(data stored in ACNUC1104 zone)

EMBL: FN667741

ID   FN667741; SV 1; circular; genomic DNA; STD; PRO; 4225498 BP.
XX
AC   FN667741;
XX
PR   Project:PRJNA13399;
XX
DT   19-FEB-2010 (Rel. 103, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   Xenorhabdus bovienii SS-2004 chromosome, complete genome
XX
KW   complete genome.
XX
OS   Xenorhabdus bovienii SS-2004
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Morganellaceae; Xenorhabdus.
XX
RN   [1]
RP   1-4225498
RA   Gaudriault S.;
RT   ;
RL   Submitted (05-FEB-2010) to the INSDC.
RL   Gaudriault S., Laboratoire EMIP, UMR 1133, INRA, Universite Montpellier2,
RL   CC 54, Universite Montpellier 2, Place Eugene Bataillon, 34095 Montpellier
RL   CEDEX 05, FRANCE.
XX
RN   [2]
RX   PUBMED; 22125637.
RA   Chaston J.M., Suen G., Tucker S.L., Andersen A.W., Bhasin A., Bode E.,
RA   Bode H.B., Brachmann A.O., Cowles C.E., Cowles K.N., Darby C., de Leon L.,
RA   Drace K., Du Z., Givaudan A., Herbert Tran E.E., Jewell K.A., Knack J.J.,
RA   Krasomil-Osterfeld K.C., Kukor R., Lanois A., Latreille P.,
RA   Leimgruber N.K., Lipke C.M., Liu R., Lu X., Martens E.C., Marri P.R.,
RA   Medigue C., Menard M.L., Miller N.M., Morales-Soto N., Norton S.,
RA   Ogier J.C., Orchard S.S., Park D., Park Y., Qurollo B.A., Sugar D.R.,
RA   Richards G.R., Rouy Z., Slominski B., Slominski K., Snyder H., Tjaden B.C.,
RA   van der Hoeven R., Welch R.D., Wheeler C., Xiang B., Barbazuk B.,
RA   Gaudriault S., Goodner B., Slater S.C., Forst S., Goldman B.S.,
RA   Goodrich-Blair H.;
RT   "The entomopathogenic bacterial endosymbionts xenorhabdus and photorhabdus:
RT   convergent lifestyles from divergent genomes";
RL   PLoS One 6(11):e27909-e27909(2011).
XX
DR   MD5; fe1f0a4403719690775fb8fb14c76503.
DR   BioSample; SAMEA3138245.
DR   EnsemblGenomes-Gn; EBG00001218223.
DR   EnsemblGenomes-Gn; EBG00001218224.
DR   EnsemblGenomes-Gn; EBG00001218225.
DR   EnsemblGenomes-Gn; EBG00001218226.
DR   EnsemblGenomes-Gn; EBG00001218227.
DR   EnsemblGenomes-Gn; EBG00001218228.
DR   EnsemblGenomes-Gn; EBG00001218229.
DR   EnsemblGenomes-Gn; EBG00001218230.
DR   EnsemblGenomes-Gn; EBG00001218231.
DR   EnsemblGenomes-Gn; EBG00001218232.
DR   EnsemblGenomes-Gn; EBG00001218233.
DR   EnsemblGenomes-Gn; EBG00001218234.
DR   EnsemblGenomes-Gn; EBG00001218235.
DR   EnsemblGenomes-Gn; EBG00001218236.
DR   EnsemblGenomes-Gn; EBG00001218237.
DR   EnsemblGenomes-Gn; EBG00001218238.
DR   EnsemblGenomes-Gn; EBG00001218239.
DR   EnsemblGenomes-Gn; EBG00001218240.
DR   EnsemblGenomes-Gn; EBG00001218241.
DR   EnsemblGenomes-Gn; EBG00001218242.
DR   EnsemblGenomes-Gn; EBG00001218243.
DR   EnsemblGenomes-Gn; EBG00001218244.
DR   EnsemblGenomes-Gn; EBG00001218245.
DR   EnsemblGenomes-Gn; EBG00001218246.
DR   EnsemblGenomes-Gn; EBG00001218247.
DR   EnsemblGenomes-Gn; EBG00001218248.
DR   EnsemblGenomes-Gn; EBG00001218249.
DR   EnsemblGenomes-Gn; EBG00001218250.
DR   EnsemblGenomes-Gn; EBG00001218251.
DR   EnsemblGenomes-Gn; EBG00001218252.
DR   EnsemblGenomes-Gn; EBG00001218253.
DR   EnsemblGenomes-Gn; EBG00001218254.
DR   EnsemblGenomes-Gn; EBG00001218255.
DR   EnsemblGenomes-Gn; EBG00001218256.
DR   EnsemblGenomes-Gn; EBG00001218257.
DR   EnsemblGenomes-Gn; EBG00001218258.
DR   EnsemblGenomes-Gn; EBG00001218259.
DR   EnsemblGenomes-Gn; EBG00001218260.
DR   EnsemblGenomes-Gn; EBG00001218261.
DR   EnsemblGenomes-Gn; EBG00001218262.
DR   EnsemblGenomes-Gn; EBG00001218263.
DR   EnsemblGenomes-Gn; EBG00001218264.
DR   EnsemblGenomes-Gn; EBG00001218265.
DR   EnsemblGenomes-Gn; EBG00001218266.
DR   EnsemblGenomes-Gn; EBG00001218267.
DR   EnsemblGenomes-Gn; EBG00001218268.
DR   EnsemblGenomes-Gn; EBG00001218269.
DR   EnsemblGenomes-Gn; EBG00001218270.
DR   EnsemblGenomes-Gn; EBG00001218271.
DR   EnsemblGenomes-Gn; EBG00001218272.
DR   EnsemblGenomes-Gn; EBG00001218273.
DR   EnsemblGenomes-Gn; EBG00001218274.
DR   EnsemblGenomes-Gn; EBG00001218275.
DR   EnsemblGenomes-Gn; EBG00001218276.
DR   EnsemblGenomes-Gn; EBG00001218277.
DR   EnsemblGenomes-Gn; EBG00001218278.
DR   EnsemblGenomes-Gn; EBG00001218279.
DR   EnsemblGenomes-Gn; EBG00001218280.
DR   EnsemblGenomes-Gn; EBG00001218281.
DR   EnsemblGenomes-Gn; EBG00001218282.
DR   EnsemblGenomes-Gn; EBG00001218283.
DR   EnsemblGenomes-Gn; EBG00001218284.
DR   EnsemblGenomes-Gn; EBG00001218285.
DR   EnsemblGenomes-Gn; EBG00001218286.
DR   EnsemblGenomes-Gn; EBG00001218287.
DR   EnsemblGenomes-Gn; EBG00001218288.
DR   EnsemblGenomes-Gn; EBG00001218289.
DR   EnsemblGenomes-Gn; EBG00001218290.
DR   EnsemblGenomes-Gn; EBG00001218291.
DR   EnsemblGenomes-Gn; EBG00001218292.
DR   EnsemblGenomes-Gn; EBG00001218293.
DR   EnsemblGenomes-Gn; EBG00001218294.
DR   EnsemblGenomes-Gn; EBG00001218295.
DR   EnsemblGenomes-Gn; EBG00001218296.
DR   EnsemblGenomes-Gn; EBG00001218297.
DR   EnsemblGenomes-Gn; EBG00001218298.
DR   EnsemblGenomes-Gn; EBG00001218299.
DR   EnsemblGenomes-Gn; EBG00001218300.
DR   EnsemblGenomes-Gn; EBG00001218301.
DR   EnsemblGenomes-Gn; EBG00001218302.
DR   EnsemblGenomes-Gn; EBG00001218303.
DR   EnsemblGenomes-Gn; EBG00001218304.
DR   EnsemblGenomes-Gn; EBG00001218305.
DR   EnsemblGenomes-Gn; EBG00001218306.
DR   EnsemblGenomes-Gn; EBG00001218307.
DR   EnsemblGenomes-Gn; EBG00001218308.
DR   EnsemblGenomes-Gn; EBG00001218309.
DR   EnsemblGenomes-Gn; EBG00001218310.
DR   EnsemblGenomes-Gn; EBG00001218311.
DR   EnsemblGenomes-Gn; EBG00001218312.
DR   EnsemblGenomes-Gn; EBG00001218313.
DR   EnsemblGenomes-Gn; EBG00001218314.
DR   EnsemblGenomes-Gn; EBG00001218315.
DR   EnsemblGenomes-Gn; EBG00001218316.
DR   EnsemblGenomes-Gn; EBG00001218317.
DR   EnsemblGenomes-Gn; EBG00001218318.
DR   EnsemblGenomes-Gn; EBG00001218319.
DR   EnsemblGenomes-Gn; EBG00001218320.
DR   EnsemblGenomes-Gn; EBG00001218321.
DR   EnsemblGenomes-Gn; EBG00001218322.
DR   EnsemblGenomes-Gn; EBG00001218323.
DR   EnsemblGenomes-Gn; EBG00001218324.
DR   EnsemblGenomes-Gn; EBG00001218325.
DR   EnsemblGenomes-Gn; EBG00001218326.
DR   EnsemblGenomes-Gn; EBG00001218327.
DR   EnsemblGenomes-Gn; EBG00001218328.
DR   EnsemblGenomes-Gn; EBG00001218329.
DR   EnsemblGenomes-Gn; EBG00001218330.
DR   EnsemblGenomes-Gn; EBG00001218331.
DR   EnsemblGenomes-Gn; EBG00001218332.
DR   EnsemblGenomes-Gn; EBG00001218333.
DR   EnsemblGenomes-Gn; EBG00001218334.
DR   EnsemblGenomes-Gn; EBG00001218335.
DR   EnsemblGenomes-Gn; EBG00001218336.
DR   EnsemblGenomes-Gn; EBG00001218337.
DR   EnsemblGenomes-Gn; EBG00001218338.
DR   EnsemblGenomes-Gn; EBG00001218339.
DR   EnsemblGenomes-Gn; EBG00001218340.
DR   EnsemblGenomes-Gn; EBG00001218341.
DR   EnsemblGenomes-Gn; EBG00001218342.
DR   EnsemblGenomes-Gn; EBG00001218343.
DR   EnsemblGenomes-Gn; EBG00001218344.
DR   EnsemblGenomes-Gn; EBG00001218345.
DR   EnsemblGenomes-Gn; EBG00001218346.
DR   EnsemblGenomes-Gn; EBG00001218347.
DR   EnsemblGenomes-Gn; EBG00001218348.
DR   EnsemblGenomes-Gn; EBG00001218349.
DR   EnsemblGenomes-Gn; EBG00001218350.
DR   EnsemblGenomes-Gn; EBG00001218351.
DR   EnsemblGenomes-Gn; EBG00001218352.
DR   EnsemblGenomes-Gn; EBG00001218353.
DR   EnsemblGenomes-Gn; EBG00001218354.
DR   EnsemblGenomes-Gn; EBG00001218355.
DR   EnsemblGenomes-Gn; EBG00001218356.
DR   EnsemblGenomes-Gn; EBG00001218357.
DR   EnsemblGenomes-Gn; EBG00001218358.
DR   EnsemblGenomes-Gn; EBG00001218359.
DR   EnsemblGenomes-Gn; EBG00001218360.
DR   EnsemblGenomes-Gn; EBG00001218361.
DR   EnsemblGenomes-Gn; EBG00001218362.
DR   EnsemblGenomes-Gn; EBG00001218363.
DR   EnsemblGenomes-Gn; EBG00001218364.
DR   EnsemblGenomes-Gn; EBG00001218365.
DR   EnsemblGenomes-Gn; EBG00001218366.
DR   EnsemblGenomes-Gn; EBG00001218367.
DR   EnsemblGenomes-Gn; EBG00001218368.
DR   EnsemblGenomes-Gn; EBG00001218369.
DR   EnsemblGenomes-Gn; EBG00001218370.
DR   EnsemblGenomes-Gn; EBG00001218371.
DR   EnsemblGenomes-Gn; EBG00001218372.
DR   EnsemblGenomes-Gn; EBG00001218373.
DR   EnsemblGenomes-Gn; EBG00001218374.
DR   EnsemblGenomes-Gn; EBG00001218375.
DR   EnsemblGenomes-Gn; EBG00001218376.
DR   EnsemblGenomes-Gn; EBG00001218377.
DR   EnsemblGenomes-Gn; EBG00001218378.
DR   EnsemblGenomes-Gn; XBJ1_0047.
DR   EnsemblGenomes-Gn; XBJ1_0173.
DR   EnsemblGenomes-Gn; XBJ1_0174.
DR   EnsemblGenomes-Gn; XBJ1_0294.
DR   EnsemblGenomes-Gn; XBJ1_0295.
DR   EnsemblGenomes-Gn; XBJ1_0527.
DR   EnsemblGenomes-Gn; XBJ1_0629.
DR   EnsemblGenomes-Gn; XBJ1_0635.
DR   EnsemblGenomes-Gn; XBJ1_0636.
DR   EnsemblGenomes-Gn; XBJ1_0823.
DR   EnsemblGenomes-Gn; XBJ1_0824.
DR   EnsemblGenomes-Gn; XBJ1_0955.
DR   EnsemblGenomes-Gn; XBJ1_0956.
DR   EnsemblGenomes-Gn; XBJ1_1081.
DR   EnsemblGenomes-Gn; XBJ1_1082.
DR   EnsemblGenomes-Gn; XBJ1_1128.
DR   EnsemblGenomes-Gn; XBJ1_1422.
DR   EnsemblGenomes-Gn; XBJ1_1423.
DR   EnsemblGenomes-Gn; XBJ1_1505.
DR   EnsemblGenomes-Gn; XBJ1_1506.
DR   EnsemblGenomes-Gn; XBJ1_1521.
DR   EnsemblGenomes-Gn; XBJ1_1522.
DR   EnsemblGenomes-Gn; XBJ1_1523.
DR   EnsemblGenomes-Gn; XBJ1_1841.
DR   EnsemblGenomes-Gn; XBJ1_1842.
DR   EnsemblGenomes-Gn; XBJ1_1932.
DR   EnsemblGenomes-Gn; XBJ1_1964.
DR   EnsemblGenomes-Gn; XBJ1_1965.
DR   EnsemblGenomes-Gn; XBJ1_1977.
DR   EnsemblGenomes-Gn; XBJ1_1979.
DR   EnsemblGenomes-Gn; XBJ1_2331.
DR   EnsemblGenomes-Gn; XBJ1_2332.
DR   EnsemblGenomes-Gn; XBJ1_2395.
DR   EnsemblGenomes-Gn; XBJ1_2396.
DR   EnsemblGenomes-Gn; XBJ1_2397.
DR   EnsemblGenomes-Gn; XBJ1_2427.
DR   EnsemblGenomes-Gn; XBJ1_2428.
DR   EnsemblGenomes-Gn; XBJ1_2652.
DR   EnsemblGenomes-Gn; XBJ1_2653.
DR   EnsemblGenomes-Gn; XBJ1_3254.
DR   EnsemblGenomes-Gn; XBJ1_3768.
DR   EnsemblGenomes-Gn; XBJ1_3769.
DR   EnsemblGenomes-Gn; XBJ1_4012.
DR   EnsemblGenomes-Gn; XBJ1_4078.
DR   EnsemblGenomes-Gn; XBJ1_4079.
DR   EnsemblGenomes-Gn; XBJ1_4106.
DR   EnsemblGenomes-Gn; XBJ1_4107.
DR   EnsemblGenomes-Gn; XBJ1_4200.
DR   EnsemblGenomes-Gn; XBJ1_4254.
DR   EnsemblGenomes-Gn; XBJ1_4255.
DR   EnsemblGenomes-Gn; XBJ1_rRNA0001.
DR   EnsemblGenomes-Gn; XBJ1_rRNA0002.
DR   EnsemblGenomes-Gn; XBJ1_rRNA0003.
DR   EnsemblGenomes-Gn; XBJ1_rRNA0005.
DR   EnsemblGenomes-Gn; XBJ1_rRNA0006.
DR   EnsemblGenomes-Gn; XBJ1_rRNA0007.
DR   EnsemblGenomes-Gn; XBJ1_rRNA0009.
DR   EnsemblGenomes-Gn; XBJ1_rRNA0010.
DR   EnsemblGenomes-Gn; XBJ1_rRNA0011.
DR   EnsemblGenomes-Gn; XBJ1_rRNA0014.
DR   EnsemblGenomes-Gn; XBJ1_rRNA0015.
DR   EnsemblGenomes-Gn; XBJ1_rRNA0016.
DR   EnsemblGenomes-Gn; XBJ1_rRNA0018.
DR   EnsemblGenomes-Gn; XBJ1_rRNA0019.
DR   EnsemblGenomes-Gn; XBJ1_rRNA0020.
DR   EnsemblGenomes-Gn; XBJ1_rRNA0022.
DR   EnsemblGenomes-Gn; XBJ1_rRNA0023.
DR   EnsemblGenomes-Gn; XBJ1_rRNA0024.
DR   EnsemblGenomes-Gn; XBJ1_rRNA0027.
DR   EnsemblGenomes-Gn; XBJ1_rRNA0028.
DR   EnsemblGenomes-Gn; XBJ1_rRNA0029.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0001.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0002.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0003.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0004.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0005.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0006.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0007.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0008.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0009.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0010.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0011.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0012.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0013.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0014.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0015.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0016.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0017.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0018.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0019.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0020.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0021.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0022.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0023.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0024.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0025.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0026.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0027.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0028.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0029.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0030.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0031.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0032.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0033.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0034.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0035.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0036.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0037.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0038.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0039.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0040.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0041.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0042.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0043.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0044.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0045.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0046.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0047.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0048.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0049.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0050.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0051.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0052.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0053.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0054.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0055.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0056.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0057.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0058.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0059.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0060.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0061.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0062.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0063.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0064.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0065.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0066.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0067.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0068.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0069.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0070.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0071.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0072.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0073.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0074.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0075.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0076.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0077.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0078.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0079.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0080.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0081.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0082.
DR   EnsemblGenomes-Gn; XBJ1_tRNA0083.
DR   EnsemblGenomes-Tr; EBT00001786980.
DR   EnsemblGenomes-Tr; EBT00001786981.
DR   EnsemblGenomes-Tr; EBT00001786982.
DR   EnsemblGenomes-Tr; EBT00001786983.
DR   EnsemblGenomes-Tr; EBT00001786984.
DR   EnsemblGenomes-Tr; EBT00001786985.
DR   EnsemblGenomes-Tr; EBT00001786986.
DR   EnsemblGenomes-Tr; EBT00001786987.
DR   EnsemblGenomes-Tr; EBT00001786988.
DR   EnsemblGenomes-Tr; EBT00001786989.
DR   EnsemblGenomes-Tr; EBT00001786990.
DR   EnsemblGenomes-Tr; EBT00001786991.
DR   EnsemblGenomes-Tr; EBT00001786992.
DR   EnsemblGenomes-Tr; EBT00001786993.
DR   EnsemblGenomes-Tr; EBT00001786994.
DR   EnsemblGenomes-Tr; EBT00001786995.
DR   EnsemblGenomes-Tr; EBT00001786996.
DR   EnsemblGenomes-Tr; EBT00001786997.
DR   EnsemblGenomes-Tr; EBT00001786998.
DR   EnsemblGenomes-Tr; EBT00001786999.
DR   EnsemblGenomes-Tr; EBT00001787000.
DR   EnsemblGenomes-Tr; EBT00001787001.
DR   EnsemblGenomes-Tr; EBT00001787002.
DR   EnsemblGenomes-Tr; EBT00001787003.
DR   EnsemblGenomes-Tr; EBT00001787004.
DR   EnsemblGenomes-Tr; EBT00001787005.
DR   EnsemblGenomes-Tr; EBT00001787006.
DR   EnsemblGenomes-Tr; EBT00001787007.
DR   EnsemblGenomes-Tr; EBT00001787008.
DR   EnsemblGenomes-Tr; EBT00001787009.
DR   EnsemblGenomes-Tr; EBT00001787010.
DR   EnsemblGenomes-Tr; EBT00001787011.
DR   EnsemblGenomes-Tr; EBT00001787012.
DR   EnsemblGenomes-Tr; EBT00001787013.
DR   EnsemblGenomes-Tr; EBT00001787014.
DR   EnsemblGenomes-Tr; EBT00001787015.
DR   EnsemblGenomes-Tr; EBT00001787016.
DR   EnsemblGenomes-Tr; EBT00001787017.
DR   EnsemblGenomes-Tr; EBT00001787018.
DR   EnsemblGenomes-Tr; EBT00001787019.
DR   EnsemblGenomes-Tr; EBT00001787020.
DR   EnsemblGenomes-Tr; EBT00001787021.
DR   EnsemblGenomes-Tr; EBT00001787022.
DR   EnsemblGenomes-Tr; EBT00001787023.
DR   EnsemblGenomes-Tr; EBT00001787024.
DR   EnsemblGenomes-Tr; EBT00001787025.
DR   EnsemblGenomes-Tr; EBT00001787026.
DR   EnsemblGenomes-Tr; EBT00001787027.
DR   EnsemblGenomes-Tr; EBT00001787028.
DR   EnsemblGenomes-Tr; EBT00001787029.
DR   EnsemblGenomes-Tr; EBT00001787030.
DR   EnsemblGenomes-Tr; EBT00001787031.
DR   EnsemblGenomes-Tr; EBT00001787032.
DR   EnsemblGenomes-Tr; EBT00001787033.
DR   EnsemblGenomes-Tr; EBT00001787034.
DR   EnsemblGenomes-Tr; EBT00001787035.
DR   EnsemblGenomes-Tr; EBT00001787036.
DR   EnsemblGenomes-Tr; EBT00001787037.
DR   EnsemblGenomes-Tr; EBT00001787038.
DR   EnsemblGenomes-Tr; EBT00001787039.
DR   EnsemblGenomes-Tr; EBT00001787040.
DR   EnsemblGenomes-Tr; EBT00001787041.
DR   EnsemblGenomes-Tr; EBT00001787042.
DR   EnsemblGenomes-Tr; EBT00001787043.
DR   EnsemblGenomes-Tr; EBT00001787044.
DR   EnsemblGenomes-Tr; EBT00001787045.
DR   EnsemblGenomes-Tr; EBT00001787046.
DR   EnsemblGenomes-Tr; EBT00001787047.
DR   EnsemblGenomes-Tr; EBT00001787048.
DR   EnsemblGenomes-Tr; EBT00001787049.
DR   EnsemblGenomes-Tr; EBT00001787050.
DR   EnsemblGenomes-Tr; EBT00001787051.
DR   EnsemblGenomes-Tr; EBT00001787052.
DR   EnsemblGenomes-Tr; EBT00001787053.
DR   EnsemblGenomes-Tr; EBT00001787054.
