_08s0007g06140"
FT                   /old_locus_tag="Vv08s0007g06140"
FT                   /product="Predicted protein"
FT   3'UTR           complement(2429848..2429850)
FT                   /locus_tag="VIT_08s0007g06140"
FT                   /old_locus_tag="Vv08s0007g06140"
FT   CDS_pept        complement(2429851..2432235)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06140"
FT                   /old_locus_tag="Vv08s0007g06140"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLL4"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR013583"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLL4"
FT                   /protein_id="CCB55270.1"
FT                   /translation="MQASSNHQEDYKLKDTHPQLGERWPHGGVRGGGGWISSDRVTSTY
FT                   DLVEQMYYLYVRVVKAKDLPTNAVTGGCDPYVEVKLGNYKGKTMHFEKKTNPEWHQVFA
FT                   FSKDKIQSSVLEVYVRERDMVSRDDYLGKVVFDMNEVPTRVPPDSPLAPQWYRLEDRRG
FT                   DSKVKGEVMLAVWMGTQADEAFPEAWHSDAATVHGEGVFNIRSKVYVSPKLWYLRVNVI
FT                   EAQDVESQDKGQLPQVFVKAQVGNQVLKTKTCPTRTTSPFWNEDLLFVAAEPFEEMLVM
FT                   TIENKMGPSKDEVMGRISLPLNIFERRMDHRPVHSRWFNLEKFGFGALEGDKRHELKFS
FT                   SRVHLRVCLEGAYHVLDESTMYISDQRPTARQLWKQPIGILEVGILSAQGLLPMKTRDG
FT                   RGTTDAYCVAKYGQKWVRTRTILESSTPKWNEQYTWEVYDPCTVITLGVFDNCHLGGNE
FT                   KPGGGGGAGKDSRIGKVRIRLSTLETDRIYTHAYPLLVLHPSGVKKMGELQLAVRFTCL
FT                   SLANMIYLYGHPLLPKMHYLHPFTVNQLDSLRYQAMSIVAARLGRAEPPLRKEVVEYML
FT                   DVDSHMWSMRRSKANFFRIVSLFSGMISMSRWLGEVCQWKNPVTSVLVHVLFFILICYP
FT                   ELILPTIFLYMFLIGIWNYRFRPRHPPHMDTKLSWAEAVHRDELDEEFDTFPTSKPQDV
FT                   VMMRYDRLRSVAGRIQTVVGDMATQGERFQSLLSWRDPRATSLYIVFCLIAAVVLYVTP
FT                   FKILALVAGLFWLRHPRFRSKMPSAPSNFFRRLPARSDSML"
FT   gene            2437169..2443385
FT                   /locus_tag="VIT_08s0007g06130"
FT                   /old_locus_tag="Vv08s0007g06130"
FT   mRNA            join(2437169..2437192,2443368..2443385)
FT                   /locus_tag="VIT_08s0007g06130"
FT                   /old_locus_tag="Vv08s0007g06130"
FT   CDS_pept        join(2437169..2437192,2443368..2443385)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06130"
FT                   /old_locus_tag="Vv08s0007g06130"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLL5"
FT                   /protein_id="CCB55271.1"
FT                   /translation="MFCMRAIRLYGHD"
FT   gap             2458198..2469833
FT                   /estimated_length=11636
FT   gap             2472362..2472461
FT                   /estimated_length=100
FT   gene            2472489..2498888
FT                   /locus_tag="VIT_08s0007g06090"
FT                   /old_locus_tag="Vv08s0007g06090"
FT   mRNA            join(2472489..2472848,2498865..2498888)
FT                   /locus_tag="VIT_08s0007g06090"
FT                   /old_locus_tag="Vv08s0007g06090"
FT                   /product="unknown predicted protein"
FT   CDS_pept        join(2472489..2472848,2498865..2498888)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06090"
FT                   /old_locus_tag="Vv08s0007g06090"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLL6"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLL6"
FT                   /protein_id="CCB55272.1"
FT                   /translation="MSLEYALFTSPGVVVHDGQFGYQNMFDAVLDAAYSALEKAGGGSL
FT                   EIVVAETGWPSAGGLASTVENARTYNTNLLRHVKGGTPKRPGKPIQTYLFSMFNENKKE
FT                   PAFEKHWGLFYPNKQPNKSLFGN"
FT   gap             2476690..2476789
FT                   /estimated_length=100
FT   gap             2492148..2492247
FT                   /estimated_length=100
FT   gene            2503429..2504887
FT                   /locus_tag="VIT_08s0007g06080"
FT                   /old_locus_tag="Vv08s0007g06080"
FT   mRNA            join(2503429..2503463,2503464..2503674,2503944..2504887)
FT                   /locus_tag="VIT_08s0007g06080"
FT                   /old_locus_tag="Vv08s0007g06080"
FT                   /product="unknown predicted protein"
FT   5'UTR           2503429..2503463
FT                   /locus_tag="VIT_08s0007g06080"
FT                   /old_locus_tag="Vv08s0007g06080"
FT   CDS_pept        join(2503464..2503674,2503944..2504887)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06080"
FT                   /old_locus_tag="Vv08s0007g06080"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLL7"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLL7"
FT                   /protein_id="CCB55273.1"
FT                   /translation="MSIAMRVPASELSWVLEWEAIKGEKGRKEIGKRSGSAAGRVYCGR
FT                   TEKLLASEGSRGKLKEVTAVEMRNFAGAHVGVCYGLLGDNLPPPHEVIHLYKHNNIPRM
FT                   RIYSPLPHVLQALRGSNIEVMVGVANEDLCHIATNMANAYSWVHNNIRNYANVNFRYIA
FT                   VGNEIHPPAWEANHLLGAMKNIHRAISEAGLGNQIKVSTPFSTEILGESYPPSKGSFKP
FT                   HMESFINPIIRFLVDTHAPFFLNMYTYFSYIGSPHLMSLEYALFTSPGVVVHDGQFGYQ
FT                   NMFDAVLDAAYSALEKAGGGSLEIVVAETGWPSAGGLASTVENARTYNTNLLRHVKGGT
FT                   PKRPGKPIQTYLFSMFNENKKEPAFEKHWGLFYPNKQPVYHTRN"
FT   gene            2505373..2507617
FT                   /locus_tag="VIT_08s0007g06070"
FT                   /old_locus_tag="Vv08s0007g06070"
FT   mRNA            join(2505373..2506498,2506499..2506588,2507297..2507354,
FT                   2507571..2507617)
FT                   /locus_tag="VIT_08s0007g06070"
FT                   /old_locus_tag="Vv08s0007g06070"
FT   5'UTR           2505373..2506498
FT                   /locus_tag="VIT_08s0007g06070"
FT                   /old_locus_tag="Vv08s0007g06070"
FT   CDS_pept        join(2506499..2506588,2507297..2507354,2507571..2507617)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06070"
FT                   /old_locus_tag="Vv08s0007g06070"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIH4"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIH4"
FT                   /protein_id="CBI30050.3"
FT                   /translation="MVWQLAFYVANVLVLVITLSTLAFRNLVAQNQKDLGLSYLTIHPI
FT                   TSHPLIVILKNVFNIFNNF"
FT   gene            2508146..2509461
FT                   /locus_tag="VIT_08s0007g06060"
FT                   /old_locus_tag="Vv08s0007g06060"
FT   mRNA            join(2508146..2508186,2508187..2508280,2508411..2509354,
FT                   2509355..2509461)
FT                   /locus_tag="VIT_08s0007g06060"
FT                   /old_locus_tag="Vv08s0007g06060"
FT                   /product="Beta 1-3 glucanase"
FT   5'UTR           2508146..2508186
FT                   /locus_tag="VIT_08s0007g06060"
FT                   /old_locus_tag="Vv08s0007g06060"
FT   CDS_pept        join(2508187..2508280,2508411..2509354)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06060"
FT                   /old_locus_tag="Vv08s0007g06060"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLL8"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLL8"
FT                   /protein_id="CCB55274.1"
FT                   /translation="MAMFDSTVKSSSRMATLLLVFGLLMASLHLTVAQTGVCYGMEGDN
FT                   LPPPGQVVGLYNQYSIRRMRLYDPNQAALQALRGSNIELMIGVPNDALQNIASIQGNAN
FT                   SWVQNNIKNYGNVRFRYVAVGNEVSPTGPTAQFVLPAMRNIFNAISAAGLGNQIKVSTA
FT                   IDTGVLGTSYPPSKGAFKPEVTSFLNPIISFLVKNRAPLLVNLYPYFSYIGNTRDIRLD
FT                   YALFKAPGVVVQDGQLGYRNLFDAILDAVYSALERAGGGSLQVVISESGWPSAGGTATT
FT                   VDNAKTYNSNLIQHVKGGTPKKPGGPIETYVFAMFNENRKSPEYEKHWGLFLPNKQAKY
FT                   PINFN"
FT   3'UTR           2509355..2509461
FT                   /locus_tag="VIT_08s0007g06060"
FT                   /old_locus_tag="Vv08s0007g06060"
FT   gene            complement(2509564..2510921)
FT                   /locus_tag="VIT_08s0007g06050"
FT                   /old_locus_tag="Vv08s0007g06050"
FT   mRNA            complement(join(2509564..2509649,2510224..2510428,
FT                   2510907..2510921))
FT                   /locus_tag="VIT_08s0007g06050"
FT                   /old_locus_tag="Vv08s0007g06050"
FT   CDS_pept        complement(join(2509564..2509649,2510224..2510428,
FT                   2510907..2510921))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06050"
FT                   /old_locus_tag="Vv08s0007g06050"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIH6"
FT                   /protein_id="CBI30052.3"
FT                   /translation="MPILRMCGNYYMFSNIPCEFRDAFCLSFTDLSSWTPDRGPLSMVL
FT                   GRSLNFEVGGIIDDDKHLLSHPLLVKSSDNYGILFYFLPQCSFLCAAKTRDFYWIF"
FT   gene            2511119..2512617
FT                   /locus_tag="VIT_08s0007g06040"
FT                   /old_locus_tag="Vv08s0007g06040"
FT   mRNA            join(2511119..2511155,2511156..2511249,2511499..2512427,
FT                   2512428..2512617)
FT                   /locus_tag="VIT_08s0007g06040"
FT                   /old_locus_tag="Vv08s0007g06040"
FT                   /product="unknown predicted protein"
FT   5'UTR           2511119..2511155
FT                   /locus_tag="VIT_08s0007g06040"
FT                   /old_locus_tag="Vv08s0007g06040"
FT   CDS_pept        join(2511156..2511249,2511499..2512427)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06040"
FT                   /old_locus_tag="Vv08s0007g06040"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLL9"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLL9"
FT                   /protein_id="CCB55275.1"
FT                   /translation="MAKLYSAGKSPPRMAAMLLLFGLLMASLEITGAQIGVCYGRNGNN
FT                   LPAPGEVVALYNQYNIRRMRLYDTRQDALQALGGSNIELILGVPNDNLQNIASSQANAD
FT                   SWVQDNIKNHLNVKFRYIAVGNEVSPSGAQAQFVLPAMQNINNAISSAGLGNQIKVSTA
FT                   IDTGVLGVSYPPSSGSFKSGVLSFLTSIISFLVKNNAPLLVNLYPYFSDLSNLNYALFT
FT                   APGVVVQDGQLGYKNLFDAILDAVYSALERAGGSSLKIVVSESGWPSAGGTQTTVDNAR
FT                   TYNSNLIQHVKGGTPKRPTGPIETYVFAMFDEDNKTPELEKHWGLFLPNKQPKYTINFN
FT                   "
FT   3'UTR           2512428..2512617
FT                   /locus_tag="VIT_08s0007g06040"
FT                   /old_locus_tag="Vv08s0007g06040"
FT   gene            2515241..2516553
FT                   /locus_tag="VIT_08s0007g06030"
FT                   /old_locus_tag="Vv08s0007g06030"
FT   mRNA            join(2515241..2515331,2515631..2516553)
FT                   /locus_tag="VIT_08s0007g06030"
FT                   /old_locus_tag="Vv08s0007g06030"
FT                   /product="unknown predicted protein"
FT   CDS_pept        join(2515241..2515331,2515631..2516553)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06030"
FT                   /old_locus_tag="Vv08s0007g06030"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLM0"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLM0"
FT                   /protein_id="CCB55276.1"
FT                   /translation="MAVNSYVKTSPRTTIVLLLLGLLMTNLHLTEAQIGVCYGTLGDNL
FT                   PPPEEVVELYTQNNFQRMRLYDPNIAALQALEGSNIELMLGVPNNALQDIANQGNANSW
FT                   VEKYVTNYTKVKFRYIAVGNEVSLSDYVAQFLLPAMKSITNAISAAGLDNQIKVSTATQ
FT                   LGVLGNSYPPSQGSFQTQARTFLDPIISLLVENRAPLLVSLYPYFSYSANTQDVSLDYA
FT                   LFTANEVTVQDGQLGYRNLFDSMVDAFYSALEEAGGSSLEIVISESGWPSAGGTGATLD
FT                   NARIYNTNLIQHVKGGTPKRPGKAIETYVFAMFDENSQTPELERHWGLFLPNKQPK"
FT   gene            2518291..2518963
FT                   /locus_tag="VIT_08s0007g06020"
FT                   /old_locus_tag="Vv08s0007g06020"
FT   mRNA            join(2518291..2518378,2518533..2518963)
FT                   /locus_tag="VIT_08s0007g06020"
FT                   /old_locus_tag="Vv08s0007g06020"
FT                   /product="unknown predicted protein"
FT   CDS_pept        join(2518291..2518378,2518533..2518963)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06020"
FT                   /old_locus_tag="Vv08s0007g06020"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLM1"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLM1"
FT                   /protein_id="CCB55277.1"
FT                   /translation="MATALLHSFDSMVVAMLLFGLLLATFQITGANTGVCYGLLGNNLP
FT                   PPHEVIDLYKHNNIPRMRIYAPVPEVLQALGGSNIELMVGVANEDLYNLATNMGTAYAW
FT                   VQNNIRNYPTVNFRYIAVGNEINPPAWEANYLLGAMKNIHQAISESGLGNQIKVSTAFS
FT                   AAWRILPSI"
FT   gene            2519049..2519477
FT                   /locus_tag="VIT_08s0007g06010"
FT                   /old_locus_tag="Vv08s0007g06010"
FT   mRNA            2519049..2519477
FT                   /locus_tag="VIT_08s0007g06010"
FT                   /old_locus_tag="Vv08s0007g06010"
FT                   /product="unknown predicted protein"
FT   CDS_pept        2519049..2519477
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06010"
FT                   /old_locus_tag="Vv08s0007g06010"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLM2"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLM2"
FT                   /protein_id="CCB55278.1"
FT                   /translation="MYPYFSYIGNTQYISLEYTLFTSPGIVVRDGQFGYQNIFDAILDA
FT                   GYSALEKAGGGSLEIVVTETGWPTAGGTATTIENARTYNTNLLRHVKGGTPKRPGKPIQ
FT                   TYIFAMFNENNKNPELEKHWGIFYPNRQSVYQIEFSPN"
FT   gene            2524472..2525910
FT                   /locus_tag="VIT_08s0007g06000"
FT                   /old_locus_tag="Vv08s0007g06000"
FT   mRNA            join(2524472..2524562,2524862..2525841,2525842..2525910)
FT                   /locus_tag="VIT_08s0007g06000"
FT                   /old_locus_tag="Vv08s0007g06000"
FT                   /product="unknown predicted protein"
FT   CDS_pept        join(2524472..2524562,2524862..2525841)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g06000"
FT                   /old_locus_tag="Vv08s0007g06000"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLM3"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLM3"
FT                   /protein_id="CCB55279.1"
FT                   /translation="MAVNSYVKTSPRTTIVLLLLGLLMTNLHLTEAQIGVCYGTLGDNL
FT                   PPPEEVVELYTQNNFQRMRLYEPNIAALQALEGSNIELMLGVPNNALSDIADQGNANSW
FT                   VEKYVTNYTKVKFRYIAVGNEVSLSDYVAQFLLPAMKSITNAISAAGLDNQIKVSTATQ
FT                   LGVLGNSYPPSQGSFQTQARTFLDPIISLLVENRAPLLVNLYPYLSYSANTQDVSLDYA
FT                   LFTAPNEVTVQDGQLGYRNLFDSMVDACYSALEEAGGSSLEIVISESGWPSAGGTGATL
FT                   DNARIYNTNLIQHVKGGTPKRPGKAIETYVFAMFDENRKTPELERHWGLFLPNKQSKYP
FT                   LLCRIPSATQIVYSIV"
FT   3'UTR           2525842..2525910
FT                   /locus_tag="VIT_08s0007g06000"
FT                   /old_locus_tag="Vv08s0007g06000"
FT   gene            2528154..2529583
FT                   /locus_tag="VIT_08s0007g05990"
FT                   /old_locus_tag="Vv08s0007g05990"
FT   mRNA            join(2528154..2528222,2528223..2528277,2528486..2529435,
FT                   2529436..2529583)
FT                   /locus_tag="VIT_08s0007g05990"
FT                   /old_locus_tag="Vv08s0007g05990"
FT                   /product="Beta 1-3 glucanase"
FT   5'UTR           2528154..2528222
FT                   /locus_tag="VIT_08s0007g05990"
FT                   /old_locus_tag="Vv08s0007g05990"
FT   CDS_pept        join(2528223..2528277,2528486..2529435)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05990"
FT                   /old_locus_tag="Vv08s0007g05990"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLM4"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLM4"
FT                   /protein_id="CCB55280.1"
FT                   /translation="MVAAMLLFGLLVATFHITGANTGVCYGLLGDNLPPPHEVIDLYKR
FT                   NNIQKMRIYAPAPEVLQALRGSNIELMVGVANEDLHSIATDMAKAYSWVQNNIRSYANV
FT                   NFRYIAVGNEINPPAWEANYLLGAMKNIHQAITEAGLGNQIKVSTPFSAMVLGESYPPS
FT                   KGSFRPDFGSFINPIISFLADTRAPFLFNMYPYFSYSGNTQYISLEYALFTSPGVMEQD
FT                   GQFGYQNIFDAMLDAGYSALEKAGGASLEIIVSETGWPTAGGTATTIENARTYITNLLR
FT                   HVKGGTPKRPGKPIQTYIFAMFNENNKNLELEKHWGLFYPNKQSVYQIEFSPN"
FT   3'UTR           2529436..2529583
FT                   /locus_tag="VIT_08s0007g05990"
FT                   /old_locus_tag="Vv08s0007g05990"
FT   gene            complement(2531897..2536165)
FT                   /locus_tag="VIT_08s0007g05980"
FT                   /old_locus_tag="Vv08s0007g05980"
FT   mRNA            complement(join(2531897..2531986,2532355..2532861,
FT                   2533079..2533228,2533347..2533574,2533931..2534215,
FT                   2536000..2536098,2536099..2536165))
FT                   /locus_tag="VIT_08s0007g05980"
FT                   /old_locus_tag="Vv08s0007g05980"
FT                   /product="Predicted protein"
FT   CDS_pept        complement(join(2531897..2531986,2532355..2532861,
FT                   2533079..2533228,2533347..2533574,2533931..2534215,
FT                   2536000..2536098))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05980"
FT                   /old_locus_tag="Vv08s0007g05980"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR025064"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLM5"
FT                   /protein_id="CCB55281.1"
FT                   /translation="MLGHFLHQCYILYAKLFLEGETVGWQCIRLCVCKSKRWKWVFTRL
FT                   KLKQCPALAAPCRTLTEARDEQKKHAMTVALATAAAAEAAVAAAHAAAEVVRLTGTPQS
FT                   YHTYDKGNQNLAAIKIQTAFRGHLARKALRALKGLVRLQALIRGQILRRQVITTLKCLP
FT                   STANNQAQVNKRGVLTANESYKDSDNRKFLRPKELGGREIKDYVIEQLEGSSKKSWDCS
FT                   MLLKEDMETIWLRKQEAVTKRERMKKYSSSHRERINAQMTEETESYKENGKWNSQFEQW
FT                   MDAREYEREELENSKSTIHLNMLNSDKNGTTNVKLRNACKQNSIEGSNLPFSHSRRSFC
FT                   HRKHNSEADNRSFPSSPVFPTYMATTESAKAKARSMSMPKQRVGFLDSCFDHSSAYKNR
FT                   LSFWSSFNGESISNIGKNGTPQNSKWFVIMEKTFLCISSKKKPFHSYPARTVL"
FT   5'UTR           complement(2536099..2536165)
FT                   /locus_tag="VIT_08s0007g05980"
FT                   /old_locus_tag="Vv08s0007g05980"
FT   gene            complement(2536166..2538371)
FT                   /locus_tag="VIT_08s0007g05970"
FT                   /old_locus_tag="Vv08s0007g05970"
FT   mRNA            complement(join(2536166..2536378,2536879..2537047,
FT                   2537180..2537453,2537812..2538036,2538113..2538371))
FT                   /locus_tag="VIT_08s0007g05970"
FT                   /old_locus_tag="Vv08s0007g05970"
FT                   /product="Predicted protein"
FT   CDS_pept        complement(join(2536166..2536378,2536879..2537047,
FT                   2537180..2537453,2537812..2538036,2538113..2538371))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05970"
FT                   /old_locus_tag="Vv08s0007g05970"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TII2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR011230"
FT                   /db_xref="UniProtKB/TrEMBL:D7TII2"
FT                   /protein_id="CBI30058.3"
FT                   /translation="MSLMCLFLLSQLILTVGFGNSAEQHEGTVALRTLRRNYVEVQQRS
FT                   SFKIALFADLHFGEDAWTNWGPRQDVKSIKVMSTVLDQENPDFVVYLGDVITANNVAIG
FT                   NASLYWDQAISPTRERGIPWASVFGNHDDAPFEWPLEWFSAPGIPHTHCNLPNSSVSGE
FT                   EECFRGTPRIELMKNEIQRNTLSYSRNGPIDLWPSISNYVLKVSSSQDPDSAVALLYFL
FT                   DSGGGSYPEVISSAQAEWFNRKSQELNPNSSVPEIIFWHIPSKAYKEVAPMFRIHKPCV
FT                   GSINKEKVASQEAEMGIMKLLVERPSVKAVFVGHNHGLDWCCPYEKLWLCFARHTGYGG
FT                   YGNWRRGARILEITEQPFSLKSWIRMENGHSRSEVLLSS"
FT   gene            complement(2540073..2542128)
FT                   /locus_tag="VIT_08s0007g05960"
FT                   /old_locus_tag="Vv08s0007g05960"
FT   mRNA            complement(join(2540073..2540606,2540767..2540916,
FT                   2540999..2541229,2541670..2541957,2542054..2542128))
FT                   /locus_tag="VIT_08s0007g05960"
FT                   /old_locus_tag="Vv08s0007g05960"
FT                   /product="Predicted protein"
FT   CDS_pept        complement(join(2540073..2540606,2540767..2540916,
FT                   2540999..2541229,2541670..2541957,2542054..2542128))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05960"
FT                   /old_locus_tag="Vv08s0007g05960"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR025064"
FT                   /db_xref="UniProtKB/TrEMBL:D7TII3"
FT                   /protein_id="CBI30059.3"
FT                   /translation="MGKKRSWFSLVKRIFISEAKEKEEKKPKSWRCLFTRFKLKQCPTL
FT                   AAPRRTLTEARAEQRKHALTVALATAAAAEAAVAAARAAAEVVRLTCSPPSYYHTCDKR
FT                   NQNLAAIKIQTAFRGYLARKALQALKGLVRLQALVRGQIVRRQAITKLKCLPSTANTRA
FT                   QVNIGGVLTTEETYKDGNNRKFLRPKKECGGREIKAYVIEQLEGSGQRSWDYNILSQED
FT                   VETIWLRKQEALIRRERMKKYSSSHRERINAQMPEETEPYKENGRQSCQLVRWMDSMEH
FT                   KRKEAENSKAAADSNLLNGHINGTTNIELRNGWKQNSTEGSDMPFSLPRRSFCHRKHNS
FT                   VIDDSSFPSSPVFPTYMAATESAKAKARALSTPKQRLGFLDSCFDQSSPYTNRPSFWSS
FT                   LNGESISSSGRSGYSWQNTVSMKSLN"
FT   gene            complement(2544051..2546660)
FT                   /locus_tag="VIT_08s0007g05950"
FT                   /old_locus_tag="Vv08s0007g05950"
FT   mRNA            complement(join(2544051..2544263,2544910..2545078,
FT                   2545321..2545597,2546117..2546344,2546417..2546660))
FT                   /locus_tag="VIT_08s0007g05950"
FT                   /old_locus_tag="Vv08s0007g05950"
FT                   /product="Predicted protein"
FT   CDS_pept        complement(join(2544051..2544263,2544910..2545078,
FT                   2545321..2545597,2546117..2546344,2546417..2546660))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05950"
FT                   /old_locus_tag="Vv08s0007g05950"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLM6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR011230"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLM6"
FT                   /protein_id="CCB55282.1"
FT                   /translation="MSLTSLYILFPLILTIGFGSSSEEHDALPLNYLQVRPGSSSFKIA
FT                   LFADLHFGESAWSDWGPLQDVNSIKVMSVVLDQETPADFVVYLGDVITANNIAIGNASL
FT                   YWEEAISPTRARGIPWASVFGNHDDAPFEWPLEWFSATGIPHTRCTLPNSSVSGEEECS
FT                   FRGTRRIELMENEIKQNNLSYSINGPKDLWPSISNFVLQVSSSQDPDSAVALLYFLDSG
FT                   GGSYPEVISSSQAEWFNRKSQELNPSSSVPEMIFWHIPSKAYKKVAPKLGIHKPCVGSI
FT                   NKEDVATQEAEMGIMKLLVKRPSVKAVFVGHNHGLDWCCPYEKLWLCFARHTGYGGYGN
FT                   WARGARILEITQQPFSLKSWIRMEDGQLHSEVVLSS"
FT   gene            2552187..2555210
FT                   /locus_tag="VIT_08s0007g05940"
FT                   /old_locus_tag="Vv08s0007g05940"
FT   mRNA            join(2552187..2552268,2553780..2554891,2554892..2555210)
FT                   /locus_tag="VIT_08s0007g05940"
FT                   /old_locus_tag="Vv08s0007g05940"
FT                   /product="putative uncharacterized protein"
FT   CDS_pept        join(2552187..2552268,2553780..2554891)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05940"
FT                   /old_locus_tag="Vv08s0007g05940"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLM7"
FT                   /protein_id="CCB55283.1"
FT                   /translation="MGGRRRQGDYHHQESQKTRSLNRKPPLGNWQPTVPSWEKKFCSSV
FT                   GSFSWQRLLENKRFIYLYDNVLQWNDSAGEEAFHNAKNRFWAQINGLPCDISLPDPDIY
FT                   IDEIDWNCSIDPEMILDLEREPVDPDDCVKSEKVSSLGNSLLLLNQSFSCTGWGDAEED
FT                   IGKAADIPSGPGLWHHNQNVDNPWELSCTQNKGAVKATGWGDSEEPVEATGWGDCGEPV
FT                   EATGWGNTNEPVKATGWGNSNEPVKATGWGDWDHQPVEATGWGDYYGAMEVPIWKDGWN
FT                   NSSGWNQYENKYNDLENLKDRRAGGVWGTGNGNSRGEEVGYMSRYRSSRFHDNEYQADR
FT                   GWRSGGRKRANFLFDEGSFLDKKAASQPRNTIHHCGPVSHHGSGKAGNSWSWKKPVS"
FT   3'UTR           2554892..2555210
FT                   /locus_tag="VIT_08s0007g05940"
FT                   /old_locus_tag="Vv08s0007g05940"
FT   gene            2557316..2564022
FT                   /locus_tag="VIT_08s0007g05930"
FT                   /old_locus_tag="Vv08s0007g05930"
FT   mRNA            join(2557316..2557417,2558887..2558997,2560377..2561314,
FT                   2561953..2562406,2562537..2562734,2562844..2562925,
FT                   2563537..2563631,2563632..2564022)
FT                   /locus_tag="VIT_08s0007g05930"
FT                   /old_locus_tag="Vv08s0007g05930"
FT                   /product="Predicted protein"
FT   CDS_pept        join(2557316..2557417,2558887..2558997,2560377..2561314,
FT                   2561953..2562406,2562537..2562734,2562844..2562925,
FT                   2563537..2563631)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05930"
FT                   /old_locus_tag="Vv08s0007g05930"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLM8"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR014906"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036285"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLM8"
FT                   /protein_id="CCB55284.1"
FT                   /translation="MKSDGAQIQKWKSRRRRAGKAEAATTHLGERRSPHFSASGCARNF
FT                   EWLELRSEAAAFFKEESSAGVIGLIQLLLILSFPLLGMDVDEENPVSVSLAEPSAAVTD
FT                   DQTPVSTIDPTPLPAMQPIIPSLVPPPIVPPIAPIPSVSAPILRPLAPLPVRPPVLRPP
FT                   LPQNGEMRASDSDSDRDDSGRAQAASGSAVEYEISEESRQFRERQEKAKQEFLMKRRAS
FT                   ALAVPTNDMAVRTRLRRLGEPITLFGEREMERRDRLRMIMAKLDAEGQLEKLMKAHEEE
FT                   EAAAPVAMEEVEEETLQYPFYTEGSKSLLEARVEIAKYSIKRAASRLYRARRKRDDPDE
FT                   DLDAEMDWVLKEAGSLVLDCSEIGDDRPLSGCSFSHDGKLLAACALSGVAKIWSMPQVN
FT                   KVSALKGHTERATDVAFSPALNHLATASADRTARLWNSEGSLLKTFEGHLDRLARIAFH
FT                   PSGKYLGTASFDKTWRLWDVETGEELLLQEGHSRSVYGISFHRDGSLAASCGLDALGRV
FT                   WDLRSGRSILALEGHVKPVLGICFSPNGYHLATGAEDNTCRIWDLRKKKSLYVIPAHSN
FT                   LVSQVKFEPQEGYFLVTASYDMTAKVWSARDFKPVKTLSGHEAKVTSLDITEDGHCIAT
FT                   VSHDRTIKLWSSAEIEKEKAMDID"
FT   3'UTR           2563632..2564022
FT                   /locus_tag="VIT_08s0007g05930"
FT                   /old_locus_tag="Vv08s0007g05930"
FT   gene            complement(2564711..2572426)
FT                   /locus_tag="VIT_08s0007g05920"
FT                   /old_locus_tag="Vv08s0007g05920"
FT   mRNA            complement(join(2564711..2565105,2565106..2565165,
FT                   2566331..2566451,2566541..2566581,2566668..2566728,
FT                   2567318..2567404,2567848..2567975,2568050..2568165,
FT                   2569023..2569141,2569278..2569369,2571119..2571206,
FT                   2571840..2572204,2572205..2572426))
FT                   /locus_tag="VIT_08s0007g05920"
FT                   /old_locus_tag="Vv08s0007g05920"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(2564711..2565105)
FT                   /locus_tag="VIT_08s0007g05920"
FT                   /old_locus_tag="Vv08s0007g05920"
FT   CDS_pept        complement(join(2565106..2565165,2566331..2566451,
FT                   2566541..2566581,2566668..2566728,2567318..2567404,
FT                   2567848..2567975,2568050..2568165,2569023..2569141,
FT                   2569278..2569369,2571119..2571206,2571840..2572204))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05920"
FT                   /old_locus_tag="Vv08s0007g05920"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TII7"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR033895"
FT                   /db_xref="UniProtKB/TrEMBL:D7TII7"
FT                   /protein_id="CBI30063.3"
FT                   /translation="MTVRKRASSETTAAAAAQQPKSQETTTATSATTTDPPIAPPKSGT
FT                   ILKLSLLLIIPYAYLILFHYRVDADLKRSILINAGLSLAGFFVTRTMIPVASSYVIRRS
FT                   LFGYDINKKGTPQGSVKVPESLGIVVGIVFLVLAILFQYFNFTSDSNWLVEYNAALASI
FT                   CFMTLLGFVDDVLDIPWRVKLILPSFAALPLLMAYAGHTTIIIPKPLIPYVGLEVLDLG
FT                   WIYKLYMGLLAVFCTNSINIHAGLNGLEVGQTVVIASAILIHNAMQIGASTDPEYKQAH
FT                   AFSIYLVQPLLATSLALLSYNWYPSSVFVGDTYTYFAGMTMAVVGILGHFSETLLIFFI
FT                   PQVLNFLLSLPQLSGYVKCPRHRLPRFDPQTGLLTGTNDGTVVNLFLRQFGRMSEKSLC
FT                   ILLLVFQAIGCCFCFVLRWFLAGWYK"
FT   5'UTR           complement(2572205..2572426)
FT                   /locus_tag="VIT_08s0007g05920"
FT                   /old_locus_tag="Vv08s0007g05920"
FT   gene            complement(2577329..2612274)
FT                   /locus_tag="VIT_08s0007g05910"
FT                   /old_locus_tag="Vv08s0007g05910"
FT   mRNA            complement(join(2577329..2577616,2577617..2577738,
FT                   2578311..2578470,2578720..2578800,2579108..2579155,
FT                   2579294..2579431,2581285..2581395,2582358..2582683,
FT                   2582879..2583112,2583290..2583369,2584006..2584106,
FT                   2584184..2584373,2587054..2587109,2587567..2587760,
FT                   2589716..2589871,2590584..2590662,2590864..2591193,
FT                   2591596..2591754,2594989..2595066,2595225..2595271,
FT                   2595536..2595596,2595773..2595829,2596014..2596097,
FT                   2598104..2598164,2599111..2599220,2599699..2599764,
FT                   2602632..2602827,2603195..2603837,2605542..2605627,
FT                   2607074..2607221,2607659..2607836,2608841..2609053,
FT                   2609693..2609893,2610454..2610671,2611969..2612110,
FT                   2612111..2612274))
FT                   /locus_tag="VIT_08s0007g05910"
FT                   /old_locus_tag="Vv08s0007g05910"
FT   3'UTR           complement(2577329..2577616)
FT                   /locus_tag="VIT_08s0007g05910"
FT                   /old_locus_tag="Vv08s0007g05910"
FT   CDS_pept        complement(join(2577617..2577738,2578311..2578470,
FT                   2578720..2578800,2579108..2579155,2579294..2579431,
FT                   2581285..2581395,2582358..2582683,2582879..2583112,
FT                   2583290..2583369,2584006..2584106,2584184..2584373,
FT                   2587054..2587109,2587567..2587760,2589716..2589871,
FT                   2590584..2590662,2590864..2591193,2591596..2591754,
FT                   2594989..2595066,2595225..2595271,2595536..2595596,
FT                   2595773..2595829,2596014..2596097,2598104..2598164,
FT                   2599111..2599220,2599699..2599764,2602632..2602827,
FT                   2603195..2603837,2605542..2605627,2607074..2607221,
FT                   2607659..2607836,2608841..2609053,2609693..2609893,
FT                   2610454..2610671,2611969..2612110))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05910"
FT                   /old_locus_tag="Vv08s0007g05910"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLM9"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR026960"
FT                   /db_xref="InterPro:IPR036361"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLM9"
FT                   /protein_id="CCB55285.1"
FT                   /translation="MAAESVTVSVQRAPFSSKWQASRRDKLHTQVRASQSMDDKNKVFK
FT                   ELGLFSLRKKIEGVVLQADMLAPAALELEEASRIRQEEMIRKYNLWDDVTKSNEILGKL
FT                   ADSSKVVDTLKDLTYKAEEAKLITQLVEMDAINHGLFEQAYNASVDVSKFLYQYEMSKL
FT                   LRGQFDMEGACLTIKAGPRGIYSEIWAEQLLSMYTKWAEKQGYKGRVVEKYASKNGGIK
FT                   SATIEFESEYGYGYLSGERGVHHMIRSSDDESILHETGSAVVDVIPLFLETAPDLQIDD
FT                   GDLRISSPSCHGVEQGRTGHAVCIQHIPTGISVQSSGERSHFANKMRALNRLKAKLVVT
FT                   AMEQGIPEVGGIKREAIADMWKQETRRHRATNPAIYRDEWRELSAKFIMDSTLRTMENL
FT                   LSKLHPLAIRRGVDDSLRWKANKNGTFSVKCFYSSLSMGINHPFPVSTIWKSWAPTRAS
FT                   FFGWEAAWNRLLTTDRLKRFGWNIPNRCFLCKNEEESIDHLLLFCEKARMLWYLTFSLF
FT                   GVQWVMHSSVKRNLLGWYGSFVGKKREKAWKTAPLCLMWTIWKERNRRAFDDVERNDQD
FT                   IKSIFLYTFVNWARVYIKDHTLSLFDFVNWLATKYAKISYQTMENMKSTIECSEELPLS
FT                   SSYEMAMEALSSLITSQKRGGRSSVSGKYGKLDRMSMYLKILGLEEKIAGLKIIHVAGT
FT                   KGKGSTCTFCEAILRECGFRTGLFISPHLIDVRERLRIDGLDISEEKFLMHFWDCWNRL
FT                   KEKVTNDLPMPPLFQFLSVLAFKIFTCEEVDVAIIEVGLGGKRDSTNVIKEPVVCGITS
FT                   LGMDHTETLGDTLGKIASHKAGIFKPQIPAFTVPQLSEAMDVLQQRAHELEVPLEVAAP
FT                   LDHKNLKGLKLSLSGDHQFINAGLAVSLCKCWLQSTGNWEKLLKNANQEDDLLEAFLRG
FT                   LSTARLSGRAQTVYDTPLKSYNLSEATENSFGDLIFYLDGAHSPESMDVCARWFSNAVK
FT                   ERRNSPSSSFVKVGNMVNGYIHHKKEDTEESNKISKQILLFNCMEVRDPHILLPQLVRT
FT                   CASSGTHFSKALFVPSISTYNKVTSGDSIVPLDLPARDLSWQFNLQRIWEKIIHNKDVV
FT                   VDESFKMDSPRILPPFEFLYENGSSGSPSSKCLSSSAVMPSLPLTIRWLRDCVKENPSL
FT                   RLQVLVTGSLHLVGDVLKLLRSFAVTPLSLRARTLVYLKARTTGSQRLVCYSSEIESSS
FT                   TLTSKKVKKESSSMSSRPNTKKGVIEENASRTQSIEIQSIRDDPAKVKAMTVQELTTTL
FT                   RSVGVPAKGCKRDLVLALKSFLDNKASDESSQAEEQLELNILSKRKAKNLSVEDHEQNV
FT                   NIVSDASGLKQSKRRAKQSPVEAKIEVNTEIINEKEKPSIKNKEASGNKLYQGERKASS
FT                   RSSIKQIAVTERIDISMNEPEPWTVLTHKKPQEGWIPYNPRTMRPPPLTGDAKFVKLMS
FT                   WNVNGLRGLLKSKGFSALKLAQREDFDVLSLQETKLQEKDVEAIKQSVIEGYENSFWTC
FT                   SVSKLGYSGTAIISRIKPLSVRYGLGISDHDSEGRLLTAEFESFYLLSGYVPNSGDGLK
FT                   RLSYRVTQWDSALGSYMKELEKSKPVILTGDLNCAHQEIDIHDPAGNRRSAGFTDEERQ
FT                   SLEKNFLSKGFVDSFRKQHPGVVGYTYWGYRNGCRKSNKGWRLDYFLVSESIADKVHDS
FT                   YILPDIGGSDHCPIGLVLKL"
FT   5'UTR           complement(2612111..2612274)
FT                   /locus_tag="VIT_08s0007g05910"
FT                   /old_locus_tag="Vv08s0007g05910"
FT   gene            complement(2614015..2622497)
FT                   /locus_tag="VIT_08s0007g05900"
FT                   /old_locus_tag="Vv08s0007g05900"
FT   mRNA            complement(join(2614015..2614200,2614360..2614498,
FT                   2615383..2615492,2616320..2616409,2616488..2616816,
FT                   2617339..2617678,2618104..2618214,2618799..2618891,
FT                   2619258..2619309,2619541..2619638,2620611..2620732,
FT                   2622275..2622497))
FT                   /locus_tag="VIT_08s0007g05900"
FT                   /old_locus_tag="Vv08s0007g05900"
FT                   /product="GCN5-related N-acetyltransferase"
FT   CDS_pept        complement(join(2614015..2614200,2614360..2614498,
FT                   2615383..2615492,2616320..2616409,2616488..2616816,
FT                   2617339..2617678,2618104..2618214,2618799..2618891,
FT                   2619258..2619309,2619541..2619638,2620611..2620732,
FT                   2622275..2622497))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05900"
FT                   /old_locus_tag="Vv08s0007g05900"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLN0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLN0"
FT                   /protein_id="CCB55286.1"
FT                   /translation="MAPKKSLQHSSIPIGKSEIKTLGDSRFSNRKILMAMDFKFSGNCE
FT                   ISIQGKATCQSDPNCLLISASKNTKIKVSGLTLFVCFTSVKAERTSFGDEYFFLLINPK
FT                   DVCSQSKSLLQEVLNIYKEELPAMNYAANTGKESMFLERCVSNGKYCSLLLLSNFMEGP
FT                   GKVIAAVTYQIIPADTQYAEIPLTAVSSNFQSKGIGRLLYIELRKRLQNVGIRTIFCWG
FT                   DKESEGFWLKQGFVSIAEVDTKGRARRLPIRADIRRALCFPGGSTLMVSHLSKDISANF
FT                   SDAVKKSFSLKPHEKSSSLDVQIQGLGDIGESLDTLKAPVQTSLKTFLPHVLVKDGFQK
FT                   DDDMLDGSFHNHESINVCRDLVPFEEVDCNNMTNDVRLTGVGTDVEANCSCSAHGAKKR
FT                   VWEASLSSLKSKKVKGSHQIGCQLDSNWDIVSGNGKIDNVCFVGCSLGTTRNESLSELS
FT                   FELQEKGEGFRIMLMNIADDTKKAHLTKIIKDLGGSVTSDGSACTHVVTGKVRKTLNFC
FT                   TALCSGAEIKSVILRAKARPRALLKGYSVCLAPHVQPAVETLSTIVRFAGGKVIYGLDV
FT                   VDASKTIFVACEIDMEEALLAVKKRIWTFSSEWFMNSIMRQELDFEAPQFAESL"
FT   gap             2628086..2628185
FT                   /estimated_length=100
FT   gene            2628647..2632709
FT                   /locus_tag="VIT_08s0007g05890"
FT                   /old_locus_tag="Vv08s0007g05890"
FT   mRNA            join(2628647..2628701,2628702..2628819,2628904..2630246,
FT                   2631084..2631251,2632033..2632386,2632387..2632709)
FT                   /locus_tag="VIT_08s0007g05890"
FT                   /old_locus_tag="Vv08s0007g05890"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           2628647..2628701
FT                   /locus_tag="VIT_08s0007g05890"
FT                   /old_locus_tag="Vv08s0007g05890"
FT   CDS_pept        join(2628702..2628819,2628904..2630246,2631084..2631251,
FT                   2632033..2632386)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05890"
FT                   /old_locus_tag="Vv08s0007g05890"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLN1"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLN1"
FT                   /protein_id="CCB55287.1"
FT                   /translation="MAILLSSVSLHSTGAKLSPVLFEDGVIEGNSTATFRLFTGMRKNS
FT                   RKNDIKFSFVALSVKSKYTIQETQKNNWKNPRKVGGNPILSEGKDEDESYGQICPGCGV
FT                   YMQDEDPNLPGYYQKRKLTLTEMPEGQEDMEGLWVDELGSEEEDVVDDIESKFEGSDGE
FT                   ESNLGTEDGNEFDWDSDEWESELEGEDDDLDLDGFAPAGVGYGNITEETINKRKKKRVS
FT                   KSEKKRMAREAEKEREEVTVCARCHSLRNYGQVKNQMAENLIPDFDFDRLIATRLMKPT
FT                   GTADATVVVMVVDCVDFDGSFPKRAAKSLFKALEGSRVGAKVSRKLPKLVLVATKVDLL
FT                   PSQISPTRLDRWVRNRAKAGGAPKLSGVYLVSARKDLGVRNLLSFIKELAGPRGNVWVI
FT                   GSQNAGKSTLINTFAKREGVKLTKLTEAAVPGTTLGILRIGGILSAKAKMYDTPGLLHP
FT                   YLMSMRLNRDEQKMAEIRKELQPRTYRMKAGQAVHVGGLMRLDLNQASVETIYVTIWAS
FT                   PNVSLHMGKIENADEIWRKHVGVRLQPPVRVDRVSEIGKWEEQEIKVSGASWDVNSIDI
FT                   AVAGLGWFSLGLKGEATLALWTYDGIEVILREPLVLDRAPFLERPGFWLPKAISDAIGN
FT                   QSKLEAEARKRDQEESTKSLSEMST"
FT   3'UTR           2632387..2632709
FT                   /locus_tag="VIT_08s0007g05890"
FT                   /old_locus_tag="Vv08s0007g05890"
FT   gene            complement(2633225..2635262)
FT                   /locus_tag="VIT_08s0007g05880"
FT                   /old_locus_tag="Vv08s0007g05880"
FT   mRNA            complement(join(2633225..2633448,2633449..2633597,
FT                   2633736..2634128,2635178..2635262))
FT                   /locus_tag="VIT_08s0007g05880"
FT                   /old_locus_tag="Vv08s0007g05880"
FT                   /product="ERD15"
FT   3'UTR           complement(2633225..2633448)
FT                   /locus_tag="VIT_08s0007g05880"
FT                   /old_locus_tag="Vv08s0007g05880"
FT   CDS_pept        complement(join(2633449..2633597,2633736..2634128,
FT                   2635178..2635262))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05880"
FT                   /old_locus_tag="Vv08s0007g05880"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR040414"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLN2"
FT                   /protein_id="CCB55288.1"
FT                   /translation="MDSPGHISYEPFVDWSERKSIEIFSLPEEQGFRALQKLEMALVTG
FT                   GRSTLNPNAPLFIPAAFRQVEDFSPEWWQLITTSTWFRDYWLSQHQEGDIFNCNNADDE
FT                   FDANDIADLLPDAFDFGTEEDFSHMEAQFEEFIQSSEAEEANKPSHLALNGTSGNGSAV
FT                   MDVNALMKFTNERGPKSLAEPAKYQEKAGRCMSPKCSPRPIQQPR"
FT   gene            2639671..2645243
FT                   /locus_tag="VIT_08s0007g05870"
FT                   /old_locus_tag="Vv08s0007g05870"
FT   mRNA            join(2639671..2639702,2639703..2640071,2640168..2640308,
FT                   2640393..2640496,2640581..2640802,2641357..2641851,
FT                   2643594..2644024,2644647..2644740,2644843..2644978,
FT                   2644979..2645243)
FT                   /locus_tag="VIT_08s0007g05870"
FT                   /old_locus_tag="Vv08s0007g05870"
FT                   /product="unknown predicted protein"
FT   5'UTR           2639671..2639702
FT                   /locus_tag="VIT_08s0007g05870"
FT                   /old_locus_tag="Vv08s0007g05870"
FT   CDS_pept        join(2639703..2640071,2640168..2640308,2640393..2640496,
FT                   2640581..2640802,2641357..2641851,2643594..2644024,
FT                   2644647..2644740,2644843..2644978)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05870"
FT                   /old_locus_tag="Vv08s0007g05870"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLN3"
FT                   /db_xref="InterPro:IPR007720"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLN3"
FT                   /protein_id="CCB55289.1"
FT                   /translation="MPVFLQETSAFTTLGHCAADFSCNGQLSSIEMDKDDQRKSNIHGH
FT                   INLQNYQDGFGENYGRWSCGCQKLGELLEQCRQASIGNSNWMQFIYDSHEYFGSEIHWI
FT                   PRLHHIHWNGQIVFDCDVHVVVYETPRFGVHHFLLCFGSSSEQVKNPLMKPKWVDELHQ
FT                   KQSLLDLDAVILAINSSNAAKIFFDRNVRPKRSSVQFPIVCMFSALIWNLLAISVASFS
FT                   TLFYIILQLLSHFASYGSESWICIILAKAFCNTWKNIRIRCCQILYWPIFLGGDYHRSL
FT                   SCVEYAEKAALHRHAMWSCIVVDVFLGSLIGLALLFHAESACLCVLKFAHNITNNLLRS
FT                   GCVWLMGVPAGFKLNTELAGILGMISFNAIQIWSTLWFHMGFLFIYFIKGLAISGIILG
FT                   VTIPAALMIDMIALATLHVSSVNWFLSLLYSLQIQALAALWRLFGGRKWNPLRRRLDSY
FT                   DYTVEQHIVGSLLFTPLLLLLPTTSVFYIFFTILNTTICLLCILVEITISIIHATPYSK
FT                   IFLWLMSPRRFPSGTWLEIISSQSNAIDSPEIGCLNEIGSPSTGTQQRKDSSERRSSVL
FT                   VSFLRSNLSNIGQILLPHYKNMFSGVCGSFITSSARGLLTGRRMPSTLGTGLPAPMPWM
FT                   SIPYKEYWRLCRDSVIACMQNPEHHLIQ"
FT   3'UTR           2644979..2645243
FT                   /locus_tag="VIT_08s0007g05870"
FT                   /old_locus_tag="Vv08s0007g05870"
FT   gene            2649609..2650825
FT                   /locus_tag="VIT_08s0007g05860"
FT                   /old_locus_tag="Vv08s0007g05860"
FT   mRNA            join(2649609..2649678,2649679..2649747,2650036..2650095,
FT                   2650186..2650219,2650454..2650635,2650636..2650825)
FT                   /locus_tag="VIT_08s0007g05860"
FT                   /old_locus_tag="Vv08s0007g05860"
FT                   /product="Gibberellin regulated protein"
FT   5'UTR           2649609..2649678
FT                   /locus_tag="VIT_08s0007g05860"
FT                   /old_locus_tag="Vv08s0007g05860"
FT   CDS_pept        join(2649679..2649747,2650036..2650095,2650186..2650219,
FT                   2650454..2650635)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05860"
FT                   /old_locus_tag="Vv08s0007g05860"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR003854"
FT                   /db_xref="UniProtKB/TrEMBL:A5AI86"
FT                   /protein_id="CCB55290.1"
FT                   /translation="MARKLSIVMLSLSMMLLLLVQNNATITEAPTPQPQQSTNGFPMHG
FT                   VTQGSLHPQECAPRCTTRCSKTAYKKPCMFFCQKCCAKCLCVPPGTYGNKQFCPCYNNW
FT                   KTKRGGPKCP"
FT   3'UTR           2650636..2650825
FT                   /locus_tag="VIT_08s0007g05860"
FT                   /old_locus_tag="Vv08s0007g05860"
FT   gene            2650826..2653149
FT                   /locus_tag="VIT_08s0007g05850"
FT                   /old_locus_tag="Vv08s0007g05850"
FT   mRNA            join(2650826..2650859,2653059..2653087,2653088..2653149)
FT                   /locus_tag="VIT_08s0007g05850"
FT                   /old_locus_tag="Vv08s0007g05850"
FT   CDS_pept        join(2650826..2650859,2653059..2653087)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05850"
FT                   /old_locus_tag="Vv08s0007g05850"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIJ6"
FT                   /protein_id="CBI30072.3"
FT                   /translation="MCHCVDPQSHKGLMGWCAEM"
FT   gap             2652161..2652260
FT                   /estimated_length=100
FT   3'UTR           2653088..2653149
FT                   /locus_tag="VIT_08s0007g05850"
FT                   /old_locus_tag="Vv08s0007g05850"
FT   gene            complement(2653347..2654054)
FT                   /locus_tag="VIT_08s0007g05840"
FT                   /old_locus_tag="Vv08s0007g05840"
FT   mRNA            complement(join(2653347..2653449,2653450..2653695,
FT                   2653696..2654054))
FT                   /locus_tag="VIT_08s0007g05840"
FT                   /old_locus_tag="Vv08s0007g05840"
FT                   /product="Predicted protein"
FT   3'UTR           complement(2653347..2653449)
FT                   /locus_tag="VIT_08s0007g05840"
FT                   /old_locus_tag="Vv08s0007g05840"
FT   CDS_pept        complement(2653450..2653695)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05840"
FT                   /old_locus_tag="Vv08s0007g05840"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLN5"
FT                   /protein_id="CCB55291.1"
FT                   /translation="MAGLQYYFFPTDFFYPLQKSTNGDSTTKMLLSLQTQEKAESDGGK
FT                   QARTVMQVDKFSPIKHPSSIALTPIQKKRDGFHNAA"
FT   5'UTR           complement(2653696..2654054)
FT                   /locus_tag="VIT_08s0007g05840"
FT                   /old_locus_tag="Vv08s0007g05840"
FT   gene            complement(2654455..2656714)
FT                   /locus_tag="VIT_08s0007g05830"
FT                   /old_locus_tag="Vv08s0007g05830"
FT   mRNA            complement(join(2654455..2654597,2654598..2654932,
FT                   2656378..2656669,2656670..2656714))
FT                   /locus_tag="VIT_08s0007g05830"
FT                   /old_locus_tag="Vv08s0007g05830"
FT   3'UTR           complement(2654455..2654597)
FT                   /locus_tag="VIT_08s0007g05830"
FT                   /old_locus_tag="Vv08s0007g05830"
FT   CDS_pept        complement(join(2654598..2654932,2656378..2656669))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05830"
FT                   /old_locus_tag="Vv08s0007g05830"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLN6"
FT                   /protein_id="CCB55292.1"
FT                   /translation="MAGQLYFFFPTDFYYPKPPSVTAENANNLPVPSLHIPKSVDPQQP
FT                   KTLVHREVQYEKVEKQPPFSPVRCAGSSHAKGRVKNLQQRRSWQMGGSPFLIVSMAGQL
FT                   YLFFPTDFYYPKPPSVNGEKANNPSFPSLQTPKTLHHQQPKALVHKNTQGEKLEKEPSS
FT                   SIEHRVSSSQAEGRPRVYNRKEVQGKSAELPAATFLDWNSRTRAF"
FT   5'UTR           complement(2656670..2656714)
FT                   /locus_tag="VIT_08s0007g05830"
FT                   /old_locus_tag="Vv08s0007g05830"
FT   gene            complement(2657955..2658897)
FT                   /locus_tag="VIT_08s0007g05820"
FT                   /old_locus_tag="Vv08s0007g05820"
FT   mRNA            complement(join(2657955..2658242,2658343..2658492,
FT                   2658595..2658897))
FT                   /locus_tag="VIT_08s0007g05820"
FT                   /old_locus_tag="Vv08s0007g05820"
FT                   /product="unknown predicted protein"
FT   CDS_pept        complement(join(2657955..2658242,2658343..2658492,
FT                   2658595..2658897))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05820"
FT                   /old_locus_tag="Vv08s0007g05820"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLN7"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR039123"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLN7"
FT                   /protein_id="CCB55293.1"
FT                   /translation="MNLESYYIPKQNISNPKGEDAHFIHKADYQTIGVADGVGGWTQRG
FT                   VDEGKYARELMKNCVLALDSENKGVVNPMMVLNEAYFKTKAPGSSTACIITLTRDNYLH
FT                   VVNVGDSGFMLFRDGEMVYKSPIQQRGFNCPYQLGRSKGSDRPSSAEELKVAVKERDIL
FT                   VVGTDGLFDNMFVSEMKEIIGNVEKEGLTPKELAWTLAELASYNSLDKDGDTPFAQAKR
FT                   FAGCGQDKGGKVDDITVIVAYIVL"
FT   gene            complement(2660702..2667275)
FT                   /locus_tag="VIT_08s0007g05810"
FT                   /old_locus_tag="Vv08s0007g05810"
FT   mRNA            complement(join(2660702..2660711,2662744..2663125,
FT                   2663327..2663356,2663465..2663692,2664326..2666362,
FT                   2666747..2667275))
FT                   /locus_tag="VIT_08s0007g05810"
FT                   /old_locus_tag="Vv08s0007g05810"
FT                   /product="putative uncharacterized protein"
FT   CDS_pept        complement(join(2660702..2660711,2662744..2663125,
FT                   2663327..2663356,2663465..2663692,2664326..2666362,
FT                   2666747..2667275))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05810"
FT                   /old_locus_tag="Vv08s0007g05810"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLN8"
FT                   /db_xref="InterPro:IPR012417"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLN8"
FT                   /protein_id="CCB55294.1"
FT                   /translation="MAQSNIPNKLEVQSDSGNEAELESLESRNRGGTEPNKRLNKLRSI
FT                   KLPKVRSFKQSKRWVNSRSDRVSSILSGNQATPQKLSPIPMSDASPNYMKATSCSSARK
FT                   ENFQASPRNSESSFGSVDSNWGNSNHLKPNVALLGQKSVRALTRRSSFKPMKGLTRMSS
FT                   LRSKRSLMKKNSGATCSSTLKNSNFPHHVELHSGGSESERISVMKVCPYKYCSLNGHCH
FT                   APLPPLKPFLLRRRRMLKTQKTMKRHFSGLEKEIQAYKMAFNIDTSRAGSPTAEKAGED
FT                   FFVEIYAKPSGKSKGEGAHGGDGEAKSDSGSLDEVLLGETSYPQIGMEESPSQLSHFQA
FT                   ANCSNKKGSDESVSEATDRDWKEEEIVASNLDNESHNSNVIDDQPDSVVFCSLEGEGPG
FT                   LCNKPSSTLDDTESTSHEEVAVGGNVFQEVHEEFVSVLNSESNEGGSESNGEKADDLTI
FT                   ATGEPSSPSKSTQPYDHLESITINGVVHSASTCGPLDKLTEGGEEKHGVSKLDYGSLRG
FT                   CSPAGDSELPCNSDEAIESQLEKQKFIRMWRLIYQHVVSGTAAKVRTQLSLDGAEGEKQ
FT                   QDEADSVVNGDACQDFSETNPDMEDNGADCQKIELCQIDAIRLVEEAIDGILLPETQDN
FT                   LSDDHSVTSDTNSDQEISETNHGKDKERNIPASPSPAKDGFRELNEIHGRVADPEQTLL
FT                   KHDNTTVQVREKTIFKVEDKPSQKMRKSWSNLKKVILLKKFIKAVEKVSKFNPQEPRYL
FT                   PLQPKSEAEKIYLRHQEMEGRKSAEEWMLDYALQQVVSKLTPARRRKVALLVEAFEAIS
FT                   PLQDIESPLKPTAAVPFHGKPVQASISSSGQGGEETGKENDGGNYGYLRGNPSPGDSEP
FT                   ESNTDVTYRNQMDKQTRNRMWYLIYQHVVSGIGANVESHGLLDDVNKTLPQGASETDQN
FT                   KDHPLDNPSSTVSKVGSKSNQPVSKNWSNLKKLILLKRFVKSLEKVKKFNPRGPRFLPL
FT                   KPDPEAEKICLRHQTTEDRKNSEEWMLDYALQQVVTKLSPARRRRVELLVEAFETVTPP
FT                   SQIEAQKRHNAASRATSWPLRKV"
FT   gene            2671007..2676509
FT                   /locus_tag="VIT_08s0007g05800"
FT                   /old_locus_tag="Vv08s0007g05800"
FT   mRNA            join(2671007..2671142,2671143..2672561,2673860..2674003,
FT                   2675236..2676225,2676226..2676509)
FT                   /locus_tag="VIT_08s0007g05800"
FT                   /old_locus_tag="Vv08s0007g05800"
FT                   /product="Predicted protein"
FT   5'UTR           2671007..2671142
FT                   /locus_tag="VIT_08s0007g05800"
FT                   /old_locus_tag="Vv08s0007g05800"
FT   CDS_pept        join(2671143..2672561,2673860..2674003,2675236..2676225)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05800"
FT                   /old_locus_tag="Vv08s0007g05800"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLN9"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021771"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLN9"
FT                   /protein_id="CCB55295.1"
FT                   /translation="MDISNEASVDPFSIGPSTIVGRTIAFRILFCKSMSHLRHRVFHVL
FT                   LELIYKFRDNIAPMISWFHPRNPQGILAMVTIIAFLLKRYTNVKMRAELAYRRKFWRNM
FT                   MRTALTYEEWAHAAKMLDKETPKLNESDLYDEELVRNKLQELRHRRQEGSLRDIIFFMR
FT                   ADLIRNLGNMCNPELHKGRLHVPKRIKEYIDEVSTQLRMVCDFDSEELLLEEKLAFMHE
FT                   TRHAFGRTALLLSGGASLGAFHVGVVKTLVEHKLLPRIIAGSSVGSIMCSVVATRSWPE
FT                   LQSFFEDSWHSLQFFDTMGGIFTVVKRVMTRGALHEIRQLQKMLRHLTSNLTFQEAYDM
FT                   TGRILGITVCSPRKHEPPRCLNYLTSPHVVIWSAVTASCAFPGLFEAQELMAKDRSGEI
FT                   VPYHPPFHLGPEQASGTTARRWRDGSLEIDLPMMQLKELFNVNHFIVSQANPHISPLLR
FT                   LKEFVRAYGGNFAAKLAHLAEMEVKHRCNQILELGFPLGGLARLFAQDWEGDVTVVMPA
FT                   TLAQYSKILQNPSYLELQKAANQGRRCTWEKLSAIKANCGIELALDECVAILNHMRRLK
FT                   RSADRAAASSHGLANTVRFNASRRIPSWNCIARENSTGSLEEDLFIDVASSFHQGVSGS
FT                   IGGHPGRNSRTHRNLHDGSDSEPESVDLNSWTRSGGPLMRTTSANKFIDFVQNLDLDAE
FT                   LNRSGMGAPNSIVIQMVGMDPYCQNSRVTTPDRSSDSTEVDQRDLYNRAPTNGSSIMVT
FT                   EGDLLQPEKIHNGIVFNVVKKEDLTLSNRSHDSESYSPVAECVQLDCPEKEMDASSSSE
FT                   NGEDDISAAKCPNEMTWNTDFIDNSGVEGGNGPGVLDG"
FT   3'UTR           2676226..2676509
FT                   /locus_tag="VIT_08s0007g05800"
FT                   /old_locus_tag="Vv08s0007g05800"
FT   gene            2679856..2680806
FT                   /locus_tag="VIT_08s0007g05790"
FT                   /old_locus_tag="Vv08s0007g05790"
FT   mRNA            join(2679856..2679923,2679924..2680592,2680593..2680806)
FT                   /locus_tag="VIT_08s0007g05790"
FT                   /old_locus_tag="Vv08s0007g05790"
FT                   /product="unknown predicted protein"
FT   5'UTR           2679856..2679923
FT                   /locus_tag="VIT_08s0007g05790"
FT                   /old_locus_tag="Vv08s0007g05790"
FT   CDS_pept        2679924..2680592
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05790"
FT                   /old_locus_tag="Vv08s0007g05790"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLP0"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR039647"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLP0"
FT                   /protein_id="CCB55296.1"
FT                   /translation="MKLIYKINPKQLFRSKKSRSVTRTDPSSFSSGTSSSTSSDSSTNL
FT                   KTGTGACGGGMGTPTSVLPMHSYEISGDWSDFSSDIQTELVHAFKMIDRDGDGKITKRE
FT                   LEALLSRVGVEPPSEEEIMMMLSEVDRDGDGCISLEEFGAISSAFGPACDTELRDAFCF
FT                   FDTDRDGKITAEELNQVFAAIGDDRCTLEDCQRMIAGVDKNGDGFVCFEDFSRMMEQQT
FT                   "
FT   3'UTR           2680593..2680806
FT                   /locus_tag="VIT_08s0007g05790"
FT                   /old_locus_tag="Vv08s0007g05790"
FT   gene            2684478..2687514
FT                   /locus_tag="VIT_08s0007g05780"
FT                   /old_locus_tag="Vv08s0007g05780"
FT   mRNA            join(2684478..2684516,2685204..2687507,2687508..2687514)
FT                   /locus_tag="VIT_08s0007g05780"
FT                   /old_locus_tag="Vv08s0007g05780"
FT                   /product="Predicted protein"
FT   CDS_pept        join(2684478..2684516,2685204..2687507)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05780"
FT                   /old_locus_tag="Vv08s0007g05780"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLP1"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR024937"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLP1"
FT                   /protein_id="CCB55297.1"
FT                   /translation="MGRLLRGSNSGKSKSSASDLRVSMLLNPKRIATLHSRVSILSLLR
FT                   RHSTLPPNPNPTTPLTKPQLKALVINHYSRGKFSNLIQNVVASPPVLLLACQNLTPRSN
FT                   DVNSLASPAVALRFSVEELGRELGENRFDVESCCVRMVPSRKKGESLVLPNLKLKVVIE
FT                   AIRMVLEIVYDERLVTFAYGGRVGMGRHTAIRYLKNSVQNPNWWFKVTFDREKFEHKNV
FT                   NKLCLIIEEKIKDTVLIGIVRKLFECEVLQIELGGCYLGRGFPQECGLSSILINVYFNG
FT                   FDKEIQDLRIRTNQENPRFDSNEVLSGSSVFYKPVKIYAVRYLDEILVITSGSKMLTMD
FT                   LKNQVMKFLEGKLELKVDRLKMAIHSATMEKIDFLGMELQAVQPSVLRPPMSEKAIRAQ
FT                   KKYLRQKEVKAIELRNARETNRKKLGLKILAHVFKKLKQSDEFKFDFHIENEVREIFRT
FT                   WADEVVKEFLGSLEEQANWYRMLSVGDFLSLRHIRHQLPQELVDAYDHFQEQVDKHIKP
FT                   VKARKALEEAERRVVEEEEQKYAERTVQELTRLCMKVDAPIELVRKAVKMAGFTNNMGR
FT                   PRPIKLLIALEDTDIIKWYAGVGRRWLDFFCCCHNFKMVKTVVTYHLRFSCLLTLAEKH
FT                   ESTKLETIRHYTKDLKVSDFNGIEEVHFPAEREIKMMGDKNLSDPKPVDGALSLALIRL
FT                   ASDEPAYSCVAHFCDRKDTIVYRVRLLQNRLNVNPLDEKKWVPGMGAIHEGLNRKCLPL
FT                   CSDHIHDLYMGTISLQDIDCTSFVDVD"
FT   3'UTR           2687508..2687514
FT                   /locus_tag="VIT_08s0007g05780"
FT                   /old_locus_tag="Vv08s0007g05780"
FT   gene            2688989..2690659
FT                   /locus_tag="VIT_08s0007g05770"
FT                   /old_locus_tag="Vv08s0007g05770"
FT   mRNA            join(2688989..2690485,2690486..2690659)
FT                   /locus_tag="VIT_08s0007g05770"
FT                   /old_locus_tag="Vv08s0007g05770"
FT                   /product="unknown predicted protein"
FT   CDS_pept        2688989..2690485
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05770"
FT                   /old_locus_tag="Vv08s0007g05770"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLP2"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLP2"
FT                   /protein_id="CCB55298.1"
FT                   /translation="MRMEMEPNSVTMVVMLQACSAFESVNEGRELHSYVIKKGFMVDRS
FT                   VQNSILRMYTKTGGSGEEVETFFSEIEERDIISWNILIAFYSFRGDIAEVAERFNEMRR
FT                   EVTSSIESLTLVVSAIANCANLSEGGMLHCSAIKTGLHDTVLMTCLLALYAKCGALEIS
FT                   AQLFRDIPHRNSITWSSMMSGFTQNGFFKEAIELYQQMLASGLQPNHDIISTLVIAYTH
FT                   LGALQLGKATHAFFIRNLSSWPEEDSAPLETSLLNMYIRCGSISSALICFNRVVVKDVV
FT                   TWTSMIEGFGTHGLAFEALKFFKSMLESEVQPNSVTFLSLLSACSHSGLVREGCEVFHS
FT                   MKWGFRIEPDLNHYTCMVDLLGRSGKLKEALTVILKLVTCPDSRIWGALLAASRVHEDK
FT                   KLGEYAAEKLLELEPDNVGYYTLWSNIEASLERWGEVEEVRRVMHERDLKKKPGWSCIE
FT                   VKGMIHGFVSGDTSHHQVEEICKVVGCLNRKIQEFGVSIV"
FT   3'UTR           2690486..2690659
FT                   /locus_tag="VIT_08s0007g05770"
FT                   /old_locus_tag="Vv08s0007g05770"
FT   gene            complement(2692488..2693153)
FT                   /locus_tag="VIT_08s0007g05760"
FT                   /old_locus_tag="Vv08s0007g05760"
FT   mRNA            complement(join(2692488..2692663,2692664..2692876,
FT                   2692877..2693153))
FT                   /locus_tag="VIT_08s0007g05760"
FT                   /old_locus_tag="Vv08s0007g05760"
FT   3'UTR           complement(2692488..2692663)
FT                   /locus_tag="VIT_08s0007g05760"
FT                   /old_locus_tag="Vv08s0007g05760"
FT   CDS_pept        complement(2692664..2692876)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05760"
FT                   /old_locus_tag="Vv08s0007g05760"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLP3"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLP3"
FT                   /protein_id="CCB55299.1"
FT                   /translation="MPNLLRPYFTPCSLHEEFVEVSAVGIDENVIGQFGIGFYLAYLVF
FT                   EKAIVTIKHNDDEGYIWKSQDWKDH"
FT   5'UTR           complement(2692877..2693153)
FT                   /locus_tag="VIT_08s0007g05760"
FT                   /old_locus_tag="Vv08s0007g05760"
FT   gene            2695327..2711255
FT                   /locus_tag="VIT_08s0007g05750"
FT                   /old_locus_tag="Vv08s0007g05750"
FT   mRNA            join(2695327..2695498,2695592..2696006,2696431..2696720,
FT                   2697595..2697978,2710129..2710375,2710514..2710652,
FT                   2710804..2710962,2710963..2711255)
FT                   /locus_tag="VIT_08s0007g05750"
FT                   /old_locus_tag="Vv08s0007g05750"
FT                   /product="unknown predicted protein"
FT   CDS_pept        join(2695327..2695498,2695592..2696006,2696431..2696720,
FT                   2697595..2697978,2710129..2710375,2710514..2710652,
FT                   2710804..2710962)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05750"
FT                   /old_locus_tag="Vv08s0007g05750"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIK1"
FT                   /db_xref="InterPro:IPR004159"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIK1"
FT                   /protein_id="CBI30077.3"
FT                   /translation="MLSAAFDLKSGQLILVALLLMFGAFYSGTFFGNNSPIYVPQSTSN
FT                   SSFYSSSSPSSSGSSRFTNRVALTYRKTPLLISEFGVDVCPLEFNEYIPCHDVSYVNTL
FT                   RSSLDLSKREELERHCPPLEKRLFCLVPPPQDYKIPIRWPSSRDYVWRSNVNHTHLAEV
FT                   KGGQNWVHEMNQLWWFPGGGTHFKHGAPEYIQRLGNMTTNETGDLRSAGVFQVLDVGCG
FT                   VASFSAYLLPLDIQTMSFAPKDGHENQIQFALERGIGAMISAISTKQLPYPSNSFEMVH
FT                   CSRCRVDWHENDGILLKELDRLLRYNGYFVYSAPPAYRKDKDFPIIWDKLVNLTSAMCW
FT                   KLIARKVQTAIWIKQENQPCLLHNADQNLFNVCDPDYDSGTSWNKPLRNCIILGTSRSD
FT                   SQKLPPRPERLSVYWGGLNAIGIDQERFISDTIFWQDQVSHYYRLMNVNKTDIRNVMDM
FT                   NALIGGFAVALNTFPVWVMNVVPASMNNSLSAIYDRGLIGSFHDWCEPFSTYPRTYDLL
FT                   HANHLFSHYQNHGEGCLLEDIMLEMDRILRPQGFIIIRDNEQITSRIRDIAPKFLWEVE
FT                   SHLLENEQKKMDSVLIARKKFWAIV"
FT   gap             2705968..2706067
FT                   /estimated_length=100
FT   3'UTR           2710963..2711255
FT                   /locus_tag="VIT_08s0007g05750"
FT                   /old_locus_tag="Vv08s0007g05750"
FT   gene            2724847..2727675
FT                   /locus_tag="VIT_08s0007g05740"
FT                   /old_locus_tag="Vv08s0007g05740"
FT   mRNA            join(2724847..2724949,2724950..2725432,2726295..2727284,
FT                   2727285..2727445,2727519..2727675)
FT                   /locus_tag="VIT_08s0007g05740"
FT                   /old_locus_tag="Vv08s0007g05740"
FT                   /product="unknown predicted protein"
FT   5'UTR           2724847..2724949
FT                   /locus_tag="VIT_08s0007g05740"
FT                   /old_locus_tag="Vv08s0007g05740"
FT   CDS_pept        join(2724950..2725432,2726295..2727284)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05740"
FT                   /old_locus_tag="Vv08s0007g05740"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLP4"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR024228"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLP4"
FT                   /protein_id="CCB55300.1"
FT                   /translation="MTLEDSLRSLSLDYLNLLINGQAFSDVTFNVEGRLVHAHRCILAA
FT                   RSLFFRKFFCGPDPPAGLDPGGSRMGSAAAALATSPRGGNSHVIPVNSVGYEVFLLVLQ
FT                   FLYSGQVSIVPQKHEPRPNCGERGCWHTHCTSAVDLALDTLAAARSFGVEQLALLTQKQ
FT                   LASMVEKASIEDVMKVLIASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIE
FT                   ELRLKSSLARRSLMPHHHHHQDIGAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLN
FT                   LDEALALHYAVENCSREVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLD
FT                   HHADPNVRTVDGVTPLDVLRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSR
FT                   EEGSANAPSSTTIYPPMSDDHHSSSSSSNMASLNLDSRLVYLNLGATGSGQMGSRMDRE
FT                   DDVSHNNQREAMNRHGSQGGCDTSMYHHSHEY"
FT   3'UTR           join(2727285..2727445,2727519..2727675)
FT                   /locus_tag="VIT_08s0007g05740"
FT                   /old_locus_tag="Vv08s0007g05740"
FT   gene            2732902..2733362
FT                   /locus_tag="VIT_08s0007g05730"
FT                   /old_locus_tag="Vv08s0007g05730"
FT   mRNA            join(2732902..2732903,2732904..2733290,2733291..2733362)
FT                   /locus_tag="VIT_08s0007g05730"
FT                   /old_locus_tag="Vv08s0007g05730"
FT                   /product="DC1 domain containing protein"
FT   5'UTR           2732902..2732903
FT                   /locus_tag="VIT_08s0007g05730"
FT                   /old_locus_tag="Vv08s0007g05730"
FT   CDS_pept        2732904..2733290
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05730"
FT                   /old_locus_tag="Vv08s0007g05730"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR004146"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIK3"
FT                   /protein_id="CBI30079.3"
FT                   /translation="MGKLSIEEMRDFSHFSHEHPLELTNLWPQGHTVCSGCKMSIVAGK
FT                   DYYTCKPCSYYLHSTCYNLPRLIQHPADPNHDLNLVPSASFDCKACGLRGSGFSYNCSF
FT                   CLVHCHTYVPQCHSQKHTVFILTH"
FT   3'UTR           2733291..2733362
FT                   /locus_tag="VIT_08s0007g05730"
FT                   /old_locus_tag="Vv08s0007g05730"
FT   gene            2735241..2736092
FT                   /locus_tag="VIT_08s0007g05720"
FT                   /old_locus_tag="Vv08s0007g05720"
FT   mRNA            join(2735241..2735299,2735300..2735339,2735434..2735518,
FT                   2735766..2735811,2735812..2736092)
FT                   /locus_tag="VIT_08s0007g05720"
FT                   /old_locus_tag="Vv08s0007g05720"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           2735241..2735299
FT                   /locus_tag="VIT_08s0007g05720"
FT                   /old_locus_tag="Vv08s0007g05720"
FT   CDS_pept        join(2735300..2735339,2735434..2735518,2735766..2735811)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05720"
FT                   /old_locus_tag="Vv08s0007g05720"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIK4"
FT                   /db_xref="InterPro:IPR028144"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIK4"
FT                   /protein_id="CBI30080.3"
FT                   /translation="MPKSNPQENQPPQGYPPANPPTGKNCCPRSKSKGDRGFIEGCLFA
FT                   LCCCWICEACF"
FT   3'UTR           2735812..2736092
FT                   /locus_tag="VIT_08s0007g05720"
FT                   /old_locus_tag="Vv08s0007g05720"
FT   gene            complement(2736787..2749903)
FT                   /locus_tag="VIT_08s0007g05710"
FT                   /old_locus_tag="Vv08s0007g05710"
FT   mRNA            complement(join(2736787..2737004,2737005..2737163,
FT                   2737632..2737772,2745591..2746011,2746630..2746815,
FT                   2748331..2748581,2749139..2749810,2749811..2749903))
FT                   /locus_tag="VIT_08s0007g05710"
FT                   /old_locus_tag="Vv08s0007g05710"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(2736787..2737004)
FT                   /locus_tag="VIT_08s0007g05710"
FT                   /old_locus_tag="Vv08s0007g05710"
FT   CDS_pept        complement(join(2737005..2737163,2737632..2737772,
FT                   2745591..2746011,2746630..2746815,2748331..2748581,
FT                   2749139..2749810))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05710"
FT                   /old_locus_tag="Vv08s0007g05710"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLP5"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR010029"
FT                   /db_xref="InterPro:IPR010031"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLP5"
FT                   /protein_id="CCB55301.1"
FT                   /translation="MLRALSLRRSLRAFHHYHHHHHQPTNPHSNLLKALSSTTSPNPNP
FT                   NLTRPFSSLSSSPSSEAEFRKYLGYFALLLGCGIATYYSFPFSDSAKHKKAQLFRYAPL
FT                   PDDLHTVSNWSGTHEVQTRVFHQPESLEELEQIVKEANEKKQKIRPVGSGLSPNGIGLT
FT                   RAGMVNLALMDNVLDVDVEKKRVRVQAGIRVQQLVDAIKDYGITLQNFASIREQQIGGI
FT                   VQVGAHGTGARLPPIDEQVISMKLVTPAKGTIEVSKERDPELFYLARCGLGGLGVVAEV
FT                   TLQCVERQELVEHTVVSNMKEIKKNHKKLLSENKHVKYLYIPYTDTVVVVTCNPVSKWK
FT                   GPPKFKPKYSRDEAIQHVRDLYQESLKKYSPEAITAKSSDNSEPDINELSFTELRDKLL
FT                   ALDPLNKDHVIQVNQAEAEFWRKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTLAKP
FT                   SMKDLEYIEDLKKLIEKEEIPAPAPIEQRWTQSSKSPMSPASSSAEDDIFSWVGIIMYL
FT                   PTMDARQRKEITEEFFHYRRLSQTQLWDLYSAYEHWAKIEVPKDKDELAALQARLRKRF
FT                   PVDEYNKARKELDPNRILSNNMLGKLFPSSDTI"
FT   5'UTR           complement(2749811..2749903)
FT                   /locus_tag="VIT_08s0007g05710"
FT                   /old_locus_tag="Vv08s0007g05710"
FT   gene            complement(2750706..2760169)
FT                   /locus_tag="VIT_08s0007g05700"
FT                   /old_locus_tag="Vv08s0007g05700"
FT   mRNA            complement(join(2750706..2750884,2750885..2751119,
FT                   2751950..2752214,2759836..2760079,2760080..2760169))
FT                   /locus_tag="VIT_08s0007g05700"
FT                   /old_locus_tag="Vv08s0007g05700"
FT                   /product="Predicted protein"
FT   3'UTR           complement(2750706..2750884)
FT                   /locus_tag="VIT_08s0007g05700"
FT                   /old_locus_tag="Vv08s0007g05700"
FT   CDS_pept        complement(join(2750885..2751119,2751950..2752214,
FT                   2759836..2760079))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05700"
FT                   /old_locus_tag="Vv08s0007g05700"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR036865"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIK6"
FT                   /protein_id="CBI30082.3"
FT                   /translation="MGSRSPEEFSVLVLASDLGIDARPFLDAQAQIEEQDENWHDCSQY
FT                   LSDEDFSDLDLLQFIRIQGSDKSGNRILRIVGKYLPAPVVSGERLKKYVFHKIVSELPE
FT                   GPFCIVYMHSTVQKEDNSPGLTILRWIYEELPSDFKDRLQTVYFVHPGLRSRLLFATLG
FT                   RFFLSGGLYWKIKYVSRLQYLWEDVKKGEVEIPEFVQSHDDVLEHRPLTDYGIEPDPLH
FT                   LTEMPSTAYSFGRYEERWTSRECMS"
FT   5'UTR           complement(2760080..2760169)
FT                   /locus_tag="VIT_08s0007g05700"
FT                   /old_locus_tag="Vv08s0007g05700"
FT   gene            2765351..2770830
FT                   /locus_tag="VIT_08s0007g05690"
FT                   /old_locus_tag="Vv08s0007g05690"
FT   mRNA            join(2765351..2765453,2765454..2766915,2770766..2770830)
FT                   /locus_tag="VIT_08s0007g05690"
FT                   /old_locus_tag="Vv08s0007g05690"
FT                   /product="Predicted protein"
FT   5'UTR           2765351..2765453
FT                   /locus_tag="VIT_08s0007g05690"
FT                   /old_locus_tag="Vv08s0007g05690"
FT   CDS_pept        join(2765454..2766915,2770766..2770830)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05690"
FT                   /old_locus_tag="Vv08s0007g05690"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLP6"
FT                   /db_xref="InterPro:IPR010108"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLP6"
FT                   /protein_id="CCB55302.1"
FT                   /translation="MDTLLKTHNKLEFLHPLHGFAEKLGNLTFPKLQNQEFRFGPKKSN
FT                   LKWGRNGCVKASSSALLELVPETKKENLEFELPMYDPSKGLVVDLAVVGGGPAGLAVAQ
FT                   QVSEAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVFIDDHSKKDL
FT                   GRPYARVNRKQLKSKMMQKCILNGVKFHQAKVIKVIHEESKSLLICNDGVTIQAAVVLD
FT                   ATGFSRCLVQYDKPYNPGYQVAYGILAEVEEHPFDVDKMVFMDWRDSHLNNNMELKNRN
FT                   SRIPTFLYAMPFSSNRIFLEETSLVARPGVPMEDIQERMVARLRHLGIKVKSIEEDERC
FT                   IIPMGGPLPVLPQRVVGIGGTAGMVHPSTGYMVARTLAAAPIVANSIVQYLGSDRSFFG
FT                   NELSSEVWRDLWPIERRRQREFFCFGMDILLKLDLQGTRRFFDAFFDLEPRYWHGFLSS
FT                   RLFLPELIFFGLSLFSHASNTSRIEIMAKGSNGHVTVGAPTVQLMLLAAM"
FT   gap             2779265..2779364
FT                   /estimated_length=100
FT   gene            2779493..2783137
FT                   /locus_tag="VIT_08s0007g05680"
FT                   /old_locus_tag="Vv08s0007g05680"
FT   mRNA            join(2779493..2779527,2782999..2783137)
FT                   /locus_tag="VIT_08s0007g05680"
FT                   /old_locus_tag="Vv08s0007g05680"
FT   CDS_pept        join(2779493..2779527,2782999..2783137)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05680"
FT                   /old_locus_tag="Vv08s0007g05680"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLP7"
FT                   /protein_id="CCB55303.1"
FT                   /translation="MAWCWEGGVGRTREGVGVLPLGEQRPTNGRQQQLGGDNSGRSELG
FT                   QPRGELLCVGWG"
FT   gene            complement(2795298..2796728)
FT                   /locus_tag="VIT_08s0007g05670"
FT                   /old_locus_tag="Vv08s0007g05670"
FT   mRNA            complement(2795298..2796728)
FT                   /locus_tag="VIT_08s0007g05670"
FT                   /old_locus_tag="Vv08s0007g05670"
FT                   /product="Predicted protein"
FT   CDS_pept        complement(2795298..2796728)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05670"
FT                   /old_locus_tag="Vv08s0007g05670"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIK8"
FT                   /db_xref="InterPro:IPR004158"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIK8"
FT                   /protein_id="CBI30084.3"
FT                   /translation="MPGSREDFPTEEVHASMKIVRNETGQTREGSDHQSAIASKQHEKT
FT                   RIDIVVEDNASSSREKRFKSVMGGPEDSKRSQLSETKWARIPKVPHMLRGTKDFKILFE
FT                   PRVVSVGPYHHHKHDLRAAEMLKRLMTKRFILESRQAIEVLYNKIVSEISELRNCYNKN
FT                   ATKKYNDEDLAWMMLVDGCSLLHFIRCYTTEGKLKDLPIKYHNAAFAQQDLFLLENQLP
FT                   FRVLELLLEPGFEEGMQMIEQFIGSAAETDPPAVKSDNEEKPAHLLDLLRRRLLGNQTA
FT                   SETEAGKGTGWNSFRNVNELKAAGIRFKPAKSGSLRDISFNSYILLGFLKLPRITIDDS
FT                   TKSRFLNLIAYEMCPEVPNEPVVTSYICFLDSLIDDPEDVKELRRQHVLRNFLGSDKEV
FT                   ARLFNEIATDLVPDSDAYKDVKGKIQKHYEIKASTWIAEGLHSHFSSPWTVLAFLGAVV
FT                   ALFFGGLQTYYTVFPRHN"
FT   gene            2824100..2824722
FT                   /locus_tag="VIT_08s0007g05660"
FT                   /old_locus_tag="Vv08s0007g05660"
FT   mRNA            join(2824100..2824108,2824624..2824722)
FT                   /locus_tag="VIT_08s0007g05660"
FT                   /old_locus_tag="Vv08s0007g05660"
FT   CDS_pept        join(2824100..2824108,2824624..2824722)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05660"
FT                   /old_locus_tag="Vv08s0007g05660"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLP8"
FT                   /protein_id="CCB55304.1"
FT                   /translation="MEKAVVRDCWRDDLSSSLSFRSIGSVGQVVAGRLK"
FT   gap             2825772..2825871
FT                   /estimated_length=100
FT   gap             2826730..2826829
FT                   /estimated_length=100
FT   gap             2830861..2830960
FT                   /estimated_length=100
FT   gene            complement(2835107..2836735)
FT                   /locus_tag="VIT_08s0007g05650"
FT                   /old_locus_tag="Vv08s0007g05650"
FT   mRNA            complement(join(2835107..2835325,2835326..2836735))
FT                   /locus_tag="VIT_08s0007g05650"
FT                   /old_locus_tag="Vv08s0007g05650"
FT                   /product="Predicted protein"
FT   3'UTR           complement(2835107..2835325)
FT                   /locus_tag="VIT_08s0007g05650"
FT                   /old_locus_tag="Vv08s0007g05650"
FT   CDS_pept        complement(2835326..2836735)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05650"
FT                   /old_locus_tag="Vv08s0007g05650"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLP9"
FT                   /db_xref="InterPro:IPR004158"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLP9"
FT                   /protein_id="CCB55305.1"
FT                   /translation="MEEWETRRNVAAEEGGQPSGPAKEHSMDAHGFSPRLERWFNSMVY
FT                   AEERTQFMYSQTRWGKIPKVPQMLRHTQDFEKFYEPRVISFGPYHHGKPHLLQGEMLKP
FT                   LCGRRFLRDSGQSIQNLYRKIESNIKLVRMCYDEDQTYKYDDEELAWMMLLDGCSLLYF
FT                   ILCVMRRNESQLSDLNVKSHFVAFVQLDCFLLENQLPFGILELLFEGARLGADTMEEMI
FT                   ERFITSNIAKPRGTMASDLDLVKDPSHLLDLLRSGLLGPQPVPEQKGQPEGIWRGTGPR
FT                   EMRKQGDWQSYRNIKELEAAGIYLKPSRTTYMRDISFESYFFFGYLKLPHITIDASTKL
FT                   KLLNLAAYEMSPNGPGDFGVTSYICFLDSLIKNAEDVMLLQSNYTLFNFLGSDEKVADL
FT                   FNDIAKDLVPNRDAYALVKAGVQKHYNTRVNVWISKWLHSNFTFLAFIGAVVALGSSIC
FT                   QTYFAAFPPHK"
FT   gene            complement(2837961..2846420)
FT                   /locus_tag="VIT_08s0007g05630"
FT                   /old_locus_tag="Vv08s0007g05630"
FT   mRNA            complement(join(2837961..2838167,2838194..2838245,
FT                   2844620..2845312,2845477..2845583,2845703..2845778,
FT                   2845799..2845985,2845986..2846420))
FT                   /locus_tag="VIT_08s0007g05630"
FT                   /old_locus_tag="Vv08s0007g05630"
FT                   /product="Predicted protein"
FT   3'UTR           complement(join(2837961..2838167,2838194..2838245,
FT                   2844620..2845312,2845477..2845583,2845703..2845778,
FT                   2845799..2845985))
FT                   /locus_tag="VIT_08s0007g05630"
FT                   /old_locus_tag="Vv08s0007g05630"
FT   CDS_pept        complement(2845986..2846420)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05630"
FT                   /old_locus_tag="Vv08s0007g05630"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLQ0"
FT                   /db_xref="InterPro:IPR004158"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLQ0"
FT                   /protein_id="CCB55306.1"
FT                   /translation="MNTSTMIIFLNLVAFESSNTSETTTNNVGIISYLCFLDSLIDRWD
FT                   DVKELQAAGILRNFAGEQIEVAQFFNNVCSKLVPNLSPYYDVIIQIDNHVKRHDNSRWR
FT                   KGYIQFKQKYFSSPWSFIALIGAIIGLTLTGIQAYTSVFS"
FT   gap             2850302..2850506
FT                   /estimated_length=205
FT   gene            complement(2882318..2884040)
FT                   /locus_tag="VIT_08s0007g05610"
FT                   /old_locus_tag="Vv08s0007g05610"
FT   mRNA            complement(join(2882318..2882561,2882562..2884040))
FT                   /locus_tag="VIT_08s0007g05610"
FT                   /old_locus_tag="Vv08s0007g05610"
FT                   /product="Predicted protein"
FT   3'UTR           complement(2882318..2882561)
FT                   /locus_tag="VIT_08s0007g05610"
FT                   /old_locus_tag="Vv08s0007g05610"
FT   CDS_pept        complement(2882562..2884040)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05610"
FT                   /old_locus_tag="Vv08s0007g05610"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR004158"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLQ1"
FT                   /protein_id="CCB55307.1"
FT                   /translation="MAAPNNQISINVWLSPNEGPEKEGGVGGSRASSSEQPDAASHGKP
FT                   GVSLLPSDSSRDPWLSSIMEDGGESGENKSQQSKIQKVPAMLRDDESNNKCFDPWVVSI
FT                   GPYHRGKPELQLMERLKKETVRQHVTESKVEDQDLYNRVVKVVGDARKCYKEGSTDELD
FT                   DREFAQMMFLDGCFILQFICCSTDKDKKMNIKNHNVAFVRRDLFLLENQLPFLVLEALM
FT                   LPKKDEWLEKINNFVDNTRAHSPDHHKQGGWLDRITKKLFREVPQAKEEQQPEQQPVHL
FT                   LGILHAQLINQSDLNALSCSMSDWSSYRSANELKAAGIQFKPSKTRRFTDVNFEPALSF
FT                   GTLELPPMMVDDSTRSMLLNLVAYESCPGAPDDFGVTSYLCFMDVLIDHAEDVKVLRSN
FT                   GILLNFLGNDKQVAKLFNEIAKDLVPNPHAYARVKGDIEKHYNNKAKIWIAEWLHTHFT
FT                   SPWTFLAFLGAILALALSCVQTYFAAFPDDGKNT"
FT   gene            complement(2886294..2896312)
FT                   /locus_tag="VIT_08s0007g05600"
FT                   /old_locus_tag="Vv08s0007g05600"
FT   mRNA            complement(join(2886294..2886516,2886517..2886705,
FT                   2889909..2890014,2890932..2891052,2891132..2891204,
FT                   2893682..2893773,2894528..2894576,2895985..2896185,
FT                   2896186..2896312))
FT                   /locus_tag="VIT_08s0007g05600"
FT                   /old_locus_tag="Vv08s0007g05600"
FT                   /product="Pyrroline-5-carboxylate reductase"
FT   3'UTR           complement(2886294..2886516)
FT                   /locus_tag="VIT_08s0007g05600"
FT                   /old_locus_tag="Vv08s0007g05600"
FT   CDS_pept        complement(join(2886517..2886705,2889909..2890014,
FT                   2890932..2891052,2891132..2891204,2893682..2893773,
FT                   2894528..2894576,2895985..2896185))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05600"
FT                   /old_locus_tag="Vv08s0007g05600"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIL1"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIL1"
FT                   /protein_id="CBI30087.3"
FT                   /translation="MAGVAPIPMDTFKLGFIGAGKMAESIAKGVVHSGLMPASRISTAP
FT                   RSSSRQDAFESLGVKIFETNQRVVEDSDVVVFSVKPQVVEDVVLELRPLLTKKKLLVSV
FT                   VAGVKLKHLQEWAGHSRFIRVMPNTPAAVGKAASVMSLGKSATEEDGGLIANLFGAIGK
FT                   IWRADEKYFDAVTGLSGSGPAYIYIAIEALADGGVAAGLPRELAWNLASQTVLGAADMA
FT                   ISTGKHPGQLKDDVASPGGTTIAGIYELEKGGFRGILMNAVVAAAKRSLDLSES"
FT   5'UTR           complement(2896186..2896312)
FT                   /locus_tag="VIT_08s0007g05600"
FT                   /old_locus_tag="Vv08s0007g05600"
FT   gene            2898527..2899155
FT                   /locus_tag="VIT_08s0007g05590"
FT                   /old_locus_tag="Vv08s0007g05590"
FT   mRNA            join(2898527..2898704,2898705..2899025,2899026..2899155)
FT                   /locus_tag="VIT_08s0007g05590"
FT                   /old_locus_tag="Vv08s0007g05590"
FT   5'UTR           2898527..2898704
FT                   /locus_tag="VIT_08s0007g05590"
FT                   /old_locus_tag="Vv08s0007g05590"
FT   CDS_pept        2898705..2899025
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05590"
FT                   /old_locus_tag="Vv08s0007g05590"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLQ2"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR002453"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLQ2"
FT                   /protein_id="CCB55308.1"
FT                   /translation="MVLDNEALHDICFKTLKLTTPSFGDPNHLFFVTMSGVTCCLRFSG
FT                   QLNFDLRKPLANLILFSHLHFFLVGLAILISHGSQQYHALPVPVLTQQIWDAKNMMRAA
FT                   NP"
FT   3'UTR           2899026..2899155
FT                   /locus_tag="VIT_08s0007g05590"
FT                   /old_locus_tag="Vv08s0007g05590"
FT   gene            2901742..2903095
FT                   /locus_tag="VIT_08s0007g05580"
FT                   /old_locus_tag="Vv08s0007g05580"
FT   mRNA            join(2901742..2901780,2901781..2901930,2902266..2902913,
FT                   2902914..2903095)
FT                   /locus_tag="VIT_08s0007g05580"
FT                   /old_locus_tag="Vv08s0007g05580"
FT                   /product="Predicted protein"
FT   5'UTR           2901742..2901780
FT                   /locus_tag="VIT_08s0007g05580"
FT                   /old_locus_tag="Vv08s0007g05580"
FT   CDS_pept        join(2901781..2901930,2902266..2902913)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05580"
FT                   /old_locus_tag="Vv08s0007g05580"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIL3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIL3"
FT                   /protein_id="CBI30089.3"
FT                   /translation="MAELFTEQAKQYSEARPSYPPELFQFIASKTPDRDLVWDVGTGSG
FT                   QAAVSLAGIYKNVIGTETSQSQLEFAAKLPNIRYQYTSPVMTIADLQASVAAQSSVDLV