DR   EnsemblGenomes-Tr; EBT00001787055.
DR   EnsemblGenomes-Tr; EBT00001787056.
DR   EnsemblGenomes-Tr; EBT00001787057.
DR   EnsemblGenomes-Tr; EBT00001787058.
DR   EnsemblGenomes-Tr; EBT00001787059.
DR   EnsemblGenomes-Tr; EBT00001787060.
DR   EnsemblGenomes-Tr; EBT00001787061.
DR   EnsemblGenomes-Tr; EBT00001787062.
DR   EnsemblGenomes-Tr; EBT00001787063.
DR   EnsemblGenomes-Tr; EBT00001787064.
DR   EnsemblGenomes-Tr; EBT00001787065.
DR   EnsemblGenomes-Tr; EBT00001787066.
DR   EnsemblGenomes-Tr; EBT00001787067.
DR   EnsemblGenomes-Tr; EBT00001787068.
DR   EnsemblGenomes-Tr; EBT00001787069.
DR   EnsemblGenomes-Tr; EBT00001787070.
DR   EnsemblGenomes-Tr; EBT00001787071.
DR   EnsemblGenomes-Tr; EBT00001787072.
DR   EnsemblGenomes-Tr; EBT00001787073.
DR   EnsemblGenomes-Tr; EBT00001787074.
DR   EnsemblGenomes-Tr; EBT00001787075.
DR   EnsemblGenomes-Tr; EBT00001787076.
DR   EnsemblGenomes-Tr; EBT00001787077.
DR   EnsemblGenomes-Tr; EBT00001787078.
DR   EnsemblGenomes-Tr; EBT00001787079.
DR   EnsemblGenomes-Tr; EBT00001787080.
DR   EnsemblGenomes-Tr; EBT00001787081.
DR   EnsemblGenomes-Tr; EBT00001787082.
DR   EnsemblGenomes-Tr; EBT00001787083.
DR   EnsemblGenomes-Tr; EBT00001787084.
DR   EnsemblGenomes-Tr; EBT00001787085.
DR   EnsemblGenomes-Tr; EBT00001787086.
DR   EnsemblGenomes-Tr; EBT00001787087.
DR   EnsemblGenomes-Tr; EBT00001787088.
DR   EnsemblGenomes-Tr; EBT00001787089.
DR   EnsemblGenomes-Tr; EBT00001787090.
DR   EnsemblGenomes-Tr; EBT00001787091.
DR   EnsemblGenomes-Tr; EBT00001787092.
DR   EnsemblGenomes-Tr; EBT00001787093.
DR   EnsemblGenomes-Tr; EBT00001787094.
DR   EnsemblGenomes-Tr; EBT00001787095.
DR   EnsemblGenomes-Tr; EBT00001787096.
DR   EnsemblGenomes-Tr; EBT00001787097.
DR   EnsemblGenomes-Tr; EBT00001787098.
DR   EnsemblGenomes-Tr; EBT00001787099.
DR   EnsemblGenomes-Tr; EBT00001787100.
DR   EnsemblGenomes-Tr; EBT00001787101.
DR   EnsemblGenomes-Tr; EBT00001787102.
DR   EnsemblGenomes-Tr; EBT00001787103.
DR   EnsemblGenomes-Tr; EBT00001787104.
DR   EnsemblGenomes-Tr; EBT00001787105.
DR   EnsemblGenomes-Tr; EBT00001787106.
DR   EnsemblGenomes-Tr; EBT00001787107.
DR   EnsemblGenomes-Tr; EBT00001787108.
DR   EnsemblGenomes-Tr; EBT00001787109.
DR   EnsemblGenomes-Tr; EBT00001787110.
DR   EnsemblGenomes-Tr; EBT00001787111.
DR   EnsemblGenomes-Tr; EBT00001787112.
DR   EnsemblGenomes-Tr; EBT00001787113.
DR   EnsemblGenomes-Tr; EBT00001787114.
DR   EnsemblGenomes-Tr; EBT00001787115.
DR   EnsemblGenomes-Tr; EBT00001787116.
DR   EnsemblGenomes-Tr; EBT00001787117.
DR   EnsemblGenomes-Tr; EBT00001787118.
DR   EnsemblGenomes-Tr; EBT00001787119.
DR   EnsemblGenomes-Tr; EBT00001787120.
DR   EnsemblGenomes-Tr; EBT00001787121.
DR   EnsemblGenomes-Tr; EBT00001787122.
DR   EnsemblGenomes-Tr; EBT00001787123.
DR   EnsemblGenomes-Tr; EBT00001787124.
DR   EnsemblGenomes-Tr; EBT00001787125.
DR   EnsemblGenomes-Tr; EBT00001787126.
DR   EnsemblGenomes-Tr; EBT00001787127.
DR   EnsemblGenomes-Tr; EBT00001787128.
DR   EnsemblGenomes-Tr; EBT00001787129.
DR   EnsemblGenomes-Tr; EBT00001787130.
DR   EnsemblGenomes-Tr; EBT00001787131.
DR   EnsemblGenomes-Tr; EBT00001787132.
DR   EnsemblGenomes-Tr; EBT00001787133.
DR   EnsemblGenomes-Tr; EBT00001787134.
DR   EnsemblGenomes-Tr; EBT00001787135.
DR   EnsemblGenomes-Tr; XBJ1_0047-1.
DR   EnsemblGenomes-Tr; XBJ1_0173.
DR   EnsemblGenomes-Tr; XBJ1_0174.
DR   EnsemblGenomes-Tr; XBJ1_0294.
DR   EnsemblGenomes-Tr; XBJ1_0295.
DR   EnsemblGenomes-Tr; XBJ1_0527-1.
DR   EnsemblGenomes-Tr; XBJ1_0629-1.
DR   EnsemblGenomes-Tr; XBJ1_0635.
DR   EnsemblGenomes-Tr; XBJ1_0636.
DR   EnsemblGenomes-Tr; XBJ1_0823.
DR   EnsemblGenomes-Tr; XBJ1_0824.
DR   EnsemblGenomes-Tr; XBJ1_0955.
DR   EnsemblGenomes-Tr; XBJ1_0956.
DR   EnsemblGenomes-Tr; XBJ1_1081.
DR   EnsemblGenomes-Tr; XBJ1_1082.
DR   EnsemblGenomes-Tr; XBJ1_1128.
DR   EnsemblGenomes-Tr; XBJ1_1422.
DR   EnsemblGenomes-Tr; XBJ1_1423.
DR   EnsemblGenomes-Tr; XBJ1_1505.
DR   EnsemblGenomes-Tr; XBJ1_1506.
DR   EnsemblGenomes-Tr; XBJ1_1521.
DR   EnsemblGenomes-Tr; XBJ1_1522.
DR   EnsemblGenomes-Tr; XBJ1_1523.
DR   EnsemblGenomes-Tr; XBJ1_1841.
DR   EnsemblGenomes-Tr; XBJ1_1842.
DR   EnsemblGenomes-Tr; XBJ1_1932.
DR   EnsemblGenomes-Tr; XBJ1_1964.
DR   EnsemblGenomes-Tr; XBJ1_1965.
DR   EnsemblGenomes-Tr; XBJ1_1977.
DR   EnsemblGenomes-Tr; XBJ1_1979.
DR   EnsemblGenomes-Tr; XBJ1_2331.
DR   EnsemblGenomes-Tr; XBJ1_2332.
DR   EnsemblGenomes-Tr; XBJ1_2395.
DR   EnsemblGenomes-Tr; XBJ1_2396.
DR   EnsemblGenomes-Tr; XBJ1_2397.
DR   EnsemblGenomes-Tr; XBJ1_2427.
DR   EnsemblGenomes-Tr; XBJ1_2428.
DR   EnsemblGenomes-Tr; XBJ1_2652.
DR   EnsemblGenomes-Tr; XBJ1_2653.
DR   EnsemblGenomes-Tr; XBJ1_3254-1.
DR   EnsemblGenomes-Tr; XBJ1_3768.
DR   EnsemblGenomes-Tr; XBJ1_3769.
DR   EnsemblGenomes-Tr; XBJ1_4012-1.
DR   EnsemblGenomes-Tr; XBJ1_4078.
DR   EnsemblGenomes-Tr; XBJ1_4079.
DR   EnsemblGenomes-Tr; XBJ1_4106.
DR   EnsemblGenomes-Tr; XBJ1_4107.
DR   EnsemblGenomes-Tr; XBJ1_4200-1.
DR   EnsemblGenomes-Tr; XBJ1_4254-1.
DR   EnsemblGenomes-Tr; XBJ1_4255-1.
DR   EnsemblGenomes-Tr; XBJ1_rRNA0001-1.
DR   EnsemblGenomes-Tr; XBJ1_rRNA0002-1.
DR   EnsemblGenomes-Tr; XBJ1_rRNA0003-1.
DR   EnsemblGenomes-Tr; XBJ1_rRNA0005-1.
DR   EnsemblGenomes-Tr; XBJ1_rRNA0006-1.
DR   EnsemblGenomes-Tr; XBJ1_rRNA0007-1.
DR   EnsemblGenomes-Tr; XBJ1_rRNA0009-1.
DR   EnsemblGenomes-Tr; XBJ1_rRNA0010-1.
DR   EnsemblGenomes-Tr; XBJ1_rRNA0011-1.
DR   EnsemblGenomes-Tr; XBJ1_rRNA0014-1.
DR   EnsemblGenomes-Tr; XBJ1_rRNA0015-1.
DR   EnsemblGenomes-Tr; XBJ1_rRNA0016-1.
DR   EnsemblGenomes-Tr; XBJ1_rRNA0018-1.
DR   EnsemblGenomes-Tr; XBJ1_rRNA0019-1.
DR   EnsemblGenomes-Tr; XBJ1_rRNA0020-1.
DR   EnsemblGenomes-Tr; XBJ1_rRNA0022-1.
DR   EnsemblGenomes-Tr; XBJ1_rRNA0023-1.
DR   EnsemblGenomes-Tr; XBJ1_rRNA0024-1.
DR   EnsemblGenomes-Tr; XBJ1_rRNA0027-1.
DR   EnsemblGenomes-Tr; XBJ1_rRNA0028-1.
DR   EnsemblGenomes-Tr; XBJ1_rRNA0029-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0001-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0002-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0003-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0004-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0005-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0006-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0007-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0008-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0009-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0010-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0011-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0012-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0013-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0014-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0015-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0016-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0017-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0018-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0019-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0020-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0021-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0022-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0023-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0024-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0025-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0026-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0027-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0028-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0029-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0030-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0031-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0032-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0033-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0034-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0035-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0036-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0037-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0038-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0039-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0040-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0041-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0042-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0043-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0044-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0045-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0046-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0047-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0048-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0049-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0050-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0051-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0052-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0053-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0054-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0055-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0056-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0057-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0058-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0059-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0060-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0061-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0062-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0063-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0064-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0065-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0066-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0067-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0068-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0069-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0070-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0071-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0072-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0073-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0074-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0075-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0076-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0077-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0078-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0079-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0080-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0081-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0082-1.
DR   EnsemblGenomes-Tr; XBJ1_tRNA0083-1.
DR   EuropePMC; PMC3091717; 20950463.
DR   EuropePMC; PMC3220699; 22125637.
DR   EuropePMC; PMC4079199; 24904010.
DR   EuropePMC; PMC4630870; 26525894.
DR   EuropePMC; PMC4758244; 26769959.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01728; STAXI.
DR   RFAM; RF01748; nuoG.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02194; HPnc0260.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   SILVA-LSU; FN667741.
DR   SILVA-SSU; FN667741.
XX
CC   Annotation results relative to BLAST similarities, COG assignations,
CC   enzymatic function prediction (PRIAM software), TMHMM and SignalP
CC   predictions, and synteny conservation (Syntonizer software)
CC   are available in the MaGe annotation system
CC   http://www.genoscope.cns.fr/agc/mage.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4225498
FT                   /organism="Xenorhabdus bovienii SS-2004"
FT                   /strain="SS-2004"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:406818"
FT   operon          159..6195
FT                   /operon="XBJ1_operon0001"
FT   CDS_pept        159..1547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0001"
FT                   /gene="dnaA"
FT                   /locus_tag="XBJ1_0001"
FT                   /product="DNA replication initiator protein,
FT                   transcriptional regulator of replication and housekeeping
FT                   genes"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0001"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79156"
FT                   /db_xref="GOA:D3UXX8"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXX8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79156.1"
FT                   /translation="MSLSLWQQCLARLQDELPATEFSMWIRPLQAELSDNTLALYAPNR
FT                   FVLDWVREKYINNINLLLNDFCGPEVPLLRFEVGNKPVSPNQSTSQKIIANMPIATAPS
FT                   SLSVRPSWDNAKAQPELSYRSNVNPKHTFDNFVEGKSNQLARAAARQVADNPGGAYNPL
FT                   FLYGGTGLGKTHLLHAVGNSIMARKANAKVVYMHSERFVQDMVKALQNNAIEEFKRYYR
FT                   SVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRF
FT                   GWGLTVAIEPPELETRVAILMKKADENQIQLPGEVAFFIAKRLRSNVRELEGALNRVIA
FT                   NANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVA
FT                   RPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIR
FT                   TLSS"
FT   CDS_pept        1552..2652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0001"
FT                   /gene="dnaN"
FT                   /locus_tag="XBJ1_0002"
FT                   /product="DNA polymerase III, beta-subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0002"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79157"
FT                   /db_xref="GOA:D3UXX9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXX9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79157.1"
FT                   /translation="MKFIIEREQLLKPLQQVSSPLGGRPTLPILGNLLLQVTESSLLLT
FT                   GTDLEMEMKARVALTQPHEQGATTIPARKFFDIWRGLPDGAEISVELDGDRILVRSGRS
FT                   RFSLSTLPASDFPNLDDWQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETE
FT                   EEELRTVATDGHRLAVCSMNIGQNLPSHSVIVPRKGVIELMRLLDGGDSLLQLQIGSNN
FT                   IRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKTLEANCDVLKQAFSRAAILSNEKFRGV
FT                   RIYLSENQLRITANNPEQEEAEEIVDVSYQGTEMEIGFNVSYVLDVLNALKCEQVSLLL
FT                   TDATSSVKIENSASQAATYVVMPMRL"
FT   CDS_pept        2671..3762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0001"
FT                   /gene="recF"
FT                   /locus_tag="XBJ1_0003"
FT                   /product="gap repair protein with nucleoside triP hydrolase
FT                   domain, part of RecFOR complex that targets RecA to
FT                   ssDNA-dsDNA junction"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0003"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79158"
FT                   /db_xref="GOA:D3UXY0"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXY0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79158.1"
FT                   /translation="MILSRLLIRDFRNIADADLTLATGFNFLVGPNGSGKTSILEAIYT
FT                   LGHGRAFRSIQAGRVIRHDCEEFILHGRLEQQFHERILAVGLSKNRLGDSKVRIDGSDG
FT                   HKIAELAKMLPMQLITPEGFTLLNGGPKYRRAFIDWGCFHNEPRFFTAWVNLKRLLKQR
FT                   NAALRQVTRYGQIQHWDRELAPLATEISQWRAEYIAGIAEDIEKTCKQFLPEFTLSISF
FT                   QQGWDKESEYAELLARQFERDRTLTYTASGPHKADLRIRVDGTPVEDMLSRGQLKLLMC
FT                   ALRLAQGEYFTRQSGQKCLYLLDDFASELDAGRRQLLAERLKSTQAQVFVSAITPGQVT
FT                   DMIDVNSRMFRVEHGKIEVQPQD"
FT   CDS_pept        3781..6195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0001"
FT                   /gene="gyrB"
FT                   /locus_tag="XBJ1_0004"
FT                   /product="DNA gyrase, subunit B (type II topoisomerase)"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0004"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79159"
FT                   /db_xref="GOA:D3UXY1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXY1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79159.1"
FT                   /translation="MSNTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVD
FT                   NAIDEALAGHCDKILVTIHTDNSVSVQDDGRGIPTGIHEEEGVSAAEVIMTVLHAGGKF
FT                   DDNSYKVSGGLHGVGVSVVNALSEKLELIIRRDGKVHEQTYQHGVPQAPLKTVGDTEQT
FT                   GTTVRFWPSMDTFKLNTEFEYDILAKRLRELSFLNSGVSIRLVDKRTNAEDHFHYEGGI
FT                   KAFVEFLSRNKTPIHPNVFYFSTEKDGIGVEISMQWNDGFQENIYCFTNNIPQRDGGAH
FT                   LVGFRAAMTRTLNSYMDKEGYNKKSKINATGDDAREGLIAVISVKVPDPKFSSQTKDKL
FT                   VSSEVKTAVETQMNEKLVEYLLENPNDAKTVVGKIIDAARAREAARKAREMTRRKGALD
FT                   LAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARF
FT                   DKMLSSQEVATLITALGCGIGRDEYNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFYRQ
FT                   MPEIIERGYVYIAQPPLYKVKKGKQEQYIKDDDAMEAYQMSIALDGASLYTNQYAPALK
FT                   GEALEKLVTEFNASNKIIKRMERLYPQALLNNLIYHPTLTEDALNDQAKVEEWVSTLAI
FT                   SLNDKEQNGSTYSYQIHENRERQIYEPVLCIRTHGVDTNYNLDFDFIHGGEYRRITKLG
FT                   ELIGNLIEEGAYIERGERRQLVSNFEQALEWLTKESRRGLSIQRYKGLGEMNPDQLWET
FT                   TMNPETRRMMRVTVKDAIATDLLFTTLMGDAVEPRRAFIEENALKAANIDI"
FT   regulatory      6420..6479
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(6506..6643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0005"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79160"
FT                   /db_xref="GOA:D3UXY2"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXY2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79160.1"
FT                   /translation="MVSLTTGINSLINLGLFLFIFILNMLSGGRVLKDFDLDRLLVDVL
FT                   "
FT   operon          6661..7782
FT                   /operon="XBJ1_operon0002"
FT   CDS_pept        6661..6921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0002"
FT                   /locus_tag="XBJ1_0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0006"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79161"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXY3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79161.1"
FT                   /translation="MNEINNIHNTIIKDRWFSHIENINNQNKTIQKIRERKSLWDMRCH
FT                   TTNRMLLKIKYKLSEPNMEYDETCTYFILYIDIAPHRSYVI"
FT   regulatory      6925..6984
FT                   /operon="XBJ1_operon0002"
FT                   /regulatory_class="promoter"
FT   CDS_pept        7006..7782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0002"
FT                   /locus_tag="XBJ1_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0007"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79162"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXY4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79162.1"
FT                   /translation="MLKRNNSFKDYISKIQSESLSRSKSFHSLPPDNILKANVNYNNPR
FT                   LINGYIPTVRETSLEEIINAVKHIYKSIKEDRWTSHIKNVTERKNEIFQKNQKTREDAW
FT                   DMRCCMTDNLLEKLQGILTILLKNGYFKTHAYFVCYINTQPIGVMLLKKYNSLYSRGTA
FT                   YYPEVNFIINHPGIQNCAYLLMEKAVNTSYKIGYQGKLKLTLATGELSSKVYQKMGFTH
FT                   IKGDENMKMELNPNGNSVWYLSPSYGGYFFTGIRRD"
FT   regulatory      complement(7799..7845)
FT                   /regulatory_class="terminator"
FT   regulatory      7812..7857
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(7878..8984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="XBJ1_0008"
FT                   /product="aspartate-semialdehyde dehydrogenase,
FT                   NAD(P)-binding"
FT                   /EC_number="1.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0008"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79163"
FT                   /db_xref="GOA:D3UXY5"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR011534"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXY5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79163.1"
FT                   /translation="MKNVGFIGWRGMVGSVLVQRMLEERDFDEINPVFFTTSQHGLSAP
FT                   EFAGKSGVLQDAFDIGALSALDIIISCQGGDYTNEIYPKLKATGWQGYWIDAASSLRMS
FT                   DDATIILDPINHQHIQNSLNKGIKTFAGGNCTVSLMLMSLGGLFANDLIEWASVSSYQA
FT                   ASGSGARHMRELLVQMGMLHNQVADELQDPASAILDIEKRVTDFTRSGALPTDQFGVPL
FT                   AGSLIPWIDKQLENGQSREEWKGQAETNKILNTGSNVIPIDGLCVRIGALRCHSQAFTL
FT                   KLKKDIPIHEIETLLASHNDWVRVIPNDRELTMRELTPAAVTGTLNTPVGRLRKLNMGP
FT                   EYLSAFTVGDQLLWGAAEPLRRMLRILL"
FT   regulatory      complement(9212..9271)
FT                   /regulatory_class="promoter"
FT   operon          complement(9563..12530)
FT                   /operon="XBJ1_operon0003"
FT   CDS_pept        complement(9563..11014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0003"
FT                   /locus_tag="XBJ1_0009"
FT                   /product="putative monooxygenase, flavin-binding family"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0009"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79164"
FT                   /db_xref="GOA:D3UXY6"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXY6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79164.1"
FT                   /translation="MSNQYDVLIMGAGVAGIGMACHLTRECPDKKVIILERRHAIGGTW
FT                   DLFRYPGIRSDSDMMTFGYKFRPWSETSVFADGESIKNYVNKTAKEYGIDKKIQFGLKI
FT                   TNADWSGTTNQWSITAVEEASGETRTFTCNYLVAATGYYNYDEAYLPEFPGIEDFKGPV
FT                   IHPQHWPEGLDYKGKRVVVIGSGATAATLVPTMANIAEHVTMLQRSPSYYLSVPGTDKI
FT                   AEFLSKFMPKRWVYSFSRNRNIFIHRLLYKTSRYLPTLLKSFLLSSARKRVGPSFNMNH
FT                   LTPKYMPWDERLCVIPNGNFLKSLKEGKSSIVTDQVKRFTENGILLQSGKELPADIIVS
FT                   ATGLKLLPLGGIEISIDEQKLQGNNRMLYKGTLIQDIPNFAYLFGYISSSWTLKVDLSA
FT                   DYVCRLLKEMDRRGAKSVTAYAQPDEMLKHENIFGELQSGYVRRGDEGLPRQGRSPNWY
FT                   VSHDYKKDKEVLEKQPVEDSALRWM"
FT   regulatory      complement(11064..11123)
FT                   /operon="XBJ1_operon0003"
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(11085..11219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0003"
FT                   /locus_tag="XBJ1_0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0010"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79165"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXY7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79165.1"