FT                   TIAQAMHWFDLPKFYQQVEWVLKKPHGVIAAWCYTVPEVNESVDLVFERFYADSKPYWD
FT                   SARDLVDDKYRSIEFPFKPVDGEDDTGPFRFKTERIMDLEAYFTYIRSWSSYQTAKKEG
FT                   VELLRNDVIEDFERAWNRDGKGKKVVTYPIYLRIGKVGNACQT"
FT   3'UTR           2902914..2903095
FT                   /locus_tag="VIT_08s0007g05580"
FT                   /old_locus_tag="Vv08s0007g05580"
FT   gene            2903885..2908089
FT                   /locus_tag="VIT_08s0007g05570"
FT                   /old_locus_tag="Vv08s0007g05570"
FT   mRNA            join(2903885..2903900,2903901..2904050,2904296..2904932,
FT                   2906667..2906830,2907244..2907885,2907886..2908089)
FT                   /locus_tag="VIT_08s0007g05570"
FT                   /old_locus_tag="Vv08s0007g05570"
FT                   /product="Predicted protein"
FT   5'UTR           2903885..2903900
FT                   /locus_tag="VIT_08s0007g05570"
FT                   /old_locus_tag="Vv08s0007g05570"
FT   CDS_pept        join(2903901..2904050,2904296..2904932,2906667..2906830,
FT                   2907244..2907885)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05570"
FT                   /old_locus_tag="Vv08s0007g05570"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIL4"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIL4"
FT                   /protein_id="CBI30090.3"
FT                   /translation="MGDFYDKLANRYSEIRPNYPPELFQFIASKTPVRDLAWDVGAGNG
FT                   QAARSLAGMYKNVVATDISQKQLDLAPKLPNVRYQQTSPVSTIADIEHDVAPQSSVDLI
FT                   TIAQAVHWFDLPKFYQQAKWVLKKPHGVIAAWCYTPAEFNQSVDSVFARFYIDAKPYWD
FT                   PARYHLDDRYRSIEFPFMPVEGEDHTGPFKFKTERQMDLDSYFAYLRTWSGYQTAQKNG
FT                   VELLTSNVIEDFERAWNEDGGGQKIGVFPIYLRIGKVGIPERKEMAAKLYDTQAKEYRD
FT                   IRPSYPPELFQFIASKTPIHDLAWDAGAGNGQATLSLAGIYKNVVATDTSQNQLHLAPD
FT                   LPNVRYQQTTPLMTEAELHHNVATQSSVDVVTVAQALHWFDISAFFQQAKWVLKKPQGV
FT                   IAAWCYSAPEVDESVDSVFNRYYLESKPYWDPARNILDDKYRSIDFPFMPVDGEVHTGP
FT                   FKFKTEKLLDLDDYFAYLRSSSGYQMPRKKGVELLRSDVIEDFERAWNEDGNAHKIATF
FT                   PIYLRIGKVGNPN"
FT   3'UTR           2907886..2908089
FT                   /locus_tag="VIT_08s0007g05570"
FT                   /old_locus_tag="Vv08s0007g05570"
FT   gene            complement(2913916..2917895)
FT                   /locus_tag="VIT_08s0007g05560"
FT                   /old_locus_tag="Vv08s0007g05560"
FT   mRNA            complement(join(2913916..2914042,2914043..2914143,
FT                   2914222..2914285,2915216..2915322,2916385..2916523,
FT                   2917783..2917878,2917879..2917895))
FT                   /locus_tag="VIT_08s0007g05560"
FT                   /old_locus_tag="Vv08s0007g05560"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(2913916..2914042)
FT                   /locus_tag="VIT_08s0007g05560"
FT                   /old_locus_tag="Vv08s0007g05560"
FT   CDS_pept        complement(join(2914043..2914143,2914222..2914285,
FT                   2915216..2915322,2916385..2916523,2917783..2917878))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05560"
FT                   /old_locus_tag="Vv08s0007g05560"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLQ3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016543"
FT                   /db_xref="InterPro:IPR028058"
FT                   /db_xref="InterPro:IPR028061"
FT                   /db_xref="InterPro:IPR033745"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLQ3"
FT                   /protein_id="CCB55309.1"
FT                   /translation="MEAKTGKFFESVGAFLDGGEDQIPWCDRDVIAGCEKEVADAANGG
FT                   SEEHKSECIMRLSWALVHSRQAEDIQRGIAMLEASLASSSSPLQKREKLYLLAVGYYRS
FT                   GEYGKSRQLVIAPDFRQVLTLKKTVEDRIAKDGVTGKGITASAVVGLIAGGIAGGIAAA
FT                   LARKK"
FT   5'UTR           complement(2917879..2917895)
FT                   /locus_tag="VIT_08s0007g05560"
FT                   /old_locus_tag="Vv08s0007g05560"
FT   gene            2923596..2927612
FT                   /locus_tag="VIT_08s0007g05550"
FT                   /old_locus_tag="Vv08s0007g05550"
FT   mRNA            join(2923596..2923607,2923608..2923700,2925039..2925177,
FT                   2926233..2926354,2927243..2927306,2927385..2927470,
FT                   2927471..2927612)
FT                   /locus_tag="VIT_08s0007g05550"
FT                   /old_locus_tag="Vv08s0007g05550"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           2923596..2923607
FT                   /locus_tag="VIT_08s0007g05550"
FT                   /old_locus_tag="Vv08s0007g05550"
FT   CDS_pept        join(2923608..2923700,2925039..2925177,2926233..2926354,
FT                   2927243..2927306,2927385..2927470)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05550"
FT                   /old_locus_tag="Vv08s0007g05550"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIL6"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016543"
FT                   /db_xref="InterPro:IPR028058"
FT                   /db_xref="InterPro:IPR028061"
FT                   /db_xref="InterPro:IPR033745"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIL6"
FT                   /protein_id="CBI30092.3"
FT                   /translation="MEAKMGKFFESVGAFFGGGDQIPWCDRDVIAGCEKEVADAANGGS
FT                   EEHKSECIMRLSWALVHSRQAEDIQRGIAMLEASLTSSSSPLQKKEKLYLLAVGYYRSG
FT                   EYGKSRQLVEQCLEIAPDFRQALTLKKTVEDRIAKDGVIGIGITATAVGLIAGGIAAAL
FT                   ARKK"
FT   3'UTR           2927471..2927612
FT                   /locus_tag="VIT_08s0007g05550"
FT                   /old_locus_tag="Vv08s0007g05550"
FT   gene            complement(2928403..2931726)
FT                   /locus_tag="VIT_08s0007g05540"
FT                   /old_locus_tag="Vv08s0007g05540"
FT   mRNA            complement(join(2928403..2928536,2928537..2928662,
FT                   2929430..2929543,2930628..2930804,2931244..2931516,
FT                   2931517..2931523,2931608..2931726))
FT                   /locus_tag="VIT_08s0007g05540"
FT                   /old_locus_tag="Vv08s0007g05540"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(2928403..2928536)
FT                   /locus_tag="VIT_08s0007g05540"
FT                   /old_locus_tag="Vv08s0007g05540"
FT   CDS_pept        complement(join(2928537..2928662,2929430..2929543,
FT                   2930628..2930804,2931244..2931516))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05540"
FT                   /old_locus_tag="Vv08s0007g05540"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLQ4"
FT                   /db_xref="InterPro:IPR000783"
FT                   /db_xref="InterPro:IPR005571"
FT                   /db_xref="InterPro:IPR014381"
FT                   /db_xref="InterPro:IPR035913"
FT                   /db_xref="InterPro:IPR036710"
FT                   /db_xref="InterPro:IPR039531"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLQ4"
FT                   /protein_id="CCB55310.1"
FT                   /translation="MDGGGWFDGDLNGDFEVKRCLSSFVDEGRIESHRYYLARRTLLEM
FT                   LRDRGYSIPALDIDISLQDFRSFYSQKPDPDRLRISAALRSDPSKKILVIFCGPDVVKV
FT                   NAIRSIATQIVNKDSLSKLILVLQNHITSQALKAVDLFSFQVEKFQITDLLVNITKHVL
FT                   KPKHRVLTDQEKNKLLKKYSLNEKQLPRMLQQDAIARYYGLEKGQVVKVIYNGEITGSH
FT                   VTYRCVW"
FT   5'UTR           complement(2931608..2931726)
FT                   /locus_tag="VIT_08s0007g05540"
FT                   /old_locus_tag="Vv08s0007g05540"
FT   gene            complement(2934837..2936348)
FT                   /locus_tag="VIT_08s0007g05530"
FT                   /old_locus_tag="Vv08s0007g05530"
FT   mRNA            complement(join(2934837..2935036,2935037..2935710,
FT                   2935793..2935802,2936165..2936218,2936219..2936348))
FT                   /locus_tag="VIT_08s0007g05530"
FT                   /old_locus_tag="Vv08s0007g05530"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(2934837..2935036)
FT                   /locus_tag="VIT_08s0007g05530"
FT                   /old_locus_tag="Vv08s0007g05530"
FT   CDS_pept        complement(join(2935037..2935710,2935793..2935802,
FT                   2936165..2936218))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05530"
FT                   /old_locus_tag="Vv08s0007g05530"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLQ5"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLQ5"
FT                   /protein_id="CCB55311.1"
FT                   /translation="MGCSASRPNTLLPRPSEESCNLEFQDLVEDKTSKPLWKHLSEESL
FT                   LAKMDSNVVSSYRRALSSRQLGYNHLKPIRSLGSSPLNSSLSNIRFHLPGAEDRVVLYF
FT                   TSLRGIRKTYEDCCAVRMILRGFRVMVDERDISMDSNYRKELQNVFGGKVVSLPQVFIR
FT                   GKYIGGAEEIKQLNEVGELGKYLEGFPVRETGFVCESCGDARFVPCPNCNGSRKIFEEE
FT                   DGQQRRCPECNENGLIRCPGCCS"
FT   5'UTR           complement(2936219..2936348)
FT                   /locus_tag="VIT_08s0007g05530"
FT                   /old_locus_tag="Vv08s0007g05530"
FT   gene            complement(2938569..2940541)
FT                   /locus_tag="VIT_08s0007g05520"
FT                   /old_locus_tag="Vv08s0007g05520"
FT   mRNA            complement(join(2938569..2938588,2938589..2940541))
FT                   /locus_tag="VIT_08s0007g05520"
FT                   /old_locus_tag="Vv08s0007g05520"
FT                   /product="Predicted protein"
FT   3'UTR           complement(2938569..2938588)
FT                   /locus_tag="VIT_08s0007g05520"
FT                   /old_locus_tag="Vv08s0007g05520"
FT   CDS_pept        complement(2938589..2940541)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05520"
FT                   /old_locus_tag="Vv08s0007g05520"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLQ6"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR032867"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLQ6"
FT                   /protein_id="CCB55312.1"
FT                   /translation="MLALSRVADVGNFTRMPFLICVQITIPALINLKLLRIPGFYLYHS
FT                   INDYRTAKISIPRKDFTVDGNVARCNWMITNLSKDGRIMEARRLFDEMREPDVITWTTV
FT                   ISGYIKCGMIEEARRLFDRVDAKKNVVTWTAMVGGYIRSNKISDAEKLFNEMPNKNVVS
FT                   WNTMIDGYAQNGRIDSAMYLFEKMPERNVVSWNTVMSMLAQCGRIEEARRLFDRMPERD
FT                   VISWTAMIAGLSKNGRIDEARLLFDRMPERNVVSWNAMITGYAQNLRLDEALDLFERMP
FT                   ERDLPSWNTMITGLIQNGDLRRARKLFNEMPKKNVISWTTMITGCVQEGESEEALKIFS
FT                   RMLSTNGAKPNQGTFVSVLGACSNLAGLGEGQQVHQIISKTVYQDSTFVVSALINMYSK
FT                   CGELGTARKMFDDGMTSQRDLVSWNGIIAAYAHHGYGKEAINFFKEMRKSGFKPDDVTY
FT                   VGLLSACSHAGLVEEGLKYFDELVKDRSILVREDHYACLVDLCGRAGRLKEAFGFIERL
FT                   ETKPSARVWGALLAGCNVHANVKIGKQAAKKLLEVEPENAGTYLLLSNIYASTGKWREA
FT                   ARVRLKMKDKGLKKQPGCSWIEVGNRVHVFVVGDKSHSQSKLIYSLLRDLHSKMKKAGY
FT                   EPNNDFISDEDFSLT"
FT   gene            complement(2941112..2944240)
FT                   /locus_tag="VIT_08s0007g05510"
FT                   /old_locus_tag="Vv08s0007g05510"
FT   mRNA            complement(join(2941112..2941314,2941315..2941447,
FT                   2944008..2944096,2944097..2944240))
FT                   /locus_tag="VIT_08s0007g05510"
FT                   /old_locus_tag="Vv08s0007g05510"
FT   3'UTR           complement(2941112..2941314)
FT                   /locus_tag="VIT_08s0007g05510"
FT                   /old_locus_tag="Vv08s0007g05510"
FT   CDS_pept        complement(join(2941315..2941447,2944008..2944096))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05510"
FT                   /old_locus_tag="Vv08s0007g05510"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIL9"
FT                   /protein_id="CBI30095.3"
FT                   /translation="MTLLALSGLVILVLSMLAESISQSVQRALCMISVRNTTWSKLYMG
FT                   PGNPEPSLILVWISKWALELLVHIISMS"
FT   5'UTR           complement(2944097..2944240)
FT                   /locus_tag="VIT_08s0007g05510"
FT                   /old_locus_tag="Vv08s0007g05510"
FT   gene            2944749..2951971
FT                   /locus_tag="VIT_08s0007g05500"
FT                   /old_locus_tag="Vv08s0007g05500"
FT   mRNA            join(2944749..2944881,2945492..2945811,2945898..2946058,
FT                   2946152..2947349,2947463..2947654,2947931..2948590,
FT                   2948685..2948861,2949182..2949249,2949335..2949557,
FT                   2949643..2949742,2949844..2949959,2950033..2950090,
FT                   2950170..2950321,2950404..2950605,2951553..2951717,
FT                   2951811..2951971)
FT                   /locus_tag="VIT_08s0007g05500"
FT                   /old_locus_tag="Vv08s0007g05500"
FT                   /product="Condensin complex subunit 1"
FT   CDS_pept        join(2944749..2944881,2945492..2945811,2945898..2946058,
FT                   2946152..2947349,2947463..2947654,2947931..2948590,
FT                   2948685..2948861,2949182..2949249,2949335..2949557,
FT                   2949643..2949742,2949844..2949959,2950033..2950090,
FT                   2950170..2950321,2950404..2950605,2951553..2951717,
FT                   2951811..2951971)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05500"
FT                   /old_locus_tag="Vv08s0007g05500"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLQ7"
FT                   /db_xref="InterPro:IPR007673"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024324"
FT                   /db_xref="InterPro:IPR026971"
FT                   /db_xref="InterPro:IPR032682"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLQ7"
FT                   /protein_id="CCB55313.1"
FT                   /translation="MAPSFIFPPNLQALENESHDGRLCAQNPIDISSLRSSELEEFVRG
FT                   VSFDLSDKELFCVEEQDVFDRVYSLIKGFSTLTPSCKLNLVESLRSNLSVLLPNVDSLS
FT                   RVSQDHADDVPILDRVASHRNAFKIYTFFLLNIILIEESNIGVNKSKATLSSRKKQPIH
FT                   SWNWEPQRGRILNLIANSLEINLPLLFGSSDPDENYLSFIVKNVFSMFENAILLKDSET
FT                   KDALCRIIGTCATKYHYMAQSCASILHLMHKHDFVITPMADAVASAEKKYADGSLASSL
FT                   IREIGRTNPKDYVKDTVGAENIGRFLVELADRLPKLISTNIGLLVPHFGGESYKIRNAL
FT                   VGVLGKLVMKAFKNVEGEVSSKSIQLRTKQAMLEILLERCRDVSAYTRSRVLQVWGELC
FT                   EEHSVSIGMWNEVAAVAAGRLEDKSAIVRKSALNLLIMMLQHNPFGPQLRIASFEATLE
FT                   QYKKKLNELQPNLASESVLDGLPSDGDTCNGDGEVDSGNEEEVGQVAKGQQDSLTDSCL
FT                   PHTAEGIVENDSPVPDVGNLEQTRALVASLEAGLRFSKCVSATMPTLVQLMASSSATDV
FT                   ENTILLLMRCKQFQVDGSEACLRKMFPLVFSQDKSTYEAVENAFVTIYIRKSSMETAKN
FT                   LLNLAIDSNIGDLAALEFIVGALVSKGDISTSMISALWDFFCFNVSGTTAEQSRGALSV
FT                   LCMAAKLSHGILVSHLQDIIDIGFGRWAKVEPLLARTACVALQRLSEADKKKLLSSNGT
FT                   RIFGILESLITSFWLPENIWYAAADKAIGAIYVIHPTPETLASDLVQKSLSSVFDCGGG
FT                   DELQNDIENGGSSVLSTVQVTKLSRYLFIVSHVAMNQLTYIESCVRRIQKQKAKKDKID
FT                   AESQYVPNGMASADVVKENGINAELGLAASEDAILDSLSERAEKEIISGGSAEKNLIGH
FT                   CAPFLSKLCRNFSLMQKYPELQASGMLALCRFMIIDGNFCEANLQLLFTVVENAPSETV
FT                   RSNCTIVLGDLAVRFPNLLEPWTENMYARLQDSSVSVRKNAVLVLSHLILNDMMKVKGY
FT                   INEMAMRLEDEDERISNLAKLFFHELSKKGSNPIYNLLPDILGKLCNRNLKRESFCNIM
FT                   QFLIGSIKKDKQMESLVEKLCNRFSGVTDVRQWEYVSYCLSQLAFTEKGMKKLMESFKT
FT                   YEHALSEDSVMDHFKNIISKSKKFAKPELKSCIEEFEEKLNKFHVERKEQEVTARNAQV
FT                   HQQKVGSLESLMVDGSTAEECQEADVVEDGEVIDPSLKGMTQSLNDVSKSRTSKVEEYS
FT                   DVSSEVIESEQGESEIQSAKVHLRGSSKSRGKKTNMKDQKRDTSTSMSTRRNLRSFQRY
FT                   ENLYSFHVIVTCIESITE"
FT   gene            2955579..2969255
FT                   /locus_tag="VIT_08s0007g05490"
FT                   /old_locus_tag="Vv08s0007g05490"
FT   mRNA            join(2955579..2955705,2955706..2955774,2956531..2956627,
FT                   2956704..2956801,2958252..2958407,2960269..2960346,
FT                   2960440..2960571,2960772..2960852,2961434..2961502,
FT                   2962461..2962550,2965116..2965260,2965346..2965434,
FT                   2967218..2967285,2967392..2967491,2967609..2967665,
FT                   2968864..2969016,2969017..2969255)
FT                   /locus_tag="VIT_08s0007g05490"
FT                   /old_locus_tag="Vv08s0007g05490"
FT                   /product="Pyruvate kinase"
FT   5'UTR           2955579..2955705
FT                   /locus_tag="VIT_08s0007g05490"
FT                   /old_locus_tag="Vv08s0007g05490"
FT   CDS_pept        join(2955706..2955774,2956531..2956627,2956704..2956801,
FT                   2958252..2958407,2960269..2960346,2960440..2960571,
FT                   2960772..2960852,2961434..2961502,2962461..2962550,
FT                   2965116..2965260,2965346..2965434,2967218..2967285,
FT                   2967392..2967491,2967609..2967665,2968864..2969016)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05490"
FT                   /old_locus_tag="Vv08s0007g05490"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HLQ8"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:F6HLQ8"
FT                   /protein_id="CCB55314.1"
FT                   /translation="MQGGHLAFEEPVRLSSVLTPSTFSSIPLLTKIVGTLGPRSRSVET
FT                   IEACLQAGMSVARFDFSWLDGDYHQETLENLRIAVKNVKKLCAVMLDTMGAELQVCNAT
FT                   GNPIKLKADDHVTITPDASKIPSAEVLPVNYDGLAESVKKGDSIFLGQYLSTGIESTSV
FT                   WLEVLETRGPDVICLVKNSATLAGSIFPMHMSQVRVKLPTLTEMDKQVISNWGSRNKVE
FT                   FIALSYTRHVEDVRELRAFLKTQNLNETQIFAKVETLEGLKHFDEILQEADGVILSRGN
FT                   LGVDLPPEKVFLFQKSAVHRCNMAGKPAIITRVVDSMTENLRPTRAEATDVANAVLDGA
FT                   DGILLGPETLCGLYPIEAIQIVGKICAEVRTAVNVNAAMIVAFTSTGGAPRLIAKYRPP
FT                   VPVLAVVIPRLKTNSLKWTLTGTLQARQLLSVRGVHPILSSPNVATSGGSSEDWGLKFA
FT                   LNHCKSMGWLKHNDRVVVFQKIGDSSVAKIVELQD"
FT   gap             2963197..2963296
FT                   /estimated_length=100
FT   3'UTR           2969017..2969255
FT                   /locus_tag="VIT_08s0007g05490"
FT                   /old_locus_tag="Vv08s0007g05490"
FT   gene            complement(2969256..2972332)
FT                   /locus_tag="VIT_08s0007g05480"
FT                   /old_locus_tag="Vv08s0007g05480"
FT   mRNA            complement(join(2969256..2969508,2969509..2969556,
FT                   2971899..2971954,2972059..2972188,2972189..2972332))
FT                   /locus_tag="VIT_08s0007g05480"
FT                   /old_locus_tag="Vv08s0007g05480"
FT   3'UTR           complement(2969256..2969508)
FT                   /locus_tag="VIT_08s0007g05480"
FT                   /old_locus_tag="Vv08s0007g05480"
FT   CDS_pept        complement(join(2969509..2969556,2971899..2971954,
FT                   2972059..2972188))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05480"
FT                   /old_locus_tag="Vv08s0007g05480"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HK93"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="InterPro:IPR031852"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:F6HK93"
FT                   /protein_id="CCB55315.1"
FT                   /translation="MANGSTSIVDFVSSRENELQIICSDSSKKQFKFDHVFRPGSDQEA
FT                   VFAQTSPIVTSMLDGYNVGDYPERDLFEEDEI"
FT   5'UTR           complement(2972189..2972332)
FT                   /locus_tag="VIT_08s0007g05480"
FT                   /old_locus_tag="Vv08s0007g05480"
FT   gap             2976129..2978147
FT                   /estimated_length=2019
FT   gene            complement(2980344..2980833)
FT                   /locus_tag="VIT_08s0007g05470"
FT                   /old_locus_tag="Vv08s0007g05470"
FT   mRNA            complement(join(2980344..2980461,2980790..2980833))
FT                   /locus_tag="VIT_08s0007g05470"
FT                   /old_locus_tag="Vv08s0007g05470"
FT   CDS_pept        complement(join(2980344..2980461,2980790..2980833))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05470"
FT                   /old_locus_tag="Vv08s0007g05470"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HK94"
FT                   /protein_id="CCB55316.1"
FT                   /translation="MPVSTPFFSENLLRRWMNAWLDYTRASVHSCRWNKGRIWGESKPS
FT                   EYQRLSQN"
FT   gene            2986504..2988513
FT                   /locus_tag="VIT_08s0007g05460"
FT                   /old_locus_tag="Vv08s0007g05460"
FT   mRNA            join(2986504..2987066,2987067..2988172,2988192..2988453,
FT                   2988454..2988513)
FT                   /locus_tag="VIT_08s0007g05460"
FT                   /old_locus_tag="Vv08s0007g05460"
FT                   /product="Predicted protein"
FT   5'UTR           2986504..2987066
FT                   /locus_tag="VIT_08s0007g05460"
FT                   /old_locus_tag="Vv08s0007g05460"
FT   CDS_pept        join(2987067..2988172,2988192..2988453)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05460"
FT                   /old_locus_tag="Vv08s0007g05460"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HK95"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR032867"
FT                   /db_xref="UniProtKB/TrEMBL:F6HK95"
FT                   /protein_id="CCB55317.1"
FT                   /translation="MYAKCGLPDIGRVLFDSISSKNSISWTAMISGYAQSGRKLDAIQL
FT                   FQKMPVKNLLSWTALISGLVQSGNWVDSFYLFMEMRSKGIDIADPFILSSIIGASANLA
FT                   VLGLGKQIHCLVILLGYESSLFVSNALVDMYAKCSDVLAAIKIFGRMVQRDIVSWTSII
FT                   VGTAQHGLAEEALSLYNRMLSTGLKPNEVTFVGLIYACSHVGLVSKGRYFFKSMIKDYG
FT                   INPSLQHYTCLLDLLSRSGHLEEAENLIKAMPFKPDEATWAALLSACNHHRNTLIGIRV
FT                   ADHLLSLKPEDPSTYILLSNIYASAAMWESVSKVRRLMAAMEVKKEPGYSCIVLGKESQ
FT                   VFLAGETSHPAKDEIFGLLKELDAEMKRSSVLHDLEQQEKERHLFWHSERLAVAYGLLK
FT                   GIPGMVLHIVKNLRVCGDCHTVLKFISIIVKREIVVRDANRYHHFKDGKCSCNNFW"
FT   3'UTR           2988454..2988513
FT                   /locus_tag="VIT_08s0007g05460"
FT                   /old_locus_tag="Vv08s0007g05460"
FT   gene            2988682..2990484
FT                   /locus_tag="VIT_08s0007g05450"
FT                   /old_locus_tag="Vv08s0007g05450"
FT   mRNA            join(2988682..2988754,2989822..2990102,2990395..2990484)
FT                   /locus_tag="VIT_08s0007g05450"
FT                   /old_locus_tag="Vv08s0007g05450"
FT   CDS_pept        join(2988682..2988754,2989822..2990102,2990395..2990484)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05450"
FT                   /old_locus_tag="Vv08s0007g05450"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HK96"
FT                   /protein_id="CCB55318.1"
FT                   /translation="MEFVLRHPSLSSHHTRWASSISLIEAGDSMLNPLKQLVQPRIIKA
FT                   GEAFECLHNLVPMRKGFQWQTFMAAGGYVKEIGKMQRLRTMKIFCHLDVRDLRSVLLST
FT                   STTETHSIYANLSSIEEVNEEGKQEMTLPTVLMLWIKEVQAEP"
FT   gene            complement(2991770..3000260)
FT                   /locus_tag="VIT_08s0007g05440"
FT                   /old_locus_tag="Vv08s0007g05440"
FT   mRNA            complement(join(2991770..2991996,2992175..2992175,
FT                   2992176..2992352,2993651..2993750,2994504..2994608,
FT                   2994721..2994833,2996201..2996273,2997087..2997154,
FT                   2997541..2997641,2998972..2999092,3000219..3000260))
FT                   /locus_tag="VIT_08s0007g05440"
FT                   /old_locus_tag="Vv08s0007g05440"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(join(2991770..2991996,2992175..2992175))
FT                   /locus_tag="VIT_08s0007g05440"
FT                   /old_locus_tag="Vv08s0007g05440"
FT   CDS_pept        complement(join(2992176..2992352,2993651..2993750,
FT                   2994504..2994608,2994721..2994833,2996201..2996273,
FT                   2997087..2997154,2997541..2997641,2998972..2999092,
FT                   3000219..3000260))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05440"
FT                   /old_locus_tag="Vv08s0007g05440"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIM5"
FT                   /db_xref="InterPro:IPR019150"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIM5"
FT                   /protein_id="CBI30101.3"
FT                   /translation="MPFNHALIDSFCIPLKASKKSIRKRTYRSLGFQGRPNRSHRRDPT
FT                   GQRPRRSSTVVQDLVMGISRTEVNLRRLLAAAPQQQNRAKLIHYVATLREQLEQLTEER
FT                   TLEGLPRVSKQKVNEYAEEIEAIASKIIAPSSDVQVSQEPLSGTYGQESHSKDEEDSIP
FT                   HSPGLRRRFVPASNVEDRTHDTVKADASGPVKLDAAAQAHVEKHRKLQEDLTDEMVGLA
FT                   KQLKQGSLLMSQSIKNSEKILDSTEKAVEHSLASTGRVNTRAMEINSNGFKTTCFTWIL
FT                   IFVMTCIFIMVVLLIRVT"
FT   gene            3000796..3002821
FT                   /locus_tag="VIT_08s0007g05430"
FT                   /old_locus_tag="Vv08s0007g05430"
FT   mRNA            join(3000796..3000879,3001248..3001343,3001438..3001505,
FT                   3001602..3001724,3002665..3002821)
FT                   /locus_tag="VIT_08s0007g05430"
FT                   /old_locus_tag="Vv08s0007g05430"
FT                   /product="Pyruvate kinase"
FT   CDS_pept        join(3000796..3000879,3001248..3001343,3001438..3001505,
FT                   3001602..3001724,3002665..3002821)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05430"
FT                   /old_locus_tag="Vv08s0007g05430"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIM6"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIM6"
FT                   /protein_id="CBI30102.3"
FT                   /translation="MMTTVFGSRISVSMYLFLYGKVMILLQRAESVYNQSLHFKRIVKH
FT                   VGEPMSHAESVASSAVRTAVNVNAAMIVAFTSTGGAPRLITKYRPPVPVLAVVIPRLKT
FT                   NSLKWTLTGTLQVPQALLPKIQTQDYVSLTETTLSNVRPNRVSLVGMNGPNVSEFSDVP
FT                   LLEKDMQITLPL"
FT   gene            complement(3003333..3020106)
FT                   /locus_tag="VIT_08s0007g05420"
FT                   /old_locus_tag="Vv08s0007g05420"
FT   mRNA            complement(join(3003333..3003620,3003621..3003668,
FT                   3004962..3005031,3011805..3011938,3012568..3012609,
FT                   3013005..3013066,3015762..3015880,3019184..3019335,
FT                   3019874..3019975,3019976..3020106))
FT                   /locus_tag="VIT_08s0007g05420"
FT                   /old_locus_tag="Vv08s0007g05420"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(3003333..3003620)
FT                   /locus_tag="VIT_08s0007g05420"
FT                   /old_locus_tag="Vv08s0007g05420"
FT   CDS_pept        complement(join(3003621..3003668,3004962..3005031,
FT                   3011805..3011938,3012568..3012609,3013005..3013066,
FT                   3015762..3015880,3019184..3019335,3019874..3019975))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05420"
FT                   /old_locus_tag="Vv08s0007g05420"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIM7"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR000938"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR036859"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIM7"
FT                   /protein_id="CBI30103.3"
FT                   /translation="MASRLQIQEDESVSLRVTHGNIKSFSADVRFSLQMTVESVKDKLW
FT                   RKCGTSVNSMCLELYDDTGAKISVLSDNLRPLGFYSPQDGYRLHVIDLDPSSVTSGGWL
FT                   EDTSLVEKYSISEEAYEKLDGTFRKFKEKLAFQNPSILESKISDHYMGDLCANIKVGDR
FT                   CEVEPGEKRGVVKFVGRAQSLAPGFWVGVQYDEPLGKHDGMVKGTRYFDCPPLHGAMVR
FT                   PDKVKVGDYPERDLFEEDEI"
FT   5'UTR           complement(3019976..3020106)
FT                   /locus_tag="VIT_08s0007g05420"
FT                   /old_locus_tag="Vv08s0007g05420"
FT   gene            3022426..3030968
FT                   /locus_tag="VIT_08s0007g05410"
FT                   /old_locus_tag="Vv08s0007g05410"
FT   mRNA            join(3022426..3022473,3022474..3022554,3022987..3023146,
FT                   3023227..3023339,3025496..3025566,3025685..3025776,
FT                   3026473..3026560,3026639..3026750,3026842..3026938,
FT                   3027026..3027107,3027807..3027924,3029936..3030043,
FT                   3030117..3030219,3030656..3030831,3030832..3030968)
FT                   /locus_tag="VIT_08s0007g05410"
FT                   /old_locus_tag="Vv08s0007g05410"
FT                   /product="unknown predicted protein"
FT   5'UTR           3022426..3022473
FT                   /locus_tag="VIT_08s0007g05410"
FT                   /old_locus_tag="Vv08s0007g05410"
FT   CDS_pept        join(3022474..3022554,3022987..3023146,3023227..3023339,
FT                   3025496..3025566,3025685..3025776,3026473..3026560,
FT                   3026639..3026750,3026842..3026938,3027026..3027107,
FT                   3027807..3027924,3029936..3030043,3030117..3030219,
FT                   3030656..3030831)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05410"
FT                   /old_locus_tag="Vv08s0007g05410"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIM8"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006238"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIM8"
FT                   /protein_id="CBI30104.3"
FT                   /translation="MASSSSSSISFTSFLTSHSNATDLNVPGFVYGKVPASLRFNTVKG
FT                   NRALFGKKFELNCFQEKEMDVSTSAVVDGIADRLTEMEVKEPSISTMLINYENKSDPFD
FT                   AVSPPLYQTATFKQPSATENGPYDYTRSGNPTRDVLESLLARLDKADRAFCFTSGMAAL
FT                   AAVTHLIAPGEEIVAGEDIYGGSDRLLSQVTTKRGIVVKRVDTTNLEEVASAIGPMTKL
FT                   VWLESPTNPRLQISDIRKITEMAHTHGALLLVDNSIMSPVLSQPLELGADIVMHSATKF
FT                   IAGHSDVMAGVLAVKGESLAKDLYFLQNAEGSGLAPFDCWICLRGIKTMALRVEKQQEN
FT                   AQKIAEFLSSHPRVKKVNYAGLPDHPGRSLHYSQAKGAGSVLSFLTGSLEFSKYIVETT
FT                   KYFSITVSFGSVKSLISMPCFMSHASIPAAVREARGLTEDLVRISVGIEDINDLIADLD
FT                   YALRTGPQ"
FT   3'UTR           3030832..3030968
FT                   /locus_tag="VIT_08s0007g05410"
FT                   /old_locus_tag="Vv08s0007g05410"
FT   gene            complement(3032228..3042829)
FT                   /locus_tag="VIT_08s0007g05400"
FT                   /old_locus_tag="Vv08s0007g05400"
FT   mRNA            complement(join(3032228..3032651,3033796..3033812,
FT                   3033813..3033877,3033954..3034040,3034287..3034775,
FT                   3039219..3039401,3040848..3040953,3041733..3041780,
FT                   3041781..3041834,3042580..3042606,3042762..3042829))
FT                   /locus_tag="VIT_08s0007g05400"
FT                   /old_locus_tag="Vv08s0007g05400"
FT                   /product="putative uncharacterized protein"
FT   3'UTR           complement(join(3032228..3032651,3033796..3033812))
FT                   /locus_tag="VIT_08s0007g05400"
FT                   /old_locus_tag="Vv08s0007g05400"
FT   CDS_pept        complement(join(3033813..3033877,3033954..3034040,
FT                   3034287..3034775,3039219..3039401,3040848..3040953,
FT                   3041733..3041780))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05400"
FT                   /old_locus_tag="Vv08s0007g05400"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR006476"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIM9"
FT                   /protein_id="CBI30105.3"
FT                   /translation="MSSGAARRVSRQDIQLVQNLIERCLQLYMNQKEVVETLLDQAKIE
FT                   PDFTELVWQKLVEENQDFFEAYHLRLMVKHQINVFNELLKQQVDLMHRICPARVDTVPI
FT                   PNGSQLSALQQNSACYPSEHVGPSMKPSSMHRHISSGLSNAFTNGGSSLQTSMHTAVDM
FT                   SANTCRIDAPQDMLSTRSPNLGLMQGMNGGMIKPEAGYSGSSPFMFGADNTALEKRVAI
FT                   GDASVTPFSSVVSNSQTLGEPLLDSDTSTYGFLGQIPQSFSLSDLTAGFSQSSDILESY
FT                   PRSPFLTTDTDNFMDSRGRGENQGDSKRLDTISEGLSYEDFPSD"
FT   5'UTR           complement(3042762..3042829)
FT                   /locus_tag="VIT_08s0007g05400"
FT                   /old_locus_tag="Vv08s0007g05400"
FT   gene            complement(3045687..3047793)
FT                   /locus_tag="VIT_08s0007g05390"
FT                   /old_locus_tag="Vv08s0007g05390"
FT   mRNA            complement(join(3045687..3045935,3045936..3046245,
FT                   3046358..3046428,3046780..3046857,3047005..3047099,
FT                   3047347..3047449,3047450..3047793))
FT                   /locus_tag="VIT_08s0007g05390"
FT                   /old_locus_tag="Vv08s0007g05390"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(3045687..3045935)
FT                   /locus_tag="VIT_08s0007g05390"
FT                   /old_locus_tag="Vv08s0007g05390"
FT   CDS_pept        complement(join(3045936..3046245,3046358..3046428,
FT                   3046780..3046857,3047005..3047099,3047347..3047449))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05390"
FT                   /old_locus_tag="Vv08s0007g05390"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HK97"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:F6HK97"
FT                   /protein_id="CCB55319.1"
FT                   /translation="MGMSTESQFHVLAVDDSLIDRKLIEKLLKNSSYQVTTVDSGSKAL
FT                   EFLGLHENDPNTPSVSPNSHQEVEVNLIITDYCMPGMTGYDLLKKIKESSSLRNIPVVI
FT                   MSSENVPSRITRCLEEGAEEFFLKPVQISDVNRLKPHMMKAKSKDQQQENEEKQEKQEE
FT                   ESKETEKSEPESQQPQQQQQQQQQQQQSNNNKRKAIEEGLSPDRTRPRYSGLTVV"
FT   5'UTR           complement(3047450..3047793)
FT                   /locus_tag="VIT_08s0007g05390"
FT                   /old_locus_tag="Vv08s0007g05390"
FT   gene            3066000..3067901
FT                   /locus_tag="VIT_08s0007g05370"
FT                   /old_locus_tag="Vv08s0007g05370"
FT   mRNA            join(3066000..3066034,3066035..3066315,3066413..3066676,
FT                   3067180..3067747,3067748..3067901)
FT                   /locus_tag="VIT_08s0007g05370"
FT                   /old_locus_tag="Vv08s0007g05370"
FT                   /product="unknown predicted protein"
FT   5'UTR           3066000..3066034
FT                   /locus_tag="VIT_08s0007g05370"
FT                   /old_locus_tag="Vv08s0007g05370"
FT   CDS_pept        join(3066035..3066315,3066413..3066676,3067180..3067747)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05370"
FT                   /old_locus_tag="Vv08s0007g05370"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HK98"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR018119"
FT                   /db_xref="UniProtKB/TrEMBL:F6HK98"
FT                   /protein_id="CCB55320.1"
FT                   /translation="MNTKLILTAITLAAISIILAVNSNHLFKPPSIPGTHDLLHGSEVI
FT                   QVTGAFGPESIAFDPKGEGPYTGVADGRVLKWEGDGRGWTDFAVTTSERKECVRPFAPE
FT                   MEHICGRPLGLRFDKKTGDLYIADAYFGLQVVEPNGGLATPLVTEVEGRRLLFTNDMDI
FT                   DEVEDVIYFTDTSTDFHRRQFMAALLSGDNTGRLMKYDKSSKEVTVLLRGLAFANGVAM
FT                   SKDRSFVLVAETTTGKIIRYWLKGPNAGKSDVFAEVPGYPDNVRRNSKGEFWVALHAKK
FT                   GPHANWITSNSWVGKTLLKLPLTFKQLHKLIVVEAHATAIKLSEEGQVLEVLEDCEGKS
FT                   MRFISEVEEHNGKLWLGSVMMPFIGVYDLH"
FT   3'UTR           3067748..3067901
FT                   /locus_tag="VIT_08s0007g05370"
FT                   /old_locus_tag="Vv08s0007g05370"
FT   gene            3074190..3076741
FT                   /locus_tag="VIT_08s0007g05360"
FT                   /old_locus_tag="Vv08s0007g05360"
FT   mRNA            join(3074190..3074485,3075480..3075746,3075994..3076567,
FT                   3076568..3076741)
FT                   /locus_tag="VIT_08s0007g05360"
FT                   /old_locus_tag="Vv08s0007g05360"
FT                   /product="Predicted protein"
FT   CDS_pept        join(3074190..3074485,3075480..3075746,3075994..3076567)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05360"
FT                   /old_locus_tag="Vv08s0007g05360"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HK99"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR018119"
FT                   /db_xref="UniProtKB/TrEMBL:F6HK99"
FT                   /protein_id="CCB55321.1"
FT                   /translation="MAMSSKLLLAAAAAAAFLITALIAGKRTSLSSPEFDSEKFSNQKD
FT                   AVIPIPTPGAIGPESLAFDSVGGGPYTGVSDGRIIKWEENEERWVDFATTSSKREGCRG
FT                   SRDHVPLEHICGRPLGLSFSELTGELYIADAYMGLLVVGPNGGLASTVASEAQGTPFGF
FT                   SNGVDIHQTNGAVYFSDSSSRYQRRNFVAAIISGDNTGRLMKYEPESKQVTVLLRSLGF
FT                   PNGVALSKNGDFILLSETSRCRILRFWLQTSKAGTVEVFTLLPGFPDNIKRNSKGEFWV
FT                   GMHSRKGKLVEWFLSYPWIGRTLLKLPFPHGFLSFFSKWRKTGFAVRLSEEGEVLEIFE
FT                   PKNGNGWISSISEVYERDGSLWIGSVTTPCVGKYEMQT"
FT   3'UTR           3076568..3076741
FT                   /locus_tag="VIT_08s0007g05360"
FT                   /old_locus_tag="Vv08s0007g05360"
FT   gene            3081279..3086793
FT                   /locus_tag="VIT_08s0007g05350"
FT                   /old_locus_tag="Vv08s0007g05350"
FT   mRNA            join(3081279..3081361,3081362..3081691,3082233..3082339,
FT                   3085230..3085338,3085544..3085705,3085838..3086011,
FT                   3086572..3086601,3086602..3086793)
FT                   /locus_tag="VIT_08s0007g05350"
FT                   /old_locus_tag="Vv08s0007g05350"
FT                   /product="unknown predicted protein"
FT   5'UTR           3081279..3081361
FT                   /locus_tag="VIT_08s0007g05350"
FT                   /old_locus_tag="Vv08s0007g05350"
FT   CDS_pept        join(3081362..3081691,3082233..3082339,3085230..3085338,
FT                   3085544..3085705,3085838..3086011,3086572..3086601)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05350"
FT                   /old_locus_tag="Vv08s0007g05350"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKA0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR011949"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKA0"
FT                   /protein_id="CCB55322.1"
FT                   /translation="MALMASRTKASRVLNCLIEKTACLRTGPCANGFSRRILDDPFGGI
FT                   GHFRCYSSSAAVASNESRLGLGGFEVLGLKDYEEYRKALYGEITHKALLVDAVGTLLVP
FT                   SQPMAQIYRKIGEKYGVEYSETEILNRYRRAYAQPWGRSRLRYVNDGRPFWQYIVSFST
FT                   GCSDTQYFEELYHYYTTEEAWHLCDPEAERVFMSLRKAGVKLAVVSNFDTRLRPVLQAL
FT                   NCNHWFDAVAVSAEVEAEKPNPTIFLKACELLGVKPEEVVHVGDDRRNDIWGARDAGCD
FT                   AWLWGSDVYSFKEVAQRIGVQV"
FT   3'UTR           3086602..3086793
FT                   /locus_tag="VIT_08s0007g05350"
FT                   /old_locus_tag="Vv08s0007g05350"
FT   gene            3087525..3115677
FT                   /locus_tag="VIT_08s0007g05340"
FT                   /old_locus_tag="Vv08s0007g05340"
FT   mRNA            join(3087525..3087527,3087528..3087651,3088293..3088382,
FT                   3089335..3089453,3092562..3092675,3092782..3092863,
FT                   3093268..3093335,3093410..3093484,3093605..3093750,
FT                   3093854..3093956,3101091..3101171,3101345..3101413,
FT                   3101519..3101578,3101658..3101819,3102395..3102458,
FT                   3105521..3105750,3106060..3106230,3106396..3106500,
FT                   3106965..3107036,3107262..3107405,3107559..3107672,
FT                   3107764..3107850,3107923..3108126,3108207..3108395,
FT                   3110981..3111187,3111312..3111401,3111498..3111638,
FT                   3112617..3112714,3113835..3113913,3114013..3114177,
FT                   3114518..3114589,3115432..3115659,3115660..3115677)
FT                   /locus_tag="VIT_08s0007g05340"
FT                   /old_locus_tag="Vv08s0007g05340"
FT                   /product="Predicted protein"
FT   5'UTR           3087525..3087527
FT                   /locus_tag="VIT_08s0007g05340"
FT                   /old_locus_tag="Vv08s0007g05340"
FT   CDS_pept        join(3087528..3087651,3088293..3088382,3089335..3089453,
FT                   3092562..3092675,3092782..3092863,3093268..3093335,
FT                   3093410..3093484,3093605..3093750,3093854..3093956,
FT                   3101091..3101171,3101345..3101413,3101519..3101578,
FT                   3101658..3101819,3102395..3102458,3105521..3105750,
FT                   3106060..3106230,3106396..3106500,3106965..3107036,
FT                   3107262..3107405,3107559..3107672,3107764..3107850,
FT                   3107923..3108126,3108207..3108395,3110981..3111187,
FT                   3111312..3111401,3111498..3111638,3112617..3112714,
FT                   3113835..3113913,3114013..3114177,3114518..3114589,
FT                   3115432..3115659)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05340"
FT                   /old_locus_tag="Vv08s0007g05340"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIN4"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIN4"
FT                   /protein_id="CBI30110.3"
FT                   /translation="MERINVTVRARPLSPEDAKTSPWRISGNSIAFSNHSSKFDFDRIF
FT                   GEDCKTAEVYQTCTKDIVVAAVRGFNGTVFAYGQTNSGKTHTMRGSATEPGVIPLAVHD
FT                   LFDIIQEDMSREFLLRMSYMEIYNEEINDLLAPEHRKLQIHESLERGIFVAGLREEIVV
FT                   SPKQILDLMEFGESHRHIGETNMNLYSSRSHTIFRMIIESRDKTVDEDIGGSCDAVRVS
FT                   VLNLVDLAGSERAAKTGAEGVRLKEGSHINKSLMALGTVIKKLSEGAESQGSHVPYRDS
FT                   KITRILQPALGGNSNTAIICNITLAQIHADETKSSLQFASRALRVTNCAHVNEILTDAA
FT                   LLKRQKKEIEELRAKLQGSHSEHFEEEILNLRNTLLKTELERERIALELEEEKKAQVER
FT                   ERRLQEQAKKIENLSSMVLYSNRDENHDHYKKQKNRRDTWCPGNLSQKTFKEVIHSRAS
FT                   TVKSMRPDRDVGPLVPFEELVNTIEVGVDESCKQEEDCHKNALEDCTLPDPRALLHVTN
FT                   RRKVPLRKKSLPIQFDFLTRKLAEADLFLDVKYDDHSTYNLSTGTITTDKNLSLRESEA
FT                   IVVIKQLQEQIELLEMEKSSSQRNLDTIVGLATEQNICAREKYEELSEELLNAREEARV
FT                   ACERLASKESNFESMIDLLMEAQEIMLEVQSSRNLVDSVASVVDELFQTLSVMLSQFLE
FT                   FKSSICQNSVQLKSIIGNHEKLEFSMRHKVAELENQKLLLCNQSADLHTQIEDLKLDGL
FT                   NSEKTLAALSEQQDLEKSEFLYHIQTLEKEISHLSSCSLAREKENLRKDLEKTKTKLKE
FT                   TEFKLKNAIQEKTKLEGEKAYAEREIKQLHGQKTLLERDISKRDSLACRRRDSVVDRSS
FT                   KMFDPKRAKSHAVPFEQTMQEDYKKLEVFAFEMETTIASLEEELAAAYRDKEEAVFRNE
FT                   TLTAELEALSDKLNISNSDLKMFQEKALSLRSRLEESSSKYEKIESIVNMLVEEKEELA
FT                   MQLTNALLEMEEEKAIWFAKEKASVEAIEERAKLYNAETMSLSKGLLEVRNELESCREE
FT                   CKVLKERLICSEENAEWERKCSMEKSFEIDRLRNDLEIADAESKRSQEILKSKLETLSS
FT                   ERHHACEELDRLQLELDFLKKEREEFEIRTKEFNMGSELSNNLQLSKAKVEVEELAREL
FT                   SSKELKMRNDEIKNSIEKAKLRMRLRWTQAKLDAFRIRYKEAADELDFMNKKYEEASTK
FT                   LKDRLASYGIEVLNLKKQLAASKAQ"
FT   gap             3091380..3091479
FT                   /estimated_length=100
FT   3'UTR           3115660..3115677
FT                   /locus_tag="VIT_08s0007g05340"
FT                   /old_locus_tag="Vv08s0007g05340"
FT   gene            complement(3116403..3138637)
FT                   /locus_tag="VIT_08s0007g05330"
FT                   /old_locus_tag="Vv08s0007g05330"
FT   mRNA            complement(join(3116403..3116623,3116624..3116984,
FT                   3117373..3117587,3117965..3118147,3119088..3119180,
FT                   3119730..3119888,3120003..3120170,3121335..3121443,
FT                   3121543..3121595,3123902..3123970,3124763..3124883,
FT                   3125004..3125062,3133737..3133827,3134700..3134800,
FT                   3136539..3136630,3136748..3136846,3138356..3138488,
FT                   3138489..3138637))
FT                   /locus_tag="VIT_08s0007g05330"
FT                   /old_locus_tag="Vv08s0007g05330"
FT                   /product="Predicted protein"
FT   3'UTR           complement(3116403..3116623)
FT                   /locus_tag="VIT_08s0007g05330"
FT                   /old_locus_tag="Vv08s0007g05330"
FT   CDS_pept        complement(join(3116624..3116984,3117373..3117587,
FT                   3117965..3118147,3119088..3119180,3119730..3119888,
FT                   3120003..3120170,3121335..3121443,3121543..3121595,
FT                   3123902..3123970,3124763..3124883,3125004..3125062,
FT                   3133737..3133827,3134700..3134800,3136539..3136630,
FT                   3136748..3136846,3138356..3138488))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05330"
FT                   /old_locus_tag="Vv08s0007g05330"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIN5"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR012580"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR040382"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIN5"
FT                   /protein_id="CBI30111.3"
FT                   /translation="MAYQGGNLRSTSINGVKTYTISSHQRSLATWLPPKKLRALRKNND
FT                   YLQRVDLIQDLRFETATTKIKATPDGEYLIASGIYPPQVKVYELRELSLKFERHLVSEI
FT                   IDFQILGDDYSKLAFLCADRTVCLHAKYGSHYSLRIPRMGRDIAYDYWSCDLLCAASSP
FT                   DLYRINLEQGRFLSSLNTQSPALNVVSRSNLHGLVACGGEDGAVECFDMRTRSSVGRIN
FT                   AVAAAGDVDQEVTALEFDGDAGFLMAVGSSSGKVLIYDLRSSCPIRIKDHMYGSPILDI
FT                   KWHRTLNSERPKLITTDNHIVRIWDPETGDGMTSIEPTGTINDICVFSDSGLMLLALDG
FT                   SQIPSYFIPALGPAPKWCSYLENLTEELEEGAQTTIYDDFKFLTKEDLERLNLTNLIGT
FT                   NLLRAYMHGFFIDYRLYKKAQSLADPFAYDNYIEQRKKEKLETERASRITIKRKLPKVN
FT                   RVLAARILEDEEAENETKDADGDDIKKKSKKKKALSSDVFKDERFAAMFENKDFEVDEL
FT                   SQEYMSLHPMPSKKQPSLVEEHFEPVMEDIDETSSDSDASEEPQSSEGKILNESSKVKK
FT                   RSRVPRLYEVKDERHAEAFWNRVSLAKEDALPLGERVAALQDEHQDSRIPNDVKLGPGG
FT                   SREISFITRSSAKYEEDEEIPHQKRRGIHSLGLKPDRSGFQGRGRGRGRGRGRGRSGGR
FT                   GRGRGRW"
FT   5'UTR           complement(3138489..3138637)
FT                   /locus_tag="VIT_08s0007g05330"
FT                   /old_locus_tag="Vv08s0007g05330"
FT   gene            3139064..3143603
FT                   /locus_tag="VIT_08s0007g05320"
FT                   /old_locus_tag="Vv08s0007g05320"
FT   mRNA            join(3139064..3139173,3141362..3141364,3141365..3141610,
FT                   3141882..3141974,3142460..3142604,3142727..3142837,
FT                   3142905..3142987,3143079..3143136,3143394..3143473,
FT                   3143474..3143603)
FT                   /locus_tag="VIT_08s0007g05320"
FT                   /old_locus_tag="Vv08s0007g05320"
FT                   /product="unknown predicted protein"
FT   5'UTR           3139064..3139173
FT                   /locus_tag="VIT_08s0007g05320"
FT                   /old_locus_tag="Vv08s0007g05320"
FT   CDS_pept        join(3141365..3141610,3141882..3141974,3142460..3142604,
FT                   3142727..3142837,3142905..3142987,3143079..3143136,
FT                   3143394..3143473)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05320"
FT                   /old_locus_tag="Vv08s0007g05320"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKA1"
FT                   /db_xref="InterPro:IPR005304"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKA1"
FT                   /protein_id="CCB55323.1"
FT                   /translation="MVRPYTIKGHKRKRREENYDKEEVKQLLEEETAATATQDENKAEE
FT                   ITHELPGIPLVPFKSNNKTGVTFILERACLEVAKVGKSYQLLSSEDHANFLRKNNKNPA
FT                   DYRPDILHQALLTILDSPLNKAGRLRAVYVRTEKGVLFEVKPHVRIPRTYKRFSGIMLQ
FT                   LLQKLSITAVGKREKLLRVIKNPVTQYLPVNSRKIGFSYSSEKSTPIRDYVAAVSDDVD
FT                   LVFVVGAMAHGKISNDYTDDFIAISGYPLSASWCTYLICGALMQKWNIF"
FT   3'UTR           3143474..3143603
FT                   /locus_tag="VIT_08s0007g05320"
FT                   /old_locus_tag="Vv08s0007g05320"
FT   gene            complement(3146079..3147555)
FT                   /locus_tag="VIT_08s0007g05310"
FT                   /old_locus_tag="Vv08s0007g05310"
FT   mRNA            complement(join(3146079..3146583,3146584..3146604,
FT                   3146815..3146920,3147419..3147555))
FT                   /locus_tag="VIT_08s0007g05310"
FT                   /old_locus_tag="Vv08s0007g05310"
FT   3'UTR           complement(3146079..3146583)
FT                   /locus_tag="VIT_08s0007g05310"
FT                   /old_locus_tag="Vv08s0007g05310"
FT   CDS_pept        complement(join(3146584..3146604,3146815..3146920,
FT                   3147419..3147555))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05310"
FT                   /old_locus_tag="Vv08s0007g05310"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIN7"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIN7"
FT                   /protein_id="CBI30113.3"
FT                   /translation="MILTIYTNYLIYLSVYLINIFKEKILKVYFSLGIENNLLLFWLEL
FT                   LWVQLAVSIQLMSWDSSNYHFEDLGNLYPGIQRASKLYEDWR"
FT   gene            3147605..3149338
FT                   /locus_tag="VIT_08s0007g05300"
FT                   /old_locus_tag="Vv08s0007g05300"
FT   mRNA            join(3147605..3147898,3148448..3148804,3149252..3149338)
FT                   /locus_tag="VIT_08s0007g05300"
FT                   /old_locus_tag="Vv08s0007g05300"
FT                   /product="Predicted protein"
FT   CDS_pept        join(3147605..3147898,3148448..3148804,3149252..3149338)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05300"
FT                   /old_locus_tag="Vv08s0007g05300"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIN8"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR015660"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIN8"
FT                   /protein_id="CBI30114.3"
FT                   /translation="MLAFSPPLFSTFGWPWEDPISHEQNYIYQETEASESFLHLPSSEP
FT                   QAELNYSTPSAAVSGNPTMVKKLNHNASERDRRKKINSLYSSLRSLLPAADQAKKLSIP
FT                   STVSRVLKYIPELQKQVERLIQKKEELLSKISRQGDIIHQEKQRKATLASSLSAVSANR
FT                   LSDREIVVQISTFKVHESPLSEVLLNLEEDGLLVINASSFESFGGRVFYNLHLQVEGTH
FT                   RMECEVLSEKLLSLCEKRRDAFP"
FT   gene            complement(3149653..3151018)
FT                   /locus_tag="VIT_08s0007g05290"
FT                   /old_locus_tag="Vv08s0007g05290"
FT   mRNA            complement(join(3149653..3149698,3150946..3150983,
FT                   3150984..3151018))
FT                   /locus_tag="VIT_08s0007g05290"
FT                   /old_locus_tag="Vv08s0007g05290"
FT   CDS_pept        complement(join(3149653..3149698,3150946..3150983))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05290"
FT                   /old_locus_tag="Vv08s0007g05290"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIN9"
FT                   /protein_id="CBI30115.3"
FT                   /translation="MSDFAYLNIGCLRIISFLTRPTWTPRA"
FT   5'UTR           complement(3150984..3151018)
FT                   /locus_tag="VIT_08s0007g05290"
FT                   /old_locus_tag="Vv08s0007g05290"
FT   gene            complement(3153095..3153688)
FT                   /locus_tag="VIT_08s0007g05280"
FT                   /old_locus_tag="Vv08s0007g05280"
FT   mRNA            complement(join(3153095..3153212,3153651..3153688))
FT                   /locus_tag="VIT_08s0007g05280"
FT                   /old_locus_tag="Vv08s0007g05280"
FT   CDS_pept        complement(join(3153095..3153212,3153651..3153688))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05280"
FT                   /old_locus_tag="Vv08s0007g05280"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKA2"
FT                   /protein_id="CCB55324.1"
FT                   /translation="MIIKILSQKGWSSDEMMADLSEGFSLLTLANNLRDVSVLFCHFNN
FT                   GGLMEF"
FT   gene            3157071..3167896
FT                   /locus_tag="VIT_08s0007g05270"
FT                   /old_locus_tag="Vv08s0007g05270"
FT   mRNA            join(3157071..3157712,3157713..3157882,3158329..3158492,
FT                   3167775..3167896)
FT                   /locus_tag="VIT_08s0007g05270"
FT                   /old_locus_tag="Vv08s0007g05270"
FT   5'UTR           3157071..3157712
FT                   /locus_tag="VIT_08s0007g05270"
FT                   /old_locus_tag="Vv08s0007g05270"
FT   CDS_pept        join(3157713..3157882,3158329..3158492,3167775..3167896)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05270"
FT                   /old_locus_tag="Vv08s0007g05270"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKA3"
FT                   /protein_id="CCB55325.1"
FT                   /translation="MVGTDIQNNSSCELRRRAARDEEGRMMVRTIVGPRGEGEGERRVM
FT                   QRKRSVNLKLMWFVVIGRFPTCKSHLKVVRFQYSTRFTSSTEMVFVLVFGIGHVGDAVN
FT                   NVLSPKCILFIYYYVYLHLCSLRRSLQEISKSTVSLEQLNPIYLNNP"
FT   gene            complement(3168650..3216187)
FT                   /locus_tag="VIT_08s0007g05260"
FT                   /old_locus_tag="Vv08s0007g05260"
FT   mRNA            complement(join(3168650..3169012,3169013..3169174,
FT                   3169688..3169771,3170360..3170438,3170541..3170779,
FT                   3171289..3171382,3171488..3171630,3172398..3172496,
FT                   3172591..3172719,3173910..3173984,3174094..3174291,
FT                   3174388..3174483,3174722..3174820,3174987..3175226,
FT                   3179368..3179478,3179623..3179820,3179903..3180018,
FT                   3182397..3182493,3187436..3187541,3187701..3187759,
FT                   3191471..3191600,3193944..3194101,3194832..3195047,
FT                   3195167..3195277,3200477..3200636,3201111..3201256,
FT                   3202816..3202908,3204341..3204437,3205769..3205839,
FT                   3206315..3206413,3207512..3207643,3207729..3208171,
FT                   3210228..3210540,3215864..3216160,3216161..3216187))
FT                   /locus_tag="VIT_08s0007g05260"
FT                   /old_locus_tag="Vv08s0007g05260"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(3168650..3169012)
FT                   /locus_tag="VIT_08s0007g05260"
FT                   /old_locus_tag="Vv08s0007g05260"
FT   CDS_pept        complement(join(3169013..3169174,3169688..3169771,
FT                   3170360..3170438,3170541..3170779,3171289..3171382,
FT                   3171488..3171630,3172398..3172496,3172591..3172719,
FT                   3173910..3173984,3174094..3174291,3174388..3174483,
FT                   3174722..3174820,3174987..3175226,3179368..3179478,
FT                   3179623..3179820,3179903..3180018,3182397..3182493,
FT                   3187436..3187541,3187701..3187759,3191471..3191600,
FT                   3193944..3194101,3194832..3195047,3195167..3195277,
FT                   3200477..3200636,3201111..3201256,3202816..3202908,
FT                   3204341..3204437,3205769..3205839,3206315..3206413,
FT                   3207512..3207643,3207729..3208171,3210228..3210540,
FT                   3215864..3216160))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05260"
FT                   /old_locus_tag="Vv08s0007g05260"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKA4"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKA4"
FT                   /protein_id="CCB55326.1"
FT                   /translation="MSLHSFSPTSQLLHSNVFPAAQSPPPTSVFATNKGIILADFVGLY
FT                   CKSRRARPRIGVSGHRRFHKFSAGKFGTINAVLDLDRIKNAAEQSSSRSDSKPKVANLD
FT                   DIISERGACGVGFIANLDNKASHEVVKDALAALSCMEHRGGCGADNDSGDGSGLMTSIP
FT                   WDLFNNWAKEQRIGSFDRLHTGVGMVFLPKDDDLMKEAKTVIDNSFKQEGLEVLGWRPV
FT                   PVDISIVGYYAKETMPNIQQVFVRVVKEENIDDIERELYICRKLIERAVKSETWGNELY
FT                   FCSLSNQTIVYKGMLRSEVLGNFYLDLKSDIYKSPFAIYHRRYSTNTSPRWPLAQPMRL
FT                   LGHNGEINTIQGNLNWMQSREASLKSPVWRGRENEIRPFGNPKASDSANLDSTAELLIR
FT                   SGRSAEESLMILVPEAYKNHPTLMIKYPEVVDFYNYYKGQMEAWDGPALLLFSDGKTVG
FT                   ACLDRNGLRPARYWRTIDNVVYVASEVGVLPMDESKVVMKGRLGPGMMISVDLTSGQVY
FT                   ENTEVKKQVALSNPYGKWVNENMRSLRPVNFLSATVMDNEGILRHQQAYGYSSEDVQMV
FT                   IETMAAQAKEPTFCMGDDIPLAVISQRSHMLYDYFKQRFAQVTNPAIDPLREGLVMSLE
FT                   VNIGKRGNILEVGPENASQVNLSSPVLNEGELESLLKDPHLKPRVLPTFFDIRKGVEGS
FT                   LQKRLNKLCEAADEAVRNGSQLLVLSDRSDELEPTRPGIPILLAVGAVHQHLIQNGLRM
FT                   SASIVADTAQCFSTHHFACLIGYGASAVCPYLALETCRQWRLSNKTVNLMRNGKMPTVT
FT                   IEQAQKNFCKAVQSGLLKILSKMGISLLSSYCGAQIFEIYGLGREVVDLAFCGSVSSIG
FT                   GLTLDELARETLSFWVKAFSEDTAKRLENFGFIQFRPGGEYHGNNPEMSKLLHKAVRQK
FT                   SESAFSVYQQHLANRPVNVLRDLLEFKSDRSPIPLGKVEPAASIVQRFCTGGMSLGAIS
FT                   RETHEAIAIAMNRLGGKSNSGEGGEDPIRWSPLTDVVDGYSPTLPHLKGLQNGDTATSA
FT                   IKQVASGRFGVTPTFLANADQLEIKIAQGAKPGEGGQLPGKKVSAYIARLRNSKPGVPL
FT                   ISPPPHHDIYSIEDLAQLIFDLHQVNPKAKVSVKLVAEAGIGTVASGVAKGNADIIQIS
FT                   GHDGGTGASPISSIKHAGGPWELGLSESHQTLIENGLRERVILRVDGGFKSGVDVMMAA
FT                   TMGADEYGFGSVAMIATGCVMARICHTNNCPVGVASQREELRARFPGVPGDLVNFFLYV
FT                   AEEVRGILAQLGFEKLDDVIGRTDLLRPRDISLVKTQHLDLSYILSNVGLPKWSSTEIR
FT                   NQDVHSNGPVLDDIILADPETSDAIENEKVVNKSIKIYNVDRAVCGRIAGVVAKKYGDT
FT                   GFAGQLNITFTGSAGQSFACFLTPGMNIRLIGEANDYVGKGMAGGELVVTPVEDTGFLP
FT                   EDATIVGNTCLYGATGGQIFVRGKGGERFAVRNSLAEAVVEGTGDHCCEYMTGGCVVVL
FT                   GKVGRNVAAGMTGGLAYILDEDDTLIPKVNKEIVKIQRVTAPVGQMQLKSLIEAHVEKT
FT                   GSSKGSAILKEWDTYLPLFWQLVPPSEEDTPEASAEFERTDASQVTLQSA"
FT   5'UTR           complement(3216161..3216187)
FT                   /locus_tag="VIT_08s0007g05260"
FT                   /old_locus_tag="Vv08s0007g05260"
FT   gene            3220250..3232049
FT                   /locus_tag="VIT_08s0007g05250"
FT                   /old_locus_tag="Vv08s0007g05250"
FT   mRNA            join(3220250..3220389,3223291..3223359,3223360..3223431,
FT                   3227147..3227752,3227891..3228013,3228215..3228444,
FT                   3228533..3230276,3230325..3230419,3230626..3230759,
FT                   3231489..3231676,3231677..3232049)
FT                   /locus_tag="VIT_08s0007g05250"
FT                   /old_locus_tag="Vv08s0007g05250"
FT                   /product="Predicted protein"
FT   5'UTR           3220250..3220389
FT                   /locus_tag="VIT_08s0007g05250"
FT                   /old_locus_tag="Vv08s0007g05250"
FT   CDS_pept        join(3223360..3223431,3227147..3227752,3227891..3228013,
FT                   3228215..3228444,3228533..3230276,3230325..3230419,
FT                   3230626..3230759,3231489..3231676)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05250"
FT                   /old_locus_tag="Vv08s0007g05250"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKA5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR018834"
FT                   /db_xref="InterPro:IPR019458"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKA5"
FT                   /protein_id="CCB55327.1"
FT                   /translation="MMTIPMDNNLDIQSRERVQRLFNKNVELESKRRRSAQARISFDPN
FT                   AWQQMRENYEAIILEDNAFSEQHEIEYALWQLHYRRIEELRAHFSAALASSASNTSQSL
FT                   KGSARPDRIGKIRAQFKTFLSEATGFYHDLMLKIRAKYGLPLGYFSEDKDNQIVMSRDG
FT                   NKSADIKKGMISCHRCLIYLGDLARYKGLYGDGDSKARDYAAASSYYMEASSLWPSSGN
FT                   PHHQLAILASYSGDELVTVYRYFRSLAVDNPFSTARENLTIAFEKNRQSYSQLLGDAKA
FT                   SSVIAPVRMNGKGRGKAEARTPLKNNKKEVSSVKERASSVRETFKAFRIRFVRLNGILF
FT                   TRTSLETFEEVYSMAKGNLLELLSSGPEEEHNFGSGAAENRLMTVRLIAILIFAVHNVN
FT                   RETENQSYAEILQRSVLLQNIFTVIFEFMGCILERCLQLHDPCASFLLPGVLVFLEWLA
FT                   CHPDIAVGNEVEEKQATARTFFWNHCISFLNNLLSSGFTSSNEDQDEICFFNMSKYEEG
FT                   ETANRLALWEDFELRGFLPLLPAQLILDYSRKQSFGSDGGNKDKNARVERIIAAGKSLI
FT                   NIVRIGQQGIYFDPKLKKFSIGVDPQMANDFAFSGSFEVLAVNGAGQEHPEEKNMNSST
FT                   LQQKPQLYLEGEEEDEEIVFKPSAADKFVDVIAPKVTSHEAFGTGVDARKVDLGSPIAS
FT                   VSAPYDGLYLQNGSRPLTTLADGFHQHLQTLQPTTSKWLVEQQTSITNGLNGLSFMENG
FT                   LSMNTELQESLGGLRAATPSLPFPQSVNISAHNIYPGQVPETVIPSKFDSIMLSGASSD
FT                   GLSMKPSSASSAISRKNPVSRPVRHSGPPPGFSPVPPKNVEEPFSGLNLKNENLVVDDY
FT                   SWLDGYQLPSSTQGIGFSHSINHSAQAYQNESKINSLNGTQNFPFPGKQVPTFQNLQLQ
FT                   LQKGNQQSIAPPEQHQGQSLWGGQFFVLYWCEHPVAWCNQVQPPLCSPASLVKFLLDHA
FT                   CSWSVAGACLLTACAELSRLVNGDYGRKRVGNGKCLNEKRLTWLDKFAIYCCRYIAWVV
FT                   PVLEFTWNEVLAVLT"
FT   3'UTR           3231677..3232049
FT                   /locus_tag="VIT_08s0007g05250"
FT                   /old_locus_tag="Vv08s0007g05250"
FT   gene            complement(3234259..3238608)
FT                   /locus_tag="VIT_08s0007g05240"
FT                   /old_locus_tag="Vv08s0007g05240"
FT   mRNA            complement(join(3234259..3234633,3234634..3234922,
FT                   3235512..3235584,3235677..3235807,3235965..3236158,
FT                   3236228..3236344,3236434..3236599,3237032..3237199,
FT                   3237770..3238608))
FT                   /locus_tag="VIT_08s0007g05240"
FT                   /old_locus_tag="Vv08s0007g05240"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(3234259..3234633)
FT                   /locus_tag="VIT_08s0007g05240"
FT                   /old_locus_tag="Vv08s0007g05240"
FT   CDS_pept        complement(join(3234634..3234922,3235512..3235584,
FT                   3235677..3235807,3235965..3236158,3236228..3236344,
FT                   3236434..3236599,3237032..3237199,3237770..3238608))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05240"
FT                   /old_locus_tag="Vv08s0007g05240"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKA6"
FT                   /db_xref="InterPro:IPR002498"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="InterPro:IPR017163"
FT                   /db_xref="InterPro:IPR023610"
FT                   /db_xref="InterPro:IPR027483"
FT                   /db_xref="InterPro:IPR027484"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKA6"
FT                   /protein_id="CCB55328.1"
FT                   /translation="MGKGKFSWPSGATYEGEFKSGYMDGKGTYTGNNGDTYRGQWVMNL
FT                   RHGRGIKSYVNGDLYDGEWRRGLQEGHGKYQWKNGNQYIGEWKNGVICGKGTMIWTSGN
FT                   RYDGYWEDGLPKGNGTFRWADGSFYMGNWSKDPDEQNGTYYPSGVSPEATLEWDPQQVF
FT                   NVDLSDCKICPGEKVSIMPSQKKLAVWRSSKAVDSSVRPRRMSVDGRVSPGAMNMWDDG
FT                   DCSFDSTDGDSIMGNFDESLLDAGQQNRPPRIVKRQGETISKGHKNYELMLNLQLGIRH
FT                   SVGRPAPVASLDLKASAFDPKEKVWTRFPPEGSKYTPPHQSSEFKWKDYCPLVFRTLRK
FT                   LFKVDPADYMISICGNDALRELSSPGKSGSFFYLTNDDRYMIKTMKKSEVKVLLRMLSA
FT                   YYNHVRAFENTLVTKFYGLHCVKLTGPTQKKVRFIIMGNLFCSEYTIHRRFDLKGSSLG
FT                   RTTDKAEAEIDETTILKDLDLNFIFRLQKSWFQEFRRQIDRDCEFLEQERIMDYSLLVG
FT                   LHFLEKSMAGDLIPSGARTPIGDSEPEGAPQLSRVDMDQLLVDPSWWASVKLGQNMPAR
FT                   VEKTVRRNDWEFQQTGEPTGEFFGVVMFFGVIDILQDYDISKKLEHAYKSIQYDPTSIS
FT                   AVDPKQYSKRFRDFIFKIFAEDP"
FT   gap             3238666..3238765
FT                   /estimated_length=100
FT   gene            complement(3240936..3243286)
FT                   /locus_tag="VIT_08s0007g05230"
FT                   /old_locus_tag="Vv08s0007g05230"
FT   mRNA            complement(join(3240936..3241022,3241139..3241230,
FT                   3242424..3242517,3242658..3242697,3242837..3242896,
FT                   3243213..3243286))
FT                   /locus_tag="VIT_08s0007g05230"
FT                   /old_locus_tag="Vv08s0007g05230"
FT                   /product="putative uncharacterized protein"
FT   CDS_pept        complement(join(3240936..3241022,3241139..3241230,
FT                   3242424..3242517,3242658..3242697,3242837..3242896,
FT                   3243213..3243286))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05230"
FT                   /old_locus_tag="Vv08s0007g05230"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKA7"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKA7"
FT                   /protein_id="CCB55329.1"
FT                   /translation="MSALHQIREKSQKDGQKKNEETISSLSTEMKSMIDDLKSKLEKER
FT                   QSFAKALSKSSKECENSLKIEAARFQEVYEKFSKERSAHLQAFQGKKEKTMISEHEKAC
FT                   ADKIARLEESLKKKKQDDKTFNILRKTLGSFLGNGSDEDFPPDD"
FT   gene            complement(3246435..3247343)
FT                   /locus_tag="VIT_08s0007g05220"
FT                   /old_locus_tag="Vv08s0007g05220"
FT   mRNA            complement(join(3246435..3246680,3246864..3246936,
FT                   3247027..3247141,3247237..3247267,3247268..3247343))
FT                   /locus_tag="VIT_08s0007g05220"
FT                   /old_locus_tag="Vv08s0007g05220"
FT                   /product="putative uncharacterized protein"
FT   CDS_pept        complement(join(3246435..3246680,3246864..3246936,
FT                   3247027..3247141,3247237..3247267))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05220"
FT                   /old_locus_tag="Vv08s0007g05220"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIP6"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIP6"
FT                   /protein_id="CBI30122.3"
FT                   /translation="MGASLMKLTPAGRNEEKKRLIQEYYNEHCKDIDINKPNEFYQAVC
FT                   KTVEKINREFGYTQIRIPDTDEMERLFNAHVESSGTLSPDSFREILRSLVFKAGFTNAG
FT                   ALDSFFYILIAPGTALLIKNAVNPKAISNQVLVPGVTSATVLLLALLKKI"
FT   5'UTR           complement(3247268..3247343)
FT                   /locus_tag="VIT_08s0007g05220"
FT                   /old_locus_tag="Vv08s0007g05220"
FT   gene            3258183..3262814
FT                   /locus_tag="VIT_08s0007g05210"
FT                   /old_locus_tag="Vv08s0007g05210"
FT   mRNA            join(3258183..3258291,3258292..3258476,3259377..3259663,
FT                   3259918..3260132,3260637..3260660,3260763..3260943,
FT                   3261027..3261246,3261329..3261464,3261716..3261821,
FT                   3262040..3262083,3262271..3262333,3262553..3262645,
FT                   3262646..3262814)
FT                   /locus_tag="VIT_08s0007g05210"
FT                   /old_locus_tag="Vv08s0007g05210"
FT                   /product="Amino acid transporter family protein"
FT   5'UTR           3258183..3258291
FT                   /locus_tag="VIT_08s0007g05210"
FT                   /old_locus_tag="Vv08s0007g05210"
FT   CDS_pept        join(3258292..3258476,3259377..3259663,3259918..3260132,
FT                   3260637..3260660,3260763..3260943,3261027..3261246,
FT                   3261329..3261464,3261716..3261821,3262040..3262083,
FT                   3262271..3262333,3262553..3262645)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05210"
FT                   /old_locus_tag="Vv08s0007g05210"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKA8"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKA8"
FT                   /protein_id="CCB55330.1"
FT                   /translation="MGDKEKQERDSEFLFVIEDDGGDDVVNRIESSSGDEEVAYGDEGY
FT                   TSPSVVFSSQQWPQSYRETTDSYTIAASPNFGILGSSLGLRRSSLDIFTKSNLDLDGKT
FT                   PLLTEQEKNYQKEDTDRISRTQLSLSEKASFHEQLTGELPISYGCSFTQTVFNGVNVLA
FT                   GIGLLSTPYAVKEAGWASLAVLVLFAVVCCYTASLLRYCLESKEGIITYPDIGEAAFGR
FT                   YGRLFVSFVLYTELYSYCVEFIILEGDNLTRLFPGASLNWGGFQLDSLHLFGILTALIV
FT                   LPTVWLRDLRVISCLSAGGVLATVLIVVSVIFVGITAGIGFHQTGKLVNWGGIPFSIGV
FT                   YGFCFSGHTVFPNIYQSMADKTKFSKALIVSILLCVIIYGGIAIVGFLMFGQGTMSQIT
FT                   LNIPRHVFASKIALWTTELLPVRISNSFWCFILLRTALVISSVCVAFLLPFFGLVMSLI
FT                   GSLLSVLVSVIIPTLCYLRIMGNKATKAQVIVSSGVAALGVICAILGTYSSLSQIARQY
FT                   "
FT   3'UTR           3262646..3262814
FT                   /locus_tag="VIT_08s0007g05210"
FT                   /old_locus_tag="Vv08s0007g05210"
FT   gene            3266832..3271581
FT                   /locus_tag="VIT_08s0007g05200"
FT                   /old_locus_tag="Vv08s0007g05200"
FT   mRNA            join(3266832..3266839,3266840..3266910,3268882..3268996,
FT                   3269396..3269479,3271108..3271386,3271387..3271581)
FT                   /locus_tag="VIT_08s0007g05200"
FT                   /old_locus_tag="Vv08s0007g05200"
FT                   /product="unknown predicted protein"
FT   5'UTR           3266832..3266839
FT                   /locus_tag="VIT_08s0007g05200"
FT                   /old_locus_tag="Vv08s0007g05200"
FT   CDS_pept        join(3266840..3266910,3268882..3268996,3269396..3269479,
FT                   3271108..3271386)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05200"
FT                   /old_locus_tag="Vv08s0007g05200"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5BLJ8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A5BLJ8"
FT                   /protein_id="CBI30125.3"
FT                   /translation="MSELVARTGRHQQRYEDGCRLVAGCIPFKYRNSVESNGAASQKIV
FT                   EVLMINSTSGPGLLFPKGGWENDETVEEAALREALEEAGVRGDLKHFLGCYLFKSKTLQ
FT                   DESCPEGLCKAAMFALLVKEELPSWPEQSTRERSWLTIPEAIERCRHPWMRKALEEGFS
FT                   KWHDDHLKINGKEEDIHIS"
FT   3'UTR           3271387..3271581
FT                   /locus_tag="VIT_08s0007g05200"
FT                   /old_locus_tag="Vv08s0007g05200"
FT   gene            3272043..3276067
FT                   /locus_tag="VIT_08s0007g05190"
FT                   /old_locus_tag="Vv08s0007g05190"
FT   mRNA            join(3272043..3272075,3274650..3274726,3276019..3276067)
FT                   /locus_tag="VIT_08s0007g05190"
FT                   /old_locus_tag="Vv08s0007g05190"
FT   CDS_pept        join(3272043..3272075,3274650..3274726,3276019..3276067)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05190"
FT                   /old_locus_tag="Vv08s0007g05190"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIQ0"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIQ0"
FT                   /protein_id="CBI30126.3"
FT                   /translation="MKFKTLYGYACQTYPQFEAASPKNSIISHNKMFVLLNMFNLTYIF
FT                   LNYVISD"
FT   gene            complement(3277711..3278416)
FT                   /locus_tag="VIT_08s0007g05180"
FT                   /old_locus_tag="Vv08s0007g05180"
FT   mRNA            complement(join(3277711..3277839,3277840..3278271,
FT                   3278272..3278416))
FT                   /locus_tag="VIT_08s0007g05180"
FT                   /old_locus_tag="Vv08s0007g05180"
FT                   /product="Predicted protein"
FT   3'UTR           complement(3277711..3277839)
FT                   /locus_tag="VIT_08s0007g05180"
FT                   /old_locus_tag="Vv08s0007g05180"
FT   CDS_pept        complement(3277840..3278271)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05180"
FT                   /old_locus_tag="Vv08s0007g05180"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKA9"
FT                   /db_xref="InterPro:IPR008889"
FT                   /db_xref="InterPro:IPR039335"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKA9"
FT                   /protein_id="CCB55331.1"
FT                   /translation="MDKALSVDQRKASGKAKAKKTTTKPFKVVYIGNPRMVKVKESEFR
FT                   ALVQELTGQDADISDPTVFEEIHDVGGNQKVPDVANNENELELDVPPVDRGDEPPQMSD
FT                   IPMEQLDDVFTPQLLENFTGLLQSTLWYESPHVNVLRSL"
FT   5'UTR           complement(3278272..3278416)
FT                   /locus_tag="VIT_08s0007g05180"
FT                   /old_locus_tag="Vv08s0007g05180"
FT   gene            3287177..3297786
FT                   /locus_tag="VIT_08s0007g05170"
FT                   /old_locus_tag="Vv08s0007g05170"
FT   mRNA            join(3287177..3287535,3287536..3287633,3289467..3289567,
FT                   3290352..3290425,3290516..3290662,3290918..3290995,
FT                   3291081..3291140,3291338..3291415,3291549..3291600,
FT                   3294013..3294284,3296581..3296829,3297322..3297468,
FT                   3297469..3297786)
FT                   /locus_tag="VIT_08s0007g05170"
FT                   /old_locus_tag="Vv08s0007g05170"
FT                   /product="Predicted protein"
FT   5'UTR           3287177..3287535
FT                   /locus_tag="VIT_08s0007g05170"
FT                   /old_locus_tag="Vv08s0007g05170"
FT   CDS_pept        join(3287536..3287633,3289467..3289567,3290352..3290425,
FT                   3290516..3290662,3290918..3290995,3291081..3291140,
FT                   3291338..3291415,3291549..3291600,3294013..3294284,
FT                   3296581..3296829,3297322..3297468)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05170"
FT                   /old_locus_tag="Vv08s0007g05170"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIQ1"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR025422"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIQ1"
FT                   /protein_id="CBI30127.3"
FT                   /translation="MGSRTVKVGAEDVSKVTPGMPSFIPQIPISNSIGTEGNNIRSRIS
FT                   DFGALEQSLGFRIEDAVDLSRNSVFNSAKPSSQAPSTDLQFGALNKTSTVQKELQQNIA
FT                   SVSGSHRENWGESNMADASPRTDTSTDVDTDEKNQRFEMGQSAALVASDSSDRSKEKAG
FT                   DQKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTQLEQELQRARQQGIFISSSGDQ
FT                   SHSMSGNGALAFDVEYARWLEEHNRQINELRSAVNSHASDTELRTIVDNVTAHFDDIFR
FT                   LKGIAAKADVFHILSGMWKTPAERCFMWIGGFRSSEVLKLLVNQLEPLTEQQLMSIYNL
FT                   QQSSQQAEDALSQGMEALQQSLAETLTSGSPGPSGSSGNVANYMGQMAMAMGKLGTLEG
FT                   FLRQADNLRQQTLQQMHRILTTRQSARALLAINDYFSRLRALSSLWLARPRE"
FT   3'UTR           3297469..3297786
FT                   /locus_tag="VIT_08s0007g05170"
FT                   /old_locus_tag="Vv08s0007g05170"
FT   gene            complement(3297787..3302589)
FT                   /locus_tag="VIT_08s0007g05160"
FT                   /old_locus_tag="Vv08s0007g05160"
FT   mRNA            complement(join(3297787..3298005,3298006..3298641,
FT                   3298741..3299696,3302523..3302589))
FT                   /locus_tag="VIT_08s0007g05160"
FT                   /old_locus_tag="Vv08s0007g05160"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(3297787..3298005)
FT                   /locus_tag="VIT_08s0007g05160"
FT                   /old_locus_tag="Vv08s0007g05160"
FT   CDS_pept        complement(join(3298006..3298641,3298741..3299696,
FT                   3302523..3302589))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05160"
FT                   /old_locus_tag="Vv08s0007g05160"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIQ2"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIQ2"
FT                   /protein_id="CBI30128.3"
FT                   /translation="MIRFISLFLNQFPEHFHLISSYGAFTWSPEQYLTLSNRGMAVDTM
FT                   VQIDELLFTALVFLVTNFFVKRITSMSRSSRRLPPGPRGWPVVGCLPLLGAMPHVALAQ
FT                   LAQKYGAIMYLKLGTCDVVVASKPDSARAFLKTLDLNFSNRPPNAGATHIAYEAQDFVF
FT                   ADIGPRWNLLRKLTSLHMLGAKSFKDWGAIRGAEIGHMIQAMCELSRRGEPVVVPEMVS
FT                   CALANIIGQKSLSRRVFETQGSESNDFKEMVVELMRLAGLFNVGDFIPSIAWMDLQGTE
FT                   GKMKLLHNKFDALLTRMIEEHSATAHERLGNPDILDVVMAEQEYSGGVKLSMVNIKALL
FT                   LNLFIAGTDTSSGTIEWALAEILKNPTMLKRAHAEMDRVIGKNRLLQESDVPKLPYLEA
FT                   ICKETFRKHPSVPLNIPRVSANACEVDGYYIPEDTRLFVNVWAIGRDPEVWENPLEFKP
FT                   ERFLSEKNARISPWGNDFELLPFGAGRRMCAGIRMGIEVVTYALGTLVHSFDWKLPKGD
FT                   ELNMDEAFGLVLQKAVPLSAMVTPRLHPSAYKAQV"
FT   gene            3304532..3304820
FT                   /locus_tag="VIT_08s0007g05150"
FT                   /old_locus_tag="Vv08s0007g05150"
FT   mRNA            join(3304532..3304577,3304578..3304820)
FT                   /locus_tag="VIT_08s0007g05150"
FT                   /old_locus_tag="Vv08s0007g05150"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           3304532..3304577
FT                   /locus_tag="VIT_08s0007g05150"
FT                   /old_locus_tag="Vv08s0007g05150"
FT   CDS_pept        3304578..3304820
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05150"
FT                   /old_locus_tag="Vv08s0007g05150"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKB0"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKB0"
FT                   /protein_id="CCB55332.1"
FT                   /translation="MVVGINTVFMQTHIGEVSRPYICSERMAHGVLLVGHGSTGHDPIR
FT                   MKGRPYWIVKNSWDEKWGENGPYKSYRRPLLCMAT"
FT   gene            3311628..3318749
FT                   /locus_tag="VIT_08s0007g05140"
FT                   /old_locus_tag="Vv08s0007g05140"
FT   mRNA            join(3311628..3311761,3311762..3311969,3313752..3313837,
FT                   3315193..3315258,3315375..3315545,3315787..3315957,
FT                   3316075..3316230,3316337..3316483,3317351..3317422,
FT                   3317511..3318050,3318152..3318327,3318477..3318495,
FT                   3318496..3318749)
FT                   /locus_tag="VIT_08s0007g05140"
FT                   /old_locus_tag="Vv08s0007g05140"
FT                   /product="Predicted protein"
FT   5'UTR           3311628..3311761
FT                   /locus_tag="VIT_08s0007g05140"
FT                   /old_locus_tag="Vv08s0007g05140"
FT   CDS_pept        join(3311762..3311969,3313752..3313837,3315193..3315258,
FT                   3315375..3315545,3315787..3315957,3316075..3316230,
FT                   3316337..3316483,3317351..3317422,3317511..3318050,
FT                   3318152..3318327,3318477..3318495)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05140"
FT                   /old_locus_tag="Vv08s0007g05140"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIQ4"
FT                   /db_xref="InterPro:IPR009768"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIQ4"
FT                   /protein_id="CBI30130.3"
FT                   /translation="MANIHISNGEAGPSSDSLKPMVLTSSASFKARKKPTISRAGSEVE
FT                   DVINLLHGSDPVRVELNRLENEVRDKDRELGDAHAEIKALKYSERLKEKAVEELTDELQ
FT                   KVDGKLKATEALLESKNLEIKKINDERKAALAAQFAAEATLRRVHAAQKDDEMPPIEAI
FT                   IAPLEAELKLARLEAAKLQDDNRALDRLTKSKETALLEAERTVEIALAKASLVDDLQNK
FT                   NQELMKQIEICQEENKILDKMHRQKVAEVKKLTQTVCELEEAVLAGGAAANAVRDYRRK
FT                   VQEMNDERKILDRELSRAKVTANRVAVVVANEWKDANDKVMPVKQWLEERKFFQGEMQL
FT                   LRDKLAVAERTAKAEAQLKEKYQLRFKVLEERLRASPSGNLRTTSEGRSISNGPSRRQS
FT                   LGGAENLSRSASNGFALRRTANSQSGSIRSNSASVLLRNAKISSRSFDGGSRSLDRDKV
FT                   IPNAARKHEVLTDTNDQIQNAKTIGTHEASTNGNRSEKTKSELDDSVSGVLYDMLQKEV
FT                   ITLRRACHEKDQSLKDKDDAIEMLAKKVDTLNKAMGVEAKKMRREVAAMEKEVAAMRVS
FT                   KEHDPRARRPSAPRGSQLLSARNARNS"
FT   3'UTR           3318496..3318749
FT                   /locus_tag="VIT_08s0007g05140"
FT                   /old_locus_tag="Vv08s0007g05140"
FT   gene            3322101..3323554
FT                   /locus_tag="VIT_08s0007g05130"
FT                   /old_locus_tag="Vv08s0007g05130"
FT   mRNA            join(3322101..3322569,3322662..3323554)
FT                   /locus_tag="VIT_08s0007g05130"
FT                   /old_locus_tag="Vv08s0007g05130"
FT                   /product="Predicted protein"
FT   CDS_pept        join(3322101..3322569,3322662..3323554)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05130"
FT                   /old_locus_tag="Vv08s0007g05130"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKB1"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKB1"
FT                   /protein_id="CCB55333.1"
FT                   /translation="MEKRRQGIRDHLVLVPCPFQGHMKPMLHLANLLHSKGFSITIIHS
FT                   QSNSPNPSHYPHFFFRCLGDSSHIQSASDGDFVPFISALNQHSPTIFRDLLLRMHFQDP
FT                   ILSIIHDSVMYFPVTVADELDIPRIVLRTSSAAAGFAFALSIPKQQRSLPFQENELEEA
FT                   LVEFPSIRGKDLPVINTFHKEARDEFLARVHHGTRTASAIVWNTFRGLEQTTLEKMELL
FT                   FSVPNFPIGPLHKHSGASLTSFVTEDHGCIAWLDQQAPSSVIYVSIGSLITTSESELVE
FT                   MAWGLANSGQPFLWVVRPGLVNGSSNAAQLLPKEFKETTNKRGRVISWAPQEAVLAHRS
FT                   VGGFWTHSGWNSTVESISEGVPMLCSPIVGDQRVNARFVSHVWRIGIQLEDGVERGKIE
FT                   KAIKRLMVDEEGTEMKKRAMDLKDKVASSLRQGGSSSEFLHSLVDFIKGKLCNP"
FT   gene            3328393..3359305
FT                   /locus_tag="VIT_08s0007g05120"
FT                   /old_locus_tag="Vv08s0007g05120"
FT   mRNA            join(3328393..3328516,3328517..3328587,3329022..3329166,
FT                   3330395..3330475,3330581..3330694,3331640..3331696,
FT                   3336062..3336163,3336660..3336810,3336940..3337016,
FT                   3337523..3337633,3337738..3337808,3338151..3338292,
FT                   3353598..3353696,3353840..3353968,3354109..3354223,
FT                   3355369..3355436,3356383..3356496,3356590..3356706,
FT                   3356832..3356885,3356983..3357088,3357989..3358119,
FT                   3358965..3359033,3359034..3359305)
FT                   /locus_tag="VIT_08s0007g05120"
FT                   /old_locus_tag="Vv08s0007g05120"
FT                   /product="unknown predicted protein"
FT   5'UTR           3328393..3328516
FT                   /locus_tag="VIT_08s0007g05120"
FT                   /old_locus_tag="Vv08s0007g05120"
FT   CDS_pept        join(3328517..3328587,3329022..3329166,3330395..3330475,
FT                   3330581..3330694,3331640..3331696,3336062..3336163,
FT                   3336660..3336810,3336940..3337016,3337523..3337633,
FT                   3337738..3337808,3338151..3338292,3353598..3353696,
FT                   3353840..3353968,3354109..3354223,3355369..3355436,
FT                   3356383..3356496,3356590..3356706,3356832..3356885,
FT                   3356983..3357088,3357989..3358119,3358965..3359033)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05120"
FT                   /old_locus_tag="Vv08s0007g05120"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIQ6"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIQ6"
FT                   /protein_id="CBI30132.3"
FT                   /translation="MASRFYAHSSMHSLTSSVLFFKPRVGFQLRRVSNHFLIRNAASPR
FT                   AFMSSSIATDAFQESTSSKAYGSEQIQVLEGLDPVRKRPGMYIGSTGLRGLHHLVYEIL
FT                   DNAIDEAQAGFASKVDVVLLADDSVSITDNGRGIPTELHPVTKKSSLETVLTVLHAGGK
FT                   FGGASSGYSVSGGLHGVGLSVVNALSEALEVTVWRDGMEYQQKYSRGKPVTSLTHRVLP
FT                   TESTDLQGTHIRFWPDKEVFTTEIQFDYNTIAGRIRELAFLNPELAITLRKEDKDPEKN
FT                   QYNEYCYAGGLVEYVRWLNTDKKPVHDVVGFRKVADGISIDVALQWCSDAYSDTMLGYA
FT                   NSIRTIDGGTHIDGMKASLTRTLNNLGKKSKIIKEKDITLSGEHVREGLTCVISVKVPN