FT                   /translation="MYFKNSSHFTGHIQVALAMRLIGSNNSLSLTMILLSHKYKWLSY"
FT   regulatory      complement(11235..11281)
FT                   /operon="XBJ1_operon0003"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(11289..12530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0003"
FT                   /locus_tag="XBJ1_0011"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0011"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79166"
FT                   /db_xref="GOA:D3UXY8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXY8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79166.1"
FT                   /translation="MSLMKKYSVTNFVIYQVSDVLFTISIKTIGMLFTWVMLNQLGLVV
FT                   ELGYFLFISWALQVLTLLAFGLYGDKFSTKFYLISFCILSLLIISSLYFIESKNYFYWG
FT                   IFFIITSLFSILTQPIGNSIISRILHNTNTDLAFRARGLVSSLNVVSGPAISGILISYL
FT                   AYGHILVIVFCSVVISFLGFLWVSMMPSEKKADTSKVSLKILKNNPTELRLGAISGIFN
FT                   FVIVPLVSYFIPFLIIDTMKLGAFDLGIAEFFFGAGMFLGSSVLVKFFNQILGKGYASL
FT                   TGTILVSLGIFGVSISQSNIHINISMLIAGIGVVIYNINTTSIRMTATPSSQRHSMESV
FT                   FLSLCIIPIPLGMLFSTYSIQFLSVNSILLGMSLILLFCSILIIKTPNFMHLCKMSSES
FT                   LDGYYEKLYPRSVS"
FT   regulatory      complement(12637..12696)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(12793..12921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0012"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79167"
FT                   /db_xref="GOA:D3UXY9"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXY9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79167.1"
FT                   /translation="MVILVLFVTLFIIFTDILVVVISFAVIFILCIFVLYLIYIII"
FT   CDS_pept        complement(13024..13167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0013"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79168"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXZ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79168.1"
FT                   /translation="MRLTSKLIADAININPPCIILLKDVILISKIINAINIINLVNYIN
FT                   LE"
FT   operon          complement(13339..21037)
FT                   /operon="XBJ1_operon0004"
FT   CDS_pept        complement(13339..14082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0004"
FT                   /locus_tag="XBJ1_0014"
FT                   /product="putative Zinc metalloprotease"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0014"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79169"
FT                   /db_xref="GOA:D3UXZ1"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXZ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79169.1"
FT                   /translation="MAQLTIGKIDMQLNRKAIKNLHISVLPPDGLVRISAPMHMSDTAI
FT                   RMAVISRIPWIKKQQQDFARQPRQSEREMVNGECHYLWGRRHRLNIVEHVGKQQVKTSG
FT                   EKIYLYVPYGAPFEKKAQVLSDYYRAALKERIEKLLMHWQPIIGVMPSSWGIKKMKTKW
FT                   GSCNTVSGSIWLNLELAKKPLECLEFILVHELVHLLERKHNERFMTYMDGYLPDWRERK
FT                   RLLSILPLSNDEWVTPCVALLDISD"
FT   CDS_pept        complement(14082..17171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0004"
FT                   /locus_tag="XBJ1_0015"
FT                   /product="HsdR protein"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0015"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79170"
FT                   /db_xref="GOA:D3UXZ2"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXZ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79170.1"
FT                   /translation="MSTVGQRERVTQDRIVKFFQTELGYRYLGNLQDRDNKNIDVDILT
FT                   AWLKKRGISGTLIGRVLRQLINTAALGDGNKLYHANKNVYNLLRYGIKEKEDVGEQHQT
FT                   IWLIDWHNPEANDFAIAEEVSIKGENKKRPDIVLYVNGIALGIIELKRSSVSVSEGIRQ
FT                   NLDNQKKEFIRDFFSTMQLVMAGNDTQGLSYGTIGTPEKYYLEWKERIDNPYPYRLDFH
FT                   LSRICSKPRFLQLIHDFIVFDAGVKKACRHNQFFGVEAAKKRILQREGGIIWHTQGSGK
FT                   SLTMVWLAKWIRENVPNSRVLIVTDRTELDAQIEKVFTGVEENIYRTKSGADLIFNLNR
FT                   PNPWLICSLVHKFGHRSEAEDDAATDEYIKELKKSLPSDFRAKGDLFVFVDECHRTQSG
FT                   KLHDAMKSILAEAVFIGFTGTPLMKKDKKKSIEVFGSFIHTYKFDEAVSDGVILDLRYE
FT                   ARDIDQYLTSQKRIDEWFEANTQGLSRLGKTQLKQKWGTMQKVLSSKSRLEMIVMDIRL
FT                   DMMKRPRLMDGRGNAMLVCSSIHQACTVYDLFSQTDLAGKVAIITSYKPDSASIKGEET
FT                   GEGLTEQLAKYKTYRKMLADYFEQPEDKVANRVEEFETKVKQQFIDEPGQMRLLIVVDK
FT                   LLTGFDAPSATYLYIDKHMSDHNLFQAICRVNRLDGDDKEYGYIIDYKDLFRSLNKAIS
FT                   DYTKEVFDGYDKKDIDGLLKNRLEQARLNLDAALEMVRALCEPVKAPRNTIDYIHYFCC
FT                   ESGADPELLSEKEALRLALYQCVAKLLRAFANIANEMTIAGYSPAQMEKIRAEVAHYEK
FT                   VRDEIKLASKDKVEMKRYEPAMRSLIDMYIRADDSEVLIDFEEIGLLELIIQKGAAVGE
FT                   DLPEGIRKDPEAMAETIENNVRKTIVDENPVNPRYYEHMSVLLDELIALRRQNALNYQE
FT                   YLEKIRDLAKKVVRPNQNTAAYPPDIDTPPKRAFYDNFDQNTDLAICIDKTIRDTKKAD
FT                   WVNDRFKEREIANALRDETAEYKVDIDKIMELAKAQRDYR"
FT   CDS_pept        complement(17217..18575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0004"
FT                   /locus_tag="XBJ1_0016"
FT                   /product="Type I restriction-modification enzyme subunit S"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0016"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79171"
FT                   /db_xref="GOA:D3UXZ3"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXZ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79171.1"
FT                   /translation="MNQIAEGNSKYLAESVGNTLPIGYKQTEAGVIPEAWVVKSIGELA
FT                   NVIRGASPRPKGDKRYYDGKIPRLMVEDVTRDGKFVTPIVDSLTEAGAKLSRPCLRGTL
FT                   TLVCSGNVGIPSILAIDACIHDGFLALTKVSKNISIDYLYHFFSTQREKFNNSATHGGV
FT                   FTNLTTEGVREFLVALPFCYEEQTTIANILSDVDGLISELEKLLAKKQAIKIATMQQLL
FT                   TGRTRLPQFAFREDGSKKGYKRSELREIPEDWNPISIGKDAVLKARIGWQALTTKEYLE
FT                   TGEYYLVTGTNFDAGTVKWEDCWYVSEWRYKQDSNIQLKEDDVLITKDGTIGKVGYVEF
FT                   LRLPSTLNSGVFVIRPKNNAFHPRYLFYILTSKIFNEFMKGITAGSTITHLYQKDFVNF
FT                   NFIAPNIEEQTTIATILLDMDTEIQALKQRLGKTRQIKQGMMQELLTGKTRLI"
FT   CDS_pept        complement(18578..21037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0004"
FT                   /locus_tag="XBJ1_0017"
FT                   /product="Type I restriction-modification enzyme subunit M"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0017"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79172"
FT                   /db_xref="GOA:D3UXZ4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR004546"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXZ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79172.1"
FT                   /translation="MAIKKNELYSSLWASCDELRGGMDASQYKDYVLTMLFMKYVSDKY
FT                   KNDRYGIIVIPEGAGFDDMVALKGKKDIGDEINKIIRKLADENGLGTMFDVANFNDEEK
FT                   LGKGKEMIDRLSKLVGIFEGLDLSNNYAGGDDLMGDAYEYLMRHFATESGKSKGQFYTP
FT                   AEVSLVLAKIIGINDKTPRDASVYDPTCGSGSLLLKASDEAPRGLSIFGQEMDVTTSSL
FT                   AKMNMILHGHESDVHSIQQGNTIASPVFKDDKGQLKTFDFAVANPPFSNKNWTSGINPR
FT                   EDEFGRFGWGIPPEKNGDYAFLLHILKSLKSTGKGAVILPHGVLFRGNAESLIRENLIK
FT                   QGYIRGIIGLPANLFYGTGIPACIIVLDKQDAISADFDAEGKVTRGRDIFMIDASRDFI
FT                   KDGNKNRLRSQDIYKIVEVFTQQKTLPRFSRTVEFKEIVANDYNLNIPRYIDSSEPEDL
FT                   HDLSAHLQGGIPNRDIDVLDKYWNVFPGIRSTLFATEREGYSHSLVEANQVKDTILNHT
FT                   EFKTFAEQSLKPFAAWCQSAALKEIHRSDNPKELLNDISGYLLINYESVPLLSKYDVYQ
FT                   ILMDYWAETMQDDVYVLVQDDWAAGKKVRELVVKQAEKLKETPDFVIKKTKYKAEIIPP
FT                   ALIIQNYFAGQQVKIDQLQIDADNATQALENYIEENSGDDGLLNDALNDKDKVTKASIT
FT                   ARLKLATDNEEKTVLKQAKELFDAEIDAKKELKKYQEALDLSVLKQYSKLTDDEIKTLV
FT                   VDKKWLATLEANIQAEIERVTQQLTNRVRELEERYAESLPTISKSVDSLSSKVADNLKA
FT                   MGLEWVL"
FT   regulatory      complement(21080..21139)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(21165..22421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0018"
FT                   /product="ATPase, AAA+ superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0018"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79173"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXZ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79173.1"
FT                   /translation="MGIITLNNKRYPRLIAPKLKEALTDTPVVCLLGPRQVGKTTLVKE
FT                   LESGRAYITFDDSTLLNAAKSDPLGFVQGLPERVTLDEVQRVPEILPALKAVVDTNRTS
FT                   GRFILTGSANLLLLPGVQESLAGRVEVTYLQPLSEQEKQYSSVTLLEKLLSNRISPSIK
FT                   GEQAQLEGIADAVVQGGYPEPNTRTEARARQWHKQYLNAIIQRDVKDIAAIRDEEELLR
FT                   LIKILALRTGNLLNISGLSKDLGLQRDTVDKYITILERLFLVRRLPAWHKNHAKRLLKT
FT                   PKIHIIDSGLACVLTKLRTNDWYDFSSDFGAVLESFVVQQLICQSGWIEHELFFSHYRD
FT                   KDQVEVDLVIEDGKKVWGVEVKKAASIQPKDGAGLAKLASLSGDDWQGGIMLYTGNNCL
FT                   PISQVPNTYAVPMNALWKE"
FT   regulatory      complement(22619..22678)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(22659..22695)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(22754..24583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="XBJ1_0019"
FT                   /product="L-glutamine:D-fructose-6-phosphate
FT                   aminotransferase"
FT                   /EC_number="2.6.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0019"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79174"
FT                   /db_xref="GOA:D3UXZ6"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXZ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79174.1"
FT                   /translation="MCGIVGAVAQRDIAEILIEGLRRLEYRGYDSAGLAVVDSENGMTR
FT                   LREVGKVQMLADEAGKQPVTGGTGIAHTRWATHGEPNELNAHPHVSEHIAVVHNGIIEN
FT                   YEELRELLKERGYTFFSDTDTETIAHLVHWEQKQGGSLLEVVQRVIPQLRGAYGTVIMD
FT                   SRHPDVLVAARSGSPLVIGLGVGENFLASDQLALLPVTRRFIYLEEGDIVEITRRTVRI
FT                   FDVTGAAVEREQIESNVQYDAGDKGIYRHYMQKEIYEQPMAIKSTLEGRLSHGQVDLSE
FT                   LGANAEELLSQVEHIQIVACGTSYNAGMVSRYWFESLAGIPCDVEIASEFRYRKPARRK
FT                   GSLLITLSQSGETADTLAALRLSKELGYLTSLVICNVAGSSLVRESDFALMTKAGAEIG
FT                   VASTKAFTTQLTVLLMLVAYMGRLKGADAALEQDVVHALQALPSRIESMLSKDKVIEAL
FT                   AEDFSEKHHALFLGRGDQYPIAVEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPV
FT                   IIVAPNNELLEKLKSNIEEVRARGGQLYVFADQDAGFTNSENMKIISLPHVEDLIAPIF
FT                   YTVPLQLLSYHVALIKGTDVDQPRNLAKSVTVE"
FT   CDS_pept        complement(24708..26087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="XBJ1_0020"
FT                   /product="bifunctional: N-acetyl glucosamine-1-phosphate
FT                   uridyltransferase (N-terminal); glucosamine-1-phosphate
FT                   acetyl transferase (C-terminal)"
FT                   /EC_number="2.7.7.23"
FT                   /EC_number="2.3.1.57"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0020"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79175"
FT                   /db_xref="GOA:D3UXZ7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXZ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79175.1"
FT                   /translation="MSISANSAKSVVILAAGKGTRMYSALPKVLHSLAGKPMVQHVIDT
FT                   AMALGTQNVHLVYGHGGDLMKQTLSNQNLNWVLQAEQLGTGHAMQQAAPYFADDEDILM
FT                   LYGDVPLIAQDTLERLVEIKPEGGIGLLTAILNNPAGYGRIIRENGEVAGIIEQKDATD
FT                   EQRKINEINTGILVANGGDLKRWLSQLDNNNAQGEYYITDIIALAHKEGRQIKAVHPSR
FT                   LSEMEGVNNRLQLSALERIYQSEQAEKLLLAGVMLLDPARFDLRGTLEHGRDVVIDTNV
FT                   IIEGHVALGNNVHIGSGCILKNCAIGDGTVISPYTVIEDSEIAAECTVGPFARLRPGSK
FT                   LAEKAHVGNFVEMKKTSLGKGSKAGHLTYLGDSEIGNNVNIGAGTITCNYDGANKFKTI
FT                   IGDDVFVGSDTQLVAPVTVAKGVTIGAGTTVTKDVAENELVISRVKQTHIQGWQRPVKK
FT                   K"
FT   regulatory      complement(26114..26173)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(26159..26194)
FT                   /regulatory_class="terminator"
FT   operon          complement(26215..33158)
FT                   /operon="XBJ1_operon0005"
FT   CDS_pept        complement(26215..26637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0005"
FT                   /gene="atpC"
FT                   /locus_tag="XBJ1_0021"
FT                   /product="membrane-bound ATP synthase, F1 sector,
FT                   epsilon-subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0021"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79176"
FT                   /db_xref="GOA:D3UXZ8"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXZ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79176.1"
FT                   /translation="MAAMTFFLNVVSAEKRLFEGLVQKIQVTGSEGELGIYPQHTPLLT
FT                   AIKPGMIRIVKQFGEEEFIYLSGGVLEVQPNGVIVLADTAIRGKDLDEAKALEAKREAE
FT                   EHVRNSHGDVDYAQASAELSKAIAKLRVIELTKQRM"
FT   CDS_pept        complement(26659..28041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0005"
FT                   /gene="atpD"
FT                   /locus_tag="XBJ1_0022"
FT                   /product="membrane-bound ATP synthase, F1 sector,
FT                   beta-subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0022"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79177"
FT                   /db_xref="GOA:D3UXZ9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXZ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79177.1"
FT                   /translation="MATGKIIQVIGAVVDVEFPQDSVPKVYNALEVKNSEEKLVLEVQQ
FT                   QLGGGIVRCIAMGTSDGLRRGLDAIDLGHPIEVPVGKATLGRIMNVLGDPIDMKGEIGE
FT                   EERWSIHRTAPSYEELSSSQELLETGIKVMDLICPFAKGGKVGLFGGAGVGKTVNMMEL
FT                   IRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVLDKVSLVYGQMNEPPGNRLRVAL
FT                   TGLTMAEKFRDEGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQE
FT                   RITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDS
FT                   TSRQLDPLVVGQEHYDVARGVQSILQRYQELKDIIAILGMDELSEEDKLVVARARKIQR
FT                   FLSQPFFVAEVFTGSPGKFVSLKETIRGFKGILEGDYDHLPEQAFYMVGTIDEAVEKAK
FT                   KM"
FT   CDS_pept        complement(28076..28939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0005"
FT                   /gene="atpG"
FT                   /locus_tag="XBJ1_0023"
FT                   /product="membrane-bound ATP synthase, F1 sector,
FT                   gamma-subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0023"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79178"
FT                   /db_xref="GOA:D3UY00"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY00"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79178.1"
FT                   /translation="MAGAKEIRTKIASVQNTQKITKAMEMVAASKMRKTQDRMAASRPY
FT                   AETIRSVIGHLALGNLEYRHPYLDEREVKRVGYLVVSTDRGLCGGLNINLFKKLLIEMK
FT                   DWSDKGVQVDLALVGSKAVSFFSSVGGNIVAQVTGMGDNPSLSELIGPVNVMMQAYDAG
FT                   RLDKLYIVTNRFINTMSQVPTITQLLPLPAGDDETLKKKSWDYLYEPDPKALLDTLLRR
FT                   YIESQVYQGVVENLASEQAARMVAMKAATDNGGNLIKELQLVYNKARQASITQELTEIV
FT                   SGASAV"
FT   CDS_pept        complement(28999..30540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0005"
FT                   /gene="atpA"
FT                   /locus_tag="XBJ1_0024"
FT                   /product="membrane-bound ATP synthase, F1 sector,
FT                   alpha-subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0024"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79179"
FT                   /db_xref="GOA:D3UY01"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY01"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79179.1"
FT                   /translation="MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVNDGIIRIHGLA
FT                   DVMQGEMISLPGNRYAIALNLERDSVGAVVMGPYADLAEGMKVKCTGRILEVPVGRGLL
FT                   GRVVNTLGEPIDGKGALENDGFSPVEVIAPGVIDRQSVDQPVQTGYKSVDAMIPIGRGQ
FT                   RELVIGDRQTGKTALAIDAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHNALANTI
FT                   VVVASASESAALQYLAPYSGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQVSLLLRRPP
FT                   GREAFPGDVFYLHSRLLERAARVNADYVEKFTNGEVKGKTGSLTALPIIETQAGDVSAF
FT                   VPTNVISITDGQIFLESALFNAGIRPAVNPGISVSRVGGAAQTKIIKKLSGGIRTALAQ
FT                   YRELAAFSQFASDLDDATRKQLDHGQKVTELLKQKQYQPMSVAQQALSLFAAERGYLED
FT                   VEIAKVVSFESALLAYANREHSDLLKEIDQSGDYNGEIEAKLTALLDSFKATQSW"
FT   CDS_pept        complement(30555..31088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0005"
FT                   /gene="atpH"
FT                   /locus_tag="XBJ1_0025"
FT                   /product="membrane-bound ATP synthase, F1 sector,
FT                   delta-subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0025"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79180"
FT                   /db_xref="GOA:D3UY02"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY02"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79180.1"
FT                   /translation="MSEFATVARPYAKAAFDFAVEHQSLEHWQNMLAFVAEVTRNEQVG
FT                   ELLSGSLAPETLANTFITLCGEQVDEHAQNFIRVMAENGRLLVLPEVFQQFTQLRASLE
FT                   STINVEVISASELNEQQQAKISAAMEKRLSRKVKLNCKIDKSVIAGVVIRAGDMVIDGS
FT                   IRGRLDRLTDVLQS"
FT   CDS_pept        complement(31101..31571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0005"
FT                   /gene="atpF"
FT                   /locus_tag="XBJ1_0026"
FT                   /product="membrane-bound ATP synthase, F0 sector, subunit
FT                   b"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0026"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79181"
FT                   /db_xref="GOA:D3UY03"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY03"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79181.1"
FT                   /translation="MNINATILGQAIAFVLFVLFCMKYVWPPIMAAIEKRQKEITDGLA
FT                   SAERAKKNLDLAQANATDQLKKAKADAQAIIEQANKQKAQIIDDAKTEAELERNKIVAQ
FT                   AQAEIDAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL"
FT   CDS_pept        complement(31626..31871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0005"
FT                   /gene="atpE"
FT                   /locus_tag="XBJ1_0027"
FT                   /product="membrane-bound ATP synthase, F0 sector, subunit
FT                   c"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0027"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79182"
FT                   /db_xref="GOA:D3UY04"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY04"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79182.1"
FT                   /translation="MENLNMDLLYMAAAILMGLAAIGAAIGIGILGGKFLEGAARQPDL
FT                   IPLLRTQFFIVMGLVDAIPMIAVGLGLFMMFAVGGQ"
FT   CDS_pept        complement(31922..32749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0005"
FT                   /gene="atpB"
FT                   /locus_tag="XBJ1_0028"
FT                   /product="membrane-bound ATP synthase, F0 sector, subunit
FT                   a, important for FO assembly"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0028"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79183"
FT                   /db_xref="GOA:D3UY05"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY05"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79183.1"
FT                   /translation="MSASGEVLTSQEYISHHLKHLQLDLRTFELVNPHASGYETTFWTL
FT                   NIDSLFFSVILGILFLFVFRRVAVRATDGVPGKLQTAVEMVFGFVDNTVRDMYHGKSKV
FT                   IAPLALTVFVWVLLMNALDLLPIDLIPLIGERYFGLPALRIVPTADVSVTLSMALGVFV
FT                   LILFYSIKMKGIRGFAKELTLQPFNHPLFIPINLILEGVSLLSKPISLALRLFGNMYAG
FT                   ELIFILITALLPFWSQWLLSLPWAIFHILIITLQAFIFMVLTVVYLSMASEEH"
FT   CDS_pept        complement(32781..33158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0005"
FT                   /gene="atpI"
FT                   /locus_tag="XBJ1_0029"
FT                   /product="membrane-bound ATP synthase subunit, F1-F0-type
FT                   proton-ATPase"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0029"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79184"
FT                   /db_xref="GOA:D3UY06"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY06"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79184.1"
FT                   /translation="MSVSLYSGRIALKLLLLQLMTFIILSVAFCTRSIEWGASAFAGGL
FT                   ACWLPNAIFMLLTRFQKAKEEDVPVRIAWFFAIGEVAKVVITIAVLIVALGVFKAAFAP
FT                   LGVAYLAVLIVQIIAPAVMNG"
FT   regulatory      complement(33254..33313)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(33690..33737)
FT                   /regulatory_class="terminator"
FT   operon          complement(33769..36291)
FT                   /operon="XBJ1_operon0006"
FT   CDS_pept        complement(33769..34389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0006"
FT                   /gene="gidB"
FT                   /locus_tag="XBJ1_0030"
FT                   /product="glucose-inhibited division protein, contains
FT                   S-adenosyl-L-methionine-dependent methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0030"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79185"
FT                   /db_xref="GOA:D3UY07"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY07"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79185.1"
FT                   /translation="MLNKLESLLVKTDIVLSLEQKQQLIAYVDMLNKWNKAYNLTSVRD
FT                   PEQMLVRHIMDSIVVNPFLHGTRFIDVGTGPGLPGIPLAIVRPDSHFTLLDSLGKRVRF
FT                   LRQVQHELGLKNIDPVQSRVEEFIPEPPFDGVISRAFASLQDMLSWCRHLPKPAEGRFY
FT                   ALKGVLPENELTQLPSGVTLDTVVSLQVPELGGERHLVVLKSN"
FT   CDS_pept        complement(34402..36291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0006"
FT                   /gene="gidA"
FT                   /locus_tag="XBJ1_0031"