FT                   PEFEGQTKTRLGNPEVRKVVDQTVQEFLTEYLELHPDVLDLILSKSLNALKAALAAKRA
FT                   RELVRQKSVLKSSSLPGKLADCSSTNPEESEIFIVEGDSAGGSAKQGRDRRFQAILPLR
FT                   GKILNIERKDEAAMYKSEEIQNLILGLGLGVKGEDFKKEALRYHKIIILTDADVDGAHI
FT                   RTLLLTFFFRYQRALFDEGCIYVGVPPLFKVERGKQVHYCYDDAELKQLQHSLPPNASY
FT                   SIQRFKGLGEMMPVQLWETTMDPERRLLKQLVVEDAAEANVVFSSLMGARVDFRKELIQ
FT                   KSASTMKLDQLDI"
FT   gap             3341207..3351874
FT                   /estimated_length=10668
FT   3'UTR           3359034..3359305
FT                   /locus_tag="VIT_08s0007g05120"
FT                   /old_locus_tag="Vv08s0007g05120"
FT   gene            3360218..3360961
FT                   /locus_tag="VIT_08s0007g05110"
FT                   /old_locus_tag="Vv08s0007g05110"
FT   mRNA            join(3360218..3360249,3360341..3360394,3360395..3360407,
FT                   3360651..3360961)
FT                   /locus_tag="VIT_08s0007g05110"
FT                   /old_locus_tag="Vv08s0007g05110"
FT   5'UTR           3360218..3360249
FT                   /locus_tag="VIT_08s0007g05110"
FT                   /old_locus_tag="Vv08s0007g05110"
FT   CDS_pept        join(3360395..3360407,3360651..3360961)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05110"
FT                   /old_locus_tag="Vv08s0007g05110"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIQ7"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIQ7"
FT                   /protein_id="CBI30133.3"
FT                   /translation="MPEIEESSKRPNGETGKNKESALLHMVWAVKDSRGIENYCGQVSV
FT                   QNVARKWFLNYSHLFNSSVIYVSIPSTWFYYLFIIIIISVLSFNHLLAQVLITIIATSF
FT                   STV"
FT   gene            complement(3361152..3366175)
FT                   /locus_tag="VIT_08s0007g05100"
FT                   /old_locus_tag="Vv08s0007g05100"
FT   mRNA            complement(join(3361152..3361152,3361153..3361488,
FT                   3361589..3361705,3362300..3362700,3363385..3363637,
FT                   3363840..3363995,3364230..3364445,3364951..3365083,
FT                   3365172..3366175))
FT                   /locus_tag="VIT_08s0007g05100"
FT                   /old_locus_tag="Vv08s0007g05100"
FT                   /product="Predicted protein"
FT   3'UTR           3361152..3361152
FT   CDS_pept        complement(join(3361153..3361488,3361589..3361705,
FT                   3362300..3362700,3363385..3363637,3363840..3363995,
FT                   3364230..3364445,3364951..3365083,3365172..3366175))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05100"
FT                   /old_locus_tag="Vv08s0007g05100"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKB2"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKB2"
FT                   /protein_id="CCB55334.1"
FT                   /translation="MAALKISKKHHKHLNNPFPSTPSSLPLLRGSLFFNPQTVPSDQTF
FT                   IVGKDFQVLWSTDNGGSLSISHQSHPSRPIWSTVPGQAFVSAALAETEVEESRGSFAIK
FT                   DGNVHLLCNDQTVEDIRLINENDCYLEANELDFLSGNQGLDQKPYLKDTQFPILLLTGW
FT                   VFRKKKKSFQNTEIHERLQLEAERSTYARYWVLFDQKTSNQIGFQVKFGKPNFEFRSRA
FT                   FATASRRFRGLKRKLRRTGRSRLGWCWSFSRPRGFVKVSSSEEEKEEKVAESIGFNRVC
FT                   LTYSSEENERFYGFGEQFSHLNFKGKRIPIFVQEQGIGRGDQPITFAVNLVSYRAAGDS
FT                   STTYAPSPHYLTSKMRSLYLEGYDYSVFDLTRKDRVQIQIHGDSVQGRILHGNSPSELI
FT                   ERFTETIGRLPELPEWIISGAVVGMQGGTDSVRQVWEKLQAHNTPVSAFWLQDWVGHRE
FT                   TLIGSQLWWNWEVDTARYWGWQNLIKDLSAQHIKVMTYCNPCLAPTNEKPNRRRDLFEE
FT                   AKKLDILVKDKNGDTYMVPNTAFDVGMLDLTHPDTASWFKQILQEMVDGGVRGWMADFG
FT                   EGLPVDASLYSGEDPIAAHNRYPELWAQMNREFVEEWKSAHSGKAREDPEEALVFFMRA
FT                   GFRNSPKWGMLFWEGDQMVSWQANDGIKSAVVGLLSSGISGYAFNHSDIGGYCAVNLPV
FT                   IKYRRSEELLLRWMEVNAFTVVFRTHEGNKPSCNSQFYSNHKTLAHFARFAKVYKAWKF
FT                   YRVQLVKEAAQKGLPVCRHLFLHYPNDEHVHKLSYQQFLVGTEILVVPVLDRGKKDVKA
FT                   YFPVGESCSWQHIWTGKLFAKPGSEVWVEAPIGHPAIFVKEGSIIGETFLKNLREFNIL
FT                   "
FT   gene            complement(3367919..3375423)
FT                   /locus_tag="VIT_08s0007g05090"
FT                   /old_locus_tag="Vv08s0007g05090"
FT   mRNA            complement(join(3367919..3368116,3368117..3369364,
FT                   3372063..3372654,3375389..3375423))
FT                   /locus_tag="VIT_08s0007g05090"
FT                   /old_locus_tag="Vv08s0007g05090"
FT                   /product="Predicted protein"
FT   3'UTR           complement(3367919..3368116)
FT                   /locus_tag="VIT_08s0007g05090"
FT                   /old_locus_tag="Vv08s0007g05090"
FT   CDS_pept        complement(join(3368117..3369364,3372063..3372654,
FT                   3375389..3375423))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05090"
FT                   /old_locus_tag="Vv08s0007g05090"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIQ9"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR033443"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIQ9"
FT                   /protein_id="CBI30135.3"
FT                   /translation="MWALRRSSNRLKNQGFSIGTLQACHAKSEMLSTYYKDMTGICKSP
FT                   QVINDCHLSSRKFYHPTDIYSVFSMGSCSFSSQAGAKSSGEEDDLEDGFSELEASGNAG
FT                   GFQDSDAESEHEDELLSDPKSDDDEIESTQNELEPLDTDTDVSEKRSPRKRVSSELFKA
FT                   IMAASDQPIHSVLNKWDQEGKDMSRAEIAQTMLNLRKIRMFLKALQFSEWMEEHKKLDM
FT                   VERDYASRVDLIAKVRGLQKAEHYIEKIPKSFRGELVYRTLLANCVSTTNAKKAEEVFN
FT                   KMKDLGFPITTFACNQLLLLYKRVDKKKIADVLLLMEKEDVKPSLFTYGLLIDTKGQSN
FT                   DITGMEQIVETMKAEGIEPNLQVQSILVRHYVFGGLKEKAEAILKEMEGGNLKENRWVC
FT                   RVLLPPYAALGKADDVERIWKVCESNPRLPEFVAAIEAYGKLKKVEEAEAIFNKMSKTF
FT                   KRLSSKHYSALLKVYADHKMLIKGKDLVKQMSDSGCRIGPLTWDALVKLYVEAGEVEKA
FT                   DKILQKAMQQSPIKPMFSTYMAIMDQYAKRGDIHNSEKMFHQMRQSGYVSRLRQFQCLI
FT                   QAYVNAKAPAYGIKERMKADNIFPNRVVAGQLAQVDAFRKSAVSDLLD"
FT   gene            3378290..3383927
FT                   /locus_tag="VIT_08s0007g05080"
FT                   /old_locus_tag="Vv08s0007g05080"
FT   mRNA            join(3378290..3378399,3379260..3379271,3379272..3379404,
FT                   3381052..3381978,3382100..3382267,3382808..3382899,
FT                   3383385..3383453,3383626..3383769,3383770..3383927)
FT                   /locus_tag="VIT_08s0007g05080"
FT                   /old_locus_tag="Vv08s0007g05080"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           3378290..3378399
FT                   /locus_tag="VIT_08s0007g05080"
FT                   /old_locus_tag="Vv08s0007g05080"
FT   CDS_pept        join(3379272..3379404,3381052..3381978,3382100..3382267,
FT                   3382808..3382899,3383385..3383453,3383626..3383769)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05080"
FT                   /old_locus_tag="Vv08s0007g05080"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR028124"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIR0"
FT                   /protein_id="CBI30136.3"
FT                   /translation="MDSSLKSPPRDKADAKTAFRKPTNDATNRKYRRRSPTSGSSSSGG
FT                   SPIHEHNSSPIFSKEDSEKVSDRRQRRKGDGRELDRDAGRSQYRKTADSYRHSDRQSSR
FT                   SSRGHYRYDDHVRQEKHAADEGDRDHHNLSSRSGRESRVGNYSDHVRQESEHSRTRDYF
FT                   RGTDKYSRDKHDNAGYRSKDKEKETSSLEHQKYKDKDLSSDRAGSGRRHTNSNFEDSKA
FT                   GEQDKHLRDGDGPDERKDYRRGLGDYKSDRSISHEESRGHRNDSTSGRDSGGYRSKEVH
FT                   KNEPKEVDGQKQPKDEKKKYDEWKTDRHKDRYNRESREQFEDKTVVASENQESAAKKPK
FT                   LVSLEKSTDYGKDVSRFSTAVADMKQSSSSKLAQDIADKVTPEHAFLNNSEVANDLNAA
FT                   KIAAMKAAELVNRNLVGVGYMSADQKKKLLWGSKKSTTAEESGHHWDTALFSDRERQEK
FT                   FNKLMGVKGEVKVEHKPDNQDAEKQRELQIDLEKQYTAGLRRRDGRTVGLGL"
FT   3'UTR           3383770..3383927
FT                   /locus_tag="VIT_08s0007g05080"
FT                   /old_locus_tag="Vv08s0007g05080"
FT   gene            3388928..3391263
FT                   /locus_tag="VIT_08s0007g05070"
FT                   /old_locus_tag="Vv08s0007g05070"
FT   mRNA            join(3388928..3388971,3388972..3389082,3389241..3389326,
FT                   3389532..3389594,3390953..3391055,3391056..3391263)
FT                   /locus_tag="VIT_08s0007g05070"
FT                   /old_locus_tag="Vv08s0007g05070"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           3388928..3388971
FT                   /locus_tag="VIT_08s0007g05070"
FT                   /old_locus_tag="Vv08s0007g05070"
FT   CDS_pept        join(3388972..3389082,3389241..3389326,3389532..3389594,
FT                   3390953..3391055)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05070"
FT                   /old_locus_tag="Vv08s0007g05070"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIR1"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIR1"
FT                   /protein_id="CBI30137.3"
FT                   /translation="MGGKCPSRKVKKRRYSHKTARRDKFLLKDILLSTFSILNKPEGEK
FT                   KPLPVDEDLPGMGQYYCLHCDRYFANVAVRDEHFKTKRHKKRLKQMMGPAPHTQLDADL
FT                   AAGMGLPDNGPKLMSI"
FT   3'UTR           3391056..3391263
FT                   /locus_tag="VIT_08s0007g05070"
FT                   /old_locus_tag="Vv08s0007g05070"
FT   gene            complement(3393691..3400427)
FT                   /locus_tag="VIT_08s0007g05060"
FT                   /old_locus_tag="Vv08s0007g05060"
FT   mRNA            complement(join(3393691..3393900,3393901..3395187,
FT                   3395587..3396301,3396406..3396779,3397851..3398074,
FT                   3398281..3398597,3398699..3398958,3399088..3399288,
FT                   3399392..3399567,3399659..3399713,3399793..3400248,
FT                   3400249..3400427))
FT                   /locus_tag="VIT_08s0007g05060"
FT                   /old_locus_tag="Vv08s0007g05060"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(3393691..3393900)
FT                   /locus_tag="VIT_08s0007g05060"
FT                   /old_locus_tag="Vv08s0007g05060"
FT   CDS_pept        complement(join(3393901..3395187,3395587..3396301,
FT                   3396406..3396779,3397851..3398074,3398281..3398597,
FT                   3398699..3398958,3399088..3399288,3399392..3399567,
FT                   3399659..3399713,3399793..3400248))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05060"
FT                   /old_locus_tag="Vv08s0007g05060"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKB3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKB3"
FT                   /protein_id="CCB55335.1"
FT                   /translation="MSQEAVEIKTTIEQWRWSEMQGLELVSPNTDDFKSHPTASRVSKS
FT                   SAEGGEARDMDGTEPKNQPQPQPQPQAQAQAHASGSGEKTELVPSSGFGELFRFADGLD
FT                   YVLMTIGSIGAIVHGSSLPIFLRFFADLVNSFGSNANNIDKMMQEVLKYAFYFLVVGAA
FT                   IWASSWAEISCWMWTGERQSTKMRIKYLEAALNQDIQFFDTEVRTSDVVFAVNTDAVMV
FT                   QDAISEKLGNFIHYMATFVSGFVVGFTAVWQLALVTLAVVPLIAVIGGIHTATLAKLSA
FT                   KSQEALSEAGNIAEQTIVQIRVVFAFVGESRALQAYSAALRISQRLGYKSGFSKGMGLG
FT                   ATYFTVFCCYALLLWYGGYLVRHHYTNGGLAIATMFSVMLGGLALGQSAPSMSAFAKAK
FT                   VAAAKIFRIIDHKPNIERNGETGLELESVTGQVELKNVDFSYPSRPEVRILSDFSLNVP
FT                   AGKTIALVGSSGSGKSTVVSLIERFYDPTSGQVLLDGHDIKTLKLRWLRQQIGLVSQEP
FT                   ALFATTIKENMLLGRPDATLVEIEEAARVANAYSFIVKLPEGFDTQVGERGFQLSGGQK
FT                   QRIAIARAMLKNPAILLLDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKA
FT                   DLVAVLQQGSVSEIGTHDELIAKGENGVYAKLIRMQETAHETALSNARKSSARPSSARN
FT                   SVSSPIIARNSSYGRSPYSRRLSDFSTSDFSLSLDASHPNYRLEKLAFKEQASSFWRLA
FT                   KMNSPEWVYALFGTIGSVVCGSISAFFAYVLSAVLSVYYNQNHAYMSKQIGKYCYLLIG
FT                   VSSAALLFNTLQHFFWDVVGENLTKRVREKMLAAVLKNEMAWFDQEENESARIAARLAL
FT                   DANNVRSAIGDRISVIMQNSALMLVACTAGFVLQWRLALVLIAVFPVVVAATVLQKMFM
FT                   QGFSGDLEGAHAKATQLAGEAIANVRTVAAFNSEAKIVGLFSTNLQTPLRRCFWKGQIA
FT                   GSGYGIAQFLLYASYALGLWYASWLVKHGISDFSKTIRVFMVLMVSANGAAETLTLAPD
FT                   FIKGGRAMRSVFDLLDRKTEIEPDDPDAIPVTDRLRGEVELKHVDFSYPSRPDVPVFRD
FT                   LCLRARAGKTLALVGPSGCGKSSVIALVQRFYEPTSGRVMIDGKDIRKYNLKSLRRHIA
FT                   IVPQEPCLFATTIYENIAYGHESATEAEIIEAATLANAHKFVSALPDGYKTFVGERGVQ
FT                   LSGGQKQRIAIARAFLRKAELMLLDEATSALDAESERCIQEALERACSGKTTIVVAHRL
FT                   STIRNAHTIAVIDDGKVAEQGSHSHLLKNYPDGCYARMIQLQRFTHGQAVGMASGSSSS
FT                   TRPRDEEEREG"
FT   5'UTR           complement(3400249..3400427)
FT                   /locus_tag="VIT_08s0007g05060"
FT                   /old_locus_tag="Vv08s0007g05060"
FT   gene            complement(3412019..3423823)
FT                   /locus_tag="VIT_08s0007g05050"
FT                   /old_locus_tag="Vv08s0007g05050"
FT   mRNA            complement(join(3412019..3412132,3412826..3412928,
FT                   3413047..3413114,3413913..3414058,3414791..3414962,
FT                   3417730..3418338,3423443..3423823))
FT                   /locus_tag="VIT_08s0007g05050"
FT                   /old_locus_tag="Vv08s0007g05050"
FT                   /product="unknown predicted protein"
FT   CDS_pept        complement(join(3412019..3412132,3412826..3412928,
FT                   3413047..3413114,3413913..3414058,3414791..3414962,
FT                   3417730..3418338,3423443..3423823))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05050"
FT                   /old_locus_tag="Vv08s0007g05050"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKB4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKB4"
FT                   /protein_id="CCB55336.1"
FT                   /translation="MATSIVYRSPRPHVDIPNDPSISMLSFLFRKTSSFSTRLALVDSD
FT                   SGETLTFFQLKSTVSRLAHSFAQLGITKNDVVLIFAPNSVRFPVCFLAIVALGAIATTA
FT                   NPLYTISELSKQVKDSNPKFVINLWDKVKNFDLTFVILSSSASQRLPSSNSRVWYYSDL
FT                   IKTPEDRDLDFPPASVVQTDTVALLYSSGTTGTSKGVILTHRNFIAAGVMVTADQAYYG
FT                   ESSNVFLCFLPMFHIFGLSVILYAQLVRGNTVVTVAKFEIEKVLRSVEKYRVTHMFVVH
FT                   PVMIALAKQSVVRKYDLSSLRQICSGAAPLGKDVMDDCAKNVPQAAVIQLHHDSKCTMW
FT                   YSSSRHSGSTGILVPRVESQIVSEDTLKPLPPNQLGEIWVQGANMMQGYFNNPQATKLT
FT                   IDEQGWVRTGDLGYFDEGGQLFVVDRIKELIKFKGFQVAPAELEGLLLSHPEILDSVVI
FT                   PLPDVEAGEVPIAYVVRSPRSSLTEEDVQKFIAKQVAPFKRLRRVTFINNVPKSASGKI
FT                   LRRELIEKVRSKI"
FT   gap             3419964..3420776
FT                   /estimated_length=813
FT   gap             3422274..3422373
FT                   /estimated_length=100
FT   gene            3428537..3434643
FT                   /locus_tag="VIT_08s0007g05040"
FT                   /old_locus_tag="Vv08s0007g05040"
FT   mRNA            join(3428537..3428600,3428601..3428808,3433282..3433382,
FT                   3433931..3434047,3434132..3434233,3434406..3434576,
FT                   3434577..3434643)
FT                   /locus_tag="VIT_08s0007g05040"
FT                   /old_locus_tag="Vv08s0007g05040"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           3428537..3428600
FT                   /locus_tag="VIT_08s0007g05040"
FT                   /old_locus_tag="Vv08s0007g05040"
FT   CDS_pept        join(3428601..3428808,3433282..3433382,3433931..3434047,
FT                   3434132..3434233,3434406..3434576)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05040"
FT                   /old_locus_tag="Vv08s0007g05040"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIR4"
FT                   /protein_id="CBI30140.3"
FT                   /translation="MAETAALCLSPFSSFSSISRSRDASSPLSSHSFSKFSITRHPPPS
FT                   RYPRFSAKASADDPFGFFPWDNENDIQWVPEERVTLFTADGLIQIGGSLVPRHVPSSDK
FT                   KHRRSRTQKFQRFQESDYLDPKQKGLCLGALFDIAATNGLDMGRRLCIFGFCRSIEMLS
FT                   DVVEDTVLEHGGEVVAAEKASKGGLHEKLTMTVAVPLLWGVPPASETLHLAVRSGGGIV
FT                   EKIYWQWDFL"
FT   3'UTR           3434577..3434643
FT                   /locus_tag="VIT_08s0007g05040"
FT                   /old_locus_tag="Vv08s0007g05040"
FT   gene            complement(3439012..3440865)
FT                   /locus_tag="VIT_08s0007g05030"
FT                   /old_locus_tag="Vv08s0007g05030"
FT   mRNA            complement(join(3439012..3439273,3439274..3440036,
FT                   3440389..3440518,3440643..3440778,3440779..3440865))
FT                   /locus_tag="VIT_08s0007g05030"
FT                   /old_locus_tag="Vv08s0007g05030"
FT                   /product="Predicted protein"
FT   3'UTR           complement(3439012..3439273)
FT                   /locus_tag="VIT_08s0007g05030"
FT                   /old_locus_tag="Vv08s0007g05030"
FT   CDS_pept        complement(join(3439274..3440036,3440389..3440518,
FT                   3440643..3440778))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05030"
FT                   /old_locus_tag="Vv08s0007g05030"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIR5"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIR5"
FT                   /protein_id="CBI30141.3"
FT                   /translation="MGRAPCCDKANVKKGPWSPEEDSKLKEYIEKYGTGGNWIALPQKA
FT                   GLKRCGKSCRLRWLNYLRPNIKHGEFSDDEDRIICSVFASIGSKWSVIANYLPGRTDND
FT                   IKNYWNTKLKKKLMGMVPVSQRKPHQATFSHHLQTYSSLSSPSHAVTTTATSSSYESNS
FT                   SNPYYTPAAPTPTSFARLEPISSIPSSLLNINTGSTAAAAIHPQEGFASPVHHYQVKDN
FT                   LLIEASSSSDDGSGSNQISQGKEPEYDQYGAVGGRYEQLGFQNYVYTGLDDQNQRFMIS
FT                   NSSGGGGGSGSHGWTDQRPNGMLGEPPLDLGLEEFKQLISANLCNNFSFDENKTEERVV
FT                   YY"
FT   5'UTR           complement(3440779..3440865)
FT                   /locus_tag="VIT_08s0007g05030"
FT                   /old_locus_tag="Vv08s0007g05030"
FT   gene            3445486..3459738
FT                   /locus_tag="VIT_08s0007g05020"
FT                   /old_locus_tag="Vv08s0007g05020"
FT   mRNA            join(3445486..3445505,3445506..3445642,3445841..3445960,
FT                   3448150..3448304,3448394..3448600,3449237..3449447,
FT                   3449841..3449901,3450104..3450154,3450324..3450377,
FT                   3452534..3452833,3456904..3457023,3457525..3457649,
FT                   3458094..3458145,3459640..3459738)
FT                   /locus_tag="VIT_08s0007g05020"
FT                   /old_locus_tag="Vv08s0007g05020"
FT   5'UTR           3445486..3445505
FT                   /locus_tag="VIT_08s0007g05020"
FT                   /old_locus_tag="Vv08s0007g05020"
FT   CDS_pept        join(3445506..3445642,3445841..3445960,3448150..3448304,
FT                   3448394..3448600,3449237..3449447,3449841..3449901,
FT                   3450104..3450154,3450324..3450377,3452534..3452833,
FT                   3456904..3457023,3457525..3457649,3458094..3458145,
FT                   3459640..3459738)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05020"
FT                   /old_locus_tag="Vv08s0007g05020"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKB5"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032640"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKB5"
FT                   /protein_id="CCB55337.1"
FT                   /translation="MATHSLYPPLTSFSPPKPFIFPCLPLIRYPLQRRFPLCASSIKKP
FT                   RARRKVKSDQELCNDIREFVSAVGLPEGHLPSMKELSQHGRTDLANIVRRRGYKHIKDL
FT                   LSSATKTDTNEFDVGESLTENQDATSDYEDESTGQDEKAKDLVEDVPLSSKGSIMESGV
FT                   TNANIDPSFNNDEQSCIRESSTHSSFQEKVAKFIQNGELDTIEDNDYGILSGAAAEEGK
FT                   GVIDSENTIELESRPLAELHVEHASSGSNAAKILNGSTLFSDQIVPPVTRNDPLGDDRF
FT                   SSEGLISADFDNLGIETNEGENQVEVNHLKLMLHQKELELSQLKKQIEKEKTYNEDEVS
FT                   EECDYYDGMTEGYSLVVRPLLTVPKVKGEEDWRRTSIFQTRISCQGRLCTMIIDGGSSL
FT                   NIASQELVEKLNLKTERHPNPFRVAWVNDTSILLALTILQTKAETEISKAQKIVLEKDA
FT                   ELNAAEESLSGLKEVQIQYSGDGEIVEVAGSFNGWHHRIKMDPQPSSSSKEPVGSRKSR
FT                   LWSTVLWLYPGLYEIKFVIDGQWRIDPQSETVTRGTIDNNILRVDR"
FT   gene            3461696..3464762
FT                   /locus_tag="VIT_08s0007g05010"
FT                   /old_locus_tag="Vv08s0007g05010"
FT   mRNA            join(3461696..3462005,3463527..3463624,3463746..3463817,
FT                   3463913..3464037,3464214..3464286,3464385..3464489,
FT                   3464490..3464762)
FT                   /locus_tag="VIT_08s0007g05010"
FT                   /old_locus_tag="Vv08s0007g05010"
FT                   /product="Predicted protein"
FT   CDS_pept        join(3461696..3462005,3463527..3463624,3463746..3463817,
FT                   3463913..3464037,3464214..3464286,3464385..3464489)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05010"
FT                   /old_locus_tag="Vv08s0007g05010"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKB6"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR025067"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKB6"
FT                   /protein_id="CCB55338.1"
FT                   /translation="MAMVSASATLPPKTYPLPPFFSSFPNSSSFFKIPTHSLVATSTTL
FT                   TRPLFTPSFVLKDDHCEVIATFDQDKVEDEEEDMREGRETLLYSFTPLPLLLVAALPGA
FT                   GAVRSLFGPFVELVKSWNLPDWLVHWGHPGNMAVVLFAMGGYGTYLGFRIRFSEDVEEK
FT                   AKAKDLHPKLLAGMFFFFALGATGGVTSLLTSDRPIFESPHAVTGFIGLALLTIQTILP
FT                   SLFEGNPGLRNVHGILGSGIMTLFLFHAALGLQLGLSY"
FT   3'UTR           3464490..3464762
FT                   /locus_tag="VIT_08s0007g05010"
FT                   /old_locus_tag="Vv08s0007g05010"
FT   gene            3464763..3467522
FT                   /locus_tag="VIT_08s0007g05000"
FT                   /old_locus_tag="Vv08s0007g05000"
FT   mRNA            join(3464763..3464772,3464773..3464818,3465578..3465726,
FT                   3465869..3465949,3466260..3466910,3467019..3467429,
FT                   3467430..3467522)
FT                   /locus_tag="VIT_08s0007g05000"
FT                   /old_locus_tag="Vv08s0007g05000"
FT                   /product="S-adenosylmethionine synthase 2"
FT   5'UTR           3464763..3464772
FT                   /locus_tag="VIT_08s0007g05000"
FT                   /old_locus_tag="Vv08s0007g05000"
FT   CDS_pept        join(3464773..3464818,3465578..3465726,3465869..3465949,
FT                   3466260..3466910,3467019..3467429)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g05000"
FT                   /old_locus_tag="Vv08s0007g05000"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIR8"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIR8"
FT                   /protein_id="CBI30144.3"
FT                   /translation="MIRELVESLRINLFLSGNRRESESDWISPINTHFCLSIPCISSYF
FT                   SSLSQSLAFFLFFFTPHLSQPLFSGSRSDRIGSGSVSIPKYLFNFINMDTFLFTSESVN
FT                   EGHPDKLCDQVSDAILDACLEQDPESKVACETCSKTNMVMVFGEITTKAKVDYEKIVRD
FT                   TCRGIGFVSADVGLDADNCKVLVNIEQQSPDIAQGVHGHLSKKPEEIGAGDQGHMFGYA
FT                   TDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYRNEGGAMVPIRVH
FT                   TVLISTQHDETVTNDQIAKELREHVIKPIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAY
FT                   IVRQAAKSVVASGLARRCLVQVSYAIGVPEPLSVFVDTYKTGKIPDKDILDLIKENFDF
FT                   RPGMIAINLDLKRGGNFRFQKTAAYGHFGRDDPDFTWETVKLLKKA"
FT   3'UTR           3467430..3467522
FT                   /locus_tag="VIT_08s0007g05000"
FT                   /old_locus_tag="Vv08s0007g05000"
FT   gene            complement(3467523..3468832)
FT                   /locus_tag="VIT_08s0007g04990"
FT                   /old_locus_tag="Vv08s0007g04990"
FT   mRNA            complement(join(3467523..3467888,3467889..3468108,
FT                   3468350..3468375,3468654..3468782,3468783..3468832))
FT                   /locus_tag="VIT_08s0007g04990"
FT                   /old_locus_tag="Vv08s0007g04990"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(3467523..3467888)
FT                   /locus_tag="VIT_08s0007g04990"
FT                   /old_locus_tag="Vv08s0007g04990"
FT   CDS_pept        complement(join(3467889..3468108,3468350..3468375,
FT                   3468654..3468782))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04990"
FT                   /old_locus_tag="Vv08s0007g04990"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIR9"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIR9"
FT                   /protein_id="CBI30145.3"
FT                   /translation="MSETDLEGTGLNLAVNRHGNLTSASNDQDLTNVLHQIKSSKSPAV
FT                   INYGSTWCRVCNQILPAFCQLSNNFPKLSFIYADIDECPETTQHIRYTPTFHFYRDGER
FT                   VDEMLGAGEERLHDRLWLHS"
FT   5'UTR           complement(3468783..3468832)
FT                   /locus_tag="VIT_08s0007g04990"
FT                   /old_locus_tag="Vv08s0007g04990"
FT   gene            complement(3469317..3477631)
FT                   /locus_tag="VIT_08s0007g04980"
FT                   /old_locus_tag="Vv08s0007g04980"
FT   mRNA            complement(join(3469317..3469764,3469765..3469842,
FT                   3471078..3471230,3471559..3471621,3471890..3471961,
FT                   3472174..3472254,3472352..3472402,3472837..3472933,
FT                   3473877..3474137,3474325..3474384,3474677..3474759,
FT                   3474908..3475025,3475173..3475342,3475447..3475492,
FT                   3477332..3477432,3477433..3477435,3477517..3477631))
FT                   /locus_tag="VIT_08s0007g04980"
FT                   /old_locus_tag="Vv08s0007g04980"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(3469317..3469764)
FT                   /locus_tag="VIT_08s0007g04980"
FT                   /old_locus_tag="Vv08s0007g04980"
FT   CDS_pept        complement(join(3469765..3469842,3471078..3471230,
FT                   3471559..3471621,3471890..3471961,3472174..3472254,
FT                   3472352..3472402,3472837..3472933,3473877..3474137,
FT                   3474325..3474384,3474677..3474759,3474908..3475025,
FT                   3475173..3475342,3475447..3475492,3477332..3477432))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04980"
FT                   /old_locus_tag="Vv08s0007g04980"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKB7"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKB7"
FT                   /protein_id="CCB55339.1"
FT                   /translation="MEIDEAIRESDDRRLKTKYNNAIYVVRRALALYSVEEVALSFNGG
FT                   KDSTVLLHLLRAGYFLHKREQSHSNGVLTDHEVAFPIRTIYFESPSAFPEINSFTYETA
FT                   TTYGLQMDIIRLDFKSGLEALLEAKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMR
FT                   VNPILDWSYRDVWAFLLACKIPYCSLYDRGYTSIGSIHDTVPNALLCVNNSSSSKEKFR
FT                   PAYLLSDGRLERAGRAKKFSLPVCRPAYPAVSNGMISVDSNKNSTLTATVIGVGDEILF
FT                   GTVEDELGPSLCRKLHSIGWSVSQTAVLRNDVDSVAEEVERWKSTNDVLFIYGGVGPLH
FT                   SDVTLAGVAKAFGVRLAPDEEFEEYLRHLIGDHCTGDRNEMAQLPEGITELLHHEKLSV
FT                   PLIKCQNVFILTATNVTELDKEWDCLIELTRSSGLLVLMEPFLSKRMTTNLSDDQTRLE
FT                   SAVEALSKKFPAGQISEAN"
FT   5'UTR           complement(3477517..3477631)
FT                   /locus_tag="VIT_08s0007g04980"
FT                   /old_locus_tag="Vv08s0007g04980"
FT   gene            complement(3478140..3480550)
FT                   /locus_tag="VIT_08s0007g04970"
FT                   /old_locus_tag="Vv08s0007g04970"
FT   mRNA            complement(join(3478140..3478386,3478387..3479519,
FT                   3479937..3480315,3480316..3480550))
FT                   /locus_tag="VIT_08s0007g04970"
FT                   /old_locus_tag="Vv08s0007g04970"
FT                   /product="Predicted protein"
FT   3'UTR           complement(3478140..3478386)
FT                   /locus_tag="VIT_08s0007g04970"
FT                   /old_locus_tag="Vv08s0007g04970"
FT   CDS_pept        complement(join(3478387..3479519,3479937..3480315))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04970"
FT                   /old_locus_tag="Vv08s0007g04970"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKB8"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR032867"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKB8"
FT                   /protein_id="CCB55340.1"
FT                   /translation="MIRGYSRSDNPREAIVLYMSMIAKGIAPPNNFTFPFLLNSCARLS
FT                   SLEPGHEVHSHIIKHGFESDLFVRNALIHLYSVFGNLNLARTLFDESLVRDLVSYNTMI
FT                   KGYAEVNQPESALCLFGEMQNSDEVTLVAVLSACARLGAFDLGKRLYHQYIENGVFNQN
FT                   TILTAAVMDMYAKCGSIDSALEIFRRVGKNMKTGFVFNSMIAGLAQHGLGETAITVFRE
FT                   LISTGLKPDEVTFVGVLCACGHSGLIEEGKKLFESMFNAYGIKPQMEHYGCMVDLLGRY
FT                   GCLEEAYDLVQKMPFEANSVIWRALLSACRTHGNVKIGEIAGQKLLEMEAQHGARYVLL
FT                   SNILADANQWEEARQVRKVMEDHGIRKPPGWSYIELGGAIHRFVASDKSHPQGKEIELM
FT                   LKDMAMRLKSAGYVPNTAQVMFDIDEEEKESVVSYHSEKLALAFGLMYCSPTDTIRIVK
FT                   NLRICADCHKAFKLVSEIYGREITVRDTMRFHHFRNGSCSCMDFW"
FT   5'UTR           complement(3480316..3480550)
FT                   /locus_tag="VIT_08s0007g04970"
FT                   /old_locus_tag="Vv08s0007g04970"
FT   gene            complement(3480854..3484967)
FT                   /locus_tag="VIT_08s0007g04960"
FT                   /old_locus_tag="Vv08s0007g04960"
FT   mRNA            complement(join(3480854..3481321,3481322..3481375,
FT                   3481462..3481528,3482605..3482692,3483996..3484128,
FT                   3484129..3484167,3484879..3484967))
FT                   /locus_tag="VIT_08s0007g04960"
FT                   /old_locus_tag="Vv08s0007g04960"
FT                   /product="Predicted protein"
FT   3'UTR           complement(3480854..3481321)
FT                   /locus_tag="VIT_08s0007g04960"
FT                   /old_locus_tag="Vv08s0007g04960"
FT   CDS_pept        complement(join(3481322..3481375,3481462..3481528,
FT                   3482605..3482692,3483996..3484128))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04960"
FT                   /old_locus_tag="Vv08s0007g04960"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR025124"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKB9"
FT                   /protein_id="CCB55341.1"
FT                   /translation="MENMEINGGNPCSNEKLPSEGSKNVNEERNSIEKEVCDSVFINHA
FT                   EIAWHQRRKEWVGDESQKPKRVHKEPVMSWTTTYEDLLLSTDRFHQPIPLAEMVDFLVD
FT                   IWHEEGLYD"
FT   5'UTR           complement(3484879..3484967)
FT                   /locus_tag="VIT_08s0007g04960"
FT                   /old_locus_tag="Vv08s0007g04960"
FT   gene            3490189..3491563
FT                   /locus_tag="VIT_08s0007g04950"
FT                   /old_locus_tag="Vv08s0007g04950"
FT   mRNA            join(3490189..3490253,3490254..3490449,3490540..3490640,
FT                   3490866..3491083,3491196..3491562,3491563..3491563)
FT                   /locus_tag="VIT_08s0007g04950"
FT                   /old_locus_tag="Vv08s0007g04950"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           3490189..3490253
FT                   /locus_tag="VIT_08s0007g04950"
FT                   /old_locus_tag="Vv08s0007g04950"
FT   CDS_pept        join(3490254..3490449,3490540..3490640,3490866..3491083,
FT                   3491196..3491562)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04950"
FT                   /old_locus_tag="Vv08s0007g04950"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKC0"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR010713"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR016455"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKC0"
FT                   /protein_id="CCB55342.1"
FT                   /translation="MAFFIFLVLVLMVPSSNAQWPPSPGYYPSRKFRSMSFYQGFRNLW
FT                   GPQHQRVDQNALTIWLDSTSGSGFKSVRPFRSGYFGASIKLQPGYTAGVITAFYLSNNE
FT                   AHPGFHDEVDIEFLGTTFGKPYTLQTNVYIRGSGDGRIIGREMKFHLWFDPTKDFHHYA
FT                   ILWSPKDIIFFVDDVPVRRYPRKSATTFPLRPMWLYGSIWDASSWATEDGKYKADYRYQ
FT                   PFVGQYSNFKASGCSAYSPASCRPVSASPYRSGRLTGQQYRAMQWVQSRHMVYNYCSDN
FT                   KRDHSLTPECWG"
FT   3'UTR           3491563..3491563
FT                   /locus_tag="VIT_08s0007g04950"
FT                   /old_locus_tag="Vv08s0007g04950"
FT   gene            complement(3496789..3504013)
FT                   /locus_tag="VIT_08s0007g04940"
FT                   /old_locus_tag="Vv08s0007g04940"
FT   mRNA            complement(join(3496789..3496826,3503956..3504013))
FT                   /locus_tag="VIT_08s0007g04940"
FT                   /old_locus_tag="Vv08s0007g04940"
FT   CDS_pept        complement(join(3496789..3496826,3503956..3504013))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04940"
FT                   /old_locus_tag="Vv08s0007g04940"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKC1"
FT                   /protein_id="CCB55343.1"
FT                   /translation="MILRLLLLLEVCLLIIGIVAEGDPKSFGCPT"
FT   gap             3504815..3504914
FT                   /estimated_length=100
FT   gene            complement(3525824..3537429)
FT                   /locus_tag="VIT_08s0007g04920"
FT                   /old_locus_tag="Vv08s0007g04920"
FT   mRNA            complement(join(3525824..3526041,3526042..3526528,
FT                   3527321..3527514,3527617..3527679,3527987..3528026,
FT                   3528152..3528291,3528536..3528646,3531792..3531850,
FT                   3532048..3532117,3534031..3534111,3535812..3535856,
FT                   3535954..3536043,3536115..3536193,3537056..3537429))
FT                   /locus_tag="VIT_08s0007g04920"
FT                   /old_locus_tag="Vv08s0007g04920"
FT                   /product="Predicted protein"
FT   3'UTR           complement(3525824..3526041)
FT                   /locus_tag="VIT_08s0007g04920"
FT                   /old_locus_tag="Vv08s0007g04920"
FT   CDS_pept        complement(join(3526042..3526528,3527321..3527514,
FT                   3527617..3527679,3527987..3528026,3528152..3528291,
FT                   3528536..3528646,3531792..3531850,3532048..3532117,
FT                   3534031..3534111,3535812..3535856,3535954..3536043,
FT                   3536115..3536193,3537056..3537429))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04920"
FT                   /old_locus_tag="Vv08s0007g04920"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIS4"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037381"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIS4"
FT                   /protein_id="CBI30150.3"
FT                   /translation="MDPFTVDEETEDDEETEGEAEDYIPVEGSTRVSQNGAVTSDQAIS
FT                   VNGGSGEVLALRVSDEGFQEGGGEMRRVEGGEISAMGSSSSSNGGETQEGSDGWVQDQI
FT                   DGLCCPICMEAWTSGGEHQVCCLPCGHIYGISCIKKWFQQCGRSSGKCPQCKRKCTLRN
FT                   VRTLYASRVVAVDEDLRKKIRSLEAKCASLEKKNADWCMKESDWHKREADLHLQVQQLI
FT                   ERTTYLERLSSEMHGRGSGLVAARGHNFAENFGRRGSSCNFVLQKELQVDGARYFDIDA
FT                   SGEILVIARRLSGTGGTHVLTKMSLISPHEIEDILLPSGTKAVKDLRVSPAKCRLALLA
FT                   SLGKKLSVLSMESNNVILTYDLPTAAWSCSWDLNSSHYMYAGLQNGMLMVFDMRQTARP
FT                   MAEISGPTSNPIHTIQSVLHNSTLPSGVSTLLSASSVGLCQWNFGGSEERPFLVPETKN
FT                   HGVCISLAHCPSSDNIVSTFRPKVEMSNEIAVSQYSLTPSVMGQGMQGSHVLLKRVGGN
FT                   CYQKLGSSCANVNDIRLQRSAIIDLQSHHPLFVSGDEITHELVLQELPSLRVSQRLKSQ
FT                   KHPLRDVKYSHDLSPSLLCCLSEDTLQFFSAKFS"
FT   gene            3540138..3542208
FT                   /locus_tag="VIT_08s0007g04910"
FT                   /old_locus_tag="Vv08s0007g04910"
FT   mRNA            join(3540138..3540197,3540198..3540280,3540414..3540552,
FT                   3541895..3542065,3542066..3542208)
FT                   /locus_tag="VIT_08s0007g04910"
FT                   /old_locus_tag="Vv08s0007g04910"
FT                   /product="Predicted protein"
FT   5'UTR           3540138..3540197
FT                   /locus_tag="VIT_08s0007g04910"
FT                   /old_locus_tag="Vv08s0007g04910"
FT   CDS_pept        join(3540198..3540280,3540414..3540552,3541895..3542065)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04910"
FT                   /old_locus_tag="Vv08s0007g04910"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIS5"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIS5"
FT                   /protein_id="CBI30151.3"
FT                   /translation="MARSISYITGSQLLALKRRPNIAIVDVRDDERSYDGHIAGSLHYA
FT                   SDTFSDKISNLVQEVKGKDTLVFHCALSQVRGPTCARRLATYLTGVENEEIKNILVLER
FT                   GFNGWEASGRPVCRCTGIPCKGDNAQ"
FT   3'UTR           3542066..3542208
FT                   /locus_tag="VIT_08s0007g04910"
FT                   /old_locus_tag="Vv08s0007g04910"
FT   gene            3543593..3548280
FT                   /locus_tag="VIT_08s0007g04900"
FT                   /old_locus_tag="Vv08s0007g04900"
FT   mRNA            join(3543593..3543673,3543674..3543676,3543774..3543851,
FT                   3544020..3544115,3547895..3547972,3547973..3548280)
FT                   /locus_tag="VIT_08s0007g04900"
FT                   /old_locus_tag="Vv08s0007g04900"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           3543593..3543673
FT                   /locus_tag="VIT_08s0007g04900"
FT                   /old_locus_tag="Vv08s0007g04900"
FT   CDS_pept        join(3543674..3543676,3543774..3543851,3544020..3544115,
FT                   3547895..3547972)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04900"
FT                   /old_locus_tag="Vv08s0007g04900"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKC2"
FT                   /protein_id="CCB55344.1"
FT                   /translation="MVCLACLLPLFLVPIVNLLPLLFNLIMAKVYGLFGWEYRKPERVP
FT                   AACPYKPAANNNSKVGVETEPGAPEPVLKPVGVENSKCD"
FT   3'UTR           3547973..3548280
FT                   /locus_tag="VIT_08s0007g04900"
FT                   /old_locus_tag="Vv08s0007g04900"
FT   gene            3552004..3555372
FT                   /locus_tag="VIT_08s0007g04890"
FT                   /old_locus_tag="Vv08s0007g04890"
FT   mRNA            join(3552004..3552030,3552031..3552184,3552632..3552844,
FT                   3553161..3553266,3553581..3553920,3554445..3554729,
FT                   3554965..3555102,3555103..3555372)
FT                   /locus_tag="VIT_08s0007g04890"
FT                   /old_locus_tag="Vv08s0007g04890"
FT                   /product="Predicted protein"
FT   5'UTR           3552004..3552030
FT                   /locus_tag="VIT_08s0007g04890"
FT                   /old_locus_tag="Vv08s0007g04890"
FT   CDS_pept        join(3552031..3552184,3552632..3552844,3553161..3553266,
FT                   3553581..3553920,3554445..3554729,3554965..3555102)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04890"
FT                   /old_locus_tag="Vv08s0007g04890"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR040217"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIS7"
FT                   /protein_id="CBI30153.3"
FT                   /translation="MGILYDDVVIIRPSEKEGEPRVLTVNCPDKTGLGCDLCRIILFFG
FT                   LSIVRVDVSTDGKWCYIVFWIIGKSTTRWSLLQDRLSEACPSCSSASGFSYFQLQPPKP
FT                   PDVFLLKFCCYDRKGLLHDVTEVLCELELTIKKVKVSTTPDGRVMDLFFITDTRELLHT
FT                   KKRQEDTHNHLKTVLGDAMISCDISMVGSEITACSQTSTLLPSAITREIFGSKFEDEPP
FT                   SGLPQVSGNISVTMDNSLSPAHTLVQIVCQDHKGLLYDMMRTLKDYNIKISYGRLTTKP
FT                   RRNCEVDLFIMQADGKKVVDPYKQNALCSRLQMELLRPLRVAVVSRGPDTELLVANPVE
FT                   LSGKGRPLVFFDITHALKMLNVCIFSAEIGRQMIADREWEVYRILLDEGDGLLVPRNKI
FT                   EEGVWKMLMGWE"
FT   3'UTR           3555103..3555372
FT                   /locus_tag="VIT_08s0007g04890"
FT                   /old_locus_tag="Vv08s0007g04890"
FT   gene            complement(3557101..3560616)
FT                   /locus_tag="VIT_08s0007g04880"
FT                   /old_locus_tag="Vv08s0007g04880"
FT   mRNA            complement(join(3557101..3557247,3557362..3557505,
FT                   3557633..3557724,3557848..3557929,3558018..3558084,
FT                   3558183..3558274,3558372..3558488,3558571..3558679,
FT                   3558782..3558897,3559031..3559107,3559225..3559306,
FT                   3560176..3560313,3560410..3560616))
FT                   /locus_tag="VIT_08s0007g04880"
FT                   /old_locus_tag="Vv08s0007g04880"
FT                   /product="Predicted protein"
FT   CDS_pept        complement(join(3557101..3557247,3557362..3557505,
FT                   3557633..3557724,3557848..3557929,3558018..3558084,
FT                   3558183..3558274,3558372..3558488,3558571..3558679,
FT                   3558782..3558897,3559031..3559107,3559225..3559306,
FT                   3560176..3560313,3560410..3560616))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04880"
FT                   /old_locus_tag="Vv08s0007g04880"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIS8"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIS8"
FT                   /protein_id="CBI30154.3"
FT                   /translation="MDYDAKRVEEGLGHVHKEDISEKADKIEKDESSATPAQSVEQKGE
FT                   EQPLIKQKSKRVATLDAFRGLTIVLMILVDDAGGSYARIDHSPWNGCTLADFVMPFFLF
FT                   IVGVAVALALKKIPRISLAVKKISLRTLKLLFWGILLQGGYSHAPDDLSYGVDMKHIRW
FT                   FGILQRIAVVYFVVALIETLTTKRRPTVIDSGHFSILSAYKWQWIGGFVAFLIYMITTY
FT                   ALYVPDWSFVIDQDHEAKRYTVKCGMRGHLGPACNAVGYVDRQVWGINHLYSQPVWTRL
FT                   KACTLSSPNSGPFREDAPSWCYAPFEPEGLLSTISAILSGTIGIHYGHVLIHFKGHAER
FT                   LKQWVSMGIVLLIVAIILHFTDAIPINKQLYSFSYVCFTAGAAGIVLSAFYLVIDVWGF
FT                   RTPFLFLEWIGMNAMLVFVMAAQGIFAAFINGWYFESSDNSLVHWIQRHVFIDVWHSER
FT                   LGTLLYVIFAEITFWAVVSGILHKLHIYWKL"
FT   gene            3562638..3566956
FT                   /locus_tag="VIT_08s0007g04870"
FT                   /old_locus_tag="Vv08s0007g04870"
FT   mRNA            join(3562638..3562728,3562830..3562840,3562841..3562951,
FT                   3565749..3565965,3566071..3566409,3566784..3566863,
FT                   3566864..3566956)
FT                   /locus_tag="VIT_08s0007g04870"
FT                   /old_locus_tag="Vv08s0007g04870"
FT                   /product="Predicted protein"
FT   5'UTR           3562638..3562728
FT                   /locus_tag="VIT_08s0007g04870"
FT                   /old_locus_tag="Vv08s0007g04870"
FT   CDS_pept        join(3562841..3562951,3565749..3565965,3566071..3566409,
FT                   3566784..3566863)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04870"
FT                   /old_locus_tag="Vv08s0007g04870"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKC3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR036875"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKC3"
FT                   /protein_id="CCB55345.1"
FT                   /translation="MGGREENRIFVGGLGWNTSERHLEDAFSRYGKILESLVMMERDTG
FT                   RPRGFGFITFADHRAMEDAIREMHGRELDGRVISVNKAQPKMGSEDSGYGYGRDHMPSG
FT                   RDHAPGGRDRMLGGRDSYRGVDKPVGRSDDCFKCGRPGHWARDCPSGDGVGSGGGRFSS
FT                   HSKFGGGGGGGGGGRGDRFGGDRYDDHFDGGRYGGDRERTDSRDNRYGRDRYNNDRYQP
FT                   GLLLLFFKTNSGCGINECLEVIVVII"
FT   3'UTR           3566864..3566956
FT                   /locus_tag="VIT_08s0007g04870"
FT                   /old_locus_tag="Vv08s0007g04870"
FT   gene            3574083..3576687
FT                   /locus_tag="VIT_08s0007g04860"
FT                   /old_locus_tag="Vv08s0007g04860"
FT   mRNA            join(3574083..3574091,3574092..3575999,3576191..3576271,
FT                   3576272..3576687)
FT                   /locus_tag="VIT_08s0007g04860"
FT                   /old_locus_tag="Vv08s0007g04860"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           3574083..3574091
FT                   /locus_tag="VIT_08s0007g04860"
FT                   /old_locus_tag="Vv08s0007g04860"
FT   CDS_pept        join(3574092..3575999,3576191..3576271)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04860"
FT                   /old_locus_tag="Vv08s0007g04860"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKC4"
FT                   /db_xref="InterPro:IPR010658"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKC4"
FT                   /protein_id="CCB55346.1"
FT                   /translation="MGMAEFSGGGGGRGMRRFGLQVLVGRWFMVFASLLIMSVAGATYM
FT                   FSLYSGEIKTSLGYDQTTLNLLSFFKDLGGNVGVLSGLINEVTPPWVVLCIGAVMNFFG
FT                   YFMIWLAVTDRIAKPQIWQMCLYICIGANSQSFANTGALVTCVRNFPESRGIVLGLLKG
FT                   FVGLSGAIITQLYRAFYGDDSKSLILFIAWLPAAVSFVFLRTIRIMKVGRQANELKVFY
FT                   DLLYMSLGLAGFLMVIIIIQNKFTFSRIEYSGSAAVVLILLFLPLAVVIKEEINIWKGK
FT                   KQALDAAQVKVITENPPAVELASSPVVSLDQLPPPTAAPENAEKSVSCFKTMFKPPDRG
FT                   EDYTILQALFSIDMLILFIVTTCGVGGTLTAIDNLGQIGSSQGYTAHSTTTFVSLVSIW
FT                   NYLGRVVSGFASEIFLTRYKFPRPLMLTFVLLFSCVGHLLIAFAVPNSLYFASVIIGFC
FT                   FGAQWPLVFAIISELFGLKYYSTLYNFGAVASPVGSYILNVKVAGHLYDKEALKQLEAS
FT                   GVTRVAGQDLTCTGAACYKLSFIIITAATLFGCIISFILVIRTKKFYQGDIYKKFRQEA
FT                   NKAEINMASSGNGILQLGETESKATVTATATATEDTTTTMDQPTQICRDGLERSNSKHI
FT                   NQSQLERLPMVTSNLFTALASPPTRWQ"
FT   3'UTR           3576272..3576687
FT                   /locus_tag="VIT_08s0007g04860"
FT                   /old_locus_tag="Vv08s0007g04860"
FT   gene            3582130..3588387
FT                   /locus_tag="VIT_08s0007g04850"
FT                   /old_locus_tag="Vv08s0007g04850"
FT   mRNA            join(3582130..3582471,3582472..3583656,3587774..3588097,
FT                   3588098..3588387)
FT                   /locus_tag="VIT_08s0007g04850"
FT                   /old_locus_tag="Vv08s0007g04850"
FT                   /product="unknown predicted protein"
FT   5'UTR           3582130..3582471
FT                   /locus_tag="VIT_08s0007g04850"
FT                   /old_locus_tag="Vv08s0007g04850"
FT   CDS_pept        join(3582472..3583656,3587774..3588097)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04850"
FT                   /old_locus_tag="Vv08s0007g04850"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5BED9"
FT                   /db_xref="InterPro:IPR002554"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A5BED9"
FT                   /protein_id="CCB55347.1"
FT                   /translation="MFNKIIKRGHRKPSKADAIDSGLYGFGPAGNRNSGMVSTSNVVVN
FT                   HASRTAPALSVVNSAPQPGGAVIDPTALPSGNIDPLPPFRDVAVSDRQLLFLRKLQICC
FT                   FQFDFTDTLKSVREKEIKRQTLLELIDFIQSGSGKITENNQEEMIKMISVNIFRCFPPA
FT                   PHENSGSEMLEIEEEPYAEPAWPHLHLVYELLLRYVVSSDTDTKIAKRYIDHSFVLKLL
FT                   DLFDADDPREREYLKTILHRIYGKFMVHRPFIRKAINNIFYRFIYETERHSGIGELLEI
FT                   LGSIINGFALPMKEEHKLFLVRALIPLHKPKALALYHQQLSYCITQFVEKDYKLADTVI
FT                   RGLLKYWPITNCTKELLFLGELEEVLEATQSAEFQRCMVPLFRQIGRCLNSSQSQVAER
FT                   AFFLWKNDHIVSLIAQNRNVILPIIFEPLEKNVRSHWNQAVHGLTINIRKMFLEMDFDL
FT                   FEECQKQHEEMEARARELEEQRELTWKRLAEAAEQRKGEDGITV"
FT   3'UTR           3588098..3588387
FT                   /locus_tag="VIT_08s0007g04850"
FT                   /old_locus_tag="Vv08s0007g04850"
FT   gene            3589188..3594202
FT                   /locus_tag="VIT_08s0007g04840"
FT                   /old_locus_tag="Vv08s0007g04840"
FT   mRNA            join(3589188..3589290,3589291..3589440,3589538..3589648,
FT                   3592786..3592854,3593814..3593864,3593865..3594202)
FT                   /locus_tag="VIT_08s0007g04840"
FT                   /old_locus_tag="Vv08s0007g04840"
FT                   /product="Predicted protein"
FT   5'UTR           3589188..3589290
FT                   /locus_tag="VIT_08s0007g04840"
FT                   /old_locus_tag="Vv08s0007g04840"
FT   CDS_pept        join(3589291..3589440,3589538..3589648,3592786..3592854,
FT                   3593814..3593864)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04840"
FT                   /old_locus_tag="Vv08s0007g04840"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5BED8"
FT                   /db_xref="UniProtKB/TrEMBL:A5BED8"
FT                   /protein_id="CBI30158.3"
FT                   /translation="MSKRGGGAALQKDVPWRASPSGKPIPKIHHSPILRVSQTPSSHYA
FT                   LSIMKHPNPIGDGLATEAIVEAAGPDCIVPGQVTPVRLLGLKVWPIHIDMKFMEPVGRE
FT                   LKLLGKFMDSAVDLMNKSFIDR"
FT   3'UTR           3593865..3594202
FT                   /locus_tag="VIT_08s0007g04840"
FT                   /old_locus_tag="Vv08s0007g04840"
FT   gene            3595010..3595583
FT                   /locus_tag="VIT_08s0007g04830"
FT                   /old_locus_tag="Vv08s0007g04830"
FT   mRNA            join(3595010..3595124,3595228..3595357,3595457..3595583)
FT                   /locus_tag="VIT_08s0007g04830"
FT                   /old_locus_tag="Vv08s0007g04830"
FT                   /product="Predicted protein"
FT   CDS_pept        join(3595010..3595124,3595228..3595357,3595457..3595583)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04830"
FT                   /old_locus_tag="Vv08s0007g04830"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIT3"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIT3"
FT                   /protein_id="CBI30159.3"
FT                   /translation="MQGENLRKGSWLEEEDERLTAFVGLLGERRWDSIARASGLKRSGK
FT                   SCRLRWLNYLRPDLKRCQISAEEEQIILQLHKRWGNKWSWIARSLPGRTDNEIKNYWRT
FT                   HLRKRTEIEEQGILQFSAS"
FT   gene            complement(3598550..3601039)
FT                   /locus_tag="VIT_08s0007g04820"
FT                   /old_locus_tag="Vv08s0007g04820"
FT   mRNA            complement(join(3598550..3598635,3598636..3598804,
FT                   3599113..3599315,3599551..3600457,3600849..3601039))
FT                   /locus_tag="VIT_08s0007g04820"
FT                   /old_locus_tag="Vv08s0007g04820"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(3598550..3598635)
FT                   /locus_tag="VIT_08s0007g04820"
FT                   /old_locus_tag="Vv08s0007g04820"
FT   CDS_pept        complement(join(3598636..3598804,3599113..3599315,
FT                   3599551..3600457,3600849..3601039))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04820"
FT                   /old_locus_tag="Vv08s0007g04820"
FT                   /product="unknown"
FT                   /db_xref="GOA:E7BTN4"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR018082"
FT                   /db_xref="UniProtKB/TrEMBL:E7BTN4"
FT                   /protein_id="CCB55348.1"
FT                   /translation="MLDVDHSRRKPTQTHPSASAMLRRTCIVLISLLSSLSALATPMQN
FT                   LTLLGQHPDPEAVVQEVQRRVNVSVSRRQTLEVSQSDQSSSCVTGNPIDDCWRCDPNWE
FT                   ADRQRLADCAIGFGQYALGGKGGQIYVVTDSSDHDAVTPRPGTLRYAVIQSDPLWIVFA
FT                   TNMLIKLSQELIFNSYKTLDGRGANVHIVGGGCITLQYISNVIIHNIHIHHCVQSGEAN
FT                   VRSSPTHYGWRTLSDGDGISIFGSRDIWIDHCSLSHCKDGLIDAVMGSTGITISNNFFS
FT                   HHDEVMLLGHSDSYVPDSGMQVTIAFNHFGEQLVQRMPRCRRGYIHVVNNDFTRWEMYA
FT                   IGGSGSPTINSQGNRYTAPSNRNAKEVTKRVDTDEKKWRDWNWRSEGDILVNGAFFIAS
FT                   GETVEVLYEKAYSVEPKSAALIDQLTTNAGVLGGSGNNLGTWRTERSGGGYGFGDDYSE
FT                   NMLSGSPSSFALSSTLLPPLFLLSSFLLLYL"
FT   gene            complement(3605750..3606339)
FT                   /locus_tag="VIT_08s0007g04810"
FT                   /old_locus_tag="Vv08s0007g04810"
FT   mRNA            complement(join(3605750..3606011,3606012..3606302,
FT                   3606303..3606339))
FT                   /locus_tag="VIT_08s0007g04810"
FT                   /old_locus_tag="Vv08s0007g04810"
FT   3'UTR           complement(3605750..3606011)
FT                   /locus_tag="VIT_08s0007g04810"
FT                   /old_locus_tag="Vv08s0007g04810"
FT   CDS_pept        complement(3606012..3606302)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04810"
FT                   /old_locus_tag="Vv08s0007g04810"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKC7"
FT                   /protein_id="CCB55349.1"
FT                   /translation="MAMKKKRLVISLLLLLVMANFACAMNRRMLMIEGNINTETATEQP
FT                   RNETENSETGDQPDVNNHHSIPRQKFSGWENNPGPSNNAQTKDGNAVDNHT"
FT   5'UTR           complement(3606303..3606339)
FT                   /locus_tag="VIT_08s0007g04810"
FT                   /old_locus_tag="Vv08s0007g04810"
FT   gene            3610670..3613936
FT                   /locus_tag="VIT_08s0007g04800"
FT                   /old_locus_tag="Vv08s0007g04800"
FT   mRNA            join(3610670..3610818,3610819..3610912,3611074..3611291,
FT                   3612789..3612895,3612989..3613091,3613268..3613432,
FT                   3613534..3613587,3613696..3613767,3613768..3613936)
FT                   /locus_tag="VIT_08s0007g04800"
FT                   /old_locus_tag="Vv08s0007g04800"
FT                   /product="unknown predicted protein"
FT   5'UTR           3610670..3610818
FT                   /locus_tag="VIT_08s0007g04800"
FT                   /old_locus_tag="Vv08s0007g04800"
FT   CDS_pept        join(3610819..3610912,3611074..3611291,3612789..3612895,
FT                   3612989..3613091,3613268..3613432,3613534..3613587,
FT                   3613696..3613767)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04800"
FT                   /old_locus_tag="Vv08s0007g04800"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIT5"
FT                   /db_xref="InterPro:IPR001148"
FT                   /db_xref="InterPro:IPR018338"
FT                   /db_xref="InterPro:IPR023561"
FT                   /db_xref="InterPro:IPR036398"
FT                   /db_xref="InterPro:IPR041891"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIT5"
FT                   /protein_id="CBI30161.3"
FT                   /translation="MKKQSNPTFSFGLLLFLLLFVHSTRIIAQEVEDEREFEYIEGSEK
FT                   GPKHWGELKEEWAACNNGDLQSPIDLSNQRVKVIPKLGDLKRNYKLCNATVKNRGHDIS
FT                   LQWVGDAGSIRINGTEYKLQQGHWHAPSEHSINGRRYDLELHMVHVSPDNNIAVVGLIY
FT                   KTGQPDKFLSKMMSNITSMADKMEQRKMGVIHPGDIKMGGRKYYKYMGSLTVPPCTEGV
FT                   TWIINKKIRTVSREQVKQLRLAVHDYAEMNARPVQPLNLREVQLYGPK"
FT   3'UTR           3613768..3613936
FT                   /locus_tag="VIT_08s0007g04800"
FT                   /old_locus_tag="Vv08s0007g04800"
FT   gene            complement(3614468..3618167)
FT                   /locus_tag="VIT_08s0007g04790"
FT                   /old_locus_tag="Vv08s0007g04790"
FT   mRNA            complement(join(3614468..3614739,3614740..3614892,
FT                   3614994..3615035,3615150..3615219,3615344..3615435,
FT                   3615808..3615890,3615998..3616038,3616156..3616199,
FT                   3616291..3616368,3616447..3616479,3616921..3616980,
FT                   3617096..3617183,3617285..3617370,3617371..3617402,
FT                   3617441..3617446,3617536..3617743,3617748..3618017,
FT                   3618027..3618167))
FT                   /locus_tag="VIT_08s0007g04790"
FT                   /old_locus_tag="Vv08s0007g04790"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(3614468..3614739)
FT                   /locus_tag="VIT_08s0007g04790"
FT                   /old_locus_tag="Vv08s0007g04790"
FT   CDS_pept        complement(join(3614740..3614892,3614994..3615035,
FT                   3615150..3615219,3615344..3615435,3615808..3615890,
FT                   3615998..3616038,3616156..3616199,3616291..3616368,
FT                   3616447..3616479,3616921..3616980,3617096..3617183,
FT                   3617285..3617370))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04790"
FT                   /old_locus_tag="Vv08s0007g04790"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIT6"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR008913"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017921"
FT                   /db_xref="InterPro:IPR027370"
FT                   /db_xref="InterPro:IPR037274"
FT                   /db_xref="InterPro:IPR037275"
FT                   /db_xref="InterPro:IPR039512"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIT6"
FT                   /protein_id="CBI30162.3"
FT                   /translation="MESGLEGQMSTHRHEEDESLMEMGSGRFGCSHYRRRCKIRAPCCD
FT                   EIFDCRHCHNEAKNALEVDPLTRHDVPRHEIKRVICSLCGTEQDVQQNCIHCGVCMGQY
FT                   FCSKCKFFDDDVSKQIYHCNKCGICRTGGEENFFHCDKCGCCYSTALKDSHNCVERAMH
FT                   HNCPVCFEYLFDTTTDITVLHCGHTIHLECLKEMERHFQYSCPVCSKSYCDMSHVWEKL
FT                   DQEVALTPMPSMFENKMVWILCNDCGETSEVNFHIVAHKCLKCNSYNTRQTRGGPASCS
FT                   SRIEEMMR"
FT   5'UTR           complement(3618027..3618167)
FT                   /locus_tag="VIT_08s0007g04790"
FT                   /old_locus_tag="Vv08s0007g04790"
FT   gene            complement(3620784..3621897)
FT                   /locus_tag="VIT_08s0007g04780"
FT                   /old_locus_tag="Vv08s0007g04780"
FT   mRNA            complement(join(3620784..3620971,3620972..3621343,
FT                   3621444..3621827,3621828..3621897))
FT                   /locus_tag="VIT_08s0007g04780"
FT                   /old_locus_tag="Vv08s0007g04780"
FT                   /product="Tonoplast intrinsic protein"
FT   3'UTR           complement(3620784..3620971)
FT                   /locus_tag="VIT_08s0007g04780"
FT                   /old_locus_tag="Vv08s0007g04780"
FT   CDS_pept        complement(join(3620972..3621343,3621444..3621827))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04780"
FT                   /old_locus_tag="Vv08s0007g04780"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKC8"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKC8"
FT                   /protein_id="CCB55350.1"
FT                   /translation="MPIRNIAFGRPEEATRPDALKAAFAEFICTLIFVFAGEGSGMAFN
FT                   KLTDNGSTTPAGLVAASLAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGI
FT                   LYWIAQLLGSTVACLLLKFSTNGMTTSAFSLSSGVTVWNAFVFEIVMTFGLVYTVYATA
FT                   IDPKKGNLGIIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWTWTNHWVYWAG
FT                   PLIGGGLAGLVYEVFFISHTHEQLPSTDY"
FT   5'UTR           complement(3621828..3621897)
FT                   /locus_tag="VIT_08s0007g04780"
FT                   /old_locus_tag="Vv08s0007g04780"
FT   gene            3632320..3633349
FT                   /locus_tag="VIT_08s0007g04770"
FT                   /old_locus_tag="Vv08s0007g04770"
FT   mRNA            join(3632320..3632416,3632417..3633247,3633248..3633349)
FT                   /locus_tag="VIT_08s0007g04770"
FT                   /old_locus_tag="Vv08s0007g04770"
FT                   /product="unknown predicted protein"
FT   5'UTR           3632320..3632416
FT                   /locus_tag="VIT_08s0007g04770"
FT                   /old_locus_tag="Vv08s0007g04770"
FT   CDS_pept        3632417..3633247
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04770"
FT                   /old_locus_tag="Vv08s0007g04770"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5ARW4"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:A5ARW4"
FT                   /protein_id="CCB55351.1"
FT                   /translation="MEVQEEVMGSNDQTHVIKGKRTKRQRLSSPLALTMASSSSSGEEG
FT                   DGGGRVSDNSGGVDRATTSPTTSTDHEFAESTEEEEDMANCLILLAQGQSRKVAVPAAA
FT                   ATSSKATGFYVYQCKTCYRCFPSFQALGGHRASHKRPKAVTEEKRTWALMEDEYDQFNH
FT                   NSTALSLQIPNRGLYSNNKSKVHECSICGAEFSSGQALGGHMRRHRTFTGPPPTMPMAT
FT                   SSPESQEAKKPRNILQLDLNLPAPEDDHRESKFPFATKEQALVFSASPLVDCHY"
FT   3'UTR           3633248..3633349
FT                   /locus_tag="VIT_08s0007g04770"
FT                   /old_locus_tag="Vv08s0007g04770"
FT   gene            3638901..3644246
FT                   /locus_tag="VIT_08s0007g04760"
FT                   /old_locus_tag="Vv08s0007g04760"
FT   mRNA            join(3638901..3638912,3638913..3639078,3643292..3643383,
FT                   3643472..3643645,3643827..3643922,3644004..3644081,
FT                   3644082..3644246)
FT                   /locus_tag="VIT_08s0007g04760"
FT                   /old_locus_tag="Vv08s0007g04760"
FT                   /product="unknown predicted protein"
FT   5'UTR           3638901..3638912
FT                   /locus_tag="VIT_08s0007g04760"
FT                   /old_locus_tag="Vv08s0007g04760"
FT   CDS_pept        join(3638913..3639078,3643292..3643383,3643472..3643645,
FT                   3643827..3643922,3644004..3644081)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04760"
FT                   /old_locus_tag="Vv08s0007g04760"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIT9"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIT9"
FT                   /protein_id="CBI30165.3"
FT                   /translation="MAVPGRRNGLMEEDDDNDEAVFGELIEDEVEAPAHLRNLAAAAQL
FT                   GDVDALRLALDTLNGSIDEPVEDGDTALHLTCLYGFLPCVQLLLERGASLEAKDEDGAI
FT                   PLHDACAGGFTEIVELLMNSTNNTECVKRMLESVDVEGDTPLHHAARGEHVGVIRLLLA
FT                   HGASPTKGNIYGKIPSELADMDTEAKRILEAAAVEHRS"
FT   3'UTR           3644082..3644246
FT                   /locus_tag="VIT_08s0007g04760"
FT                   /old_locus_tag="Vv08s0007g04760"
FT   gene            3646545..3649620
FT                   /locus_tag="VIT_08s0007g04750"
FT                   /old_locus_tag="Vv08s0007g04750"
FT   mRNA            join(3646545..3646550,3646551..3646623,3647421..3647493,
FT                   3647575..3647675,3648414..3648479,3648627..3648724,
FT                   3648800..3648862,3649185..3649277,3649355..3649438,
FT                   3649439..3649620)
FT                   /locus_tag="VIT_08s0007g04750"
FT                   /old_locus_tag="Vv08s0007g04750"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           3646545..3646550
FT                   /locus_tag="VIT_08s0007g04750"
FT                   /old_locus_tag="Vv08s0007g04750"
FT   CDS_pept        join(3646551..3646623,3647421..3647493,3647575..3647675,
FT                   3648414..3648479,3648627..3648724,3648800..3648862,
FT                   3649185..3649277,3649355..3649438)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04750"
FT                   /old_locus_tag="Vv08s0007g04750"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIU0"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIU0"
FT                   /protein_id="CBI30166.3"
FT                   /translation="MAAAPARARADYDYLVKLLLIGDSGVGKSCLLLRFSDDSFTTSFI
FT                   TTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDESSFN
FT                   NIRNWIRNIEQHASDNVNKILVGNKADMDESKRAVPTSQGQALADEYGIKFFETSAKTN
FT                   FNVEQVFFSIARDIKQRIAESDSKAEPLTIKISKPDPAIGSATAQEKSACCGS"
FT   3'UTR           3649439..3649620
FT                   /locus_tag="VIT_08s0007g04750"
FT                   /old_locus_tag="Vv08s0007g04750"
FT   gene            complement(3649905..3658087)
FT                   /locus_tag="VIT_08s0007g04740"
FT                   /old_locus_tag="Vv08s0007g04740"
FT   mRNA            complement(join(3649905..3650104,3650105..3650215,
FT                   3650470..3650598,3654164..3654285,3655792..3655857,
FT                   3656666..3656734,3657939..3658077,3658078..3658087))
FT                   /locus_tag="VIT_08s0007g04740"
FT                   /old_locus_tag="Vv08s0007g04740"
FT                   /product="Predicted protein"
FT   3'UTR           complement(3649905..3650104)
FT                   /locus_tag="VIT_08s0007g04740"
FT                   /old_locus_tag="Vv08s0007g04740"
FT   CDS_pept        complement(join(3650105..3650215,3650470..3650598,
FT                   3654164..3654285,3655792..3655857,3656666..3656734,
FT                   3657939..3658077))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04740"
FT                   /old_locus_tag="Vv08s0007g04740"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIU1"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIU1"
FT                   /protein_id="CBI30167.3"
FT                   /translation="MGSSSGQSSSYDLSFKILLIGDSAVGKSSLLVSFISSSVEDLAPT
FT                   IGVDFKIKQLTVGGKRLKLTIWDTAGQERFRTLTSSYYRGAQGIILVYDVTRRESFTNL
FT                   SDVWAKEVELYSTNQDCVKMLVGNKVDRESERVVSREEGIALAKEHGCLFFECSAKTRE
FT                   NVEKCFEELALKIMEVPSLLEEGSTVGKRNILKPKPENQPPPTGGCCS"
FT   5'UTR           complement(3658078..3658087)
FT                   /locus_tag="VIT_08s0007g04740"
FT                   /old_locus_tag="Vv08s0007g04740"
FT   gap             3665027..3665126
FT                   /estimated_length=100
FT   gap             3666667..3666685
FT                   /estimated_length=19
FT   gene            3677524..3677757
FT                   /locus_tag="VIT_08s0007g04730"
FT                   /old_locus_tag="Vv08s0007g04730"
FT   mRNA            3677524..3677757
FT                   /locus_tag="VIT_08s0007g04730"
FT                   /old_locus_tag="Vv08s0007g04730"
FT   CDS_pept        3677524..3677757
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04730"
FT                   /old_locus_tag="Vv08s0007g04730"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIU2"
FT                   /protein_id="CBI30168.3"
FT                   /translation="MSPFPMLYPYINYLTLLESLLESLLEMTTSTNELPNPFSRNPTIE
FT                   DSPLHSRGRLPSPKMPYLETNNLHMTTKMSFL"
FT   gap             3682412..3682511
FT                   /estimated_length=100
FT   gene            complement(3683182..3685242)
FT                   /locus_tag="VIT_08s0007g04720"
FT                   /old_locus_tag="Vv08s0007g04720"
FT   mRNA            complement(join(3683182..3683463,3683464..3684718,
FT                   3684810..3684869,3684999..3685242))
FT                   /locus_tag="VIT_08s0007g04720"
FT                   /old_locus_tag="Vv08s0007g04720"
FT   CDS_pept        complement(3683182..3683463)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04720"
FT                   /old_locus_tag="Vv08s0007g04720"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIU3"
FT                   /protein_id="CBI30169.3"
FT                   /translation="MEWTLEVFENHNSNEINVYQIKVLSYLTAMLRKLLDSDFTKVNTT
FT                   FATLGSTRGYSTSSIIFFVFWSVDLIGDHFQGFVWNYPVSRKNSLVFL"
FT   gap             3684887..3684986
FT                   /estimated_length=100
FT   5'UTR           complement(3684999..3685242)
FT                   /locus_tag="VIT_08s0007g04720"
FT                   /old_locus_tag="Vv08s0007g04720"
FT   gene            3697347..3715274
FT                   /locus_tag="VIT_08s0007g04710"
FT                   /old_locus_tag="Vv08s0007g04710"
FT   mRNA            join(3697347..3697368,3697369..3697520,3697790..3697959,
FT                   3699658..3699734,3699870..3699935,3700140..3700214,
FT                   3700305..3700379,3714435..3714893,3714894..3715274)
FT                   /locus_tag="VIT_08s0007g04710"
FT                   /old_locus_tag="Vv08s0007g04710"
FT                   /product="unknown predicted protein"
FT   5'UTR           3697347..3697368
FT                   /locus_tag="VIT_08s0007g04710"
FT                   /old_locus_tag="Vv08s0007g04710"
FT   CDS_pept        join(3697369..3697520,3697790..3697959,3699658..3699734,
FT                   3699870..3699935,3700140..3700214,3700305..3700379,
FT                   3714435..3714893)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04710"
FT                   /old_locus_tag="Vv08s0007g04710"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKD0"
FT                   /db_xref="InterPro:IPR000690"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR031781"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKD0"
FT                   /protein_id="CCB55352.1"
FT                   /translation="MDRDWGSKPGTGGAASAQNEAIDRRERLRRLALETIDLAKDPYFM
FT                   RNHLGSYECKLCLTLHNNEGNYLAHTQGKRHQTNLAKRAAREAKEAPAQPQPHKRKVSV
FT                   RKTVKIGRPGYRVTKQFDPETKQRSLLFQIEYPEIEDLAKPRHRFMSSFEQRVQSFDKR
FT                   YQYLLFAAEPYEIIAFKVPSTEIDKSTPKFFSHWDPDSKMFTLQLYFKTKPPEANKPQP
FT                   ASAANGTTAPGAPPRPLPPPPQAPPPPPPPPQGLPPGATIANPPRGPPPPMPGTLPPPP
FT                   PPMGNGPRPMPPGGALPVPPPPVGSGTMANFTPGTQMARPPSMMPPQGFPGQQMQGQGI
FT                   RPPMQPPNMGQQVPRPQ"
FT   gap             3703901..3708775
FT                   /estimated_length=4875
FT   3'UTR           3714894..3715274
FT                   /locus_tag="VIT_08s0007g04710"
FT                   /old_locus_tag="Vv08s0007g04710"
FT   gene            complement(3716749..3738764)
FT                   /locus_tag="VIT_08s0007g04700"
FT                   /old_locus_tag="Vv08s0007g04700"
FT   mRNA            complement(join(3716749..3717133,3717134..3717413,
FT                   3717781..3717949,3719101..3719258,3720196..3720383,
FT                   3720682..3720792,3733346..3733511,3736474..3736641,
FT                   3737429..3738705,3738706..3738764))
FT                   /locus_tag="VIT_08s0007g04700"
FT                   /old_locus_tag="Vv08s0007g04700"
FT                   /product="Predicted protein"
FT   3'UTR           complement(3716749..3717133)
FT                   /locus_tag="VIT_08s0007g04700"
FT                   /old_locus_tag="Vv08s0007g04700"
FT   CDS_pept        complement(join(3717134..3717413,3717781..3717949,
FT                   3719101..3719258,3720196..3720383,3720682..3720792,
FT                   3733346..3733511,3736474..3736641,3737429..3738705))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04700"
FT                   /old_locus_tag="Vv08s0007g04700"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKD1"
FT                   /db_xref="InterPro:IPR002498"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="InterPro:IPR017163"
FT                   /db_xref="InterPro:IPR023610"
FT                   /db_xref="InterPro:IPR027483"
FT                   /db_xref="InterPro:IPR027484"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKD1"
FT                   /protein_id="CCB55353.1"
FT                   /translation="MSGPVATGDVVEGAISRTERTKSLDAITSNGKDYQSILTNGEVLH
FT                   ASSETVGFKSGNLFLPNGECYSGSLLGSVPEGPGKYVWSDGCVYEGGWRRGMRNGNGKI
FT                   RWSSGAAYEGEFSGGYMHGTGTYIGPDNMTYNGRWRLNLKHGLGYQNYPNGDVFEGSWI
FT                   QGTPEGPGKYTWANGNVYLGNMKGGKMSGKGTLTWTNGDSFEGSWLNGMMHGFGVYTWS
FT                   DGGYYVGTWTRGLKDGKGAFYPKGSSLPALQQLYINALRKRGLLPDLKKQFNVSHIHRA
FT                   SSVDMGNVKVGGNQVSRRGSSDKLSKGNLLNLDQSRNRNVALERRWSLEVSIEKVIGHD
FT                   LSLGLSESVSEGGEKESVKNAPILEREYMQGVLISEMVLDNRFSPSSRSAKRRQKKLTK
FT                   DVKRPGEAIIKGHRSYDLMLSLQLGIRYTVGKITPIQRREVRASDFGPRASFWMSFPKE
FT                   GSQLTPPHQSEDFKWKDYCPMVFRNLREMFKIDAADYMMSICGNDALRELSSPGKSGSV
FT                   FFLSQDDHFMIKTLRKSEVKVLLRMLPNYHHHVRSHENTLITKFFGLHRIKPSSGQKFR
FT                   FVVMGNMFCTELRIHRRFDLKGSSLGRSADKVEIDENTTLKDLDLNYRFYLEPSWRDAL
FT                   LMQIEIDSKFLEAQHIMDYSLLLGVHYRAPQHLRSLMSYNRSIGADGLGILAEEDSIED
FT                   DISSYPEGLVLVPRGSDDGSVVVGPHIRGSRLRASSAAGGEEVDLLLPGTASRLQIQLG
FT                   VNMPARAEKITGIQEVETLHETYDVVLYLGIIDILQEYNMGKKIEHAYKSLQFDSLSIS
FT                   AVDPTFYSKRFLEFIQKVFPPNEVTS"
FT   5'UTR           complement(3738706..3738764)
FT                   /locus_tag="VIT_08s0007g04700"
FT                   /old_locus_tag="Vv08s0007g04700"
FT   gene            3745256..3758871
FT                   /locus_tag="VIT_08s0007g04690"
FT                   /old_locus_tag="Vv08s0007g04690"
FT   mRNA            join(3745256..3745267,3745268..3745501,3746247..3746462,
FT                   3746590..3747711,3748364..3748486,3749317..3749498,
FT                   3749611..3749842,3749974..3750183,3753840..3753968,
FT                   3755202..3755270,3756900..3757022,3757981..3758031,
FT                   3758122..3758289,3758290..3758871)
FT                   /locus_tag="VIT_08s0007g04690"
FT                   /old_locus_tag="Vv08s0007g04690"
FT                   /product="unknown predicted protein"
FT   5'UTR           3745256..3745267
FT                   /locus_tag="VIT_08s0007g04690"
FT                   /old_locus_tag="Vv08s0007g04690"
FT   CDS_pept        join(3745268..3745501,3746247..3746462,3746590..3747711,
FT                   3748364..3748486,3749317..3749498,3749611..3749842,
FT                   3749974..3750183,3753840..3753968,3755202..3755270,
FT                   3756900..3757022,3757981..3758031,3758122..3758289)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04690"
FT                   /old_locus_tag="Vv08s0007g04690"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKD2"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007148"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKD2"
FT                   /protein_id="CCB55354.1"
FT                   /translation="MVKAYLRYEPAAAFGVIASVDSNIAYDSSGKHLLAPALEKVGVWH
FT                   VRQGVCTKTLTPSPSSRGSSFAVTSIASSQSSLIASGYADGSIRIWDCDKGTCVTTLNG
FT                   HKGAVTALRYNKIGSLLASGSKDNDVILWDVVGETGLFRLRGHRDQVTDLVFLDSGKKL
FT                   VSSSKDKFLRVWDLETQHCMQIVSGHHTEIWSIDTDPEERYLVTGSADPELRFYTIKHD
FT                   LVNERSISKLNGTEAVDSGDSSVQSKWEVLKLFGEIQRQSKDRVATVRFNKSGHLLACQ
FT                   VAGKIVEILRVLDESESKRKAKRRIHRKKEKKSIKEVADVTLDGDVNLLKGEESFIPTV
FT                   TVSDVFKLIHTLRASKKICSISFCPVTPKSSLASLALSLNNNLLEIHSIESSSSTKTLA
FT                   IELQGHRSDVRSVTLSSDNTLLMSTSHNAVKFWNPSTGSCLRTIDSGYGLCGLILPRNK
FT                   YALVGTKAGTIEIIDIGSGTCIEVVEAHGGSVRSIATIPDGNGFVTGSEDHEVKYWEYQ
FT                   YTQEPNQHTKPLMLSHVRTMKMNDDVQVVAVSPDAKYIAAALLDCTVKVFFMDSLKFFL
FT                   SLYGHKLPVLCMDVSSDGDLLVTGSADKNLKIWGLDFGDCHKSIFAHADSVMAVQFVRN
FT                   THYVFSAGKDRLIKYWDADKFELLLTLEGHHAEVWCLSISNRGDFIVSGSHDRSIHRWD
FT                   RTEEPFFIEEEKEKRLEQMFESDLDNAFENRYAPKEELPEEGAVALAGKKTKETLSATD
FT                   SIIDALDIAEDELKRISEHEEEKTKGKVADFQPNILMLGLSPSDFVLRALSNVHTNDME
FT                   QTLLALPFSDALKLLSYLKDWTINPDKVELVCRIATVLLQTHYNQLVTTPSARPVLSVL
FT                   RDILYARVKECKDVLGFNLAAMDHLKQLMALKSDALFQDAKTKLLEIRAQHSKRIEART
FT                   ETREEKQRKKKKKKSSDEHAWT"
FT   3'UTR           3758290..3758871
FT                   /locus_tag="VIT_08s0007g04690"
FT                   /old_locus_tag="Vv08s0007g04690"
FT   gene            complement(3760110..3761431)
FT                   /locus_tag="VIT_08s0007g04680"
FT                   /old_locus_tag="Vv08s0007g04680"
FT   mRNA            complement(join(3760110..3760354,3760355..3760664,
FT                   3760777..3761080,3761169..3761373,3761374..3761431))
FT                   /locus_tag="VIT_08s0007g04680"
FT                   /old_locus_tag="Vv08s0007g04680"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(3760110..3760354)
FT                   /locus_tag="VIT_08s0007g04680"
FT                   /old_locus_tag="Vv08s0007g04680"
FT   CDS_pept        complement(join(3760355..3760664,3760777..3761080,
FT                   3761169..3761373))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04680"
FT                   /old_locus_tag="Vv08s0007g04680"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKD3"
FT                   /db_xref="InterPro:IPR002963"
FT                   /db_xref="InterPro:IPR007112"
FT                   /db_xref="InterPro:IPR007117"
FT                   /db_xref="InterPro:IPR007118"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR036749"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKD3"
FT                   /protein_id="CCB55355.1"
FT                   /translation="MALPLRALLSSLLPLLLLLLSHDVHANGWTGNARHALLSKHHRPK
FT                   FKPGPWHNAHATFYGGADASQTMGGACGYGDLHKQGYGVQTAALSTVLFNGGQACGACF
FT                   EIKCVDDPQGCKRGQASLMVTATNLCPPSSNGGWCNPPREHFDLSQPAFLQIAEYKAGI
FT                   VPVQYRRVPCKKKGGIRFTISGNPYFNLVFIWNVGGAGDITSVQVKGDRKLKWTTLKRN
FT                   WGQNWETDAMLVGESLTFRVRVSDGRYSTSWHIAPKNWQFGQTFEGKNFK"
FT   5'UTR           complement(3761374..3761431)
FT                   /locus_tag="VIT_08s0007g04680"
FT                   /old_locus_tag="Vv08s0007g04680"
FT   gene            complement(3762121..3779960)
FT                   /locus_tag="VIT_08s0007g04670"
FT                   /old_locus_tag="Vv08s0007g04670"
FT   mRNA            complement(join(3762121..3762604,3762605..3762667,
FT                   3763748..3763890,3764937..3765169,3766267..3766455,
FT                   3770427..3770572,3771217..3771346,3771426..3771478,
FT                   3771552..3771672,3772329..3772501,3773757..3774028,
FT                   3775022..3775070,3776958..3777053,3777149..3777305,
FT                   3777569..3777674,3777751..3777836,3777946..3778034,
FT                   3778422..3778673,3779657..3779821,3779822..3779960))
FT                   /locus_tag="VIT_08s0007g04670"
FT                   /old_locus_tag="Vv08s0007g04670"
FT                   /product="Predicted protein"
FT   3'UTR           complement(3762121..3762604)
FT                   /locus_tag="VIT_08s0007g04670"
FT                   /old_locus_tag="Vv08s0007g04670"
FT   CDS_pept        complement(join(3762605..3762667,3763748..3763890,
FT                   3764937..3765169,3766267..3766455,3770427..3770572,
FT                   3771217..3771346,3771426..3771478,3771552..3771672,
FT                   3772329..3772501,3773757..3774028,3775022..3775070,
FT                   3776958..3777053,3777149..3777305,3777569..3777674,
FT                   3777751..3777836,3777946..3778034,3778422..3778673,
FT                   3779657..3779821))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04670"
FT                   /old_locus_tag="Vv08s0007g04670"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIU8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIU8"
FT                   /protein_id="CBI30174.3"
FT                   /translation="MEKYAELREAVEKVELVDAHAHNIVALDSAFPFIGCFSEANGDAL
FT                   SYATHSLCFKRSLREIAELYGSEVSLSGVEEYRRCSGLQSITSTCFKAARITAILIDDG
FT                   IDFDKKHDIQWHRNFTPIVGRILRIEHLAEKILDEEAPDGSPWTLDVFTAIFVGKLKSY
FT                   PLHISYIAAYRSGLEINTNVSRQDAEEGLAEVLYAGKPVRITNKNFIDYIFTRSLEVAL
FT                   CFDLPMQLHTGFGDRDLDLRLANPLHLRTLLEDKRFSKCRIVLLHASYPFSKEASYLAS
FT                   VYPQVYLDFGLAIPKLSTHGMISSVKELLELAPIKKVMFSTDGYAFPETFYLGAKKARE
FT                   VVFTVLRDACIDGDLSIPEAVEAAEDIFAKNAIQFYKLNVAMKSIDLKNAICPKLMSIG
FT                   NNSSQNDITLVRIIWVDASGQQRCRVVPARRFYDVVLKNGVGLTFACMGMSSAIDGPAD
FT                   GTNLSGVGETRLVPDLSTKCRIPWAKQEEMVLADMHLKPGKPWEYCPREALRRISKVLK
FT                   DEFNLVVNAGFEVEFYLLKRILREGKEEWVPFDSTPYCSTSAFDAASPIFHEVLAALQS
FT                   LNVPVEQLHAEAGKGQFEIALGHTVCSCSADNLIFTHEVIKACARRHGLLATFVPKYTL
FT                   DDIGSGSHVHISLWENGENVFMASGQGSHYGISKVGEEFMAGVLHHLPSILAFTAPVPN
FT                   SYDRIQPDTWSGAYQCWGQENREAPLRTACPPGVPDGLVSNFEIKSFDGCANPHLGLAS
FT                   IIASGIDGLRKHLQLPVPVDENPSDLSAELRRLPKSLSESLEALGKDNVMKDLIGEKLL
FT                   VAIKGIRKAEINYYSQNVDAYKQLIHRY"
FT   5'UTR           complement(3779822..3779960)
FT                   /locus_tag="VIT_08s0007g04670"
FT                   /old_locus_tag="Vv08s0007g04670"
FT   gene            3792468..3794680
FT                   /locus_tag="VIT_08s0007g04650"
FT                   /old_locus_tag="Vv08s0007g04650"
FT   mRNA            join(3792468..3792480,3794003..3794679,3794680..3794680)
FT                   /locus_tag="VIT_08s0007g04650"
FT                   /old_locus_tag="Vv08s0007g04650"
FT                   /product="Thaumatin-like protein 1"
FT   CDS_pept        join(3792468..3792480,3794003..3794679)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04650"
FT                   /old_locus_tag="Vv08s0007g04650"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKD4"
FT                   /db_xref="InterPro:IPR001938"
FT                   /db_xref="InterPro:IPR037176"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKD4"
FT                   /protein_id="CCB55356.1"
FT                   /translation="MRIKGVHSATFTFKNQCPYTVWPATLTGAGSQLSSTGFELASGAS
FT                   SSLDVPAPWSGRFWARTLCSTDSTGKFACATADCASNQVSCNGAGAIPPASLIELTIAP
FT                   NGGQDFYDVSLVDGFNLPLSVTPQGGSGDCNTTSCPANVNSACPSDLAMKGSDGSVIGC
FT                   KSACLVFNQPQYCCTGQYATPETCLPTDYSRFFKSQCSQAYSYAYDDKSSTFTCFGGPN
FT                   YLITFCP"
FT   3'UTR           3794680..3794680
FT                   /locus_tag="VIT_08s0007g04650"
FT                   /old_locus_tag="Vv08s0007g04650"
FT   gene            3808163..3875023
FT                   /locus_tag="VIT_08s0007g04630"
FT                   /old_locus_tag="Vv08s0007g04630"
FT   mRNA            join(3808163..3808302,3808303..3808426,3809575..3809794,
FT                   3810030..3810177,3811853..3811935,3812059..3812101,
FT                   3812587..3812643,3812762..3812855,3813841..3813967,
FT                   3815914..3815968,3816073..3816204,3816585..3816656,
FT                   3817617..3817707,3817843..3817938,3818481..3818559,
FT                   3818661..3818724,3819517..3819620,3821034..3821139,
FT                   3822465..3822554,3822842..3822919,3823925..3824101,
FT                   3824510..3824599,3824794..3824859,3825069..3825167,
FT                   3825261..3825335,3830132..3830191,3831003..3831092,
FT                   3831628..3831749,3834766..3834895,3834976..3835055,
FT                   3836480..3836615,3836855..3836936,3837654..3837799,
FT                   3837913..3837993,3838099..3838199,3843253..3843491,
FT                   3843570..3843679,3843782..3843910,3844382..3844456,
FT                   3844557..3844690,3844883..3844955,3845112..3845243,
FT                   3851202..3851383,3851467..3851589,3851702..3851762,
FT                   3851870..3851965,3857686..3857786,3858326..3858431,
FT                   3859020..3859133,3859239..3859313,3871959..3872057,
FT                   3873323..3873394,3873481..3873566,3873663..3873756,
FT                   3874211..3874318,3874403..3874561,3874562..3875023)
FT                   /locus_tag="VIT_08s0007g04630"