FT                   /product="glucose-inhibited division protein,
FT                   oxidoreductase-like with FAD/NAD(P)-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0031"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79186"
FT                   /db_xref="GOA:D3UY08"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY08"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79186.1"
FT                   /translation="MFYPEHFDVIIIGGGHAGTEAAMAAARMGRQTLLLTHNIDTLGQM
FT                   SCNPAIGGIGKGHLVKEIDALGGLMAQATDQAGIQFRTLNASKGPAVRATRAQADRVLY
FT                   RQAVRTALENQSNLMIFQQSVEDLIVENNTITGVVTRMGLKFKAKSVVLTVGTFLDGKI
FT                   HIGLENYSGGRAGDPPAIALSHRLRELPLRVARLKTGTPPRIDARTIDFSQLEQQLGDN
FT                   PTPVFSFMGNVDQHPRQIPCYITHTNEKTHEVIRNNLDRSPMYAGIIEGIGPRYCPSIE
FT                   DKVMRFADRNAHQIFLEPEGLTSNEIYPNGISTSLPFDVQMQIVHSMKGMENARIVRPG
FT                   YAIEYDFFDPRDLKQTLESKFINGLFFAGQINGTTGYEEAAAQGLLAGLNAARYAADEN
FT                   GWFPRRDQAYIGVLVDDLCTLGTKEPYRMFTSRAEYRLMLREDNADLRLTEKGRELGLV
FT                   DDQRWEHYCRKVEMIEQERQRLRNIWVHPHSDSLDEINQMLKAPLSKEANGEDLLRRPE
FT                   MNYELLTSLPRFTPGLTEPQAADQVEIQVKYEGYIARQQEEIEKQLRNENAALPLDLDY
FT                   KQVNGLSNEVIAKLNDHKPSSIGQASRISGITPAAISILLVWLKKQGLLRRSA"
FT   regulatory      complement(36332..36391)
FT                   /regulatory_class="promoter"
FT   operon          complement(36666..37661)
FT                   /operon="XBJ1_operon0007"
FT   CDS_pept        complement(36666..37106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0007"
FT                   /gene="mioC"
FT                   /locus_tag="XBJ1_0032"
FT                   /product="FMN-binding protein, required for biotin synthase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0032"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79187"
FT                   /db_xref="GOA:D3UY09"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY09"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79187.1"
FT                   /translation="MSTITLISGSTMGSSEYVAEHMAEILENHGFSTEVLHGPSLDDLR
FT                   LGGLWLVVTSTHGAGDLPENLQPLADTIAQQQPDLSNVTFGAVGIGSSEYDIFCGAIKS
FT                   FEHLLKDRGAKRIGDRLEIDIQKYEIPEDPAEDWVKEWAKLL"
FT   regulatory      complement(37130..37189)
FT                   /operon="XBJ1_operon0007"
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(37200..37661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0007"
FT                   /gene="asnC"
FT                   /locus_tag="XBJ1_0033"
FT                   /product="transcriptional regulator of asparagine
FT                   biosynthesis (AsnC family)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0033"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79188"
FT                   /db_xref="GOA:D3UY10"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY10"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79188.1"
FT                   /translation="MAEIYQIDNLDRDILHALMDNARTPYAELAKKFAVSPGTIHVRVE
FT                   KMKQAGIITGTRVDISAKQLGFDVCCFIGIILKSAKDYPAALKKLDMLDEVVEVYYTTG
FT                   HYSIFTKVMCRSIESLQDVLINKIQTIDEIQSTETLISLQNPIIRTIKP"
FT   regulatory      37691..37750
FT                   /regulatory_class="promoter"
FT   regulatory      complement(37748..37807)
FT                   /regulatory_class="promoter"
FT   CDS_pept        37827..38819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnA"
FT                   /locus_tag="XBJ1_0034"
FT                   /product="asparagine synthetase A"
FT                   /EC_number="6.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0034"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79189"
FT                   /db_xref="GOA:D3UY11"
FT                   /db_xref="InterPro:IPR004618"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY11"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79189.1"
FT                   /translation="MKTSFIEKQQQISFVKSYFSRLLEKQLGLIEVQGPILSRLGDGTQ
FT                   DNLSGHEKAVQVKVKTLPDATFEVVHSLAKWKRKTLGRFGFQAEQGLYTHMKALRPDED
FT                   RLTPIHSVFVDQWDWEKVMGEGHRSLGYLKQTVGKIYEAIKETQKAVSKEFGLAPFLPD
FT                   QIHFLHSEELLKRYPDLDAKSREREAAKEFGAIFLMGIGGKLSDGQAHDVRAPDYDDWT
FT                   TPNSDGLFGLNGDIIVWNPVLQDAFEISSMGIRVDAEALQRQLELTCDEDRLQYDWHQA
FT                   LVKGDMPQSIGGGIGQSRLVMLLLQMAHIGQVQCGVWSPEIIESVEGVL"
FT   operon          complement(38853..41817)
FT                   /operon="XBJ1_operon0008"
FT   CDS_pept        complement(38853..40310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0008"
FT                   /locus_tag="XBJ1_0035"
FT                   /product="Protein viaA (VWA-domain protein interacting with
FT                   AAA ATPase)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0035"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79190"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR023481"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY12"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79190.1"
FT                   /translation="MLTLTTLDLLLSINEGELIEEIILALLSAPQLTIFFEKYPRFKRA
FT                   LLKDVPAWQQTLQQRIKDTLIPASLAEEFQLYQQLLTANTTKFYQQLPDLADKLEQIKS
FT                   PFTHDAHTLREALSEHTHAGQILFIQHWRTSLILQVTTFHKQLLEQEKEQLLAEIQKRL
FT                   DLSGNLDPIFDENDRAAGRLWDMSKGRLHLTSHNTALFTQYAQFLKQQPELEKLAQLLG
FT                   RSQAAKSIPEDSNTLEPFTQIERIPDTVPEQVSGIQQGDDIQRLLPTELAMLGIEELEY
FT                   EFYRRLVDKKLLIYRLQGDNWQPRNILKPMTHHDHAEQPRGPFIVCVDTSGSMGGFNEH
FT                   CAKAFCLALMRIALADNRHCHIILFSTELIHYDLTSQDGLTQAVHFLGQTFKGGTDLAF
FT                   CLNAIIEKMQESIWKDADAVVISDFIAQRLPDVLIHQIQNLQQRQQHRFHAVSLSHYGK
FT                   PGIMQIFDHIWHFDTGVTSRLLRRWRH"
FT   regulatory      38890..38948
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(40315..41817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0008"
FT                   /gene="yieN"
FT                   /locus_tag="XBJ1_0036"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0036"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79191"
FT                   /db_xref="GOA:D3UY13"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR022547"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041538"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY13"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79191.1"
FT                   /translation="MQLVEKISQLSQYLEIGLYERRQTIRLCLLAALCGESVFLLGPPG
FT                   IAKSLIARRLKFSFQNAHAFEYLMTRFSTPEEIFGPLSIQALKDEGRYQRLTEGYLPEA
FT                   EIVFLDEIWKAGPAILNTLLTAINEKKFRNGNQEENLPMRLLVTASNELPDADSSLEAL
FT                   YDRMLIRIWLNNIQEKKNFRALLTDRNNENDNPVPTHFQITDEEFHQWQCKIKHVSLPD
FT                   YIFELIYQLRQLLNASENLPHVSDRRWKKAIRLLQASAFFSGKNAISPLDLVLLKDCLW
FT                   HDLNALKLLPQFLHDLLTEQAYQQSFLLQKMDGVYQQWIQTSRDETHLHPLQLTTNSSL
FT                   FGRKIHYSLPKTINDEKLILFLYPALHLHDIEVNFIEIDSKVLENVLKNSNGELLARLN
FT                   GIGFPLKISAEINEKHQLEVLDMSRNRAILCQAEAKQLTTEKTNNEWNEKLISISDAIQ
FT                   HQRQLFGQHQPCLFIEEHWIANIEQSFLQLIEKLKQLRSKMR"
FT   regulatory      complement(41929..41988)
FT                   /regulatory_class="promoter"
FT   regulatory      41946..42005
FT                   /regulatory_class="promoter"
FT   operon          42100..47934
FT                   /operon="XBJ1_operon0009"
FT   CDS_pept        42100..42519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0009"
FT                   /gene="rbsD"
FT                   /locus_tag="XBJ1_0037"
FT                   /product="membrane-associated component of high-affinity
FT                   D-ribose transport system, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0037"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79192"
FT                   /db_xref="GOA:D3UY14"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY14"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79192.1"
FT                   /translation="MKKGVLLHSDISAVISRLGHTDQITISDAGLPIPLSTQRIDLALT
FT                   QGIPDLMSVFDVVVQEVQVEAAILATEMIDHNPQIHEQIIKRIAELETKQGNAIAIEYV
FT                   NHNILKEKTEKSKAIIRTGECSPYANILLCSGVTF"
FT   CDS_pept        42527..44032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0009"
FT                   /gene="rbsA"
FT                   /locus_tag="XBJ1_0038"
FT                   /product="high-affinity D-ribose transport protein (ABC
FT                   superfamily, atp_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0038"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79193"
FT                   /db_xref="GOA:D3UY15"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY15"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79193.1"
FT                   /translation="MEPLLELKEIDKAFPGVKALSGAALRVYPGKVMALVGENGAGKST
FT                   MMKVLTGIYTKDAGSIHYLGKNVVFSDPKSSQEAGIGIIHQELNLIPQLTIAENIFLGR
FT                   EFVNKLGIINWQKMYEEADNLLKRLNIRYSSRRLVSELSIGDQQMVEIAKVLSFQSKVI
FT                   IMDEPTDALTDTETESLFHVIRELKAQDCGIVYISHRLKEIFEICDDVTVFRDGQFIGE
FT                   QPVAALQEDTLIEMMVGRKLEDQYPRLDLPRGGKRLEIENLSGSGIKNVSFSLFGGEIL
FT                   GISGLMGAGRTELMKMIYGALPKTKGRILLDGKSLTIRNPQDGLANGIVYISEDRKRDG
FT                   LVLGMSVKENMSLTALRYFSQKPYRLNHSAEQKTVTDFIKLFNIKTPSMEQSIGLLSGG
FT                   NQQKVAIARGLMTRPKVLILVEPTRGVDVGAKKEIYQLINQFKKEGLSIILVSSEMPEV
FT                   MGMSDRILVMHEGGISGEFSADNASQEALMVAAVGKQYGAVER"
FT   CDS_pept        44051..45022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0009"
FT                   /gene="rbsC"
FT                   /locus_tag="XBJ1_0039"
FT                   /product="high-affinity D-ribose transport protein (ABC
FT                   superfamily, membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0039"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79194"
FT                   /db_xref="GOA:D3UY16"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY16"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79194.1"
FT                   /translation="MNFNTAATSRYWLTKAWLMEQKSLIALLILIVVVSFFSPNFFTLN
FT                   NLFNILQQTSVNAIMAVGMTLVILTSGIDLSVGSLLALTGAVAASMVGTDVNALVAVAA
FT                   ALALGAAIGACTGVIVAKGKVQAFIATLVMMLLLRGVTRVYTDGSPINTGFSDNADLFG
FT                   WFGIGRPLGVPAPVWIMLLVFATAWYILHHTRLGRYIYALGGNESATRLSGINVDKIKI
FT                   IVYSLCGLLAALASIIEVARLSSAQPMAGSGYELDAIAAVVLGGTSLAGGKGRIVGTLI
FT                   GALILGFLNNGLNLLGISSNYQMIVKAVVILLAVLVDNKSSK"
FT   CDS_pept        45047..45937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0009"
FT                   /gene="rbsB"
FT                   /locus_tag="XBJ1_0040"
FT                   /product="D-ribose transport protein (ABC superfamily,
FT                   peri_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0040"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79195"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY17"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79195.1"
FT                   /translation="MKMNKLATILSAVVLSATMSANALAKDSIALVISTLNNPFFVTMK
FT                   DSAQKEADKLGYNLIVLDSQDNPAKELANVQDLTVRGTKLMLINPTDSDAVGNAVIMAN
FT                   KANIPVITLDRAANKGNVVSHIASDNRLGGKMAGDFIAEKLGNNAKIIQLEGISGTSGA
FT                   RERSEGFSQAAKSHQFNMLASQPADFDRTKGLNVMQNLLTAHPSVQAVFAQNDEMALGA
FT                   LRALQTANKKDVLVVGFDGTDDGVKAVRSGKLSATIAQRPDQIGIIGVQTADKVLKGEK
FT                   VDATIPVELELVIKK"
FT   CDS_pept        46001..46930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0009"
FT                   /gene="rbsK"
FT                   /locus_tag="XBJ1_0041"
FT                   /product="ribokinase"
FT                   /EC_number="2.7.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0041"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79196"
FT                   /db_xref="GOA:D3UY18"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY18"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79196.1"
FT                   /translation="MSMAKLAVMGSINADHILNLESFPQPGETVMGKQYQVAFGGKGAN
FT                   QAVAAGRCGADITFIACVGQDDIGERVRQQLVKDNINTSAIGVIEGETTGVALIFVNQQ
FT                   GENVIGISAGANGALTSEYFHHHEQVVKEADVLLLQLETPLETVQLAAETARKHNTKVI
FT                   LNPAPAQKLSEQLLSLVDIITPNETEAEYLTGIAVKDNVGAEKAAQDLHKKGIEIVIIT
FT                   LGSRGVWLSENGKQGKIVPGFKVKAIDTIAAGDTFNGALVTGLLEGKGIVSAIRFAHAA
FT                   AAIAVTRQGAQPAVPWRREIDAFLAEQD"
FT   CDS_pept        46942..47934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0009"
FT                   /gene="rbsR"
FT                   /locus_tag="XBJ1_0042"
FT                   /product="transcriptional repressor for ribose metabolism
FT                   (GalR/LacI family)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0042"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79197"
FT                   /db_xref="GOA:D3UY19"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY19"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79197.1"
FT                   /translation="MKDVARLAGVSTSTVSYVINDNRYVSERVKKKVNAAIDELNYAPS
FT                   ALARSLKIKKTKTIGMLVTTSNNPFYAEIVRGVERNCYERGYSLILCNTEGDVTRLIRS
FT                   METLLQKRVDGLLIMCSENAILPNDFLLRYPLIPMVTMDWSPFYVSSDVIKDNSLLGGE
FT                   LATSYLISRGFRKIACIAGPQDKTPARQRLAGYRKAMKDAQLEIPEGYEIHSDFEFAGG
FT                   LSSMEQLLQLSKPPEAVFAGNDAMAIGAYQALHRAGFSVPDDISVIGYDDISMAPYMTP
FT                   PLTTIHQPKDELGKLAIDTLLYRMGNPESEPKQLILKPKLIERNSVARR"
FT   CDS_pept        complement(47940..49322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsrA"
FT                   /locus_tag="XBJ1_0043"
FT                   /product="putative transport protein (MFS family)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0043"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79198"
FT                   /db_xref="GOA:D3UY20"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY20"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79198.1"
FT                   /translation="MVKSARSMSGLPWIAAIAFFMQSLDATILNTALPAIAKSLNHHPL
FT                   AMQPAIVSYTLTVAMLIPVSGWLADRFGTQRIFIYAVSLFSLGSLACALSSSFSFLVAA
FT                   RVIQGIGGAMMMPVARLALLRAYPRSELLPVLNFVTMPGLLGPILGPMLGGLLVTYATW
FT                   HWIFIINIPIGLLGIIYAKKHMPNFTMPKCFFDFLGFMLFSVGLVMLSVSFDLFGNNTL
FT                   PNYVPVAVMAGSIIMLSGYIFHAKRHPNPLIDLQLFQTRTFSVGITSNIATRLSTGSLS
FT                   FLIPLMLQVGFGYSAVIAGIMMAPNAIGAILAKSFVTKLLTQFGYRNTLIWVTVIIGVM
FT                   IAQFSLQTPEISLVFLIIPLFVLGMAMSTQFTSMNTITLGDLNNNNASAGNSLLAVTQQ
FT                   LSISLGVTVSAAILRFYESAEYGSTVDHFHYTFITIGVITLASSFVFLLLKKEDGRNLI
FT                   KK"
FT   regulatory      complement(49533..49592)
FT                   /regulatory_class="promoter"
FT   rRNA            49904..51400
FT                   /locus_tag="XBJ1_rRNA0001"
FT                   /product="16S ribosomal RNA"
FT   tRNA            51505..51580
FT                   /gene="GluTTC"
FT                   /locus_tag="XBJ1_tRNA0001"
FT                   /product="tRNA-Glu"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   rRNA            51941..52306
FT                   /gene="LSU_RRNA"
FT                   /locus_tag="XBJ1_rRNA0002"
FT                   /product="23S ribosomal RNA"
FT   rRNA            52321..54327
FT                   /gene="LSU_RRNA"
FT                   /locus_tag="XBJ1_rRNA0003"
FT                   /product="23S ribosomal RNA"
FT   rRNA            54762..54874
FT                   /locus_tag="XBJ1_0047"
FT                   /product="5S ribosomal RNA protein"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT   regulatory      complement(54882..54912)
FT                   /regulatory_class="terminator"
FT   regulatory      complement(54923..54982)
FT                   /regulatory_class="promoter"
FT   operon          complement(54998..56952)
FT                   /operon="XBJ1_operon0010"
FT   CDS_pept        complement(54998..56644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0010"
FT                   /gene="yjcG"
FT                   /locus_tag="XBJ1_0048"
FT                   /product="putative transport protein (SSS family)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0048"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79199"
FT                   /db_xref="GOA:D3UY21"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR014083"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY21"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79199.1"
FT                   /translation="MKKIVLSAMLLFSTLFHNLAQADAISGKVEEQPLNIQAIVMFLLF
FT                   VGFTLCITYWASKRTQSRSDYYTAGGRITGFQNGMAIAGDYMSAASFLGISALVYTSGY
FT                   DGLIYSIGFLVGWPIILFLIAERLRNLGRYTFADVASYRLKQRPIRTLSAIGSLVVVAL
FT                   YLIAQMVGAGKLIELLFGLNYHIAVILVGILMVLYVLFGGMLATTWVQIIKAILLLAGA
FT                   TFMALMVMKAVNFNFNTLFKEAIAVHSRGQAIMSPGGLVSDPISALSLGLALMFGTAGL
FT                   PHIIMRFFTVSDAKEARKSVFYATGFIGYFYILTFIIGFGAILLVSPNPAFKDATGALI
FT                   GGTNMSAVHLADAVGGNFFLGFISAVAFATILAVVAGLTLAGASAVSHDLYANVIKQGQ
FT                   ANERDELKVSKITVIILGFVAIGLGILFEKQNIAFMVGLAFSIAASCNFPIILLSMYWN
FT                   KLTTRGALIGGWLGLISAVVLMILGPTIWVNILGHEKPIYPYEYPALFSMFVAFICTWL
FT                   FSITDGSQQGQQERKMFRNQFIRSQTGIGIE"
FT   CDS_pept        complement(56641..56952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0010"
FT                   /locus_tag="XBJ1_0049"
FT                   /product="Inner membrane protein yjcH"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0049"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79200"
FT                   /db_xref="GOA:D3UY22"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY22"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79200.1"
FT                   /translation="MNPDIYQEIENNPRFKELVQKRGRFAWLLSAIMLVLYVGFIFLIA
FT                   FSPEWLGTPLYEGSSMTRGIPVGVGIIFISFILTGIYVVRANGEFDRLTSTILNEVKK"
FT   CDS_pept        complement(57122..59077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acs"
FT                   /locus_tag="XBJ1_0050"
FT                   /product="acetyl-CoA synthetase, has propionyl-CoA
FT                   synthetase activity"
FT                   /EC_number="6.2.1.1"
FT                   /EC_number="6.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0050"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79201"
FT                   /db_xref="GOA:D3UY23"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY23"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79201.1"
FT                   /translation="MTQIIKHLIPADIAETALISKQQYLQDYQWSLQDPEAFWSEKGKI
FT                   VDWIKPYTQVKNTSFDPGHVSIRWFEDGTLNLSANCLDRHLQERGEQTAIIWEGDNPAE
FT                   SKHVTYRELYHDVCQFANVLKKLDVKKGDVVAIYMPMVPEAAVAMLACTRVGAIHSVIF
FT                   GGFSPDAIAGRVIDSNAKLIITADEGIRAGRVIPLKKNVDEALSNPAVTDVVNVVVFKR
FT                   TGNTKSWQEGRDLWWHELIENVSTDCPAEEMNAEDPLFILYTSGSTGKPKGVLHTTGGY
FT                   LVYASLTFKYTFDYRPGEIYWCTADIGWVTGHSYLLYGPLSCGATSLMFEGVPNYPDVN
FT                   RLCQIVDKHQVNIIYTAPTAIRALMAEGDKAIEGTKRTSLRIMGSVGEPINPEAWEWYY
FT                   RKIGNSKCPIVDTWWQTETGGFMITPLPGAVDLKPGSATLPFFGISPALVGNSGEPLTG
FT                   ECEGNLVITDSWPGQARTLFGDHERFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVD
FT                   DVLNISGHRLGTAEIESALVSHPKIAEAAVVGIPHHIKGQAIYAYVTLNHGEEPSPDLY
FT                   TEVRNWVRKEIGPIATPDILHWTDSLPKTRSGKIMRRILRKIASGDTSNLGDTSTLADP
FT                   GVVEKLLEEKQSMNMT"
FT   regulatory      complement(59272..59331)
FT                   /regulatory_class="promoter"
FT   regulatory      59339..59398
FT                   /regulatory_class="promoter"
FT   CDS_pept        59449..60075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodA"
FT                   /locus_tag="XBJ1_0051"
FT                   /product="superoxide dismutase, manganese"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0051"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79202"
FT                   /db_xref="GOA:D3UY24"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY24"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79202.1"
FT                   /translation="MSYSLPALPYSYDALEPHFDKPTMEIHYTKHHQTYVTNTNTALEA
FT                   FPELAKLHIDDLIQQLDKIPADKRTFIRNNAGGHSNHSLFWKGLKLGTVLGGALKTAIE
FT                   RDLGSIEIFKEKFEQAAATRFGSGWAWLVLKADGKLAVVSTANQDSPLMGEEIAGASGY
FT                   PILGLDVWEHAYYLKYQNRRPDYIKAFWHVVDWDEAAKRYEEKIK"
FT   regulatory      60095..60143
FT                   /regulatory_class="terminator"
FT   operon          complement(60231..64576)
FT                   /operon="XBJ1_operon0011"
FT   CDS_pept        complement(60231..61265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0011"
FT                   /gene="trpS"
FT                   /locus_tag="XBJ1_0052"
FT                   /product="tryptophan tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0052"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79203"
FT                   /db_xref="GOA:D3UY25"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY25"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79203.1"
FT                   /translation="MNEPTVMKPNSQKPIVFSGAQPSGELTIGNYMGALRQWVKMQDEY
FT                   DCIYCIVNQHAITVRQDPNELKKRTLDTLALYLACGIDPKKSTIFVQSHVPQHSQLSWV
FT                   LNCYTYFGELGRMTQFKDKSARHAENINAGLFSYPVLMAADILLYQANQIPVGIDQKQH
FT                   LELSRDLAQRFNAIYGDIFTVPEPFIPTGGAKVMSLQDPAKKMSKSDDNCNNVIALLED
FT                   PKSVAKKIKRAVTDSEDPPRVRYDLENKPGVSNLLDILSGVTGKTIAELEAEFEGKMYG
FT                   HLKGAVADAVSEMLTDLQERYHHFRNDEALLNQIMAEGAAKAQARAQATLDKIYDAVGL
FT                   LAHP"
FT   CDS_pept        complement(61270..61974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0011"
FT                   /gene="gph"
FT                   /locus_tag="XBJ1_0053"
FT                   /product="phosphoglycolate phosphatase, contains a
FT                   phosphatase-like domain"