FT                   /old_locus_tag="Vv08s0007g04630"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           3808163..3808302
FT                   /locus_tag="VIT_08s0007g04630"
FT                   /old_locus_tag="Vv08s0007g04630"
FT   CDS_pept        join(3808303..3808426,3809575..3809794,3810030..3810177,
FT                   3811853..3811935,3812059..3812101,3812587..3812643,
FT                   3812762..3812855,3813841..3813967,3815914..3815968,
FT                   3816073..3816204,3816585..3816656,3817617..3817707,
FT                   3817843..3817938,3818481..3818559,3818661..3818724,
FT                   3819517..3819620,3821034..3821139,3822465..3822554,
FT                   3822842..3822919,3823925..3824101,3824510..3824599,
FT                   3824794..3824859,3825069..3825167,3825261..3825335,
FT                   3830132..3830191,3831003..3831092,3831628..3831749,
FT                   3834766..3834895,3834976..3835055,3836480..3836615,
FT                   3836855..3836936,3837654..3837799,3837913..3837993,
FT                   3838099..3838199,3843253..3843491,3843570..3843679,
FT                   3843782..3843910,3844382..3844456,3844557..3844690,
FT                   3844883..3844955,3845112..3845243,3851202..3851383,
FT                   3851467..3851589,3851702..3851762,3851870..3851965,
FT                   3857686..3857786,3858326..3858431,3859020..3859133,
FT                   3859239..3859313,3871959..3872057,3873323..3873394,
FT                   3873481..3873566,3873663..3873756,3874211..3874318,
FT                   3874403..3874561)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04630"
FT                   /old_locus_tag="Vv08s0007g04630"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR000313"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKD5"
FT                   /protein_id="CCB55357.1"
FT                   /translation="MAKKKENVIRIDHIPKSCRQPRSHPRRRTDFSTLLSTPFHGGSLL
FT                   RSSSSKDTLSSVSIASLDDRMEKRTEMAKLPLIKCNNSEDKGLCSDVYEIPIDEVESVV
FT                   QGAHFDSGNDRTFDEQKDDNAATLDFMPIKSQVMESSGAFTNPGSVVWAKTACQVWWPA
FT                   EVMEEKSTDSRNQGIDGHVLVQYYGNHHSAWVDPDRDLSLFEDCFEERSCNPMEDFQDA
FT                   LKQALHRKRHLNSCRQLVGSPDGPDNLHQQDQSSGGGTSIETSKKGSPVQDNAVPWPHS
FT                   SSWFTFFTSSCKNRFQVINPLLVLECCCAVSRGGRRRFGNMSGLFQVMASAVRALEKRD
FT                   VDPPFMAKLAKIATAEMISSKELSADWQRAAAGLLVSIGSHLPDLMMEEIFLHLPGPNS
FT                   ALPAMVQILADFASADALQFTPRLKGVLSRVLPILGNVRDAHRPIFANAFKCWCQASWQ
FT                   YSMDFPSTSPLDADVMSFLNSAFELLLRVWATSRDLKVRVSSVEALGQMVGLITRAQLK
FT                   AALPRLVPTILELYKKDLDIAFLATCSLHNLLNASLLSENGPPLLDFEELMVILSTLLP
FT                   VVCINNDSKEQSDFSVGLKTYNEVQHCFLTVGLVYPEDLFMFLLNLVVIMASHCYLVGP
FT                   SGELFVEYLVRNCALSDQESYALENSKEVIRSNNNNYGCQYKRLEVKSGAVCLTELRSI
FT                   CEKGLLLLTITIPEMEHILWPFLLKMIIPRAYTGAAATVCRCISELCRHGSSYANTMLS
FT                   ECKARIDIPNPEELFARLVVLLHNPLAREQLATQVLTVLYYLAPLFPKNINLFWQDEIP
FT                   KMKAYVSDTDDLKQDPSYQETWDDMIINFLAESLDVIQDTEWVISLGNAFSRQYELYTS
FT                   DDEHSALLHRCLGILLQKVDDRLYVLEKINWMYTQANIAFPSNRLGLAKAMGLVAASHL
FT                   DTVLEKLKDILDNVGQSIFQRILSFFSDRGRMEESDDIHAALALMYGYAARYAPSTVIE
FT                   ARIDALVGTNMLSRLLHVRHPTAKQAVITAIDLLGRAVINAAESGASFPLKRRDQLLDY
FT                   ILTLMGCDDDDGFAESSLELLHTQALALSACTTLVSVEPKLTIETRNHVMKATLGFFAL
FT                   PNEPSDVVDPLIDNLITLLCAILLTSGEDGRSRAEQLLHILRQIDQYVSSPLEYQRKRS
FT                   CLAVYEMLLKFKSVCVSGYCALGCHGSCTHSKHIDRTLHGNFSNLPSAFVLPSRDSLCL
FT                   GNRVIMYLPRCADTNSEVRKISAQILDLFFSISLSLPRPVGSSFGVDIELSYSALSSLE
FT                   DVIAILRSDASIDPSEVFNRVVSSVCVLLTKDELVAALHYCTGAICDKIKQSAEGAIQA
FT                   VTDFVMKRGHELNEMDVSRTTQSLLSAAAHVTEKYLRQETLAAISSLAENTSSKIVFNE
FT                   VLTTAARDIVTKDISRLRGGWPMQDAFYAFSQHIVLSYMFLEHVISVLSQSPIVKDDPE
FT                   KGDSSSHRVDSHIEDNILQAAIFALTAFFRGGGKIGKKAVEQSYASVLAALTLQLGSCH
FT                   GLATSGEQEPLRALLIAFQAFCECVGDLEMGKILARDGEQNENEKWINLIGDLAGCISI
FT                   KRPKEVPTICLILTKSLDRHQGFQREAAAAALSEFVRYSDGLDSLLEQMVEALCRHASD
FT                   DSPTVRCLCLRGLVQIPSIHILQYTNQVLGVIMALLEDSDESVQLTAVSCLLKVLESSP
FT                   NDAVEPILINLSVRIRNLQICTNVKMRANAFAGLGSLSNYGVGAQREAFLEQVHAAFPR
FT                   LVLHIHDDDLSVRLACRSTLKRIAPLMELEGMFALFNTHSFNSDHRSDYEDFVRDLSKQ
FT                   FSLRLSSRVDTYMASTIQAFDAPWPTIQANAIYFSSSMLSVSDDQHILALYYTRVFGML
FT                   ISKMSHSADEIVRATCSSALGLLLKSTNLLQWRASGLDRADSARERP"
FT   gap             3841200..3841299
FT                   /estimated_length=100
FT   gap             3841827..3841926
FT                   /estimated_length=100
FT   gap             3869144..3869228
FT                   /estimated_length=85
FT   3'UTR           3874562..3875023
FT                   /locus_tag="VIT_08s0007g04630"
FT                   /old_locus_tag="Vv08s0007g04630"
FT   gene            3875217..3876401
FT                   /locus_tag="VIT_08s0007g04620"
FT                   /old_locus_tag="Vv08s0007g04620"
FT   mRNA            join(3875217..3875234,3875385..3875467,3876248..3876401)
FT                   /locus_tag="VIT_08s0007g04620"
FT                   /old_locus_tag="Vv08s0007g04620"
FT   CDS_pept        join(3875217..3875234,3875385..3875467,3876248..3876401)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04620"
FT                   /old_locus_tag="Vv08s0007g04620"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIV3"
FT                   /protein_id="CBI30179.3"
FT                   /translation="MVRYLIQGNQRNHPPISATTFAKISSSHTHSLLIYHFLYWRLGLW
FT                   CNRVSSSIRPKVLFCFELLRFPFSSCSRTDDHHCYFNSL"
FT   gene            3876803..3878290
FT                   /locus_tag="VIT_08s0007g04610"
FT                   /old_locus_tag="Vv08s0007g04610"
FT   mRNA            join(3876803..3877134,3877228..3878290)
FT                   /locus_tag="VIT_08s0007g04610"
FT                   /old_locus_tag="Vv08s0007g04610"
FT                   /product="unknown predicted protein"
FT   CDS_pept        join(3876803..3877134,3877228..3878290)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04610"
FT                   /old_locus_tag="Vv08s0007g04610"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKD6"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="InterPro:IPR035595"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKD6"
FT                   /protein_id="CCB55358.1"
FT                   /translation="MASQLLQLHFVLIPFMAPGHLIPMVDMARLLAQHGVIVTVVTTPL
FT                   NATRFKSMIDRAVESGLQIHLLELQFPAVEAGLPEGCENVDLLPSRSLIRNFFVAASML
FT                   QQPLEQLLYFDAMSCFAFSCSHNLEASKVHESISKLETFLVPGLPDQIELTKAQLPESL
FT                   NPDSSDLTGILNQMRASESIADGIVVNTYEELEPRYVKEYKRIKGDKVWCIGPVSACNK
FT                   LNLDKAERGKKALVDENQCLRWLDSWEPNSVVYACLGSISGLTALQLIELGLGLEASNR
FT                   PFIWVIRGGEKSKELERWILEEGFEERTEGRGLLIRGWAPQMLILSHPSIGVFLTHCGW
FT                   NSTLEGVCTGVPILTCPLFAEQFINEKLVVQILGIGVSVGVESAVTWGMEEKFGVVMKR
FT                   EDVMKAIDEVMDKGEGGEKRRKRARELGEMAKKAIEEGGSSYLNMKRLIHYILQQTIGN
FT                   PSTQLS"
FT   gene            3880718..3882161
FT                   /locus_tag="VIT_08s0007g04600"
FT                   /old_locus_tag="Vv08s0007g04600"
FT   mRNA            join(3880718..3881603,3881694..3881950,3881951..3882161)
FT                   /locus_tag="VIT_08s0007g04600"
FT                   /old_locus_tag="Vv08s0007g04600"
FT                   /product="unknown predicted protein"
FT   CDS_pept        join(3880718..3881603,3881694..3881950)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04600"
FT                   /old_locus_tag="Vv08s0007g04600"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKD7"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKD7"
FT                   /protein_id="CCB55359.1"
FT                   /translation="MDNLPSRELLANFYVAIRMLQQPVEKLFEEMKPSPSCIISDANLA
FT                   WPADTARKFQVPRFYFDGRNCFSLLCSHNLHITKVHEQVSESEPFVVPGLPHRITLTRA
FT                   QLPGAFSSNFSDLNDTRREIRAAELVADGVVVNSFEELEAEYVKEYRKVKGDKIWCIGP
FT                   VSVCHKEDIDKAQRGNNTSTDQNQCLKWLDSWEPSSVVYACLGSLSNITPPQLIELGLG
FT                   LEASNCPFILVLRGHKAEEMEKWISDDGFEERTKERGLLIRGWVPQILILSHPAVGGFL
FT                   THCGWNSTLEAVSAGVEVSVQLGQEEKFGVLVKWEEVQKAISKVMDKGPEGRKRRERVR
FT                   KLGVMANKAMEQGGSSNHNIALLIENIKQHATVHSSKDTS"
FT   3'UTR           3881951..3882161
FT                   /locus_tag="VIT_08s0007g04600"
FT                   /old_locus_tag="Vv08s0007g04600"
FT   gene            3883829..3885354
FT                   /locus_tag="VIT_08s0007g04590"
FT                   /old_locus_tag="Vv08s0007g04590"
FT   mRNA            join(3883829..3883898,3883899..3885311,3885312..3885354)
FT                   /locus_tag="VIT_08s0007g04590"
FT                   /old_locus_tag="Vv08s0007g04590"
FT                   /product="unknown predicted protein"
FT   5'UTR           3883829..3883898
FT                   /locus_tag="VIT_08s0007g04590"
FT                   /old_locus_tag="Vv08s0007g04590"
FT   CDS_pept        3883899..3885311
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04590"
FT                   /old_locus_tag="Vv08s0007g04590"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKD8"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKD8"
FT                   /protein_id="CCB55360.1"
FT                   /translation="MIDIAKLLAQHGVIVTVITTPVNAAGLTTIIDRAVDSGLRIQLLQ
FT                   VPFPSVEAGLPEGCESMDRLPSRDLFRNLLIGIGMLKQPVENLFDELQPRVSCIIADKN
FT                   LVWTDDTARRFQIPRLVFDGISCFSLLCTHNLHVSKVHEKVSEGEPFVVPGLPDRIELT
FT                   RAQLPGAVNMGGTDLREMRNQIREAELAAYGVVVNTFEELEPAYVKEFRKVRGDKVWCV
FT                   GPVSLCHKENKDKAERGNKASIDEKQCFNWLDSKEPSSVVYACLGSLSRLTPLQLMELG
FT                   LALEASNRPFIWAIKEGKNAQELEKILLEDGFMERTRGRGLLIRGWAPQVLILSHPAIG
FT                   GFLTHCGWNSTLEGVCAGVPMITWLLFAEQFYNEKFVVQVLRIGVRVGAEFAVKWGEEE
FT                   KFGVVLKREVVEKAIEQLMEEGVEGQERRKRARELGEMAKRAMEEGGSSYLNMTLLIQD
FT                   IMQQVTCNQTKT"
FT   3'UTR           3885312..3885354
FT                   /locus_tag="VIT_08s0007g04590"
FT                   /old_locus_tag="Vv08s0007g04590"
FT   gene            complement(3888975..3890577)
FT                   /locus_tag="VIT_08s0007g04580"
FT                   /old_locus_tag="Vv08s0007g04580"
FT   mRNA            complement(join(3888975..3889353,3889354..3890577))
FT                   /locus_tag="VIT_08s0007g04580"
FT                   /old_locus_tag="Vv08s0007g04580"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(3888975..3889353)
FT                   /locus_tag="VIT_08s0007g04580"
FT                   /old_locus_tag="Vv08s0007g04580"
FT   CDS_pept        complement(3889354..3890577)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04580"
FT                   /old_locus_tag="Vv08s0007g04580"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKD9"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="InterPro:IPR035595"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKD9"
FT                   /protein_id="CCB55361.1"
FT                   /translation="MDSIPSPDLKKQFFLASSMLQQPLENLLGHLEPPPSCIIASVCLP
FT                   WTRDVAVKFKIPWLVFHGISCFTLLCGKNIARSDVLKSVAADSEPFEVPGMPDKIEFTK
FT                   AQLPPGFQPSSDGSGFVEKMRATAILAQGVVVNSFEDLEPNYLLEYKKLVNKVWCIGPV
FT                   SLCNKEMSDKFGRGNKTSIDENQCLKWLDSRKPKSVIYACFGSLCHFSTSQLIEIGLGL
FT                   EASNRPFVWIIRQSDCSFEIEEWLLEERYEERIKGRGLIIRGWAPQVLILSHPAAGGFL
FT                   THSGWNSTIEAICSGVPMITWPMFAEQFYNEKLVVQVLRIGVEVIVQWGEEEKAGALVK
FT                   RNQIKEAVDKLMDEGKEGEERRERARKLGELAKMAVEEGGSSHLNTTLLIQDIMEQVNQ
FT                   NGPTKEIV"
FT   gene            3902744..3904323
FT                   /locus_tag="VIT_08s0007g04570"
FT                   /old_locus_tag="Vv08s0007g04570"
FT   mRNA            join(3902744..3904222,3904223..3904323)
FT                   /locus_tag="VIT_08s0007g04570"
FT                   /old_locus_tag="Vv08s0007g04570"
FT                   /product="Predicted protein"
FT   CDS_pept        3902744..3904222
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04570"
FT                   /old_locus_tag="Vv08s0007g04570"
FT                   /product="unknown"
FT                   /db_xref="GOA:A5BL00"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="InterPro:IPR035595"
FT                   /db_xref="UniProtKB/TrEMBL:A5BL00"
FT                   /protein_id="CCB55362.1"
FT                   /translation="MASTSNQLHFVLVPLLAQGHMIPMIDMARLLAERDVVVSLITTPF
FT                   NASRFENTIHRAADAGLPIRLVPIPFPCREVGLPPECENLDIVPSRDLIRKFYSAMDKL
FT                   QQPLEHYLQQQKPPPSCIISDKCLSWTSGTARKFGIPRLVFHGMCCFSLLSSHNIWLHN
FT                   AHRSVLSDSQPFVVPGMPQKIEIKKAQLPGAFVTLPDLDDIRNQMREAESTAYGVVVNT
FT                   FNELEHGCVEEYEKAIKKKVWSIGPVSLSNKHNLDKFERGNKASIDEKQCLGWLDSMKP
FT                   GSVVYACLGSQCRLVPAQLIELGLGLEASKQPFIWVIKTGERFSELEDWLVEERFEDRI
FT                   KGRGLVIKGWAPQVLILSHPAIGGFLTHCGWNSTVEGVCSGVPMITWPLFAEQFLNEKL
FT                   IIEVLRIGVSLGVEVPVRWGDEERVGVLVKKCEVEKAVETLMDGGEEGEMRKKRARELS
FT                   TSARRAMEDGGSSHVNMSILIQDITKLQSTQENS"
FT   3'UTR           3904223..3904323
FT                   /locus_tag="VIT_08s0007g04570"
FT                   /old_locus_tag="Vv08s0007g04570"
FT   gene            3909021..3912869
FT                   /locus_tag="VIT_08s0007g04560"
FT                   /old_locus_tag="Vv08s0007g04560"
FT   mRNA            join(3909021..3909034,3911299..3911536,3911680..3911895,
FT                   3912332..3912556,3912557..3912869)
FT                   /locus_tag="VIT_08s0007g04560"
FT                   /old_locus_tag="Vv08s0007g04560"
FT                   /product="putative uncharacterized protein"
FT   CDS_pept        join(3909021..3909034,3911299..3911536,3911680..3911895,
FT                   3912332..3912556)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04560"
FT                   /old_locus_tag="Vv08s0007g04560"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKE1"
FT                   /db_xref="InterPro:IPR006734"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKE1"
FT                   /protein_id="CCB55363.1"
FT                   /translation="MVVPRYQTVPDSLPEFHLRVQNKRQCRFHRGWNHCSPHPSSPSAA
FT                   PMEMRPGANATCIAWIAVATPFAFIAAHLDTRIIKSFRQIRRSSYHDVVRVAEIQKVLD
FT                   ISGVQTYVINSARVLFLNERPQPKTGKGVSHICETCGRSLLDPFRFCSLGCKLVGIKRN
FT                   GDASFSLEAKNEMAMERGEGISRRESSRDEDELREGLQQDIYPPTPPPPPSSARRRKGI
FT                   PHRAPFAS"
FT   3'UTR           3912557..3912869
FT                   /locus_tag="VIT_08s0007g04560"
FT                   /old_locus_tag="Vv08s0007g04560"
FT   gene            3918314..3920480
FT                   /locus_tag="VIT_08s0007g04550"
FT                   /old_locus_tag="Vv08s0007g04550"
FT   mRNA            join(3918314..3918453,3918454..3919202,3919359..3920145,
FT                   3920146..3920480)
FT                   /locus_tag="VIT_08s0007g04550"
FT                   /old_locus_tag="Vv08s0007g04550"
FT                   /product="unknown predicted protein"
FT   5'UTR           3918314..3918453
FT                   /locus_tag="VIT_08s0007g04550"
FT                   /old_locus_tag="Vv08s0007g04550"
FT   CDS_pept        join(3918454..3919202,3919359..3920145)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04550"
FT                   /old_locus_tag="Vv08s0007g04550"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKE2"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKE2"
FT                   /protein_id="CCB55364.1"
FT                   /translation="MVSKYLSLHLPPNPHSSSTTAISPTTTRFLTTRPFPTSIPTKLSV
FT                   SRRWLSFSTMASSQATPSPTPTSKFNDFEPHPTLTNDDLKPTAPHQRTFSGWEMASLWV
FT                   GLVVGVPSYYLAGSLVELGMAWWQGIATVVAANIILLVPLVLTGHPGTRYGISFPVLAR
FT                   SAFGIRGAHLPTLLRALVGCGWYGIETWIGGEAIFLLLPKTIKQSSLSQFLPWLGTSPL
FT                   EFSCFIVFWLAQLAIVWRGMDGIRELENFWATVALNIPDFTRYAKTQTDQIIGQVGLPI
FT                   FMGAFTFVGLAVTSSTTVIFGRLISNPIQLLGQIGGFTTMILAIIGISLATITTNIAAN
FT                   VVAPANALVNLSPSKFTFRRGALLTALLGIAFQPWRLLHSSESFVYTWLVGYSALLGPI
FT                   GSIILADYYLIHRMNLSINDLYSLSPHGAYYYSGGYNLAAMTALVIGILPVVPGLLQKL
FT                   GILTSVPDTFVAIYNNAWFFSFFSAGILYWILSCLKGKDRNSHPLDPLLPAAN"
FT   3'UTR           3920146..3920480
FT                   /locus_tag="VIT_08s0007g04550"
FT                   /old_locus_tag="Vv08s0007g04550"
FT   gene            3924413..3927912
FT                   /locus_tag="VIT_08s0007g04540"
FT                   /old_locus_tag="Vv08s0007g04540"
FT   mRNA            join(3924413..3924700,3924814..3925061,3925178..3925529,
FT                   3925629..3925874,3925875..3925896,3927721..3927912)
FT                   /locus_tag="VIT_08s0007g04540"
FT                   /old_locus_tag="Vv08s0007g04540"
FT                   /product="unknown predicted protein"
FT   CDS_pept        join(3924413..3924700,3924814..3925061,3925178..3925529,
FT                   3925629..3925874)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04540"
FT                   /old_locus_tag="Vv08s0007g04540"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKE3"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKE3"
FT                   /protein_id="CCB55365.1"
FT                   /translation="MSPAMGITTESKQENDPLDTHYQNGVKHLCENGISKVPNKYILPV
FT                   SERPSSDNGVPNAAELSLNLPVIDFAELQGSNRSQVLKSIANACEEYGFFQLVNHGIPS
FT                   DIISSMIDVSQRFFDLPMEERAKYMSADMCSPVRYGTSFNQTKDGVFCWRDFLKLMCHP
FT                   LSDVLPHWPSSPVDFRKLAVTYSKETKYLFLTLMEAILESLGLCGDTKKKTGEEDDDIL
FT                   EKFQDGSQLMVVNCYPPCPEPELTLGMPPHSDYGFLTLLLQDDIQGLQIQFKGKWLTVE
FT                   PLANSFVINIGDHLEIFSNGKYKSVLHRVVVNSTKPRISVASLHSLPFKCMVKPAPQLI
FT                   SQENPRHYKDTDFASFLDYISSCEPKRKNFLESRKLS"
FT   3'UTR           join(3925875..3925896,3927721..3927912)
FT                   /locus_tag="VIT_08s0007g04540"
FT                   /old_locus_tag="Vv08s0007g04540"
FT   gene            3927913..3936359
FT                   /locus_tag="VIT_08s0007g04530"
FT                   /old_locus_tag="Vv08s0007g04530"
FT   mRNA            join(3927913..3928395,3928958..3929254,3929338..3929535,
FT                   3930018..3930119,3931370..3931510,3931612..3931719,
FT                   3932106..3932188,3932362..3932524,3933079..3933144,
FT                   3933145..3933234,3934244..3934443,3934982..3935227,
FT                   3936170..3936359)
FT                   /locus_tag="VIT_08s0007g04530"
FT                   /old_locus_tag="Vv08s0007g04530"
FT                   /product="putative epsilon-ring carotene hydroxylase"
FT   CDS_pept        join(3927913..3928395,3928958..3929254,3929338..3929535,
FT                   3930018..3930119,3931370..3931510,3931612..3931719,
FT                   3932106..3932188,3932362..3932524,3933079..3933144)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04530"
FT                   /old_locus_tag="Vv08s0007g04530"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKE4"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKE4"
FT                   /protein_id="CCB55366.1"
FT                   /translation="MPSLMSLSSFALLTPPTFNFKPTTLPPNPSLPYLSITCSSDNNPK
FT                   PTRSSSWVSPDWLTSLSRSLTMGQDDSGIPMATAKLDDVSELLGGALFLPLFRWMNMYG
FT                   PIYRLAAGPRNFVVVSDPAIAKHVLRNYGKYAKGLVAEVSEFLFGSGFAIAEGELWTVR
FT                   RRAVVPSLHKRYLSIIVDRVFCKCAERLVENLRTDALNGSAVNMEEKFSQLTLDVIGLS
FT                   VFNYNFDSLTADSPVIDAVYTALKEAEARSTDLLPYWKVKALCKIIPRQIKAEESVTVI
FT                   RKTVEELIAKCKEIVEREGERIDEDEYVNDSDPSILRFLLASREEVSSVQLRDDLLSML
FT                   VAGHETTGSVLTWTLYLLSKNSSSLMKAQEEVDRVLQGRSPSYEDIKDLKFLTRCINES
FT                   MRLYPHPPVLIRRAKVADVLPGNYKVNAGQDIMISVYNIHHSSQVWERAEDFLPERFDL
FT                   EGPVPNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFVQHMNFELVPDQNISMTT
FT                   GATIHTTNGLYMKLTQRQIPSAFVPTSSR"
FT   3'UTR           join(3933145..3933234,3934244..3934443,3934982..3935227,
FT                   3936170..3936359)
FT                   /locus_tag="VIT_08s0007g04530"
FT                   /old_locus_tag="Vv08s0007g04530"
FT   gene            3936360..3939146
FT                   /locus_tag="VIT_08s0007g04520"
FT                   /old_locus_tag="Vv08s0007g04520"
FT   mRNA            join(3936360..3937071,3937166..3937230,3938669..3938968,
FT                   3938969..3939146)
FT                   /locus_tag="VIT_08s0007g04520"
FT                   /old_locus_tag="Vv08s0007g04520"
FT                   /product="Beta-alanine n-methyltransferase related"
FT   CDS_pept        join(3936360..3937071,3937166..3937230,3938669..3938968)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04520"
FT                   /old_locus_tag="Vv08s0007g04520"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKE5"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR012967"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKE5"
FT                   /protein_id="CCB55367.1"
FT                   /translation="MEDETLESRNQARLAILELTNMISVPMCLHAIVRLNVPDAIWQGG
FT                   SNAPLSASQILTRVLPSGDPHNLQRILRLLTTYGVFAEHLLTDPSSDQVLRKYSLTDIG
FT                   KTLVTDADGLSYGAYVLQHYQEELMTAWPLVHEAVVDSTTEPFVKANGEPAYSYYGKKP
FT                   EMNDLMQRAMSGVSVPFMKAILNGYNGFDGVQRLVDVGGSAGDCLRMILQKHTNIKEGI
FT                   NFDLPEVVAKAPNIPGVTHVGGDMFKSVPDGDAIFMKWVLTTWTDEECKLIMKNCYNAL
FT                   PVGGKMIACEPVLPKESDNSLRTRALLEGDIFVMTIYRAKGKHRTEEEFRQLGLSAGFP
FT                   HLRAFYIDHFYTVLEFQK"
FT   3'UTR           3938969..3939146
FT                   /locus_tag="VIT_08s0007g04520"
FT                   /old_locus_tag="Vv08s0007g04520"
FT   gene            3945057..3956013
FT                   /locus_tag="VIT_08s0007g04510"
FT                   /old_locus_tag="Vv08s0007g04510"
FT   mRNA            join(3945057..3945137,3946225..3946347,3949506..3953144,
FT                   3953264..3953389,3953609..3953745,3955318..3955552,
FT                   3955553..3956013)
FT                   /locus_tag="VIT_08s0007g04510"
FT                   /old_locus_tag="Vv08s0007g04510"
FT                   /product="Predicted protein"
FT   CDS_pept        join(3945057..3945137,3946225..3946347,3949506..3953144,
FT                   3953264..3953389,3953609..3953745,3955318..3955552)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04510"
FT                   /old_locus_tag="Vv08s0007g04510"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKE6"
FT                   /protein_id="CCB55368.1"
FT                   /translation="MFRLHRNKAAKSGERVDFKFSNFQATQGSARTGILGEATINMASY
FT                   MSSSASVSVSLPLKKCNHGTILQETSFSTSGSNHSFDSAGGFVVRGSFSSANNMNGDGN
FT                   KPTGRDDSTSSQTSASHDKYTFEDPPQSIHSLFNSRVMGSGNLSQNPPPDIALSASNVI
FT                   ASSSLTNGGSSKNLLEAAEDTIEELRAEAKMWERNSQKLMLDLEILRKEFSDQSKNQAT
FT                   LDMELSAAYSERDALKKEIDQLKILLEESKMKQAMGESTFQDEGATHIQKELEDEIKFQ
FT                   KESNANLALQLRRSQESNIELVSVLQELELTIEKQKIELEDLAALRLKLNDADSSIHES
FT                   LAENKDVALQLQQLQDSEKNLQVKVGFLEQALEDKNHELENERSLSNQAILDVETGYKS
FT                   KLSAKEEEIVDLEARLSESIKGTNSEQMVANNGGDESLIKEIEALKVKLEELERDCNEL
FT                   TDENLELLFKLKESKSKSMGGSASFDFSSTEVPAKSYSSSESEVSELKLQICHLEQELE
FT                   KKVHGEDQLAAFGTSTIFSEVFKQLQMALSQIKKPWYGVSSNVNEECGCDIDNLVDLKS
FT                   VDVIAQRDHVESILNCLVELNRLLEARIIECEEVRKHDEAEIRDGSRTIIEAQKKLEDY
FT                   IVKENNLFRSIHEIESSKMELEVKVTDLDKELTERKSEIIKLEACLLSKEEEIGLLRQS
FT                   QRESESQVSELQKEKTQLEENIEIVVRESNITSKCLDDLRNDLMVLSSSVDSHVSANRI
FT                   LRRKMSELENGKRELELHISELELENVQLSERTSGLEAQLRYLTDERASCQLELENSKS
FT                   VASSFQDEIRRLAIEMETQKVVIEQKLQDMQTKWSEAQEECDYLKRANPKLKATAERLI
FT                   EECSSLQKSNGELRKQKLELHEGSTLLEAKLRESQKRFANCSKRVEVLEENLSSMLEDM
FT                   ASKEKIFTSELDILLQENRKQKEKLILGESLFNQRYSEKTAEVEKLQKEVEHLNNQISA
FT                   THDERERITSNSVYEASSLHADKAKLESELQEVQSKVKLIENELYIVQLESEEKVQGLT
FT                   SDLSISKQNHSMLMADHKKNLKLLENYRSSEEKLKTTLSDLELKLTVSEYERQQLLEET
FT                   ASLKVQLQKLAPLQDEVLALKAEFDAAKFERGKMEASLHLISADNEELKAEKISFIEKI
FT                   SSLETSTSELEDCKLNRVVLEEKILRMEGDLTAREAFCAQDAELKNELSRIRREVRQFQ
FT                   RKVEQLEEEKNECLKRAEALEEELKLMKEEKQGRSESSSKKFTGLSNAKVNHMTSKNET
FT                   AKSTNQHRDNRRKQSTKTGQVRELLKDQQNTYSTQHQQEGDEKNGLQDKNSHAVGVDPV
FT                   SKVQLLENELAEALEANKKYKVQLKRLSDGRKGPADSSRKSTADGEVVPKERYERTKSS
FT                   LESELRDIRERYFHMSLKYAEVEAQREELVMKLKVTKNGKRWFS"
FT   3'UTR           3955553..3956013
FT                   /locus_tag="VIT_08s0007g04510"
FT                   /old_locus_tag="Vv08s0007g04510"
FT   gene            3958112..3958213
FT                   /locus_tag="VIT_08s0007g04500"
FT                   /old_locus_tag="Vv08s0007g04500"
FT   mRNA            3958112..3958213
FT                   /locus_tag="VIT_08s0007g04500"
FT                   /old_locus_tag="Vv08s0007g04500"
FT   CDS_pept        3958112..3958213
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04500"
FT                   /old_locus_tag="Vv08s0007g04500"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIW3"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIW3"
FT                   /protein_id="CBI30189.3"
FT                   /translation="MPKLDEDYHGSNPILVVSFLCIYIIYITGLILV"
FT   gene            3959535..3969828
FT                   /locus_tag="VIT_08s0007g04490"
FT                   /old_locus_tag="Vv08s0007g04490"
FT   mRNA            join(3959535..3959578,3962992..3963081,3963190..3963271,
FT                   3963351..3963410,3963485..3963537,3963625..3963791,
FT                   3966396..3966603,3966782..3966839,3967293..3967538,
FT                   3968177..3968241,3968497..3968590,3969166..3969306,
FT                   3969403..3969507,3969508..3969828)
FT                   /locus_tag="VIT_08s0007g04490"
FT                   /old_locus_tag="Vv08s0007g04490"
FT                   /product="unknown predicted protein"
FT   CDS_pept        join(3959535..3959578,3962992..3963081,3963190..3963271,
FT                   3963351..3963410,3963485..3963537,3963625..3963791,
FT                   3966396..3966603,3966782..3966839,3967293..3967538,
FT                   3968177..3968241,3968497..3968590,3969166..3969306,
FT                   3969403..3969507)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04490"
FT                   /old_locus_tag="Vv08s0007g04490"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKE7"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR032308"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKE7"
FT                   /protein_id="CCB55369.1"
FT                   /translation="MKLVKRRYKYRFNFLLLKPIPVTKSSGSALYNSSENKSLGKITKK
FT                   DQRLHRLVFEEGGLPDGTEVAYYAGGKKLLDGYKKGFGIFCWCCHCEVSASQFEAHAGW
FT                   ASRKKPYSYIYTSNGVSLHELAISLSKGRKYSARDNDDLCSICGDGGNLLLCDGCPRAF
FT                   HRVCASLPSIPQDDWYCRYCQNMFQREKFVEHNANAVAAGRVSGVDPIEQITKRCIRIV
FT                   NPEAEVSACVLCRGYDFSKSGFGPRTIILCDQELPSGKWFCCLECIRIHSALQKLHVRG
FT                   EEKLPDSLLNVIKEKHERKGLESIADYNVRWRLLSGKLASPETRVLLSEAVAIFHDRFD
FT                   PIIDSVTGRDLIPAMVYGSHVVSAGILRVFGQEVAELPLVATSVDNQGRGYFQILFSCI
FT                   EKLLAFLNVRSFVLPAAEEAECIWTKKFGFKKITPDQLSEYRKSFYQMISFQGTCMLEK
FT                   GVPEWRRIIHQK"
FT   3'UTR           3969508..3969828
FT                   /locus_tag="VIT_08s0007g04490"
FT                   /old_locus_tag="Vv08s0007g04490"
FT   gene            3973157..3982945
FT                   /locus_tag="VIT_08s0007g04480"
FT                   /old_locus_tag="Vv08s0007g04480"
FT   mRNA            join(3973157..3973584,3973812..3973983,3974088..3974294,
FT                   3974653..3974903,3975038..3975236,3980094..3980262,
FT                   3980348..3980442,3980771..3981011,3981326..3981483,
FT                   3981571..3981779,3981899..3981968,3982328..3982380,
FT                   3982462..3982597,3982692..3982766,3982767..3982945)
FT                   /locus_tag="VIT_08s0007g04480"
FT                   /old_locus_tag="Vv08s0007g04480"
FT                   /product="Predicted protein"
FT   CDS_pept        join(3973157..3973584,3973812..3973983,3974088..3974294,
FT                   3974653..3974903,3975038..3975236,3980094..3980262,
FT                   3980348..3980442,3980771..3981011,3981326..3981483,
FT                   3981571..3981779,3981899..3981968,3982328..3982380,
FT                   3982462..3982597,3982692..3982766)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04480"
FT                   /old_locus_tag="Vv08s0007g04480"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKE8"
FT                   /db_xref="InterPro:IPR000070"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033131"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKE8"
FT                   /protein_id="CCB55370.1"
FT                   /translation="MRIKTTLFFWSSAFLIALLSITVALFTISSSTATITQGDLELAFL
FT                   RRIVKQSGVEDFLSLLNQATDRASQRHHHHHHHHRKPEVICDDAKWKSKIISSYNVSLI
FT                   LTVDLKGCANFSSVQKAVDAVPDSSLSRTLIIMDSGIYREKVVVGASKTNLIFQGQGYL
FT                   NTAIAWNDTANSTGGTSYSYSVAIFAPNFTAYNISFQNTAPPASPGDVGGQAVALRVAN
FT                   DQAAFYGCGFYGAQDTLHDDRGRHYFRECFIQGSIDFIFGNARSLYEECTINSTAKEVS
FT                   SGISGAITAQGRQSVDEKTGFSFVKCVIGGTGRVWLGRAWGAYATVVFSNTYMADLVAS
FT                   DGWNDWRDPSRDQTVFFGEYDCKGPGSNNTYRVSYAKQLMQSEAAPYLDVSYIDGNEWL
FT                   LPLPKDPTNERHRKICHACRYLLNQFHFITMVAAMEKNSFLFLSFLVLFPLLHGYTAFA
FT                   AGTDDGSEQWGYVEVRPKAHLFWWLYKSPDRVEDPSNPWPILLWLQGGPDSPVATGFSY
FT                   VEDESLVVTTDDEAATDLTTLLKELFNGNETLQKSPLYIVAESYGGKFAVTLGLSALKA
FT                   IEAGELKLQLGGLGRSFTRNLTQTVCENRLALQIQQQLAEGQYKEATETFFELENVISI
FT                   SSNDVDFYNFMVDYANDPVLSTSGGWNEVMMGRDPRYLGAKKSLSSNGSSSTDDLPSLM
FT                   NGPIREKLKIIPESVSWGGQGNLVFPAMAGDFMRPRINELDVICSTKGAEAWLDKLKWG
FT                   DLKTFLSLDRTPLYCGNDETTTKGFVKSYKNLFFYWILGAGHFVPVEQPCVSLEMVGNI
FT                   TRSPNLHS"
FT   3'UTR           3982767..3982945
FT                   /locus_tag="VIT_08s0007g04480"
FT                   /old_locus_tag="Vv08s0007g04480"
FT   gene            3984490..3989042
FT                   /locus_tag="VIT_08s0007g04470"
FT                   /old_locus_tag="Vv08s0007g04470"
FT   mRNA            join(3984490..3984636,3984637..3984653,3985851..3986075,
FT                   3986715..3986802,3988203..3988242,3988339..3988385,
FT                   3988472..3988592,3988716..3988879,3988880..3989042)
FT                   /locus_tag="VIT_08s0007g04470"
FT                   /old_locus_tag="Vv08s0007g04470"
FT                   /product="Predicted protein"
FT   5'UTR           3984490..3984636
FT                   /locus_tag="VIT_08s0007g04470"
FT                   /old_locus_tag="Vv08s0007g04470"
FT   CDS_pept        join(3984637..3984653,3985851..3986075,3986715..3986802,
FT                   3988203..3988242,3988339..3988385,3988472..3988592,
FT                   3988716..3988879)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04470"
FT                   /old_locus_tag="Vv08s0007g04470"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIW6"
FT                   /db_xref="InterPro:IPR009851"
FT                   /db_xref="InterPro:IPR029012"
FT                   /db_xref="InterPro:IPR037202"
FT                   /db_xref="InterPro:IPR037859"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIW6"
FT                   /protein_id="CBI30192.3"
FT                   /translation="MFKSFWGSQEQQPQPRPQDISGQSWYPPSVVTSPSSSRPSTPSSS
FT                   TSSSFSLQRPSDRPQSPSHVSPAEAAGMIVLLKDKSIDELRKLLSDKDAYNQLLLSLDQ
FT                   VKIQNNLRDELRKETLQLARENLEKEPQIVELRNQCRIIRTTELAAAQEKLNELERQKE
FT                   EILKFYSPACLLHRLQETMNKTEEESETLHRQLLDREMDLGAFVQKYKRLRTTYHRRAL
FT                   THLAAKTSSTG"
FT   3'UTR           3988880..3989042
FT                   /locus_tag="VIT_08s0007g04470"
FT                   /old_locus_tag="Vv08s0007g04470"
FT   gene            complement(3989426..3990771)
FT                   /locus_tag="VIT_08s0007g04460"
FT                   /old_locus_tag="Vv08s0007g04460"
FT   mRNA            complement(join(3989426..3989636,3989637..3989726,
FT                   3989819..3990149,3990534..3990694,3990695..3990771))
FT                   /locus_tag="VIT_08s0007g04460"
FT                   /old_locus_tag="Vv08s0007g04460"
FT                   /product="Predicted protein"
FT   3'UTR           complement(3989426..3989636)
FT                   /locus_tag="VIT_08s0007g04460"
FT                   /old_locus_tag="Vv08s0007g04460"
FT   CDS_pept        complement(join(3989637..3989726,3989819..3990149,
FT                   3990534..3990694))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04460"
FT                   /old_locus_tag="Vv08s0007g04460"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR018961"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIW7"
FT                   /protein_id="CBI30193.3"
FT                   /translation="MLNQGHLLYKTRCASFSSAPKPEKKAPHHLSAVIDAVKERKLPPE
FT                   LRGQRSSLRSETDIINIAEQRIWQSMKEGQFENLPGKGKPLDLSDNPHADPAEDTLYRI
FT                   LSKNGCAPEWVELNKEIRTQVNGWRSALKKAWANRCNQSDSQWIESCKALKLQMSDINN
FT                   KVFRYNLIVPFGRQMFGLKWEKEVARLEEQ"
FT   5'UTR           complement(3990695..3990771)
FT                   /locus_tag="VIT_08s0007g04460"
FT                   /old_locus_tag="Vv08s0007g04460"
FT   gene            complement(3991546..3991902)
FT                   /locus_tag="VIT_08s0007g04450"
FT                   /old_locus_tag="Vv08s0007g04450"
FT   mRNA            complement(join(3991546..3991634,3991722..3991902))
FT                   /locus_tag="VIT_08s0007g04450"
FT                   /old_locus_tag="Vv08s0007g04450"
FT                   /product="putative uncharacterized protein"
FT   CDS_pept        complement(join(3991546..3991634,3991722..3991902))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04450"
FT                   /old_locus_tag="Vv08s0007g04450"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIW8"
FT                   /protein_id="CBI30194.3"
FT                   /translation="MAAAAVVMMIATSLLLIGIGSVNVGEAWEEANVIHVGGKVLCQDC
FT                   TKGWNEWVNGSNPIKGSRVSVTCMDDRRRVMYYGSDETDEAGKY"
FT   gene            3994338..3995432
FT                   /locus_tag="VIT_08s0007g04440"
FT                   /old_locus_tag="Vv08s0007g04440"
FT   mRNA            3994338..3995432
FT                   /locus_tag="VIT_08s0007g04440"
FT                   /old_locus_tag="Vv08s0007g04440"
FT                   /product="unknown predicted protein"
FT   CDS_pept        3994338..3995432
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04440"
FT                   /old_locus_tag="Vv08s0007g04440"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIW9"
FT                   /db_xref="InterPro:IPR004405"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR038069"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIW9"
FT                   /protein_id="CBI30195.3"
FT                   /translation="MKLVEEEKILPNSSGIINIVPEEPDDMWLLYNLISKGDVIVADTT
FT                   RKTAFGRVRLTLEIKITAIDYDKVGSVIRVAGRNLVHNEHVDAGAFHTIEIERNKPFDL
FT                   KKKVWDSDAIEELRSYGNAAKADLAVLLIQDVSAELYSIGKIATTLCANIEAPSKTNRA
FT                   AKSKSQSKSNKFFENILTEFVKHVNFNFVSLVIIASPVGTEFRQYLLAESRRQKLQQIE
FT                   ENKERVVVVNTSGKATLKAVLQEPEVMKLIRGKNGAVEITAWKDLCDMLSNDSSRACYG
FT                   SKSVEKANELMAIDTLFISDELYRSANHGSRHKYTDLVKSVKKAGGKALVYSHNHVMGE
FT                   QLGQLTGIAAILRFPLPDLDDMEL"
FT   gene            complement(3997290..4003450)
FT                   /locus_tag="VIT_08s0007g04430"
FT                   /old_locus_tag="Vv08s0007g04430"
FT   mRNA            complement(join(3997290..3997429,3997430..3997597,
FT                   3998657..3998742,3999006..3999117,3999226..3999627,
FT                   4000101..4000166,4003349..4003450))
FT                   /locus_tag="VIT_08s0007g04430"
FT                   /old_locus_tag="Vv08s0007g04430"
FT                   /product="RNA helicase-like protein"
FT   3'UTR           complement(3997290..3997429)
FT                   /locus_tag="VIT_08s0007g04430"
FT                   /old_locus_tag="Vv08s0007g04430"
FT   CDS_pept        complement(join(3997430..3997597,3998657..3998742,
FT                   3999006..3999117,3999226..3999627,4000101..4000166,
FT                   4003349..4003450))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04430"
FT                   /old_locus_tag="Vv08s0007g04430"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKE9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKE9"
FT                   /protein_id="CCB55371.1"
FT                   /translation="MKVWAVLTDLGLRLWRDPGEKSKPPTAHMQGKLPDGFKDDSLRIM
FT                   KDIQRSGAQCQVLLFSATFNDTVKNFVTRIVKDYNQMFVKKEELSLQSVKQYKVKCPDE
FT                   LSKILVIKDKIFEIGQKLGQTIIFVRTKNSAGMLHKALVDFGYEVTTIQGALRQEDRDK
FT                   IIKEFKDGLTQVLISTDLLARGFDQSRVNLVVNYDLPLKYGTQAEPDYEVYLHRIGRAG
FT                   RFGRKGAVFNLLCSDKDNILISKIENHFGVQIAEVTYPPSPGVPRVGLVVLLPVEGRHV
FT                   AYCGPISQPRPPTCYEGGVGSGRYAPTEGL"
FT   gap             4000843..4000942
FT                   /estimated_length=100
FT   gap             4015627..4015726
FT                   /estimated_length=100
FT   gap             4018452..4018551
FT                   /estimated_length=100
FT   gene            complement(4020009..4020365)
FT                   /locus_tag="VIT_08s0007g04410"
FT                   /old_locus_tag="Vv08s0007g04410"
FT   mRNA            complement(join(4020009..4020097,4020185..4020365))
FT                   /locus_tag="VIT_08s0007g04410"
FT                   /old_locus_tag="Vv08s0007g04410"
FT                   /product="putative uncharacterized protein"
FT   CDS_pept        complement(join(4020009..4020097,4020185..4020365))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04410"
FT                   /old_locus_tag="Vv08s0007g04410"
FT                   /product="unknown"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIW8"
FT                   /protein_id="CCB55372.1"
FT                   /translation="MAAAAVVMMIATSLLLIGIGSVNVGEAWEEANVIHVGGKVLCQDC
FT                   TKGWNEWVNGSNPIKGSRVSVTCMDDRRRVMYYGSDETDEAGKY"
FT   gene            complement(4025854..4033016)
FT                   /locus_tag="VIT_08s0007g04400"
FT                   /old_locus_tag="Vv08s0007g04400"
FT   mRNA            complement(join(4025854..4025963,4025964..4026146,
FT                   4027544..4027629,4027893..4028004,4028113..4028514,
FT                   4028990..4029055,4030040..4030267,4030662..4030955,
FT                   4031940..4032110,4032111..4032116,4032627..4032863,
FT                   4032903..4033016))
FT                   /locus_tag="VIT_08s0007g04400"
FT                   /old_locus_tag="Vv08s0007g04400"
FT                   /product="RNA helicase-like protein"
FT   3'UTR           complement(4025854..4025963)
FT                   /locus_tag="VIT_08s0007g04400"
FT                   /old_locus_tag="Vv08s0007g04400"
FT   CDS_pept        complement(join(4025964..4026146,4027544..4027629,
FT                   4027893..4028004,4028113..4028514,4028990..4029055,
FT                   4030040..4030267,4030662..4030955,4031940..4032110))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04400"
FT                   /old_locus_tag="Vv08s0007g04400"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKF1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKF1"
FT                   /protein_id="CCB55373.1"
FT                   /translation="MAEDAPKPKQLWGDVEDDPPSSSSTPAVDLPVESLTIHDEAKEAE
FT                   SLDEPKDSSIQAVTSGDTPYTSASTFEDLNLSPELLRGIYSEMKFERPSKIQAISLPMI
FT                   LTPPYKNLIAQAHNGSGKTTCFVLGMLSRVDPKLQVPQALCICPTRELAIQNLEVLRKM
FT                   GKHTGIESECAIPMDSANYTSISQRPPVKAQVVIGTPGTVKKWMSHRKLGISNMKILVF
FT                   DEADHMLAEDGFKDDSLRIMKAIEKSGAQCQVLLFSATFNDTVKNFVTRIVKDYNQMFV
FT                   KKEELSLQSVKQYKVKCPDELSKILVIKDKIFEIGQKLGQTIIFVRTKNSAGMLHKALV
FT                   DFGYEVTTIQGALRQEDRDKIIKEFKDGLTQVLISTDLLARGFDQSRVNLVVNYDLPLK
FT                   YGTQAEPDYEVYLHRIGRAGRFGRKGAVFNLLCSDKDNILISKIENHFGVQIAECRPPP
FT                   FVDQSLGRDMQPAPGVPLLPFMRRYAAMLSLFCHSGASGMVTFRANVLYGHVRGV"
FT   5'UTR           complement(4032903..4033016)
FT                   /locus_tag="VIT_08s0007g04400"
FT                   /old_locus_tag="Vv08s0007g04400"
FT   gene            4043282..4049885
FT                   /locus_tag="VIT_08s0007g04390"
FT                   /old_locus_tag="Vv08s0007g04390"
FT   mRNA            join(4043282..4043397,4043398..4043648,4044460..4044589,
FT                   4044667..4044917,4045558..4045785,4046630..4046792,
FT                   4047901..4047974,4048105..4048201,4048335..4048401,
FT                   4048996..4049067,4049165..4049340,4049341..4049885)
FT                   /locus_tag="VIT_08s0007g04390"
FT                   /old_locus_tag="Vv08s0007g04390"
FT                   /product="Predicted protein"
FT   5'UTR           4043282..4043397
FT                   /locus_tag="VIT_08s0007g04390"
FT                   /old_locus_tag="Vv08s0007g04390"
FT   CDS_pept        join(4043398..4043648,4044460..4044589,4044667..4044917,
FT                   4045558..4045785,4046630..4046792,4047901..4047974,
FT                   4048105..4048201,4048335..4048401,4048996..4049067,
FT                   4049165..4049340)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04390"
FT                   /old_locus_tag="Vv08s0007g04390"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIX3"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR032799"
FT                   /db_xref="InterPro:IPR032861"
FT                   /db_xref="InterPro:IPR033121"
FT                   /db_xref="InterPro:IPR034161"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIX3"
FT                   /protein_id="CBI30199.3"
FT                   /translation="MPSSISILALILAFAAILLTAAVVHCGSPASLLTLERAFPVNQRV
FT                   ELEVLRARDQARHGRLLRGVVGGVVDFTVYGTSDPYLVGLYFTKVKLGSPPREFNVQID
FT                   TGSDILWVTCNSCNDCPRTSGLGIELSFFDPSSSSTTSLVSCSHPICTSLVQTTAAECS
FT                   PQSNQCSYSFHYGDGSGTTGYYVSDMLYFDTVLGDSLIANSSASIVFGCSTYQSGDLTK
FT                   VDKAIDGIFGFGQQDLSVVSQLSSLGITPKVFSHCLKGEGDGGGKLVLGEILEPNIIYS
FT                   PLVPSQSHYNLNLQSISVNGQLLPIDPAVFATSNNQGTIVDSGTTLTYLVETAYDPFVS
FT                   AITATVSSSTTPVLSKGNQCYLVSTSVDEIFPPVSLNFAGGASMVLKPGEYLMHLGFSD
FT                   GAAMWCIGFQKVAEPGITILGDLVLKDKIFVYDLAHQRIGWANYDCSLSVNVSVTSGKD
FT                   EFINSGQLSMSSSSQNMLFEPIPRSIKALLIHILVFSGFLFFVT"
FT   3'UTR           4049341..4049885
FT                   /locus_tag="VIT_08s0007g04390"
FT                   /old_locus_tag="Vv08s0007g04390"
FT   gene            4051622..4059320
FT                   /locus_tag="VIT_08s0007g04380"
FT                   /old_locus_tag="Vv08s0007g04380"
FT   mRNA            join(4051622..4051817,4052429..4052547,4052663..4052856,
FT                   4053025..4053284,4053373..4053479,4053574..4053763,
FT                   4055530..4055816,4056074..4056223,4058460..4058663,
FT                   4058903..4059100,4059101..4059320)
FT                   /locus_tag="VIT_08s0007g04380"
FT                   /old_locus_tag="Vv08s0007g04380"
FT                   /product="unknown predicted protein"
FT   CDS_pept        join(4051622..4051817,4052429..4052547,4052663..4052856,
FT                   4053025..4053284,4053373..4053479,4053574..4053763,
FT                   4055530..4055816,4056074..4056223,4058460..4058663,
FT                   4058903..4059100)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04380"
FT                   /old_locus_tag="Vv08s0007g04380"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIX4"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002004"
FT                   /db_xref="InterPro:IPR003954"
FT                   /db_xref="InterPro:IPR006515"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR036053"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIX4"
FT                   /protein_id="CBI30200.3"
FT                   /translation="MAVPPTVPAAPASLYVGDLHPDITDGLLFDAFSEFKSLASVRICR
FT                   DSSSGRSLCYGYVNFISPQDASHAIEAKNHTMLHGKVIRVMWSHRDPDARRSGIGNVFV
FT                   KNLSDSIDNVRLQAMFQKFGNILSCKVVVTEDGKSKGYGFVQFESEEYANAAIEKLNGF
FT                   IIDGKQIYAGKFVRKTDRVLPNPDAKYTNLYIKNLDPDVTEEALREKFFEFGKIASLVI
FT                   SKDENGMSRGFGFVNFESPEDAKRALEALNGLQLGSKVLYVARAQKKAEREQLLRRQFE
FT                   EKRNEQILKYRGSNVYVKNIDDNVNDDDLREHFSVCGKITSAKLMRDQKGISKGFGFVC
FT                   FSTPDEASKAVNTFHGYMFHRKPLYVAIAQRKEDRQAQLQLHYAQRMAGLAGPSTPVIP
FT                   GGYPPLYYTAPPGVIPPRQGLMYQPLGLRTGWRANNLIPPTRPAFQPSSIPLMPNTPRQ
FT                   HRQNRGRTNGHIPQGGGHSTAFMPHLQQPTQPVISPKDSINQQRAGQAKYVPNGRSYEM
FT                   SKGSGIPSAASNSVGTGSQGSEMLSSMLAAASPEQQKQILGEHLYPLVQKQKPDLAAKI
FT                   TGMLLEMDNSELLLLLESPESLAAKVEEAVQVLKLSKSKPSGQDTLHPSYLAAEVAVN"
FT   3'UTR           4059101..4059320
FT                   /locus_tag="VIT_08s0007g04380"
FT                   /old_locus_tag="Vv08s0007g04380"
FT   gene            4060654..4070204
FT                   /locus_tag="VIT_08s0007g04370"
FT                   /old_locus_tag="Vv08s0007g04370"
FT   mRNA            join(4060654..4060690,4060691..4060960,4061048..4061139,
FT                   4062503..4062602,4063667..4063738,4063896..4063958,
FT                   4064109..4064249,4067486..4067581,4068441..4068725,
FT                   4068814..4068952,4069045..4069187,4069273..4069449,
FT                   4069533..4069799,4069885..4070004,4070005..4070204)
FT                   /locus_tag="VIT_08s0007g04370"
FT                   /old_locus_tag="Vv08s0007g04370"
FT                   /product="putative uncharacterized protein"
FT   5'UTR           4060654..4060690
FT                   /locus_tag="VIT_08s0007g04370"
FT                   /old_locus_tag="Vv08s0007g04370"
FT   CDS_pept        join(4060691..4060960,4061048..4061139,4062503..4062602,
FT                   4063667..4063738,4063896..4063958,4064109..4064249,
FT                   4067486..4067581,4068441..4068725,4068814..4068952,
FT                   4069045..4069187,4069273..4069449,4069533..4069799,
FT                   4069885..4070004)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04370"
FT                   /old_locus_tag="Vv08s0007g04370"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIX5"
FT                   /db_xref="InterPro:IPR018816"
FT                   /db_xref="InterPro:IPR019134"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIX5"
FT                   /protein_id="CBI30201.3"
FT                   /translation="MGTHGSSSRRKKSRRRSDDSDDSDTPDSSPDRSSTKRRERSRSSR
FT                   RRSSSRHLDDSDSSGKSDGGGKKRSSRNITEEEIADYLAKKAQKKALRVAKKLKSQTVS
FT                   GYSNDSNPFGDANLNEKFVWRKKIERDVSQGVPLDTFSVKAEKKRQRERMAEIEKVKKR
FT                   REERAIEKAQHEEEMALLARERARAEFQDWEKKEEEFHFDQSKVRSDIRLREGRLKPID
FT                   ILSNLLNGSDDFDMDISEPYMVFKGLTVKEMEELRDDLKMHLDMDRATPTHIEYWEALL
FT                   VVCDWELAEARKKDALDRARVRGEEPPAELLAEERGLHSSIEADVKNLLQGKTYSELEV
FT                   LQSHIESQMRSGTAKVVEYWEAVLKRLHIYKAKACLKEIHAKMLHKHLQYLEPHSESED
FT                   ELEAEPGPEPKVEDSIQDLEDAQTFSPEPILHEEAHEAEEEAGSFSPELLHGDENEEAI
FT                   DPEEDRAILERKRIAVLEEQQKRIQEAMASKPTPSEDNLELKVMKAMGAMEEGDAVFGS
FT                   GAEVNLDSQVYWWHDKYRPRKPKYFNRVHTGYEWNKYNQTHYDHDNPPPKIVQGYKFNI
FT                   FYPDLVDKTKAPVYTIEKDGSSGETCLIRFHAGPPYEDIAFRIVNKEWEYSHKKGFKCT
FT                   FERGILHVYFNFKRYRYRR"
FT   3'UTR           4070005..4070204
FT                   /locus_tag="VIT_08s0007g04370"
FT                   /old_locus_tag="Vv08s0007g04370"
FT   gene            complement(4071589..4077124)
FT                   /locus_tag="VIT_08s0007g04360"
FT                   /old_locus_tag="Vv08s0007g04360"
FT   mRNA            complement(join(4071589..4071749,4071873..4071904,
FT                   4072049..4072143,4072242..4072315,4072400..4072526,
FT                   4072604..4072667,4072744..4072806,4072894..4073036,
FT                   4073133..4073270,4073360..4073481,4073565..4073715,
FT                   4073809..4073928,4074036..4074107,4074211..4074318,
FT                   4074450..4074566,4074664..4074796,4075009..4075109,
FT                   4075618..4075739,4075898..4076031,4076156..4076308,
FT                   4076413..4076615,4077002..4077124))
FT                   /locus_tag="VIT_08s0007g04360"
FT                   /old_locus_tag="Vv08s0007g04360"
FT                   /product="Argonaute protein group"
FT   CDS_pept        complement(join(4071589..4071749,4071873..4071904,
FT                   4072049..4072143,4072242..4072315,4072400..4072526,
FT                   4072604..4072667,4072744..4072806,4072894..4073036,
FT                   4073133..4073270,4073360..4073481,4073565..4073715,
FT                   4073809..4073928,4074036..4074107,4074211..4074318,
FT                   4074450..4074566,4074664..4074796,4075009..4075109,
FT                   4075618..4075739,4075898..4076031,4076156..4076308,
FT                   4076413..4076615,4077002..4077124))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04360"
FT                   /old_locus_tag="Vv08s0007g04360"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIX6"
FT                   /db_xref="InterPro:IPR003100"
FT                   /db_xref="InterPro:IPR003165"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014811"
FT                   /db_xref="InterPro:IPR032472"
FT                   /db_xref="InterPro:IPR032474"
FT                   /db_xref="InterPro:IPR036085"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIX6"
FT                   /protein_id="CBI30202.3"
FT                   /translation="MPFCISFLSFVFPFFLWASLKVPYSLFYFALFISSFKWLDVVSIT
FT                   PEVTSRVLSRSLIKELVHLYGQSHLYRNPAYDGRRGIYTAGPLPFTSKEFMIKLEEGND
FT                   GTHERKKKEFIVKIRFATSTDIHNLREFLLSRQSNVPYEIIHALDVVLKDSLSNNRCTL
FT                   SGKTFFPLGLGARSEIGNGVQCWNGFYQSLRPTQMGLSLNIDVSSKSFYEPIPVIEFAA
FT                   KFLNLEDPSIMARMPLSNDDRLKLKKVLKGIKVEVTHGGQRRYKIFDITEQPTNQLRFT
FT                   EDGQQKSVIQYFREKYNIVLRYASWPSLRSGKDSRPIYLPMETCTIVAGQRYAKKLNER
FT                   QVASMLRMTCQRPWRRQEIIHQIADQDDYIRNDFVKEFGVNVSVDMAAIDARVLPPPAL
FT                   KYHDSGREKTIRPRTGQWNAQHVKLYHGAVVEYWMCVNFSNLKQEVVFNFCQHLVDMCC
FT                   RKGMDFARNPLFPIQSSPPGQIEAKLSDVHHQCRVEGKQLQMLIIILPEVNAYYGKIKR
FT                   ICETELGMVSQCCQPRHARTCNRIYLENIVLKINVKAGGQNAILEDTLYGRIPLLTDIP
FT                   TIIFGADVTHPQSGEDQGPSIAAVVASMDWPTVVTYRGLVSAQPHRSEIIEDLFRVKED
FT                   PKRGVVHAGMIRELLLAFKSSTGLKPLRIIFFRDGVSEGMFEMVLLKEMDAIRKACASL
FT                   EEGYLPPVTFIVVQKRHNTRLFPTNEDNMDKSGNILPGTVVDTVICHPSEHDFYLCSHA
FT                   GIRGTSRPAHYRVLLDENKFSADALQMLANDLCYTYARCTRSVSIVPPVYYAHLAAFRA
FT                   KFYVERSGAQYEGGSSTGPDDRIELPEIDPTVKSVMFYC"
FT   gene            complement(4083646..4085726)
FT                   /locus_tag="VIT_08s0007g04350"
FT                   /old_locus_tag="Vv08s0007g04350"
FT   mRNA            complement(join(4083646..4083806,4083807..4085726))
FT                   /locus_tag="VIT_08s0007g04350"
FT                   /old_locus_tag="Vv08s0007g04350"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(4083646..4083806)
FT                   /locus_tag="VIT_08s0007g04350"
FT                   /old_locus_tag="Vv08s0007g04350"
FT   CDS_pept        complement(4083807..4085726)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04350"
FT                   /old_locus_tag="Vv08s0007g04350"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKF2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR025287"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKF2"
FT                   /protein_id="CCB55374.1"
FT                   /translation="MATIPSMKRPLLCSSLLFLLFFCHHSSSQKDCPNCGSIQVPYPLS
FT                   TNPNCGDPDYSLRCDGDSQKLYFDGLNGSSYLVLRIMASSQRMVVQPSPWLPGTCVTQD
FT                   MPVSEGLWLNQTRPFKITSSNTIFLFNCSPRLLVSPLNCTPSSLCHHYLESSGHVDRKR
FT                   ALQCASGLDPCCTFVAGGMPSAYKIRLHSSGCRAFRSILGLDPEKPPSQWEEGLEIQWA
FT                   PAPEPVCKTQLDCTRDSKCSPAGGKGLLRCLCNRGYYWDLARGTCLKKEKNSKLAISLK
FT                   VSIGVVSFFSLAVAIAAVTVRRSGKFSNQEKLVKAREEMLKSSMGGKSARMFSLKEVKK
FT                   ATNGFSKDRVLGSGGFGEVYKGELHDGTIVAVKSAKVGNLKSTQQVLNEVGILSQVNHK
FT                   NLVKLLGCCVEAEQPLMIYNYIPNGTLHEHLHGKRSTFLKWDTRLRIALQTAEALAYLH
FT                   SAAHTPIYHRDVKSTNILLDEDFNAKVADFGLSRLAEPGLSHVSTCAQGTLGYLDPEYY
FT                   RNYQLTDKSDVYSYGIVMLELLTSQKAIDFSREPDDINLAIYVSQRASDGAVMGVVDQR
FT                   LLGHNPSVEVITSIRLFSELALACLREKKGERPSMKAVVQELQRIIKFVDKEEVFSEVS
FT                   ASKI"
FT   gene            complement(4086845..4090937)
FT                   /locus_tag="VIT_08s0007g04340"
FT                   /old_locus_tag="Vv08s0007g04340"
FT   mRNA            complement(join(4086845..4087063,4087064..4087091,
FT                   4087179..4087219,4087839..4087916,4088318..4088407,
FT                   4088868..4088942,4089555..4089612,4089909..4089964,
FT                   4090060..4090115,4090602..4090742,4090834..4090912,
FT                   4090913..4090937))
FT                   /locus_tag="VIT_08s0007g04340"
FT                   /old_locus_tag="Vv08s0007g04340"
FT                   /product="Predicted protein"
FT   3'UTR           complement(4086845..4087063)
FT                   /locus_tag="VIT_08s0007g04340"
FT                   /old_locus_tag="Vv08s0007g04340"
FT   CDS_pept        complement(join(4087064..4087091,4087179..4087219,
FT                   4087839..4087916,4088318..4088407,4088868..4088942,
FT                   4089555..4089612,4089909..4089964,4090060..4090115,
FT                   4090602..4090742,4090834..4090912))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04340"
FT                   /old_locus_tag="Vv08s0007g04340"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIX8"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIX8"
FT                   /protein_id="CBI30204.3"
FT                   /translation="MELSLLSGHQLNPTLLHKNFSPLPITRKRSFKRNSSVLFCQCSFS
FT                   SSDDSAKPATLSLQREGRRALMGCVLVAAAGIYVCDVAGAVSTSRRALRGAKIPESDYT
FT                   TLPNGLKYYDLKVGGGLKAVKGSRVAVHYVAKWKGITFMTSRQGLGVGGGTPYGFDVGQ
FT                   SERGSVLKGLDLGVEGMKVGGQRLLIVPPELAYGSKGVQEIPPNATIELDVELLAIKQS
FT                   PLGTGVKIIEG"
FT   5'UTR           complement(4090913..4090937)
FT                   /locus_tag="VIT_08s0007g04340"
FT                   /old_locus_tag="Vv08s0007g04340"
FT   gene            complement(4091363..4092911)
FT                   /locus_tag="VIT_08s0007g04330"
FT                   /old_locus_tag="Vv08s0007g04330"
FT   mRNA            complement(join(4091363..4091884,4092111..4092911))
FT                   /locus_tag="VIT_08s0007g04330"
FT                   /old_locus_tag="Vv08s0007g04330"
FT                   /product="Predicted protein"
FT   CDS_pept        complement(join(4091363..4091884,4092111..4092911))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04330"
FT                   /old_locus_tag="Vv08s0007g04330"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIX9"
FT                   /db_xref="InterPro:IPR040265"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIX9"
FT                   /protein_id="CBI30205.3"
FT                   /translation="MKPKILKAGLPLALSVAAFIIAKIMERRNLVPKASSFENQVDSPP
FT                   ANSMVESVDGLNSACVLLEEGEGQIITNRSLVESSEIQDPPDHEEEILALRRQIEHLQE
FT                   REWELAMRFLCYCEIKEQESRLLELRSRLLLEIARVEFLNWEVSLMEAENKRHEDLVVE
FT                   YLRVVEQLEFWKLENRLLHREVKKLAKKTRQQSRVIRDCNLKIEGIEKEISRNQEELER
FT                   RTTAISKLDNEVRELQATLNQVQEEKHQLSDKLKLAEKSAPSTSKSEAEGIAKEDYNQL
FT                   VNELERLHKDRAAEVKELVYLRWSNACLRHELMRNQKQPEQNQESCQSELDFEPKGETG
FT                   EHASEHELEGTVLEPPSEPCLGVSSGSHISSKRPKILQKLRRWVDGSEKIKPTSEEGEE
FT                   HEIKCFGKHCVLHKAEEHHVHKNNALSVIMNSQIPDHSYSM"
FT   gene            4100912..4101454
FT                   /locus_tag="VIT_08s0007g04320"
FT                   /old_locus_tag="Vv08s0007g04320"
FT   mRNA            4100912..4101454
FT                   /locus_tag="VIT_08s0007g04320"
FT                   /old_locus_tag="Vv08s0007g04320"
FT   CDS_pept        4100912..4101454
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04320"
FT                   /old_locus_tag="Vv08s0007g04320"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIY0"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIY0"
FT                   /protein_id="CBI30206.3"
FT                   /translation="MGSLCLSATAFPPVRPIKHVPIATTRKPFIRATICNPVPLTITYS
FT                   ETSSPPLRKVSPDSLQYEEGYLGAVPAGRVDESREGVVKAMRYLTNILSSKVYDISTES
FT                   PLQLAQNLSRRLGVQLWLKREDFPPVIVSLINLLYFYHFSWVFVSLGLDCACVFPFLHI
FT                   VNLLNFLFIFINIWLKG"
FT   gene            4105194..4115020
FT                   /locus_tag="VIT_08s0007g04310"
FT                   /old_locus_tag="Vv08s0007g04310"
FT   mRNA            join(4105194..4105365,4105366..4105812,4106622..4106801,
FT                   4106900..4107169,4107816..4108022,4109199..4109447,
FT                   4109537..4109610,4112481..4112598,4114301..4114435,
FT                   4114552..4114692,4114693..4115020)
FT                   /locus_tag="VIT_08s0007g04310"
FT                   /old_locus_tag="Vv08s0007g04310"
FT                   /product="Predicted protein"
FT   5'UTR           4105194..4105365
FT                   /locus_tag="VIT_08s0007g04310"
FT                   /old_locus_tag="Vv08s0007g04310"
FT   CDS_pept        join(4105366..4105812,4106622..4106801,4106900..4107169,
FT                   4107816..4108022,4109199..4109447,4109537..4109610,
FT                   4112481..4112598,4114301..4114435,4114552..4114692)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04310"
FT                   /old_locus_tag="Vv08s0007g04310"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIY1"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIY1"
FT                   /protein_id="CBI30207.3"
FT                   /translation="MESLCFSTTHFSLLRPTLPNPIRPIKHVLIGSAAKPFIKATISKP
FT                   AAEISGTSSTTVTSSQTSLHPSPVPPLKRVSSDSLQYQPGCIGAVPDRTIHDGIDGVVG
FT                   AMEYLTNILSSKVYDVAIESPLQLAPKLSERLGAQIWLKREDLQPVFSFKLRGAYNMMA
FT                   KIPKEQLERGVICSSAGNHAQGVALAAKRLGCNAVIAMPVTTPEIKWKSVERLGATVVL
FT                   VGDSYDEAQAYAKQRGEEECRTFIPPFDHPDVIMGQGTIGMEIVRQMQGPLDAIFVPVG
FT                   GGGLIAGIAAYVKRVSPEVKIIGVEPCDANAMALSLHHDQRVMLDQVGGFADGVAVKVV
FT                   GEETFRLCRELIDGIVLVSRDAICASIKNMFEEKRSILEPAGALALAGAEAYCKYYGIK
FT                   GGNIVAITSGANMNFDRLRLVTELADVGRQREAVLATLLPEEPGSFKQFCEMVGHMNIT
FT                   EFKYRYNPHKEKALVLYSVGLHTVLELSAMVERMESSQLTTLNLTNDDLVKDHLRHLMG
FT                   GRSHVENELLCRFVFPERPGTLMKFLDTFSPRWNISLFHYRGQGEAGANVLVGIQVPET
FT                   EMTEFKRRADALGYEYAVETSNKAYLLLMH"
FT   gap             4108402..4108501
FT                   /estimated_length=100
FT   gap             4110512..4110611
FT                   /estimated_length=100
FT   3'UTR           4114693..4115020
FT                   /locus_tag="VIT_08s0007g04310"
FT                   /old_locus_tag="Vv08s0007g04310"
FT   gene            4116625..4120582
FT                   /locus_tag="VIT_08s0007g04300"
FT                   /old_locus_tag="Vv08s0007g04300"
FT   mRNA            join(4116625..4116628,4116629..4116869,4116967..4117097,
FT                   4117205..4117438,4117908..4118163,4118534..4118722,
FT                   4120542..4120582)
FT                   /locus_tag="VIT_08s0007g04300"
FT                   /old_locus_tag="Vv08s0007g04300"
FT                   /product="Predicted protein"
FT   5'UTR           4116625..4116628
FT                   /locus_tag="VIT_08s0007g04300"
FT                   /old_locus_tag="Vv08s0007g04300"
FT   CDS_pept        join(4116629..4116869,4116967..4117097,4117205..4117438,
FT                   4117908..4118163,4118534..4118722,4120542..4120582)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04300"
FT                   /old_locus_tag="Vv08s0007g04300"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIY2"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR035669"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIY2"
FT                   /protein_id="CBI30208.3"
FT                   /translation="MGFARNALGAFLLLVLILSVAHGDPLVPALCIFGDSVVDAGNNNN
FT                   LATLVKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEYLGFTSYPPPYLSQEAQGKNLL
FT                   QGANFASASSGYYDRTAQLYRAISLTQQVEYYKEYQAKVVRLVGKARAHDIFSGGIHLL
FT                   SAGSSDFVQNYYINPLLNRAYSADQFSDLLMKSYTTFVQNLYGLGVRKIGVTTLPPTGC
FT                   LPAAITLFSSGSNQCVARLNQDAINFNSKLNITSQVLQNKLPGLKLVVFDIYQPLLNLI
FT                   TKPTDNGFFESRKACCGTGTIETSLLCNARSVGTCSNASQYVFWDGFHPSESANQLLAG
FT                   SLLEQGINLIGHHVLWVNACFNL"
FT   gene            complement(4120844..4148056)
FT                   /locus_tag="VIT_08s0007g04290"
FT                   /old_locus_tag="Vv08s0007g04290"
FT   mRNA            complement(join(4120844..4120868,4120869..4120952,
FT                   4121112..4121201,4123294..4123410,4123953..4124060,
FT                   4131836..4131928,4132059..4132229,4132794..4133046,
FT                   4133133..4133411,4134308..4134636,4134713..4135696,
FT                   4138529..4139118,4146275..4146515,4147532..4147654,
FT                   4147990..4148013,4148014..4148056))
FT                   /locus_tag="VIT_08s0007g04290"
FT                   /old_locus_tag="Vv08s0007g04290"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(4120844..4120868)
FT                   /locus_tag="VIT_08s0007g04290"
FT                   /old_locus_tag="Vv08s0007g04290"
FT   CDS_pept        complement(join(4120869..4120952,4121112..4121201,
FT                   4123294..4123410,4123953..4124060,4131836..4131928,
FT                   4132059..4132229,4132794..4133046,4133133..4133411,
FT                   4134308..4134636,4134713..4135696,4138529..4139118,
FT                   4146275..4146515,4147532..4147654,4147990..4148013))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04290"
FT                   /old_locus_tag="Vv08s0007g04290"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIY3"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR035983"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIY3"
FT                   /protein_id="CBI30209.3"
FT                   /translation="MDDHRKHQVSLRGASAKEITRDALLEKVSQERELRNYVRRATAAA
FT                   IFIQRVWRRYNVIKMVAVQLQEEWETLVNHHAVLMTRTWISSSFLRPFLFFITYLSIRH
FT                   QRIRTRDVDCIRHCFKTLLESINSTDSKMNFCSLATGTPEERRIWTYEAEKLISICLFI
FT                   LAECDTHPGGQDINVLSSMAMRLLVVLTDTKGWKSITDDNFQDADRAVKDLVRFMGSRK
FT                   GGLYLCIRKYFNKLDAPCSSLKNSVVQADERFLITASAITLALRPFQAANLDVTEPGPF
FT                   NVQYAAEQYCVYILTIPWLAQRLPAVLLPAMKHKSILSPCFQTLLILRKKILKEMSEMH
FT                   PFQIPHCSKAVPQVSWALANVICLATGSENDCVDQGQFTQGLNHTSYVHVVNILAENLL
FT                   DWLEDVGWIRKDNQEIQENVETCANPIDIACSPDTTYGPIKMSYMDLFRPVCQQWHLMK
FT                   LLAILKNVAFICDSSLPNNLEYSGKLELLDIAYFYSYMLRIFSVLNPVVGPLPVLNMLA
FT                   FTPGFLVNLWEALEGYLFPGDVKFSEDNDLCKSKISTNKNDGAYEKKQKQASRDGGNKW
FT                   VTMLQKITGKSQMDVDLISGRTRTSQVKEDAFDVWDVEPLRCGPQGISKDISCLLHLFC
FT                   ATYSHLLLVLDDIEFYEKQVPFTLEQQRRIASMLNTLVYNGSFHGSGGQQNRPLMDAAV
FT                   RCLHLLYERDCRHQFCPPGLWLSPARNNRPPIAVAARTHEVLSAKPDDALTIPSMAPVI
FT                   TTTHVFPFEERVQMFREFIKMDKFSRKMAGEVAGPGSRSVEVVIRRGHIVEDGFQQLNS
FT                   LGSRLKSCIHVSFISECGLPEAGLDYGGLFKEFLTDIAKAAFAPEYGLFSQTSTSDRLL
FT                   VPNTAARFLENGTQMIEFLGKVVGKALYEGILLDYSFSHVFIQKLLGRYSFLDELSTLD
FT                   PELYRNLMYVKHYDGDVKELSLDFTVTEESLGKRHIIELKPGGKDAIVTNENKLQYVHA
FT                   MADYKLNRQMLPLSNAFYRGLTDLISPSWLKLFNASEFNQLLSGGNHDIDITDLRNHTR
FT                   YTGGYTEGSRTVKLFWEVITGFEPKERCMLLKFVTSCSRAPLLGFKHLQPTFTIHKVAC
FT                   DVPLWATIGGQDVERLPSASTCYNTLKLPTYKRPSTLRAKLLYAINSNAGFELS"
FT   gap             4142141..4142240
FT                   /estimated_length=100
FT   5'UTR           complement(4148014..4148056)
FT                   /locus_tag="VIT_08s0007g04290"
FT                   /old_locus_tag="Vv08s0007g04290"
FT   gene            4149435..4152139
FT                   /locus_tag="VIT_08s0007g04280"
FT                   /old_locus_tag="Vv08s0007g04280"
FT   mRNA            join(4149435..4152137,4152138..4152139)
FT                   /locus_tag="VIT_08s0007g04280"
FT                   /old_locus_tag="Vv08s0007g04280"
FT                   /product="Predicted protein"
FT   CDS_pept        4149435..4152137
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04280"
FT                   /old_locus_tag="Vv08s0007g04280"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIY4"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR032867"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIY4"
FT                   /protein_id="CBI30210.3"
FT                   /translation="MDDSKPVGAGGYVWRLSNMALLSVYFPQTPFPFCLSRPTLPSQSL
FT                   YSLSLSKTSFSSSRSKPYALLTSHPPLSNQPALLSNFPSVSNDTVNDHYYLLDLSVRYD
FT                   DVELIKAVHASIFKLAEDIHLANALIVAYLKLGMVPNAYKVFVGLSCPNVVSYTAMISG
FT                   FAKSNRERQAMEIFFRMRSSGIELNEFSFVAILTVCIRLLDLELGCQLHAIVIKMGFLN
FT                   YTFVSNALMGLYGKCGYLDSVLQLFDEMPHRDIASWNTVISSVVKEMMYERAFELFRDM
FT                   RRIDGFRIDHFTLSTILVAARGLASMVGREIHAHVIKIGFESNISVINALIRFYTKCGS
FT                   IKHVVALFEKMRVRDVITWTEMITAYMEFGLTDLALEVFDKMPARNSISYNAILSGFCQ
FT                   NGEGSKALAFFCRMVEEGVELTDFTLTGVLNACGLLMEAKISKQIHGFILKFGFGSNAC
FT                   IEAALLDMCTRCGRMADAQKMFSQGSFSQSGSIIWTSMICGYARNAQPEEAISLFCQSQ
FT                   LEGAMVVDKVASTAVLGVCGTLAFHEMGKQIHCHALKSGFLSDLGVGNSIITMYSKCSN
FT                   MDDAIKVFNVMPAHDIVSWNGLIAGHLLHRQGDEALSVWSKMEKAGIKPDTVTFVLIIS
FT                   AYRHTNSNLVDNCRRLFLSMKTIYHIDPTVEHYTSLVGVLGYWGLLEEAEEMINKMPIE
FT                   PEASVWRALLDACRIHSNTTIGKRAAKHLLAMKPLDPSTYILVSNLYSAYGRWHCSDMV
FT                   REEMRVKGFRKHPGRSWIIHENKVHSFYARDKSHPQAKDIHSGLELLIMECLKAGYVPD
FT                   TSFVLHEVEEHQKKDFLFYHSAKIAATYGLLMTRPGRPIRIVKNILLCGDCHTFLKYVS
FT                   IVTGREIFLRDASGHHCFLNGQCSCKDYW"
FT   3'UTR           4152138..4152139
FT                   /locus_tag="VIT_08s0007g04280"
FT                   /old_locus_tag="Vv08s0007g04280"
FT   gene            complement(4152419..4157449)
FT                   /locus_tag="VIT_08s0007g04270"
FT                   /old_locus_tag="Vv08s0007g04270"
FT   mRNA            complement(join(4152419..4152526,4152633..4152930,
FT                   4153022..4153233,4153327..4153554,4153657..4153766,
FT                   4153860..4153963,4154043..4154230,4154310..4154471,
FT                   4154548..4154666,4154783..4154870,4154966..4155071,
FT                   4155166..4155254,4155332..4155475,4155568..4155660,
FT                   4155751..4155817,4156900..4157012,4157085..4157180,
FT                   4157273..4157449))
FT                   /locus_tag="VIT_08s0007g04270"
FT                   /old_locus_tag="Vv08s0007g04270"
FT                   /product="Beta-galactosidase"
FT   CDS_pept        complement(join(4152419..4152526,4152633..4152930,
FT                   4153022..4153233,4153327..4153554,4153657..4153766,
FT                   4153860..4153963,4154043..4154230,4154310..4154471,
FT                   4154548..4154666,4154783..4154870,4154966..4155071,
FT                   4155166..4155254,4155332..4155475,4155568..4155660,
FT                   4155751..4155817,4156900..4157012,4157085..4157180,
FT                   4157273..4157449))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04270"
FT                   /old_locus_tag="Vv08s0007g04270"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKF3"
FT                   /db_xref="InterPro:IPR000922"
FT                   /db_xref="InterPro:IPR001944"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019801"
FT                   /db_xref="InterPro:IPR031330"
FT                   /db_xref="InterPro:IPR041392"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKF3"
FT                   /protein_id="CCB55375.1"
FT                   /translation="MVATMGSSSSFLVLSLFVLSFCLTCNADQITSDARGIMINGERKI
FT                   LISGSVHYPRSTPEMWPDLIQKSKDGGLNTIDTYVFWDLHEPQRRQYDFTGNKDLVRFI
FT                   KAIQAQGLYAVLRIGPYVCAEWTYGGFPVWLHNQPSIQLRTNNTVYMSEMQTFTTMIVD
FT                   MMKKEQLFASQGGPIIISQIENEYGNVMRAYHDAGVQYINWCAQMAAALDTGVPWIMCQ
FT                   QDNAPQPMINTCNGYYCDQFTPNNPNSPKMWTENWSGWYKNWGGSDPHRTAEDLAFSVA
FT                   RFYQLGGTFQNYYMYHGGTNFGRTAGGPYITTSYDYDAPLNEYGNKNQPKWGHLRDLHL
FT                   LLLSMEKALTYGDVKNVDYETLTSATIYSYQGKSSCFFGNSNADRDVTINYGGVNYTIP
FT                   AWSVSILPDCSNEVYNTAKVNSQYSTFVKKGSEAENEPNSLQWTWRGETIQYITPGRFT
FT                   ASELLDQKTVAEDTSDYLYYMTTVDISNDDPIWGKDLTLSVNTSGHILHAFVNGEHIGY
FT                   QYALLGQFEFQFRRSVTLQLGKNEITLLSATVGLTNYGPDFDMVNQGIHGPVQIIASNG
FT                   SADIIKDLSNNNQWAYKAGLNGEDKKIFLGRARYNQWKSDNLPVNRSFVWYKATFDAPP
FT                   GEDPVVVDLMGLGKGEAWVNGHSLGRYWPSYIARGEGCSPECDYRGPYKAEKCNTNCGN
FT                   PSQRWYHVPRSFLASTDNRLVLFEEFGGNPSSVTFQTVTVGNACANAREGYTLELSCQG
FT                   RAISGIKFASFGDPQGTCGKPFATGSQVFEKGTCEAADSLSIIQKLCVGKYSCSIDVSE
FT                   QILGPAGCTADTKRLAVEAIC"
FT   gene            4160368..4161108
FT                   /locus_tag="VIT_08s0007g04260"
FT                   /old_locus_tag="Vv08s0007g04260"
FT   mRNA            join(4160368..4160730,4160971..4161108)
FT                   /locus_tag="VIT_08s0007g04260"
FT                   /old_locus_tag="Vv08s0007g04260"
FT   CDS_pept        join(4160368..4160730,4160971..4161108)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04260"
FT                   /old_locus_tag="Vv08s0007g04260"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIY6"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIY6"
FT                   /protein_id="CBI30212.3"
FT                   /translation="MASGNDRLVSCSSSSSLRLLLFMIPLIVISGCASVLGSRNSSWGF
FT                   ISRHPWPWSSPTAATITSVKTPQVPSTKESEGLLDLHSTVVGVHHREEAISEDSVLNRS
FT                   SSPPLDVEAAQPPPAAALQIIYSLQRNPKKMAHISTCETRKATPKISLRPFSEKQNVLS
FT                   FKL"
FT   gene            4161463..4162998
FT                   /locus_tag="VIT_08s0007g04250"
FT                   /old_locus_tag="Vv08s0007g04250"
FT   mRNA            join(4161463..4161647,4161744..4161762,4161763..4162098,
FT                   4162183..4162860,4162861..4162998)
FT                   /locus_tag="VIT_08s0007g04250"
FT                   /old_locus_tag="Vv08s0007g04250"
FT                   /product="unknown predicted protein"
FT   5'UTR           4161463..4161647
FT                   /locus_tag="VIT_08s0007g04250"
FT                   /old_locus_tag="Vv08s0007g04250"
FT   CDS_pept        join(4161763..4162098,4162183..4162860)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04250"
FT                   /old_locus_tag="Vv08s0007g04250"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIY7"
FT                   /db_xref="InterPro:IPR004263"
FT                   /db_xref="InterPro:IPR040911"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIY7"
FT                   /protein_id="CBI30213.3"
FT                   /translation="MEKQLKVYVYDEGEPPLFHNGPCKSIYSMEGNFIHKMEMDSHFRT
FT                   KDPEKAHLFFLPFSVAMLVRFVYVRDSHDLGPIKQTVIDYVNVVSTKYPYWNRSLGADH
FT                   FMLACHDWGPETSFSIPYLHKNSIRVLCNANTSEGFNPSKDVSFPEINLLTGSTDSFIG
FT                   GPSPSHRTLLAFFAGGLHGPIRPILLEHWENKDEDVKVHKYLPKGVSYYEMMRKSKYCL
FT                   CPSGYEVASPRVVEALYTGCVPVLISDHYVPPFSDVLNWKSFSVEVPVREIPNLKRILM
FT                   DISPRQYIRMQRRGIQARRHFEVNSPPKRYDVFHMILHSLWLRRLNFRVHHHGIGK"
FT   3'UTR           4162861..4162998
FT                   /locus_tag="VIT_08s0007g04250"
FT                   /old_locus_tag="Vv08s0007g04250"
FT   gene            4168573..4170339
FT                   /locus_tag="VIT_08s0007g04240"
FT                   /old_locus_tag="Vv08s0007g04240"
FT   mRNA            join(4168573..4168648,4168649..4169503,4169845..4169972,
FT                   4170069..4170219,4170220..4170339)
FT                   /locus_tag="VIT_08s0007g04240"
FT                   /old_locus_tag="Vv08s0007g04240"
FT                   /product="BP8 protein"
FT   5'UTR           4168573..4168648
FT                   /locus_tag="VIT_08s0007g04240"
FT                   /old_locus_tag="Vv08s0007g04240"
FT   CDS_pept        join(4168649..4169503,4169845..4169972,4170069..4170219)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04240"
FT                   /old_locus_tag="Vv08s0007g04240"
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR004238"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKF4"
FT                   /protein_id="CCB55376.1"
FT                   /translation="MASGQEKEERAEPALRLAGSEKREAEREREEGAKLVSDRQKQEQQ
FT                   QRPGVIGSVLRAVQETYEHAKEAATGKSQEAVEKTRETAEVASEKAREAAQKTGQTKDA
FT                   AAEKTRGVSDAASQKAQEAKEKMRESKDYTADKSKEAKDSAAEKARETKDTGAEKTVEH
FT                   KNSAAEKAKETKDAVAGQAGEYKDYAAEKARGVKDTTLGKTGEYKDYAAEKAKETKDAT
FT                   VQKAAEYKDYTAGKAEEGKDTSVGKITELKDSAADAARRAMEYLTGKKEETKHKTSETA
FT                   EAAKERLTETEEAARRKMEELKLKGKEEHKEAEGRETQQSKDAPGVKGVLINVRETPTG
FT                   YVATALKAADQMTAQTFNDVGPLDEEEIARVDHQEKT"
FT   3'UTR           4170220..4170339
FT                   /locus_tag="VIT_08s0007g04240"
FT                   /old_locus_tag="Vv08s0007g04240"
FT   gene            4174842..4178299
FT                   /locus_tag="VIT_08s0007g04230"
FT                   /old_locus_tag="Vv08s0007g04230"
FT   mRNA            join(4174842..4174863,4174864..4175049,4175126..4175285,
FT                   4175608..4175808,4175964..4176025,4176115..4176163,
FT                   4176427..4176482,4176577..4176663,4176753..4176803,
FT                   4176887..4177126,4177291..4177384,4177647..4177787,
FT                   4177927..4178009,4178010..4178299)
FT                   /locus_tag="VIT_08s0007g04230"
FT                   /old_locus_tag="Vv08s0007g04230"
FT                   /product="Predicted protein"
FT   5'UTR           4174842..4174863
FT                   /locus_tag="VIT_08s0007g04230"
FT                   /old_locus_tag="Vv08s0007g04230"
FT   CDS_pept        join(4174864..4175049,4175126..4175285,4175608..4175808,
FT                   4175964..4176025,4176115..4176163,4176427..4176482,
FT                   4176577..4176663,4176753..4176803,4176887..4177126,
FT                   4177291..4177384,4177647..4177787,4177927..4178009)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04230"
FT                   /old_locus_tag="Vv08s0007g04230"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIY9"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIY9"
FT                   /protein_id="CBI30215.3"
FT                   /translation="MATRGLVLYLLSGFSVAVLSVFFFTDPNGNHTYPPSNLSSLNTTL
FT                   LQNPFPSVSSSSEKVWPELKFSWRIVLATVIGFLGSAFGTVGGVGGGGIFVPMLTLIVG
FT                   FDTKSAAALSKCMIMGASTSSVWYNLRVNHPTKEAPIIDYDLALLFQPMLMLGITVGVA
FT                   LSVVFPYWLITILIIILFMGTSTRSFFKAVQMWNEETLFKKELEEQRRTMVNSHGELLI
FT                   DAEYDPLIPNEEKSWIQILCSNLRWKRILVLVTVWVIFLLLQIFKNDSTVCSAWYWVLF
FT                   LLQFPVAVVVFGYEAVKLHKEYKKRIISGNTEAVCEANIEWTGLNLAFCALCGILGGTV
FT                   GGLLGSGGGFILGPLLLEIGVIPQVASATATFVMMFSSSLSVVEFYLLKRFPIPYALYL
FT                   ISVSVVAGFWGQLFIRKLVAFLRRASIIIFILSGVIFASALTMGVVGTKESITMIHNHE
FT                   FMGFLSFCDSQ"
FT   3'UTR           4178010..4178299
FT                   /locus_tag="VIT_08s0007g04230"
FT                   /old_locus_tag="Vv08s0007g04230"
FT   gene            complement(4182522..4189422)
FT                   /locus_tag="VIT_08s0007g04220"
FT                   /old_locus_tag="Vv08s0007g04220"
FT   mRNA            complement(join(4182522..4182962,4183055..4183102,
FT                   4186970..4187953,4189197..4189397,4189398..4189422))
FT                   /locus_tag="VIT_08s0007g04220"
FT                   /old_locus_tag="Vv08s0007g04220"
FT                   /product="unknown predicted protein"
FT   CDS_pept        complement(join(4182522..4182962,4183055..4183102,
FT                   4186970..4187953,4189197..4189397))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04220"
FT                   /old_locus_tag="Vv08s0007g04220"
FT                   /product="unknown"
FT                   /db_xref="GOA:F6HKF5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:F6HKF5"
FT                   /protein_id="CCB55377.1"
FT                   /translation="MGDKQEEDRSESSDYTSEDEGTEDYRRGGYHAVRIGDTFKNGRYI
FT                   VQTKLGWGHFSTVWLAWDTLNSRYVALKVQKSAQHYTEAAMDEITILQQIAEGDPDDKK
FT                   CVVKLLDHFKHSGPNGQHVCMVFEYLGDNLLTLIKYTDYHGLPLHMVKEICFHVLEGLD
FT                   YLHGQLSIIHTDLKPENILLLSMIDPSKDPRKSGATLILPSNKDKNVFESGVGKDIKTS
FT                   NGDLTKNQKKKIRRKAKQAAKGCVEKDAAVEAEPDPETSGALESSPNVKLDLASVEDQP
FT                   NSSGNGDRLLDADGKKGPGQGNQGHRRGSHSMRQKLLASVDLKCKLVDFGNACWTYKQF
FT                   TNDIQTRQYRCPEVILGSKYSTSADLWSFACICFELATGDVLFDPHSGDNFDRDEDHLA
FT                   LMMELLGMMPRKIALGGQYSREFFNRYGDLRHIRRLRFWPMNKVLVEKYEFSEKDANDM
FT                   ADFLVPILDFVPEKRPTAAQCLLHPWISAGPLLLEPSMPSVKIQAGESVICEKKKREKD
FT                   EREAMEIGMGNIAISADSKPVEDPQSSSKPSSKASTSAPR"
FT   5'UTR           complement(4189398..4189422)
FT                   /locus_tag="VIT_08s0007g04220"
FT                   /old_locus_tag="Vv08s0007g04220"
FT   gene            4190037..4193622
FT                   /locus_tag="VIT_08s0007g04210"
FT                   /old_locus_tag="Vv08s0007g04210"
FT   mRNA            join(4190037..4190103,4190104..4190114,4191042..4191117,
FT                   4191278..4191379,4192921..4193069,4193280..4193439,
FT                   4193440..4193622)
FT                   /locus_tag="VIT_08s0007g04210"
FT                   /old_locus_tag="Vv08s0007g04210"
FT                   /product="Predicted protein"
FT   5'UTR           4190037..4190103
FT                   /locus_tag="VIT_08s0007g04210"
FT                   /old_locus_tag="Vv08s0007g04210"
FT   CDS_pept        join(4190104..4190114,4191042..4191117,4191278..4191379,
FT                   4192921..4193069,4193280..4193439)
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04210"
FT                   /old_locus_tag="Vv08s0007g04210"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIZ1"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR023442"
FT                   /db_xref="InterPro:IPR038630"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIZ1"
FT                   /protein_id="CBI30217.3"
FT                   /translation="MVLKTELCRFSGAKIYPGKGIRFVRSDSQVFLFANSKCKRYFHNR
FT                   LKPSKLTWTAMYRKQHKKDIAQEAVKKRRRATKKPYSRSIVGATLEVIQKRRTEKAEVR
FT                   DAAREAALREIKERIKKTKDEKKAKKAEVMAKVQKTQGKGNVPKGAAAPKGPKIGGGGG
FT                   KR"
FT   3'UTR           4193440..4193622
FT                   /locus_tag="VIT_08s0007g04210"
FT                   /old_locus_tag="Vv08s0007g04210"
FT   gene            complement(4196971..4198190)
FT                   /locus_tag="VIT_08s0007g04200"
FT                   /old_locus_tag="Vv08s0007g04200"
FT   mRNA            complement(join(4196971..4197210,4197383..4197714,
FT                   4198100..4198190))
FT                   /locus_tag="VIT_08s0007g04200"
FT                   /old_locus_tag="Vv08s0007g04200"
FT                   /product="unknown predicted protein"
FT   CDS_pept        complement(join(4196971..4197210,4197383..4197714,
FT                   4198100..4198190))
FT                   /codon_start=1
FT                   /locus_tag="VIT_08s0007g04200"
FT                   /old_locus_tag="Vv08s0007g04200"
FT                   /product="unknown"
FT                   /db_xref="GOA:D7TIZ2"
FT                   /db_xref="InterPro:IPR000047"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="UniProtKB/TrEMBL:D7TIZ2"
FT                   /protein_id="CBI30218.3"
FT                   /translation="MDWNGNLRPFVSRPESSFTFLYNYNYDPYPGMEVKHPVSAETAHA
FT                   MVRPMDKSSYGNQEKKKRLTNEQLESLERSFQEEIKLEPDRKMKLARELGLQPRQIAVW
FT                   FQNRRARWKTKELERLYDVLKQEYDLMSKEKQKLQEEVSKLKGILREQATRKQVSMGYT
FT                   EVSGEETVESTSITIRSSNKPRGLSHQIADCNYVYTAEEYNPVSPPYWGVLPPYPST"
FT   gene            complement(4202711..4207391)
FT                   /locus_tag="VIT_08s0007g04190"
FT                   /old_locus_tag="Vv08s0007g04190"
FT   mRNA            complement(join(4202711..4202942,4202943..4203411,
FT                   4206257..4206375,4206896..4207207,4207208..4207391))
FT                   /locus_tag="VIT_08s0007g04190"
FT                   /old_locus_tag="Vv08s0007g04190"
FT                   /product="unknown predicted protein"
FT   3'UTR           complement(4202711..4202942)
FT                   /locus_tag="VIT_08s0007g04190"
FT                   /old_locus_tag="Vv08s0007g04190"
FT   CDS_pept        complement(join(4202943..4203411,4206257..4206375,
FT