FT                   /EC_number="3.1.3.18"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0053"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79204"
FT                   /db_xref="GOA:D3UY26"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY26"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79204.1"
FT                   /translation="MVTSIKKNLRAIAFDLDGTLVDSASGLAEALDQALIAKGLPPAGK
FT                   ERVAIWIGNGADVMVERALKWAGVESTPELHRETRKLFDGFYETTVTTGSQLFPYVKET
FT                   LATLAQHNLPMAIVTNKPTPFIAPLLESLGISEYFSLVLGGDDVKEKKPHPAPLYLTMG
FT                   MFGIHKEELLFVGDSRNDILAAQAAGCPCVGLTYGYNYGESIALSHPDYILDHFPDLLP
FT                   AIGLSTLKLQEA"
FT   CDS_pept        complement(61974..62648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0011"
FT                   /gene="rpe"
FT                   /locus_tag="XBJ1_0054"
FT                   /product="D-ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0054"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79205"
FT                   /db_xref="GOA:D3UY27"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY27"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79205.1"
FT                   /translation="MKKDFLIAPSILSADFARLGEDTAKVLAAGADVVHFDVMDNHYVP
FT                   NLTIGPMVCQALCDYGITAPIDVHLMVKPVDRIIPDFAKAGATYITFHPEASEHVDRTL
FT                   QLIKEHGCKAGLVFNPATPLSYLDYVLDKLDVILLMSVNPGFSGQSFIPETLNKLRQVR
FT                   KIIDESGYDIRLEVDGGIKANNIREAAQAGADMFVAGSAIFSQPDYKTVIDEMRRELSK
FT                   VA"
FT   CDS_pept        complement(62707..63525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0011"
FT                   /gene="dam"
FT                   /locus_tag="XBJ1_0055"
FT                   /product="DNA adenine methylase"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0055"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79206"
FT                   /db_xref="GOA:D3UY28"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY28"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79206.1"
FT                   /translation="MKKKRAFLKWAGGKYPLVDDIRRHLPEGERLIEPFVGAGSVFLNT
FT                   DYDSYILSDINSDLINLYDTVKSRPEEFINHARPLFSQEFNTAEDFYRLREEFNKSQEP
FT                   LYRSLLFLYLNRHCYNGLCRYNSRGEFNVPFGRYKKPYFPEDELYWFAEKAQKASFVCQ
FT                   HYQITLDNAPQGSVIYCDPPYAPLSATANFTAYHTNSFNLLDQENLARMAYHLSSQQGI
FT                   PVLISNHDTLMTREWYHQATLHIVKARRTISRNILARSKVDELLALYCRK"
FT   CDS_pept        complement(63611..64576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0011"
FT                   /gene="damX"
FT                   /locus_tag="XBJ1_0056"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0056"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79207"
FT                   /db_xref="GOA:D3UY29"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR032899"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY29"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79207.1"
FT                   /translation="MDELKSENKQKTENEFKPDTSDRHPPRSRSQSNQPKLAVSRQQLM
FT                   IGVGILVLLLLIIAISSALKSPTEHEKQQSQNTAEKNIDLSGSSSLSTNNQNSSPENPL
FT                   ASAINGSQEISMPPISNTPSKDLSPAPEASNHNQRIELPGDISDALNQQQGNINNTVQK
FT                   NLTPSQSNPMQQTVIPPVEQNKTEKVAPPKIEKTEKVAKSEKHAKSTDKPAIFHHQASK
FT                   KSVTDTRGDLLKASANRFTLQLSSASRSDTLIAFAKNNNLSNYTVYEAKREGKAWFILI
FT                   HGSYGSVSDAKSAISSLPAEVQAKKPWVRKLQQVQQDLKK"
FT   regulatory      complement(64674..64733)
FT                   /regulatory_class="promoter"
FT   operon          complement(64764..66428)
FT                   /operon="XBJ1_operon0012"
FT   CDS_pept        complement(64764..65861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0012"
FT                   /gene="aroB"
FT                   /locus_tag="XBJ1_0057"
FT                   /product="dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0057"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79208"
FT                   /db_xref="GOA:D3UY30"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY30"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79208.1"
FT                   /translation="MEQVTVTLGERSYPIAIAQGLFSSDEAFKSLQAGQQVMIVTNETL
FT                   APLYLEQVKSTLQGMGLRVDEVILPDGEQYKSLFVVNDIFSALLENNHGRDTTLIALGG
FT                   GVIGDMTGFAAACYQRGIRFIQIPTTLLSQVDSSVGGKTGVNHPLGKNMIGAFYQPASV
FT                   IIDINCLKTLPAQELHAGLAEVIKYGIILDGEFFNWLESNIEQLLALDNQVIAYCIRRC
FT                   CELKAWVVAADEQERNGMRALLNLGHTFGHAIEAEMGYGVWLHGQAVAAGMVMAARTSE
FT                   LMGTFSKQDTQRIISLLERAKLPVNGPVEMSPEIYLPHMMRDKKVSAGKLHLVLPTAIG
FT                   KAELRSDIGSDVILDAIHLCLPSTS"
FT   CDS_pept        complement(65907..66428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0012"
FT                   /gene="aroK"
FT                   /locus_tag="XBJ1_0058"
FT                   /product="shikimate kinase I"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0058"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79209"
FT                   /db_xref="GOA:D3UY31"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY31"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79209.1"
FT                   /translation="MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIERRTGA
FT                   DVGWVFDVEGEEGFRDREEKIINELTEKQGIVLATGGGSVKSKETRNRLSARGVVVYLE
FT                   TTIEKQLARTQRDKKRPLLQVDAPAREVLENLADERNPLYEEIADLTIRTDEQSAKVVA
FT                   NQIIELLEKN"
FT   CDS_pept        66533..66784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0059"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79210"
FT                   /db_xref="GOA:D3UY32"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY32"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79210.1"
FT                   /translation="MGKLSQYINLYCNYIYLARTVVVWFMLCWLTVSLLYVYWGRLLLV
FT                   MLDPLTQLDNPCMLNYSQRQIHKQVRPRKIVENLVKKT"
FT   regulatory      complement(66534..66593)
FT                   /regulatory_class="promoter"
FT   operon          complement(66832..69836)
FT                   /operon="XBJ1_operon0013"
FT   CDS_pept        complement(66832..67917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0013"
FT                   /locus_tag="XBJ1_0060"
FT                   /product="putative transport protein, possibly in
FT                   biosynthesis of type IV pilin (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0060"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79211"
FT                   /db_xref="GOA:D3UY33"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY33"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79211.1"
FT                   /translation="MNSHFFILLACLFLLLPILASAEEINTWKETESEKAVRNPFQPPK
FT                   NELDEQLEFFPAERDEQEQEIEYQSITLQYADAGQIAEQLQKNTPALLTKWGKVEHDTM
FT                   TNSLILEDKFDAITRIKGWLKEVDTPQQQVQITAHIVTSSREALHELGIHWGMAADPLN
FT                   RSIGLNRLNLHQSAGNQSHRLVLNTARIHASLLEMELSALEQENQLDIIASPRLTASHQ
FT                   QPASIKQGSDIPYLVQDKDKTTIQFKEAVLGMEVTPHILRKGKIRLALKISQNAPGLPI
FT                   SQGGNENLAIDKQEIVTQVTVRNGETLILGGIFQQKKGASLQKVPYLSDLPLLGALFNQ
FT                   KGEQHSRRELVIFITPQLTDI"
FT   CDS_pept        complement(67920..68471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0013"
FT                   /locus_tag="XBJ1_0061"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0061"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79212"
FT                   /db_xref="GOA:D3UY34"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY34"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79212.1"
FT                   /translation="MKSNYLVWFHRPAWQLFLLQQLPVIPLILGFYFWVWQENEYAIHD
FT                   LQLNLTEQKHNSALSEKRIAELPNLPDIRQQIQQLTAELSQGNNILPNNIPQKNATVLK
FT                   RLHQPLTSSGSQLMEWKSHREGNQIFWHIMLSLSYDQLLHFLNEIQQVQPVLLIKHLTI
FT                   IPVDNDLTVRMVLSDVLHEG"
FT   CDS_pept        complement(68461..69012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0013"
FT                   /locus_tag="XBJ1_0062"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0062"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79213"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="InterPro:IPR016778"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY35"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79213.1"
FT                   /translation="MMYQVNFLPWRQARLKRLCRKWGLLLCLQLILCISVLTFISVQQK
FT                   NKIAQHHDKLTEISHQLMQLQQNIQESEHAIQHHQQLTQQLRKKQTFMEQNQRYLQLFR
FT                   QLPHLLPEKSWLTAFSDDTGQLVFAASSQNYDDVSDLLDNLTDNASLNNVQLKKMSTTE
FT                   EHLKIFTIDANWLMGAPDEK"
FT   CDS_pept        complement(68837..68986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0013"
FT                   /locus_tag="XBJ1_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0063"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79214"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY36"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79214.1"
FT                   /translation="MASGKIKTPMPEMGAIALPAINTLHICTNVYFRAAKKQNCATSRQ
FT                   INRN"
FT   CDS_pept        complement(69009..69836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0013"
FT                   /locus_tag="XBJ1_0064"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0064"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79215"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY37"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79215.1"
FT                   /translation="MYLSKWYIGLDVHEHYINAFAAIKRRDGWQLRHCWQYRLSSDIIS
FT                   GGRLQHPEKLGHILMQWRRKLPKKISLRLTLPVQQTLQKQIALPTHTLLQEPELGWFVH
FT                   ANAEKQFPVSDLALDYRVRGQQICISATRQKDLNLWLKLLADIDLSPDAIDISPCALRY
FT                   IAKLAGVPDDGWLIHKRITDWLWVTPASSPFGYGLISIQTHPHLAQIISQLPVLSDMAS
FT                   PEIYYSDEQHAIPAEPVHVWHMQTAFRHYQLPLPEKTDAFIIAAGLALRPDDQ"
FT   regulatory      69871..69930
FT                   /regulatory_class="promoter"
FT   CDS_pept        69975..72482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcA"
FT                   /locus_tag="XBJ1_0065"
FT                   /product="bifunctional penicillin-binding protein 1a:
FT                   transglycosylase (N-terminal); transpeptidase (C-terminal)"
FT                   /EC_number="2.4.2.-"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0065"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79216"
FT                   /db_xref="GOA:D3UY38"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY38"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79216.1"
FT                   /translation="MILVVVCILLGTASIFGLYKYIEPQLPDVATLKDVRLQTPMQVYS
FT                   ADGELMAQYGEKRRLPLTLSEMPPLMVKAFIATEDSRFYEHHGVDPIGVIRAVSVMMTS
FT                   GHASQGASTITQQLARNFFLSREKTLIRKAKEAFLAIKIEQLLTKDEILELYLNKIYLG
FT                   NRAYGVGAAANVYFGKNANELTLSEMAMIAGLPKAPSTLNPLYSYDRAVSRRNVVLVRM
FT                   LEEGYITQQQYNEARSEKLVARYHSPQIVFSAPYLTEMVRQEMINRYGENAYTDGYKVY
FT                   TTITRKVQLAAVDAVRANVIDYDMRHGYRGAQEVLWTVSQSAWSQSQIVDKLKTLSKYG
FT                   SLLPAVVTKSSATQAEAMLVDGNKVELTMAGVRWARQFKSDSLQGAAPRSVNEVIRAGE
FT                   QVWVRKVNDIWWLAQLPQVNAALVSLNPMNGEVEALVGGFDFELSKFNRVTQSLRQVGS
FT                   NIKPFLYTAAMDKGLTLASMFNDVPISRWDAGAGTDWRPKNSPPSYDGPIRLRQGLGQS
FT                   KNVVMVRAMRAMGVDYAADYLRRFGLPGENVVRTESMALGSPSFTPMQMVRGYAVMANG
FT                   GYLVDPYFITKIENDEGKVLFEAKPKLACPQCENIPVIYGDTAHSIELSEDSIENVTHS
FT                   NVTQNSTQPQSELERAPVNVNNDDQQYAPHVISTPLAFLIHDALNTNVFGEPGWMATGW
FT                   RSARDLKRRDIGGKTGTTNSSKDAWFSGYGPDMVATVWIGFDEHSRSLGRTPALKGEGG
FT                   AKSAQPIWNDFMKVALEGVPVKVMEPPAGIVSVTIDRATGKLSNGGGNTRKEYFIEGTQ
FT                   PTEYAVPEAGTTVTENGESQELF"
FT   regulatory      72501..72550
FT                   /regulatory_class="terminator"
FT   CDS_pept        72817..73866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0066"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0066"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79217"
FT                   /db_xref="GOA:D3UWQ9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWQ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79217.1"
FT                   /translation="MIAPMKINLTDAQKDALELMHDTTRDGRVRDRIKAVLLASEGWTA
FT                   QMIAQALRIHESTVSRHLKDYFSEEKLAPENGGSESRLSAEQTTELVEYLMANLMHTTA
FT                   QIVAYVRARWQVTFTVAGMTKWLHRQGFSYKKPMGAPHKFDADKQQQFIETYNALKEEC
FT                   GQNAPILFIDAVHPTLSTKLSYGWMKSGRKHVKVVETTGSRTRLNIMGALNLQRIEETI
FT                   VREYPTINAKNVVLFFGSIRETYPLSQKIHIILDGAGYHRSGVVQFFAEVLNIELHYLP
FT                   PYSPNLNPIERLWKYVNEQVRNNVYFPDTKTFRETLRHFFHVTLPEKAKELTTRLTDNF
FT                   QILKPASSS"
FT   CDS_pept        complement(74275..74718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0067"
FT                   /product="Nudix hydrolase, active on
FT                   adenosine(5')triphospho(5')adenosine,
FT                   adenosine(5')diphospho(5')adenosine, ADP-ribose and NADH
FT                   (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0067"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79218"
FT                   /db_xref="GOA:D3UY40"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY40"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79218.1"
FT                   /translation="MKPSNREAVLIIPVIGDELLLIREYAVGIEQYELGFPKGAIDAGE
FT                   STLEAANRELKEEVGFGAAKLELLTKLTMAPSYFSSRMNIVIAQDLYPECLEGDEPEPL
FT                   VQVRWPIADMMSLLEHPDFNEARNVSALFFAQRYLQASSNGTR"
FT   regulatory      complement(74806..74865)
FT                   /regulatory_class="promoter"
FT   regulatory      75016..75075
FT                   /regulatory_class="promoter"
FT   operon          75246..78690
FT                   /operon="XBJ1_operon0014"
FT   CDS_pept        75246..77303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0014"
FT                   /gene="yrfF"
FT                   /locus_tag="XBJ1_0068"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0068"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79219"
FT                   /db_xref="GOA:D3UY41"
FT                   /db_xref="InterPro:IPR010771"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY41"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79219.1"
FT                   /translation="MVSFLTFRWKRPDNARYLPSIAKTGHRKLNADEYQAIDSYLQNAL
FT                   SLMQPDRSHRSGQPALSVKNDTVYTINHTINRFSVATDESQYWRYYVDEMEIHLPALLE
FT                   SFIKQQNTIEIVQTTFMPLVIAVNGHFLKDYQQDLSIARIVKQTAQASIQKNGNSIANF
FT                   LYIRKETPEENRLRRSTGILEGILMCIGLSLWFLALFMPTPILPWLMLAAVLFLITSFW
FT                   LTFRSPSPRNILNISCFNGIPKRWGIFSESEPEQRRNISLGGIDLIYPSHWEPYVVREL
FT                   DQNTDVDIYTNCHVVQQGRYLSLHEEEKHYPYQRYRKNLILVVFSICAMLVLYFYQPVS
FT                   LSMRLSFAWLYGSNTQVITSVTELQNMPLKEGDVLRVKGIGMCYIPPRLNDNPGGIKHI
FT                   FTAFDCTGIYWNNDSPLPIPESDIIENASTLITTVNEQLHPIERSRKTNSDLNEAIAKS
FT                   GMTLLDNFSQVILKTHNLCMDEIDCIRLKSALVNLSNAEDWNDLLKQAERGKLNGTKVL
FT                   LRSVSADALEKLIDTTTASFIYREIDKISILLNSPSPGGVLLISEEGNKLVELPYLPFL
FT                   TYEYSALDQWRELQRLAEILLSAPFEAVGIVTKLSEDANETRRITLHSEPDSVTLIRYL
FT                   GSCFFLAILMAILSINAILIISKRQKNKVRLQRIGEYYDNCFNSKQPPMD"
FT   CDS_pept        77378..77791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0014"
FT                   /gene="hslR"
FT                   /locus_tag="XBJ1_0069"
FT                   /product="heat shock protein 15, DNA/RNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0069"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79220"
FT                   /db_xref="GOA:D3UY42"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY42"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79220.1"
FT                   /translation="MPNSDTDQTMRLDKWLWAARFYKTRSIAREMIDGGKVHYNGQRSK
FT                   PSKLVELNAEIKLRQGNEEKIVTVLALNSHRRSATEAQQLYQETEKSIINREKTALARK
FT                   MNVLTMPHPDRRPDKKERRTLIKFKNTKLNEPE"
FT   CDS_pept        77818..78690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0014"
FT                   /gene="hslO"
FT                   /locus_tag="XBJ1_0070"
FT                   /product="heat shock protein 33, redox regulated chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0070"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79221"
FT                   /db_xref="GOA:D3UY43"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY43"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79221.1"
FT                   /translation="MTKHDQLHRFLFESHSVRGELVSVSETYQRMMENHHYPLPVQQLL
FT                   GELLVATSLLTATLKFNGDITVQIQGDGPVRLAVINGNNQQQMRGTARIDGDVDAASSL
FT                   RDMVGNGYMVITVTPTEGERYQGVVALEGETLAECLDAYFKQSEQLPTRLFIRTGILDG
FT                   KMAAGGMLLQILPGAQEGSEDLLDHLVQLTATIKGEELFTLDVKEILHRLYHEEDVTLY
FT                   EPQQVEFRCTCSHQRCADTLVTLPDADLQEILLKDGKIDMECEFCGMHYIFNDKDISEI
FT                   KIVKKELLH"
FT   regulatory      78711..78739
FT                   /regulatory_class="terminator"
FT   regulatory      78787..78846
FT                   /regulatory_class="promoter"
FT   CDS_pept        78888..80507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pck"
FT                   /locus_tag="XBJ1_0071"
FT                   /product="phosphoenolpyruvate carboxykinase"
FT                   /EC_number="4.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0071"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79222"
FT                   /db_xref="GOA:D3UY44"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY44"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79222.1"
FT                   /translation="MSVKGITAQELAVYGICDVSEIVYNPSYELLFSEETQPSLQGYER
FT                   GTLTHLGAVAVDTGIFTGRSPKDKYIVRDDVTCDTVWWADQGKGKNDNKPLSQETWSQL
FT                   KGLVTQQLSGKRLFVVDAFCGANADTRLKVRFITEVAWQAHFVKNMFIRPSDEELVNFT
FT                   PDFIVMNGAKCTNPQWKEQELNSENFVAFNLTERMQLIGGTWYGGEMKKGMFSIMNYLL
FT                   PLKGIASMHCSANVGGEGDVAIFFGLSGTGKTTLSTDPKRKLIGDDEHGWDDDGVFNFE
FT                   GGCYAKTINLSKEAEPDIYHAICRDALLENVTVLADGTVDFNDGSKTENTRVSYPIYHI
FT                   ENIVKPVSKAGHATKVIFLTADAFGVLPPVSCLTPEQTQYHFLSGFTAKLAGTERGVTE
FT                   PTPTFSACFGAAFLSLHPTQYAEVLVKRMQASGAKAYLVNTGWNGTGKRISIKDTRAII
FT                   DAILNGDIEDADTIELPIFDLAVPTALPGVDTGILDPRNTYADKSEWDVKAKDLAQRFV
FT                   DNFDKYTDTAAGAALVKAGPNL"
FT   regulatory      complement(80533..80564)
FT                   /regulatory_class="terminator"
FT   regulatory      80543..80578
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(80595..81290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0072"
FT                   /product="Protein yhhW"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0072"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79223"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY45"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79223.1"
FT                   /translation="MIYLRKASERGHANHGWLDSWHTFSFADYYDANFMGFSALRVINE
FT                   DVIDAGQGFGMHPHKNMEILTYVLSGTVEHRDSMGNQGQISAGEFQIMSAGTGIRHSEY
FT                   NPHDSSKLHLYQIWIMPEKNDLPPRYEQRCFDSAKGRQLILSPDTRDDSLKVFQNMILW
FT                   RWALKNGETDEYDIEKSRKIWIQVVRGEVTINGVQATTSDGIAIWDESHLQLIASQESE
FT                   ILLFDLPPN"
FT   CDS_pept        complement(81303..81470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0073"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79224"
FT                   /db_xref="GOA:D3UY46"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY46"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79224.1"
FT                   /translation="MLTLLPVFIFIANLNVGFFLYLTQLSYSYYSKILNFKIKFTIFYI
FT                   SSLQLDYKKH"
FT   regulatory      complement(81399..81458)
FT                   /locus_tag="XBJ1_0073"
FT                   /regulatory_class="promoter"
FT   regulatory      81866..81925
FT                   /regulatory_class="promoter"
FT   operon          81989..83538
FT                   /operon="XBJ1_operon0015"
FT   CDS_pept        81989..82468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0015"
FT                   /locus_tag="XBJ1_0074"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0074"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79225"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY47"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79225.1"
FT                   /translation="MSYMIYLTLNGKKQGLISAGCSTLDSIGNRYQKGHEDQIQVLSLN
FT                   HAISRQQNVSHQPIQFIKPIDKSSPLLAMAIDSNESLNGGFIFYRTSQTGQLELFYEVK
FT                   ITEATITDISCVYPHSINDHDMMPYEKVTLNYKSISWNHITAGTSAYIPVVIEDA"
FT   CDS_pept        82489..83538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0015"
FT                   /locus_tag="XBJ1_0075"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0075"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79226"
FT                   /db_xref="GOA:D3UWQ9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWQ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79226.1"
FT                   /translation="MIAPMKINLTDAQKDALELMHDTTRDGRVRDRIKAVLLASEGWTA
FT                   QMIAQALRIHESTVSRHLKDYFSEEKLAPENGGSESRLSAEQTTELVEYLMANLMHTTA
FT                   QIVAYVRARWQVTFTVAGMTKWLHRQGFSYKKPMGAPHKFDADKQQQFIETYNALKEEC
FT                   GQNAPILFIDAVHPTLSTKLSYGWMKSGRKHVKVVETTGSRTRLNIMGALNLQRIEETI
FT                   VREYPTINAKNVVLFFGSIRETYPLSQKIHIILDGAGYHRSGVVQFFAEVLNIELHYLP
FT                   PYSPNLNPIERLWKYVNEQVRNNVYFPDTKTFRETLRHFFHVTLPEKAKELTTRLTDNF
FT                   QILKPASSS"
FT   regulatory      83582..83619
FT                   /regulatory_class="terminator"
FT   CDS_pept        83901..84023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0076"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79227"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY49"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79227.1"
FT                   /translation="MSFMLMNDMKSLQEKYKNNVVINKKIIDITTQKILFGRVM"
FT   CDS_pept        complement(84050..84223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0077"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79228"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY50"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79228.1"
FT                   /translation="MIVFGLVVAGVLYYLDDKYQVSEKLIEALRNEEAKKRFREHLANP
FT                   KYNMPRPPIFYR"
FT   CDS_pept        complement(84237..84410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0078"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0078"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79229"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY51"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79229.1"
FT                   /translation="MQKISNLLINSPVKSEDKLAVMMMFCFQLLSSTQTDGVNMRVSDG
FT                   RVLSLELETLKL"
FT   regulatory      complement(84456..84515)
FT                   /regulatory_class="promoter"
FT   regulatory      85123..85182
FT                   /regulatory_class="promoter"
FT   operon          85221..92403
FT                   /operon="XBJ1_operon0016"
FT   CDS_pept        85221..86651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0016"
FT                   /gene="ydcW"
FT                   /locus_tag="XBJ1_0079"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0079"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79230"
FT                   /db_xref="GOA:D3UY52"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR015657"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY52"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79230.1"
FT                   /translation="MPVPTFKHFINGQYIESQGSEYFDLVSPVTGKAYARSPNATVADV
FT                   DDAYASAKEAFKIWGRSTPSARQQALLALADTVEKNAERLIESQSRNTGQLKHLIASEE
FT                   IATSVDHIRFFAGAARFLEGKATAEYLSGMTSSIRREPLGVVGQVTPWNYPLMMAVWKI
FT                   APALAAGNTVVLKPSDTTPESTLLLAELSAPFFPAGTFNVVLGNASAGSLVVSHKTPAM
FT                   VSITGSVRAGLQVASSAAANLTRAHLELGGKAPVVIFADADIDKAVGTIVTAGYFNAGQ
FT                   DCTAASRVLVHESVYDIFVTKLVAAAKATRFGDPEDKEALYGPLNNVRQLEQVTGFLAR
FT                   LPAHARIETGGRQADRSGYYFEPTVITGLEQEDEMIQTEIFGPVITVQKFLTEQDAIEK
FT                   ANDVKYGLASSVWTRDHGRALRLSRELDFGTVWINTHIPLTAEAPHGGFKNSGYGKDLS
FT                   AYGFDEYTRIKHVMSSND"
FT   CDS_pept        86667..87440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0016"
FT                   /locus_tag="XBJ1_0080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0080"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79231"
FT                   /db_xref="GOA:D3UY53"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY53"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79231.1"
FT                   /translation="MVQNRSSRDLVSRAHHELFTDRDVRALERYFAPNFIEHSPLVKEG
FT                   FAGLRERVQAHPELHHEMYRVLQDGDLVAIHGRFTGLDEQPLVGFDLYRVADGLIVEHW
FT                   DGLVPQSAPNTSGRTQLDGPTETGYSHDREKNRELVVNFFTRTLIEEHYDEFGNYTNGE
FT                   EFRQHSPDIPDGTVAVIEFLKQLKDEGQGLHYAKIHHTVADGQFVLSHSEGSIAGVRHS
FT                   YFELWRIENGKVAELWDAITPVPEDAQALHRHGMF"
FT   CDS_pept        87494..88249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0016"
FT                   /locus_tag="XBJ1_0081"
FT                   /product="putative GntR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0081"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79232"
FT                   /db_xref="GOA:D3UY54"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY54"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79232.1"
FT                   /translation="MTDYSIIYAPLDQATRTEQVVERLSNAIISGILQTDAQLPNENEL
FT                   SRLLGVSPVTVRDALNTLRARQLIDTRRGRHGGSFVCQVPVEAMRKYHPLRLMASGELA
FT                   DFSEFHCAVIGHSARLAAQRSTQGELRKLEQLIDSFAAATQPDARIQTDMRCLLTLASQ
FT                   SQSARLANQELEIQAEWTPLMGLLYQEAAVHSEVVAAWRTLLAALYQGDDLACYQLAQK
FT                   MITQITDHLLECKLRVDTDAPFLQRSDRE"
FT   CDS_pept        88286..89035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0016"
FT                   /locus_tag="XBJ1_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0082"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79233"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY55"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79233.1"
FT                   /translation="MYNDIHVERARSILNDILVTAQQATAALADKTARILLELPLCHTV
FT                   GVRLAREQRGALQKHIHDVLRNNVWCNGAGFASYAVPKTVGKEGYWTLEWWRQEGDTIQ
FT                   YAPLEHNQEQRRRLDFRLFEWFRQPANCHLPVIDGPYVDYVCNGAYTITIAHPVLIGEE
FT                   FAGVAAVDMLVSTLDRLLLPALGAIGKPALIINDDARVVTSTVPGVRSGSLLKSQGVNR
FT                   SVDGEVPSLRLVILPSSHTESHRAFVC"
FT   CDS_pept        89072..90355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0016"
FT                   /gene="goaG"
FT                   /locus_tag="XBJ1_0083"
FT                   /product="4-aminobutyrate aminotransferase, PLP-dependent"
FT                   /EC_number="2.6.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0083"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79234"
FT                   /db_xref="GOA:D3UY56"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY56"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79234.1"
FT                   /translation="MTESMLAKRRSAAIAKGVGVTTQVYVERAENAEIWDAQGQRYIDF
FT                   AAGIAVVNTGHRHPRVIAAAREQLEQFIHTCHQVVPYENYVALAERLNRLVPGNFVKKT
FT                   VFVTTGAEAVENAVKIARAATGRSGVVAFSGAFHGRTFLGMSLTGKVVPYKMGFGSLVS
FT                   DVYRVPFPVALHGISVEQTLNALDNLFKTDIEPTRVAAIIIEPVQGEGGFYPAPPELLK
FT                   SLREIADRYGIVLIADEIQTGFARTGKLFAMEHHEVAADLTTMAKGLAGGFPLAAVTGR
FT                   AELMDAVAPGGLGGTYGGNPVAIAAGHAVLDVIEEEKLAARATQLGERLKQCLNELRPR
FT                   VPQIADVRGLGLMIAVEFNRADSQEPDAGFTNAVRQKALERGLILLACGIHGNVIRFLP
FT                   PLTIQNDVFDEALNVLESVLLDLNRTAV"
FT   CDS_pept        90438..90836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0016"
FT                   /gene="yhaI"
FT                   /locus_tag="XBJ1_0084"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0084"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79235"
FT                   /db_xref="GOA:D3UY57"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY57"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79235.1"
FT                   /translation="MHWYLNVLNNYACFRGRAQRKTFWYFVLFQILAVLIISFLERLFA
FT                   VANPEIYMGWFSAIYLLLTFLPALAVNARRLHDINCSAWWLLLHLIPFVGTVILLILAA
FT                   LKGQAGSNKYSSESRVHSQGNTQSQANG"
FT   CDS_pept        90862..92403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0016"
FT                   /locus_tag="XBJ1_0085"
FT                   /product="FAD dependent oxidoreductase"
FT                   /EC_number="1.5.3.1"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0085"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79236"
FT                   /db_xref="GOA:D3UY58"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY58"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79236.1"
FT                   /translation="MAMNRRDFISTTAALAGAGVLSSLLPTTSLLARTLTAADASAVNI
FT                   DQLRPTLLKDAQYRTSRLGLDPRIWNWHRDVAATAMPANYYEASLADWPAFGSFPIDQN
FT                   CEVVVIGGGLLGASTALHLAEAGVDVILVEKDNIGSGASGRNGGQMTPGIARWEAETML
FT                   EKLSPDEAKRLWRFASVEAMNLVDELRERYGFECDRKYGHITAAIHPGHMGPLVANADA
FT                   RRQLGDTAVKVIGPHELQERYVRSGIYHGANIDSIGGQVQPLALLRGLIYSFAKLGGRV
FT                   YDGTKVKGIRQDASSAVIETERGVIRASKAVVLGVHGSTEEFISGPSTTVPFFTYVAVT
FT                   PPLPVDIKELIPSDLPVYDTQLQIDYYRAVRDNRLLFGGQGTGNSWSSRDVNNYLLERI
FT                   RTVFPQLEKPELEYSWGGISDLTLNGATDARKSGDSVPVYMVHGWSGHGVAQTVRIGKA
FT                   ISDDLTERNHDFTMLTRIEHSSIPLGSYFSPVAIPLIKGALGVINTVNPADMVSF"
FT   CDS_pept        complement(92443..92625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0086"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79237"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY59"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79237.1"
FT                   /translation="MYLGVASENGKNRTIKASPDGQHQFVIFLLAQRSRFRLVKLTFIV
FT                   SAQSHRNFQFTNNLF"
FT   regulatory      complement(92699..92732)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(92787..93632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0087"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0087"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79238"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY60"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79238.1"
FT                   /translation="MNRILNVCVALCLTMIPVEAVKADITAPIVYLEHVTPSVSLNING
FT                   KEVNRLSIDTGASGAFYLPRTVFDSIFSELNHRTTTVQNSIDVFGVEKSAVTARASHIT
FT                   VNGERLSDVNVEIFKTWGNGGMLDDNGQLIINGVLGLGVAKNKTLIINYASKMLTIADH
FT                   LKALPDGYRWQSIPFTRTRNGIEISVSSGNEKIRRMVIDTGASHTMLFTRSKEGCAKLS
FT                   QHCPKKAIVTPDGVKLSAFLFQIPDERIDFDGLLGDDFLSNRVLIISNDRLLISLPNNS
FT                   "
FT   regulatory      complement(93686..93745)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(93999..94047)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(94089..95282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhiN"
FT                   /locus_tag="XBJ1_0088"
FT                   /product="putative oxidoreductase with FAD/NAD(P)-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0088"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79239"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY61"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79239.1"
FT                   /translation="MEKFDVVIIGAGAAGLFCAAQAGQEGLNVLVLDNGKKAGRKILMS
FT                   GGGRCNFTNMYTEPAAYLSANPHFCKSALARYTQWDFIDLVQQHGIAYHEKALGQLFCD
FT                   DSAQQIIDLLLKECEAGQVTVRLRSEVTQIEKDEQGFVITTAGKKVSAHSLVVASGGLS
FT                   MPGLGASPLGYRIAEQFGLNILPTHAALVPFTLHKPLLEQLQTLSGVAVPSIVTAKDGT
FT                   VFRENILFTHRGLSGPAILQISSYWQPGEYVSINLLPDMDLDAFLDKERESHPNQNLKN
FT                   TLAKLLPKRLVECLQSLEQLPDVSLKQINPAQQKELIATLQYWQVQPNGTEGYRTAEVT
FT                   MGGIDTNELSSKTMESHKVKGLYFIGEVVDVTGWLGGYNFQWAWSSAWACAQALVVV"
FT   regulatory      complement(95377..95436)
FT                   /regulatory_class="promoter"
FT   regulatory      95400..95459
FT                   /regulatory_class="promoter"
FT   CDS_pept        95583..97073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pitA"
FT                   /locus_tag="XBJ1_0089"
FT                   /product="low-affinity phosphate transport protein (PiT
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0089"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79240"
FT                   /db_xref="GOA:D3UY62"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY62"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79240.1"
FT                   /translation="MLHLFTGLDFYTSLMLVLALLFVLFYEAINGFHDTANAVATVIYT
FT                   RAMRSQFAVVMAGVFNFLGVLLGGLSVAYAIVHLLPTDLLLNVSSTHGLAMVFSMLLAA
FT                   IIWNLGTWYFGIPASSSHTLIGSIIGIGLTNAIVADSSVVDALNISKMIQIFMSLILSP
FT                   LVGLVIAGAMVFLLRRYWSGTKKRRRIHMTPAEREKQDGKRKPPFWTRTALILSAVGVS
FT                   FSHGANDGQKGIGLIMLVLIGVAPAGFVVNMNSTSYDITRTHDAVASLQKYYVQHGPAL
FT                   SHAIEQTPAVSSVEDSADQMLHCDSSQAQDVLNTAAVMLGSIQNFSELTPDQRNNMRRM
FT                   LMCAADTASAVAKLPETSLEDARFLNKLRKDLLNTVEYAPMWIIIAVALALSLGTMVGW
FT                   KRVAVTIGEKIGKKGMTYAQGVSAQVTAAVSIGVASYTGMPVSTTQVLSSAVAGTMLVD
FT                   GGGVQSKTIKNIMLAWVLTLPISIGLSGILYWIALQLI"
FT   regulatory      97184..97243
FT                   /regulatory_class="promoter"
FT   CDS_pept        97349..97780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uspA"
FT                   /locus_tag="XBJ1_0090"
FT                   /product="universal stress protein A, possibly linked to
FT                   resistance to DNA-damage and respiratory uncoupling"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0090"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79241"
FT                   /db_xref="GOA:D3UY63"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY63"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79241.1"
FT                   /translation="MAYKHILVAVDLSPESQVLVEKAVSMAKPYNAKVSLIHVDVNYSD
FT                   LYTGLIDVNLGDMQQRIADETRNALKDLSVNADYEIQETLSGCGDLGQVLVDAIKQYDM
FT                   DLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEE"
FT   regulatory      97888..97947
FT                   /regulatory_class="promoter"
FT   CDS_pept        98038..99381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdhA"
FT                   /locus_tag="XBJ1_0091"
FT                   /product="glutamate dehydrogenase, NADP-specific"
FT                   /EC_number="1.4.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0091"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79242"
FT                   /db_xref="GOA:D3UY64"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY64"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79242.1"
FT                   /translation="MNISPSLVSFLDSIQSHNPHQPEYLQAVREVLTSLWPFLQQNPQY
FT                   REQSLLERLIEPERVIQFRVCWVNDQGKVQVNRAWRVQFNSAIGPFKGGMRFHPSVNLS
FT                   ILKFLGFEQTLKNALTTLPMGGAKGGSDFDPKGKSHGEVMRFCQALMTELYRHLGPDTD
FT                   VPAGDIGVGGREVAFMAGMMKKLSNNTACVFTGKELSFGGSLIRPEATGYGLVYFTHEM
FT                   LKRHGMGLEGMRVSVSGAGNVAQYTIEKCIELGAKVVTVSDSGGTVLDEEGFTPEKLAH
FT                   LEEIKNQRYGRVEEYAKEHGLTFLKGQDPWSIPVDIALPCATQNELDLDAAKTLIKNGV
FT                   KVVAEGANMPATISATDAFLEAGVLFAPGKAANAGGVATSGLEMAQNAARLSWKAEKVD
FT                   VRLHHIMLDIHHACVEYGGEGKQTNYVQGANIAGFVKVADAMLSQGIL"
FT   regulatory      99415..99458
FT                   /regulatory_class="terminator"
FT   operon          complement(99469..102261)
FT                   /operon="XBJ1_operon0017"
FT   CDS_pept        complement(99469..100212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0017"
FT                   /gene="yhiQ"
FT                   /locus_tag="XBJ1_0092"
FT                   /product="putative methyltransferase with SAM-dependent
FT                   methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0092"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79243"
FT                   /db_xref="GOA:D3UY65"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY65"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79243.1"
FT                   /translation="MKICLICEQGADSSALSQLAERWNLVHDEDSVMALVLTPERLELR
FT                   KLDEPKLGGIYVDFVAGTMAHRRRFGGGRGEAVAKAVGIKKGYLPTVVDATAGLGRDAF
FT                   VLASIGCQVRMLERHPVVAALLDDGLQRGYQNEEIGSWLKERMTLIHTSSITALTDITP
FT                   PPDVVYLDPMYPHRQKSALVKKEMRVFQSLVGADEDADGLLEPARALAKRRVVVKRPDY
FT                   AEPLAGAKASAAITTKNHRFDIYPC"
FT   CDS_pept        complement(100219..102261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0017"
FT                   /gene="prlC"
FT                   /locus_tag="XBJ1_0093"
FT                   /product="oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0093"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79244"
FT                   /db_xref="GOA:D3UY66"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY66"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79244.1"
FT                   /translation="MTNPLLTPSVLPKFAAIEPKHVVPAVKETLANYRQVIEKVLAGNV
FT                   TFTWDNLCQPISEAKDHLSRVWSPVEHLNAVKNSPELREAYEQSLPLISEFETWMGQHE
FT                   GLYQAYKALKESEAFKALSQPQRKAIENTLRDFELSGIGLPKEKQKRYGEISARLSELG
FT                   SQFGNNLLDATMGWTKLITDECDLEGMPDSAKAAAKAAAEAKGLEGWLLTLNGPSYLPV
FT                   MTYADDSELRQEMYYAYTTRASEQGPNAGQWDNSAVMTEILALRHELALLLGFKNYAEN
FT                   SLATKMAKTPKQVLDFLNDLANRAHAQGKRELEELTDFAESHYWVDELEAWDLAYYSEK
FT                   QKQHDFSISDEQLRPYFPEQRVIEGLFEVIRRIYAITAKERRDVETWHPDVRFFELYDE
FT                   KQTLLGSFYLDLYAREHKRGGAWMNSYVGRMRHTSGELQTPVAYLTCNFNKPVGDQPAL
FT                   FTHNEVTTLFHEFGHGLHHMLTQVETLDVAGINGVPWDAVEMPSQFMENWCWEPEALAF
FT                   ISGHYETKEPLPKEMLDNMLAAKNYQAAMAILRQLEFGLFDFRLHVEYDPAKGAQILPT
FT                   LQSVKKQVAVVPSPEWGRFPNTFSHIFNGGYAAGYYSYMWADVLAADAYSRFAEEGIFN
FT                   RTTGQSFLDNILTRGGSEDPMTLFVRFRGREPKLDAMLKSSGISG"
FT   regulatory      complement(102386..102445)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(102575..102630)
FT                   /regulatory_class="terminator"
FT   operon          complement(102838..103509)
FT                   /operon="XBJ1_operon0018"
FT   CDS_pept        complement(102838..103164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0018"
FT                   /locus_tag="XBJ1_0094"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0094"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79245"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY67"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79245.1"
FT                   /translation="MRYTLFMLLILSPLSLAASFDCAKAKVPDEKAICTDHRLNDLDIE
FT                   MSVKYHFLRGLFAMGMSGEMYDSQQAWLKQRQKCKGDKTCLLQRYHQRINQLDAIYNSI
FT                   QKPI"
FT   CDS_pept        complement(103165..103509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0018"
FT                   /locus_tag="XBJ1_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0095"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79246"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY68"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79246.1"
FT                   /translation="MTDKSAVKEVESWSDTKKVAEFICRPLALSVIQQEHKEADKVFLG
FT                   DESPNSIRLVDSHLIGTGMYRQGFGWKNIRFSCELDPKTGEARSFKLLKALPPQLQTGP
FT                   EPVILPKKGE"
FT   regulatory      complement(103591..103650)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(103653..104702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0096"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0096"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79247"
FT                   /db_xref="GOA:D3UWQ9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWQ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79247.1"
FT                   /translation="MIAPMKINLTDAQKDALELMHDTTRDGRVRDRIKAVLLASEGWTA
FT                   QMIAQALRIHESTVSRHLKDYFSEEKLAPENGGSESRLSAEQTTELVEYLMANLMHTTA
FT                   QIVAYVRARWQVTFTVAGMTKWLHRQGFSYKKPMGAPHKFDADKQQQFIETYNALKEEC
FT                   GQNAPILFIDAVHPTLSTKLSYGWMKSGRKHVKVVETTGSRTRLNIMGALNLQRIEETI
FT                   VREYPTINAKNVVLFFGSIRETYPLSQKIHIILDGAGYHRSGVVQFFAEVLNIELHYLP
FT                   PYSPNLNPIERLWKYVNEQVRNNVYFPDTKTFRETLRHFFHVTLPEKAKELTTRLTDNF
FT                   QILKPASSS"
FT   regulatory      complement(104774..104833)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(104894..104928)
FT                   /regulatory_class="terminator"
FT   operon          complement(104965..108081)
FT                   /operon="XBJ1_operon0019"
FT   CDS_pept        complement(104965..106629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0019"
FT                   /gene="treC"
FT                   /locus_tag="XBJ1_0097"
FT                   /product="trehalose-6-P hydrolase, alternative inducer of
FT                   maltose system, cytoplasmic"
FT                   /EC_number="3.2.1.93"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0097"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79248"
FT                   /db_xref="GOA:D3UY70"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012769"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY70"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79248.1"
FT                   /translation="MTEQQPWWLDSVIYQIYPKSFQDSTGSGTGDINGITQRLDYLQHL
FT                   GVEAIWITPFYPSPQVDNGYDVADYCAINPDYGSMEDFDNLVENAHRRGIRIILDMVFN
FT                   HTSTEHPWFQAAQDINSPSRQFYIWREGSSDSLPNNWKSKFGGNAWQWHAESQQYYLHL
FT                   FAIKQADLNWEHEPVRAELKKICEFWADRGVDGLRLDVVNLVSKQQDYPSDDHGDGRRF
FT                   YTDGPRIHEFLQEMSRDVFQPKGLMTVGEMSSTGLEHCLRYSALDSSALSMTFNFHHLK
FT                   VDYPNGEKWTLAKPDYIALKKIFSTWQQGMHQKAWNALFWCNHDQPRIVSRFGDEHQHH
FT                   RTSAKMLAMVLHGMQGTPYIYQGEELGMTNPHFERIEEYRDIESLNMYQERIEQGMAPE
FT                   EILAILAQKSRDNSRTPMQWDGSANAGFTSGTPWIASCDNYPELNAEAALQDKDSVFYC
FT                   YHELIKLRKQQPILTYGDYLDLLPDHPSLWCYLRRWQNQVMLVIANLSDENQLWSPEPS
FT                   LTDKEWQVLISNYPSPSSIEKEMSIKPYESIYLIAEK"
FT   CDS_pept        complement(106648..108081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0019"
FT                   /gene="treB"
FT                   /locus_tag="XBJ1_0098"
FT                   /product="PTS family enzyme IIBC,
FT                   trehalose(maltose)-specific"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0098"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79249"
FT                   /db_xref="GOA:D3UY71"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011296"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY71"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79249.1"
FT                   /translation="MKKNQVNQKDLEKLITLIGGKENIASVSHCITRLRFVLYSPENAN
FT                   AKAIEELSMVKGCFTNAGQFQVVIGTNVDIYYKALLENTGKQSVNKEEVKQAARQNMKW
FT                   HENAISHFAEIFFPLLPALISGGLILGFRNIIGDIPFSEGKTLAQLYPIWQTIYSFLWL
FT                   IGEAIFLYLPVGICWSAVKKMGGTPILGIVLGITLVSPQLMNAYLLGQQAPEVWDFGWF
FT                   TISKVGYQAQVIPSLLAGLTLGWIETRLKKWVPDYLYLVIVPVVSLLLAVFLAHTLIGP
FT                   MGRAIGDGVAWVVKSLMTGSFAPIGAALFGFFYAPLVITGVHQTTLAIDLQMIQSTGGT
FT                   PIWPIIALSNIAQGSAVAGIIWASKKQKEREVSIPAAISAYLGVTEPAMYGINLKYRYP
FT                   MFCAMIGAGLAGLVCGLNHVIANGIGVGGLPGILSIKPQFWMVYLIAMIIAIVVPMLLT
FT                   VLAYRRNERKTTLINELTN"
FT   regulatory      complement(108243..108302)
FT                   /regulatory_class="promoter"
FT   CDS_pept        108700..108855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0099"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79250"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY72"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79250.1"
FT                   /translation="MILLNMTEGLEDNINLFHINICQIGMNYINKLIYIRIIIIKHNIL
FT                   ITTKTP"
FT   regulatory      complement(109055..109098)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(109150..109605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0100"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79251"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY73"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79251.1"
FT                   /translation="MSIWVDADACPKVIKEVLYRAAEREKIQVTFVANQRLSVPASAFL
FT                   RTLQVPAGFDVADNEIVRRSEIGDLVITADIPLAAEVIEKGAIALNPRGERYSEATIRE
FT                   RLTMRDFMDTMRASGIHTGGPATLNQRDRQQFANELDKWLLQQKKVS"
FT   regulatory      complement(109731..109790)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(109793..109945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0101"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79252"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY74"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79252.1"
FT                   /translation="MLISRLQQQIKGDLSLSYRRKEHQNFFERENSYSENMELIFEEFE
FT                   LIETE"
FT   CDS_pept        complement(110167..110703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0102"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0102"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79253"
FT                   /db_xref="GOA:D3UY75"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY75"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79253.1"
FT                   /translation="MSKLIYYVAATMDGYIATEDHGLGWLEAFTLGDDATPYDEFYQGI
FT                   GAAIMGAGTYEWIMKNTSGDWPYQDIPSFILSSRNISIPPGISAVVTHTSTNDIAAEAR
FT                   AAAKGKNVWMIGGGKTAASFADAGELQQLFITTIPIFLGSGIRVLPVNKPIHVTSDKRR
FT                   FLRSGAIETIMDIKW"
FT   regulatory      111025..111084
FT                   /regulatory_class="promoter"
FT   operon          111135..112518
FT                   /operon="XBJ1_operon0020"
FT   CDS_pept        111135..111977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0020"
FT                   /locus_tag="XBJ1_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0103"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79254"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY76"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79254.1"
FT                   /translation="MSRFIISRNNKSLLNETVFYLTKGNMLTLKIDGLNSNTKRHLKFQ
FT                   SNNTLVSIFQRDNYLFREQSLQITALNMGVSVVRAVDTDIDYCPYFAAGVAEDCFPPLT
FT                   IHVLSKISIPTDLTAEQKAILMVLLAETTTPETPGIKYDEKKAKDVMQYMHDVLLNRVR
FT                   SPKAHELDVPSQGNKLIGLISGARTIEGFSQYPNIKSDIKDRINGMIIAANEGSNSNFL
FT                   AYRRLIKNAIDIAKSNKISNTEIIAWRTKSTDSPGSNFIKLFSLQGQDFYKLSDSYLK"
FT   CDS_pept        complement(111219..111335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0104"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79255"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY77"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79255.1"
FT                   /translation="MQALLSKQIIITLKNGHKRIIRLKFKMSFCITIQTIYL"
FT   CDS_pept        111988..112518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0020"
FT                   /locus_tag="XBJ1_0105"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0105"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79256"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY78"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79256.1"
FT                   /translation="MKYLIGLCVIFFSLTVFSKQDELDFKAWEKKGSWGIYSEKPNSHF
FT                   KPLKIKSYKEGYLPAFSYLIKRFNLQNVNNQYCLIGYKWNKTKNSDERENIIVFWKTAN
FT                   YLINWNLPDSEDDDSYKAIIFSKPFIDMSESVVPYKESEGAQALWAKEGVIQMMNDCEL
FT                   NGQKITITPSGVR"
FT   regulatory      complement(112479..112525)
FT                   /regulatory_class="terminator"
FT   regulatory      112522..112565
FT                   /regulatory_class="terminator"
FT   operon          complement(112701..113896)
FT                   /operon="XBJ1_operon0021"
FT   CDS_pept        complement(112701..113294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0021"
FT                   /locus_tag="XBJ1_0106"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0106"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79257"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY79"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79257.1"
FT                   /translation="MKVPYFSQWESFHLANDIIHHQLPLSHDPLWEQSGADSPEEYAKW
FT                   ANHICGMACLKMLLAARSGKIYPLLKLTKMATEYGAYQIEDEHIKGMIYAPVVSMLSEQ
FT                   FGIISQIVTGMTAEKIHEVFTQDSLYIASVHPSIRWPTRLPEKKGGHLVLVTNATPEEI
FT                   TFHNPSGANTQSQIDVKMSVDIFGRFYAERGILI"
FT   CDS_pept        complement(113291..113896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0021"
FT                   /locus_tag="XBJ1_0107"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0107"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79258"
FT                   /db_xref="GOA:D3UY80"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY80"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79258.1"
FT                   /translation="MLIAQQNLINKSLSSATYVFPISLGFIALIDILIFGSNLTFSSIL
FT                   SINILFVAGILFTMIGHIKSMHKRSKLMFFIMIFCVIGFAIMDRTGIPMSGWFTYLLFT
FT                   GVGNISVIFFYQKNKFSFVPLKFWLSISIIWFLPELFFNYAIATYLPVSYGYLAITLRI
FT                   PLLMLISVLVYREGKLSEQMLFSFVAVIAILLMFMERL"
FT   regulatory      complement(113990..114022)
FT                   /regulatory_class="terminator"
FT   regulatory      complement(114023..114082)
FT                   /regulatory_class="promoter"
FT   operon          complement(114142..115981)
FT                   /operon="XBJ1_operon0022"
FT   CDS_pept        complement(114142..114873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0022"
FT                   /locus_tag="XBJ1_0108"
FT                   /product="putative aspartate/glutamate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0108"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79259"
FT                   /db_xref="GOA:D3UY81"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY81"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79259.1"
FT                   /translation="MERIGLIGGVSWASTMEYYKRLNMAVQNTGKDFESADLAIISLNF
FT                   SKILAAQKRDDNETEFNILSKAVHQLAQAEVKKILICSNTTSNTCDRLSKLVNIPIINI
FT                   IDATANKLLSMKVSNVGLIGTQYVMERDFYKKRLEAKGINVLIPRSRTRQIIHDSIYQD
FT                   LCRYALTDTSRGIMYRAIDELAELGAEAVILGCTEIPLVVSDRVYQNSIKIIDSIDAHI
FT                   EAALSLTPENNNTSSMLRYLN"
FT   CDS_pept        complement(114884..115981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0022"
FT                   /locus_tag="XBJ1_0109"
FT                   /product="putative D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0109"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79260"
FT                   /db_xref="GOA:D3UY82"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY82"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79260.1"
FT                   /translation="MVYFPSDTKTTIPLSIIFGGISPEHPASVSSFDNLIKSFRELNFD
FT                   RNLNSIYFFDKDGSVLYNAYTPYISPYDFTHSGDKIDLYTAIKRMSKQSEFHINLLHGN
FT                   LGEDGHIQGVAKYFKIKGTFGSVLPSSLSMSKYHMSHYINSLLPSLRSPKTLLLTEGNL
FT                   EKAFSLISDNFPEEKIVIKPNSLGASLFTNKYVNLENEKKSILDNLKNIFEYDRFALVQ
FT                   AFIKGKEYSVGCIRIEGKAIALNVVEIITKNGFFGHDEKHRINKAEEILLIQDSEITRT
FT                   LKDLSIKIFESTGYEFMCRFDFIVTESEEIYFLESNPIPGMMKNSIFPKMLKGHKLSIP
FT                   GLFIHLSCSSQNISEKKSIFNYIIE"
FT   regulatory      complement(116089..116148)
FT                   /regulatory_class="promoter"
FT   regulatory      116095..116154
FT                   /regulatory_class="promoter"
FT   CDS_pept        116364..116513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0110"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79261"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY83"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79261.1"
FT                   /translation="MSKSVIHDKETEDAQALWTKEVVIQMINDCELNGKKITITPYFKG
FT                   VVAL"
FT   regulatory      complement(116470..116498)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(116534..117160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0111"
FT                   /product="Chloramphenicol acetyltransferase"
FT                   /EC_number="2.3.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0111"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79262"
FT                   /db_xref="GOA:D3UY84"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY84"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79262.1"
FT                   /translation="MENYFDSPFKGKTLAEQVTNPNIQIGRFSYYSGYYHGHSFDDCAR
FT                   YLHPDLVDVDKLIIGSFCSIGTGVAFMMAGNQGHRLDWVSSFPFFYMSEEPAFADAQNG
FT                   YQPMGDTVIGNDVWMGAEAIIMPGVNIGDGAVIGTRALVTKDVEPYTIIGGNPAKVIRK
FT                   RFSDEQIAMLLEMQWWNWPLEQLKAAMKMLTSADIEGLYRWWQNQ"
FT   regulatory      complement(117187..117246)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(117202..117357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0112"
FT                   /product="putative acyl transferase with trimeric LpxA-like
FT                   domain , iron-binding (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0112"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79263"
FT                   /db_xref="GOA:D3UY85"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY85"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79263.1"
FT                   /translation="MIWLYWSYNELLPSQDLVTRCKKTLREVEPLAEMEQGRKRLTFSQ
FT                   DFIPKN"
FT   regulatory      117375..117434
FT                   /regulatory_class="promoter"
FT   operon          117474..118257
FT                   /operon="XBJ1_operon0023"
FT   CDS_pept        117474..117767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0023"
FT                   /locus_tag="XBJ1_0113"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0113"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79264"
FT                   /db_xref="GOA:D3UY86"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014795"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY86"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79264.1"
FT                   /translation="MATLSNERITTRVNSETKELLEMALSLSGYASLNSFIANAAVAEA
FT                   KRLIEQNMRIKLCQEDAVAFVHALEEPTQINERFLRAARRHKDLLDEDRVSK"
FT   CDS_pept        117745..118257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0023"
FT                   /locus_tag="XBJ1_0114"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0114"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79265"
FT                   /db_xref="GOA:D3UY87"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY87"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79265.1"
FT                   /translation="MKIECLNKNKHDRNNFDCGEPALNNYLKAVSGQHDKKDLSRTFVL
FT                   TSSQNESQIKGYYSLALCTVELDEIPEKISKKYPSSLYCALIGRLAINKLFQRQGLGEI
FT                   LLIDAIRKSIESSESIPTPMIIVDAKHDIAKKFYINMGFQEFPKMKFRLFMPMNAAVNI
FT                   IEQIDAI"
FT   regulatory      complement(118247..118287)
FT                   /regulatory_class="terminator"
FT   regulatory      118265..118298
FT                   /regulatory_class="terminator"
FT   operon          complement(118363..119640)
FT                   /operon="XBJ1_operon0024"
FT   CDS_pept        complement(118363..118614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0024"
FT                   /locus_tag="XBJ1_0115"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0115"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79266"
FT                   /db_xref="GOA:D3UY88"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY88"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79266.1"
FT                   /translation="MKRKSPQKFTDNFKREAVNLVVEQSYTVPQAAETKTHHENQAEMK
FT                   KDVLGYLHYYNLTRLHTANNDLTPVEYEMAFVKVSDFS"
FT   regulatory      complement(118637..118696)
FT                   /operon="XBJ1_operon0024"
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(118714..119640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0024"
FT                   /gene="paaX"
FT                   /locus_tag="XBJ1_0116"
FT                   /product="transcriptional repressor for phenylacetic acid
FT                   degradation"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0116"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79267"
FT                   /db_xref="GOA:D3UY89"
FT                   /db_xref="InterPro:IPR011965"
FT                   /db_xref="InterPro:IPR012906"
FT                   /db_xref="InterPro:IPR013225"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY89"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79267.1"
FT                   /translation="MEKMAHKLDDFIRHALDAQPISGTSLIISLFGDALSHRGGEVWLG
FT                   SLSLLLEPMGFSDRFVRTSVFRLQKEGWLAVEKIGRRSYYRITERGMNQFRHAESKIYL
FT                   SEQPEWDGKWDLLLLEGTTKEERNRLKKELSWLGFGQLNSTLMAAPSSAQSDIPALLGE
FT                   LNASDSVIYFRADYPYPRSEQSLKERVSASWSLDQVVKHYHEFIVSFRPLMKLLQDCSE
FT                   ADLTPERSFQLRLLLIHFYRRVVLRDPLLPDALLPAQWEGQVARNLCTNIYHRIDLTAT
FT                   HYVSERCETTIGTLPPPAAAYYRRFGG"
FT   regulatory      complement(119662..119721)
FT                   /regulatory_class="promoter"
FT   operon          complement(119726..129707)
FT                   /operon="XBJ1_operon0025"
FT   CDS_pept        complement(119726..121033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0025"
FT                   /gene="paaK"
FT                   /locus_tag="XBJ1_0117"
FT                   /product="phenylacetyl-CoA ligase, phenylacetic acid
FT                   degradation"
FT                   /EC_number="6.2.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0117"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79268"
FT                   /db_xref="GOA:D3UY90"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY90"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79268.1"
FT                   /translation="MSNNVQHLDSIEFASRDEIQAHQFEQIKWTLHHAYNNVPMYRRKF
FT                   DTAGIHPSDFRQLADITKFPYTTKQDLRDHYPFDTFAVPMEQIVRIHASSGTTGHPTVV
FT                   GYTQRDIDHWANLVARCLRFAGASAKDKVHVAYGYGLFTGGLGAHYGAERLGATVIPMS
FT                   GGQTEKQAQLILDFKPDVIMMTPSYCLTLLDALEQRMGGDASKCSLRVGIFGAEPWTEA
FT                   LRSEIETRMGIKALDIYGLSEVMGPGIAMESVEHANGSTIWEDHFYPEVIEPDNLNVLP
FT                   DGESGELVFTTLTKEAMPVIRYRTRDLTRLLPGTARHMRRMDRIAGRSDDMLIIRGINV
FT                   FPSQVEEQIIRFKELSPHYQLEVNRTGNYDCLSVKVELKEPERLDAQQRCDICHQLRHH
FT                   IKSMIGLSTEVSIVNCGDIPRSEGKAVRVIDHRQHE"
FT   regulatory      complement(121053..121112)
FT                   /operon="XBJ1_operon0025"
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(121129..122343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0025"
FT                   /gene="paaJ"
FT                   /locus_tag="XBJ1_0118"
FT                   /product="putative beta-ketoadipyl CoA thiolase with
FT                   thiolase-like domain, phenylacetic acid degradation"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0118"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79269"
FT                   /db_xref="GOA:D3UY91"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY91"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79269.1"
FT                   /translation="MTHAFICDGIRTPIGRYGGALSGLRADDLAALPLQALLARYPSLD
FT                   WQQIDDVILGCANQAGEDNRNVARMAVLLAGLPYSVSATTLNRLCGSGLDALAFAARGI
FT                   KAGEAQLMLAGGVESMTRAPFVMGKTDSPFSRQAQIFDTTLGWRFINPLMQQQFGTDSM
FT                   PETAENVAAQFQISRDDQDAFALRSQQRTANAEQRGIFAEEITPITLPSTDKKGTPTIV
FT                   SRDEHPRPETTFEQLQRLKTPFRVDGTITAGNASGVNDGAAALIIASETAALQQGLTPR
FT                   ARIIATATCGVEPRMMGIGPLPATRKVLELTGLSLNQMDVIELNEAFAAQSLAVMRQLG
FT                   LPDDAEQVNPNGGAIALGHPLGMSGARLALTATLELERRTGRYALCTMCIGVGQGIAMI
FT                   IERIS"
FT   CDS_pept        complement(122340..122807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0025"
FT                   /gene="paaI"
FT                   /locus_tag="XBJ1_0119"
FT                   /product="putative phenylacetic acid degradation protein
FT                   with thioesterase/thiol ester dehydrase-isomerase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0119"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79270"
FT                   /db_xref="GOA:D3UY92"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR011973"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY92"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79270.1"
FT                   /translation="MSANASSQLAQRCIEAMYAKDACAQNMGMHIDHVDTGVAQVSMTI
FT                   KPDMLNGHQSCHGGILFSLADTAFAYACNSEGLAAVASGCSIDFIRPAFSGDRLTATAF
FT                   MQHQGKTTGLYDVRIINQDGKIVAFFRGHAHRLGHSILEDRQETPLQGEQS"
FT   CDS_pept        complement(122797..124401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0025"
FT                   /gene="paaH"
FT                   /locus_tag="XBJ1_0120"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase, phenylacetic
FT                   acid degradation"
FT                   /EC_number="1.1.1.157"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0120"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79271"
FT                   /db_xref="GOA:D3UY93"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041040"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY93"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79271.1"
FT                   /translation="MNTPAHHHPILHGPIAVIGAGTMGIGIAQVAAQAGYSVLLFDVNN
FT                   EAAQRALETLHTRLHQRVEAGKAAAGATQALLQRITRVDSLQALAPSALVIEAIIEQLE
FT                   VKQNLFRQLEPLCSAGTIFASNTSSLSITAIARVLASPQRMAGLHFFNPAPLMKLVEII
FT                   QGLETSSQTITTLKSLVTDWQKQPVVCRSTPGFIVNRIARPFYAETLRALEENVASPAT
FT                   LDAVMKESGGFAMGALQLTDLIGHDVNYAVTESLFHAFHGDPRFQPSLRQKELVEADHL
FT                   GRKRGQGFYVYDSKEKHQPLPRLETLQEQIRPARIQATGDWGTLPHFAALLKPLLQQYG
FT                   IAPEESKNTDSQPPALQLDDVILTLTQGKTSAQLADEIRAPVVQFDLAANHQTASIITL
FT                   SSACQNTRPQTAKVISFLQSLGKQVILLPDYPALLTMRTVAMLCNEALDAINKSIASAA
FT                   DIDLAMCYGVNYPIGPLAWGEQLGWRHILSTLENLQQFYGEPRYRPAPLLRQLAAGYVT
FT                   LHLQRDQNQNKERNHVR"
FT   CDS_pept        complement(124404..125201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0025"
FT                   /gene="paaG"
FT                   /locus_tag="XBJ1_0121"
FT                   /product="acyl-CoA hydratase, phenylacetic acid degradation
FT                   (strain W)"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0121"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79272"
FT                   /db_xref="GOA:D3UY94"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR011968"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY94"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79272.1"
FT                   /translation="MENMSMILTDIEAGVLSITLNRPERINSFNEEMHQQLSEALKIAE
FT                   QDESVRCVLLSGAGRGFCAGQDLNDRNAIISEGDVPDLGQSVERFYNPLIRRLTSLPKP
FT                   VICAVNGVAAGAGVSVALACDIVIASRTASFIQAFCRIGLTPDAGGSWFLPHKIGHARA
FT                   MGMALLGDKISAEQALEWGMIWQVVEPEALEDKTRELAQHLATQPTVALSCIKKATYAA
FT                   AANSLDQQLNLERDLQRLCGRSEDFREGVSAFIDKRQPQFKGR"
FT   CDS_pept        complement(125205..125978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0025"
FT                   /gene="paaF"
FT                   /locus_tag="XBJ1_0122"
FT                   /product="enoyl-CoA hydratase-isomerase, phenylacetic acid
FT                   degradation (strain W)"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0122"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79273"
FT                   /db_xref="GOA:D3UY95"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY95"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79273.1"
FT                   /translation="MSHEWILCHQQQRVRTLTLNRPEVRNALSNDCLEQLVQQLEQADA
FT                   DTGTGAIVITGASRYFAAGADLRELQQQTVATAMTDRRPQLWQRLHNISKPLIAAVNGY
FT                   ALGAGCELVLACDLVICGESARFGLPEITLGLMPGAGGTQRLIRCVGKALANQMILTGE
FT                   AINAQKAQQAGLVSEVCIDALTLERAEQIAQRISEFSPLALRAAKAALKTAHETSLSQG
FT                   LLAERQQFVALAGTADRQEGITAFLEKRKPTFKGF"
FT   CDS_pept        complement(126003..127088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0025"
FT                   /gene="paaE"
FT                   /locus_tag="XBJ1_0123"
FT                   /product="putative phenylacetic acid degradation protein
FT                   with NADP-linked, 2Fe-2S ferredoxin-like and riboflavin
FT                   synthase-like domains"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0123"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79274"
FT                   /db_xref="GOA:D3UY96"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR011884"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY96"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79274.1"
FT                   /translation="MATFHRPTFHRLSIAAIERETPDAVTVTLHVPDELKALFCYQPGQ
FT                   HLTLKARVDGAELRRCYSICSSPLDDGLQIGVKATYQGRFSTFINQRLKVGDELDVMQP
FT                   QGNFGHHPDGNNAGNYLAIAAGSGITPILSIIKSTLALEPDSTFTLIYGNRTSRSVMFK
FT                   EALADLKNRYLHRFQVLYLFSQEITDSPMFNGRIDSEHLQHLGKILLNFSQFGQAFLCG
FT                   PAAMLDDAKSALEQAGMASERIHTERFNTGRNPSSTAARPANLAERSETRVEIHLDGRT
FT                   LNIAMNTEDDSILDAALRQGADLPYACKGGVCATCKCRLKSGEVDMNVNYSLEPDQLAA
FT                   GYILSCQSWPKGDGVVVDFDV"
FT   CDS_pept        complement(127108..127617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0025"
FT                   /gene="paaD"
FT                   /locus_tag="XBJ1_0124"
FT                   /product="putative subunit of multicomponent oxygenase,
FT                   phenylacetic acid degradation"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0124"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79275"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR011883"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY97"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79275.1"
FT                   /translation="MEQHVNTLQLQNPAIHQIWQCLHQIADPELPVLSITDLGMVRAVT
FT                   PQLTGWRVTFTPTYSGCPATEYLINEIQQTLARAGFTSVTVEISLRPAWTTDWMNADAK
FT                   QRLREFGIAPPQGLACEKPTETETITCPRCGSHETEKISEFGSTACKAIYRCQQCLEPF
FT                   DYFKCI"
FT   CDS_pept        complement(127647..128423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0025"
FT                   /gene="paaC"
FT                   /locus_tag="XBJ1_0125"
FT                   /product="putative subunit of multicomponent oxygenase,
FT                   phenylacetic acid degradation"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0125"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79276"
FT                   /db_xref="GOA:D3UY98"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011882"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY98"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79276.1"
FT                   /translation="MNTHSVDPSNHDLLNYVLRQGDTPLILAQRLCEWCGHAPELEIDL
FT                   ALSNIGLDLLGQARHFLSYAATLYGMDFDEDRLAFGRDEREYRNLLLVEQPNGGFNDTL
FT                   VRQFFIDAYHVLLHQALGQSRDPQLAAISTKSLKEVEYHLRFSRGWMIRLGDGTELSRE
FT                   KIRQSVNQLWRFTGELFYCDEVEQRLAEEGIAVDPRTLYEPWRQIINETFAQATLEIPQ
FT                   ETPYRQGGKQGLHTEHLGYMLAEMQYLQRTYPNCNW"
FT   CDS_pept        complement(128434..128721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0025"
FT                   /gene="paaB"
FT                   /locus_tag="XBJ1_0126"
FT                   /product="putative subunit of multicomponent oxygenase,
FT                   phenylacetic acid degradation"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0126"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79277"
FT                   /db_xref="InterPro:IPR009359"
FT                   /db_xref="InterPro:IPR038693"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY99"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79277.1"
FT                   /translation="MSDTDWPLYEVFIRSKQGLAHRHVGSLHAADDQMALENARDVYTR
FT                   RNEGCSIWVVKSIHLVASQPEERGAFFDPSEDKIYRHPTFYTIPDGIKNM"
FT   CDS_pept        complement(128766..129707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0025"
FT                   /gene="paaA"
FT                   /locus_tag="XBJ1_0127"
FT                   /product="putative subunit of multicomponent oxygenase,
FT                   phenylacetic acid degradation with ferritin-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0127"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79278"
FT                   /db_xref="GOA:D3UYA0"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011881"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYA0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79278.1"
FT                   /translation="MTTNSLQAHFDAKIAADLSIEAKDWMPDAYRQNLIRQIGQHAHSE
FT                   IVGMLPEANWITRAPTLRRKAVLLAKVQDEAGHGLYLYSAAETLGCTRQDIYQKLLNGK
FT                   MKYSSIFNYPTLNWADVGVIGWLVDGAAIINQVALCRASYGPYARAMVKICKEESFHQR
FT                   QGYEAVMVLAAGNDAQRKMLQDAINRFWWPTLMMFGPNDNDSPNSAQSMAWKIKRFSND
FT                   ELRQKFIDSTVPQLEALGMTAPDPELVWDATTEHYRFGEIDWDEFYQVLKGQGICNHER
FT                   LEAKRRAWETGSWVREAASIHAKKMATRKNAA"
FT   regulatory      complement(129736..129795)
FT                   /regulatory_class="promoter"
FT   regulatory      129831..129890
FT                   /regulatory_class="promoter"
FT   CDS_pept        130032..132119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maoC"
FT                   /locus_tag="XBJ1_0128"
FT                   /product="putative aldehyde dehydrogenase, phenylacetic
FT                   acid degradation"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0128"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79279"
FT                   /db_xref="GOA:D3UYA1"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR011966"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYA1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79279.1"
FT                   /translation="MQQLTSYICGAWVYGQGNARTLHHAVSGEALYQVCSDGLPLADSL
FT                   GYAREKGGKSLSAMTFQQRAQMMKAVAKHLLANKETLYAISAETGATRADGWVDIEGGI
FT                   ATLFSYAGLAGRELPDDTLWPEDEMIPLSKQSQFVARHVLTSRPGVALHINAFNFPCWG
FT                   MLEKLAPTWMAGMPAIIKPATASAQLTQAMVKMIIDSGLVPEGALQLICGGIGDLFDHL
FT                   DYQDAVTFTGSAQTGQKLRVHPRLIEKSIPFTMEADSLNCCMLGEDVTPEMPEFGVFIK
FT                   EVVREMTAKAGQKCTAIRRIIVPVSQLEAVKQALLKRLSGVTVGDPALPEVRMGALISL
FT                   EQRDEVQAKVDELLRHGCEPLCGGALDQLVLTGNSSNEGAFYPPTLLYCADPVAHQAVH
FT                   GTEAFGPVSTLMPYQGTEQAIALVLMGQGSLAGSLVTADEQIAVQVIRATACAHGRMLV
FT                   LDEAASAESTGHGSPLPMLVHGGPGRAGGGEELGGLRAVKHYMQRTAIQGSPNMLAAIG
FT                   REWVRGAKVKTDPVHPFRKYFEQLEIGESLLTARRTVTEADIVNFACLSGDHFYAHMDK
FT                   LGAAESLFGERVAHGYFVVSAAAGLFVDAAVGPVLANYGMENLRFIEPVKIGDTIQVRL
FT                   TCKKKIKKVQKTPDDKPQGVVVWDVQVLNQEQQPVALYSILTLVERQQGDFTASESVRL
FT                   R"
FT   CDS_pept        132597..132662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0129"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79280"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYA2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79280.1"
FT                   /translation="MNFMLFEYNINEVNILIGYIS"
FT   operon          complement(132966..136979)
FT                   /operon="XBJ1_operon0026"
FT   CDS_pept        complement(132966..134060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0026"
FT                   /gene="yhfS"
FT                   /locus_tag="XBJ1_0130"
FT                   /product="putative enzyme with PLP-dependent tansferase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0130"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79281"
FT                   /db_xref="GOA:D3UYA3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYA3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79281.1"
FT                   /translation="MKTYPLQSMTMAQAQQQQFKLVDIICRHFPGADFLSQGDLGLVPD
FT                   LHQPRMTHRIEAVIAEHFGAEAAAFVNGAGTGALRAGLAALVSPNATLLVHDAPIYPTT
FT                   KISIEQMGLHVVYADFNHTEQIAAAIRQYQPAASLIQHTRQKIDDSYALQDVLAILHQY
FT                   QIPSLVDDNYAAMKVAHIGCEYGATLSSFSCFKLLGPQGVGLVIGKQTMIETLRRSMYS
FT                   GGCQIQGYQAMEALRGLVSAPVIHAVQAEVNETLVTRLNQGELPQVKQAFLANAQSKVL
FT                   LVEFHDPIAEAVLTAAHGLGALPYPVGAESKFEIPPLFYRISGTFRQADPTLEKRMIRI
FT                   NPNRSGAETVMRILRESIFQKSGQ"
FT   CDS_pept        complement(134065..135432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0026"
FT                   /gene="yhfT"
FT                   /locus_tag="XBJ1_0131"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0131"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79282"
FT                   /db_xref="GOA:D3UYA4"
FT                   /db_xref="InterPro:IPR019733"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYA4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79282.1"
FT                   /translation="MSDINAIQHLHSFLMSLMEVDPFKAGLLAAIGAIAAMMANRGIAV
FT                   FHDGLRPLLPEYLEGRMSRKALAATSFALSIGLVVGFGIPFSLAAPIVLVHSLLLGTDM
FT                   IGIWCANSRRGFIASGIIGALYAIALLAGLRSVVELFAMLPVNFTDDLKKVGDPIVACF
FT                   ALFPAIVVGYQYGYRKGLWVMLTALIGYLATKAVGPLSFGGMIEKPVSFDPNGAALLLS
FT                   MIAMFYFAMRERPAQSAEQKGANEVLVGLFSTRIERIQKNKWLLILCGGLTASAATMSF
FT                   SLLAEGPVSLQLMAQGEQTNALLVALARAISFIPLVGTTAIATGVYSPNGMKFVFVAGL
FT                   ATNNPWIAFIAGGITMFIEIQLLAKIAIWLDKYPGVKACSGHIRTAITKMLEVALLVGG
FT                   MIASNAILPGIGFMIVAGIYLLNRTSRRPLVEMAIGPIATIAVGILANVLYLLGIK"
FT   CDS_pept        complement(135443..135805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0026"
FT                   /locus_tag="XBJ1_0132"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0132"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79283"
FT                   /db_xref="InterPro:IPR021238"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYA5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79283.1"
FT                   /translation="MKFVIGGQIEKERIAESIRQLAGDKATAITIMNDIEAAMAIKNGD
FT                   ADYYLGACNTGGGGALAIAIALIGLNQCATISMPGKILSDDEIIAHVKAGKKAFGFTGQ
FT                   DIDVVLPVIINTIVSQ"
FT   CDS_pept        complement(135891..136979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0026"
FT                   /locus_tag="XBJ1_0133"
FT                   /product="putative phosphotriesterase with
FT                   metallo-dependent hydrolase domain (modular protein)"
FT                   /EC_number="3.1.8.1"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0133"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79284"
FT                   /db_xref="GOA:D3UYA6"
FT                   /db_xref="InterPro:IPR001559"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYA6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79284.1"
FT                   /translation="MGYQKQTGNTPTHSATYSSSRIDEAEDALKQADYQEYQVKRRGET
FT                   LLYSSNKQLNNPHLGTQQNTCIDTSGYTYVHEHLHIDLSGAKGSLDCRLDQYDLIVDEL
FT                   RHLYTLGLRNIAEMTNRYMGRNANFLLDLMRDSHINIIASTGYYKEPFFPAHFSELSVQ
FT                   AIADDMIAEIETGIDGTGLKAGVIAEIGSSLDQITADEKKVFAAAALAHHATGCPISTH
FT                   TTLSTMGREQLALLKEFGVSAEHVAIGHCDLKDNLDTIIPLLEEGAWIQFDTIGKNNYY
FT                   PDSGRIAMLREVAKRGLLGQVMLSQDITRRSHLKSNGGIGFDYLLTVFVPMLLAAGFSQ
FT                   TQIDLMLRDNPAQFFRHGFSKT"
FT   regulatory      complement(137013..137072)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(137076..138251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0134"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0134"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79285"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYA7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79285.1"
FT                   /translation="MFINALKKQNPKLIEIAKDLWQQGAILPDTYIIDVDQVLDNGRHL
FT                   LQAAEQYGIELYLMTKQIGRNPWLAQKLIELGYPGVVAVDFREAYALSQHGIPLCHIGH
FT                   LVQTPAHLIETMLKQHPGIITVFSIEKAQAISDAAEKLGRIQPIMLKVFDKRDITLPSQ
FT                   EAGIFFDELDTTVDVLKTMPGIKLSGLTHFPCLEWNARYQTTLPTINLQTLLRARNRLE
FT                   QLGIELSQINAPSASSCNTIPLLAKYGATHLEPGHALTGTIPANISGQEPEKISMVYIT
FT                   EVSHHYDGNSYCYGGGYYKRGHMKYALVFPEHARSPKTVRVLSLGDPCIDYHIPISGIH
FT                   PIGSPVIMCFRTQIFVTRSDVALVSGIQSGSPKLQGIYDSQGNWKNRGYFQ"
FT   regulatory      complement(138284..138343)
FT                   /regulatory_class="promoter"
FT   operon          complement(138356..139676)
FT                   /operon="XBJ1_operon0027"
FT   CDS_pept        complement(138356..138718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0027"
FT                   /locus_tag="XBJ1_0135"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0135"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79286"
FT                   /db_xref="GOA:D3UYA8"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYA8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79286.1"
FT                   /translation="MVEQRLTILLQGGVIDQDIYDNMLDIVHDLEDIWLIPVHHPQGEM
FT                   ALTHMASAFMRSRRGEIVLPLEKNILTKIEQSEHCAQLFKIHRALLEKFTITLHPNEEG
FT                   YLLVNLYGLILATKIP"
FT   CDS_pept        complement(138768..139676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0027"
FT                   /locus_tag="XBJ1_0136"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0136"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79287"
FT                   /db_xref="InterPro:IPR032791"
FT                   /db_xref="InterPro:IPR041444"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYA9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79287.1"
FT                   /translation="MMSQTFIKKEGIAQSFLARYLLSEQCGNRLKTIELLAKECGLSVG
FT                   LMQAALKSLEQAQAVGIKRRGRNGSFLSQINHKLLLEYADIGNVVCAMPLPYTRAYEGL
FT                   ASGLKALCAEIPFYFAHMRGSDIRIECLLNGVYDLAVTSRLAAEQHPENKDLYIALSLG
FT                   TQSYTDRHRLIFRHGEMDSIRRVGLDSTSADQKIMTNQYFEGKEIEVVEVSYHECLNQI
FT                   MKGHIDAAIWNVGQGHELVAQGLMTQLPDDSECFIKASEAVILARKDNIPIQQLLYTMV
FT                   DREALLTHQQNVVAGTIEPVY"
FT   regulatory      complement(139774..139833)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(140106..140615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0137"
FT                   /product="putative Acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0137"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79288"
FT                   /db_xref="GOA:D3UYB0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYB0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79288.1"
FT                   /translation="MLTIREATIKDAVLLSQLIEESYRFHFSYLWHNKTELEEYVAEEG
FT                   SPEKISNSLNTTNHKWFIAETHHSVGFAKIVFYEPLPDSDLTGVYLHKLHLMPHQTGQK
FT                   YGEQLFDHIVKLGQEQGLQWLWLEVLEQNTLAIKFYERKGMKWYKNIIFSRSKQKSTLH
FT                   IMTKPI"
FT   regulatory      complement(140675..140734)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(140823..140869)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(140883..142388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpD"
FT                   /locus_tag="XBJ1_0138"
FT                   /product="sn-glycerol-3-phosphate dehydrogenase
FT                   FAD/NAD(P)-binding (aerobic)"
FT                   /EC_number="1.1.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0138"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79289"
FT                   /db_xref="GOA:D3UYB1"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYB1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79289.1"
FT                   /translation="METKDLIVIGGGINGAGIAADAAGRGLSVLLLEGQDLASATSSAS
FT                   SKLIHGGLRYLEHYEFRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRIG
FT                   LFLYDNLGKRVSLPSSKGLKFGANSVLKPSIRRGFEYSDCWVDDARLVVLNAQEVQKHG
FT                   GEVRTRTQVTRAWREKGYWMVEAKDLTTGKTDTWRAKGLVNATGPWVKNFFDDGLKLKS
FT                   PYGIRLIKGSHIVVPRAHDEPQAYILQNEDNRIVFVIPWNDEFSIIGTTDVEYKGDPKE
FT                   VKIDDQEIGYLLKVYNNHFKKQLNRSDVVWTYSGVRPLCDDESDSPQAITRDYTLDVQD
FT                   EQGQMPLLSVFGGKLTTYRKLAEHALEKLVQYYPNAGKAWTKNGKLPGGELEGHDRDGY
FT                   ARLLRQRHNWLPEGVAQRYARTYGSNCQIILKGAEALTDLGEFFGHGLYEAELRYLVEH
FT                   EWVTQLDDAIWRRTKLGMWLTDEQKQRVADWLAQNVQSSQAQS"
FT   CDS_pept        142400..142639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0139"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79290"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYB2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79290.1"
FT                   /translation="MKCSEQFFNARFRSKDCNQNFINRQPLTRKKPIRVMQITNFYHMY
FT                   KINKEFAGSKLRAEIWEQGLATGSPTLFIFQVGK"
FT   regulatory      complement(142528..142587)
FT                   /regulatory_class="promoter"
FT   operon          complement(142651..144701)
FT                   /operon="XBJ1_operon0028"
FT   CDS_pept        complement(142651..143409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0028"
FT                   /gene="glpR"
FT                   /locus_tag="XBJ1_0140"
FT                   /product="transcriptional repressor for the dissimilation
FT                   of sn-glycerol 3-phosphate (DeoR family)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0140"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79291"
FT                   /db_xref="GOA:D3UYB3"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYB3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79291.1"
FT                   /translation="MKQTQRHDAIIELVRLQGYVSTEELVEHFDVSPQTIRRDLNDLAD
FT                   KNKIQRHHGGAALPSSSVNTAYHDRKIMWSDEKARIARQVATQIPNGATLFIDIGTTPE
FT                   AVAHALLNHRDLRIVTNNLNVASLFMGKEDFRLIMAGGEVRSRDGGIIGEATLDFISQF
FT                   RLDFGILGISGIDSDGSLLEFDYHEVRAKRAIIENSRCVMLVADHSKFGRSAMVNLGNM
FT                   NLIDFLFTDKVPPASIQKIIEQHSVKLELC"
FT   CDS_pept        complement(143471..144304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0028"
FT                   /gene="glpG"
FT                   /locus_tag="XBJ1_0141"
FT                   /product="putative membrane protein, member of glp regulon"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0141"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79292"
FT                   /db_xref="GOA:D3UYB4"
FT                   /db_xref="InterPro:IPR022732"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR023662"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="InterPro:IPR038236"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYB4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79292.1"
FT                   /translation="MIHVTSISNPRLAQAFIDYMVTQGIHLTMRPTHEPALVELWLEDE
FT                   NQLSFVEQELNQFSRDPFNERYQTASWQAGKSGYSFKYHNSLNLSTLKSQSGPLTISVT
FT                   ALCILVYLWMQVAGDSDVMRWLAWPNGEQYLELWRWVSPALLHFSLTHLLFNLALWWYL
FT                   GSQVERHMGAGKLFEITIVSAVFTDWAQSLFSGSHFGGLSGVVYALISYVWLTGEMSPK
FT                   RGISVPRGLIAISVIWLLVGYFDMFSLNIANAAHFSGLIIGLLMGLWDNLRKQKN"
FT   CDS_pept        complement(144378..144701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0028"
FT                   /gene="glpE"
FT                   /locus_tag="XBJ1_0142"
FT                   /product="thiosulfate:cyanide sulfurtransferase
FT                   (rhodanese)"
FT                   /EC_number="2.8.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0142"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79293"
FT                   /db_xref="GOA:D3UYB5"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYB5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79293.1"
FT                   /translation="MDRFQTINPEQAYQHWLNKTAVMVDIRDPQSFRAGHTTGAFHLTN
FT                   ETLNNLLQETDFDQPVMVMCYHGHSSQGAAQYLVNMGFETVYSVNGGFDVWQRSYPEAV
FT                   NTL"
FT   regulatory      complement(144803..144862)
FT                   /regulatory_class="promoter"
FT   operon          complement(144865..146196)
FT                   /operon="XBJ1_operon0029"
FT   CDS_pept        complement(144865..145440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0029"
FT                   /gene="nfuA"
FT                   /locus_tag="XBJ1_0143"
FT                   /product="Fe/S biogenesis protein"
FT                   /function="11 : Protein fate"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0143"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79294"
FT                   /db_xref="GOA:D3UYB6"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYB6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79294.1"
FT                   /translation="MINITEAAQAHFAKLLASQEPGTQIRVFVINPGTPTAECGVSYCP
FT                   PDAVEATDTELKFDQISAYVDEISAPFLAEAVIDFVTDQLGSQLTLKAPNAKMRKVTDD
FT                   APLIERVEYVLQSQINPQLAGHGGRVSLMEITDAGYAILQFGGGCNGCSMVDVTLKEGI
FT                   EKELLNMFPELKGVRDLTEHQRGEHSYY"
FT   CDS_pept        complement(145513..146196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0029"
FT                   /gene="gntX"
FT                   /locus_tag="XBJ1_0144"
FT                   /product="putative periplasmic gluconate-binding protein in
FT                   GNT I transport system"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0144"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79295"
FT                   /db_xref="GOA:D3UYB7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYB7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79295.1"
FT                   /translation="MLTMVGYCWLCHQSLYFAHHGICHICHQQLKRLKHVCPRCALPAE
FT                   SRDFPCGRCLKNPPPWQHLIAITDYAPPLSRLIRRYKYHGTPQLATVLARLFLLHWLQG
FT                   YRDGRWNKPDCILGIPLHSKKRWRRGFDQIELIAKPLSRWLQCHYQPDLLWRSRATLTQ
FT                   RGLSATQRKTNLKHAFQLRGDFTDQNVAIFDDVITTGTTLHEASQLLIRAGAHSVQAWA
FT                   ICRTL"
FT   regulatory      146144..146203
FT                   /regulatory_class="promoter"
FT   regulatory      complement(146219..146278)
FT                   /regulatory_class="promoter"
FT   CDS_pept        146235..147011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioH"
FT                   /locus_tag="XBJ1_0145"
FT                   /product="putative enzyme in pimeloyl-CoA (biotin
FT                   precursor) synthesis with alpha/beta-hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0145"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79296"
FT                   /db_xref="GOA:D3UYB8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010076"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYB8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79296.1"
FT                   /translation="MNKLFWQIMGEAPRDLVMLHGWGLNSEVWRSVETRLSSHFRLHLV
FT                   DLPGHGRSQPYPAMTLAEMADTVWQQAPENALWLGWSLGGLVASRIALDHPAEVAGLIT
FT                   VASSPKFSAEGDWPGIKPTVLRAFEHQLSEDFQKTVERFLSLQTLGTDSARQDARLLKS
FT                   VILNQPMPTVEVLNAGLETLRTDDLRAELAQLQLPFLRLYGYLDGLVPRKIAAQLDNEW
FT                   PHTHSVIMRNAAHAPFVSHPDEFVDAVMEFVANAGL"
FT   regulatory      147018..147066
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(147058..147501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0146"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0146"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79297"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYB9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79297.1"
FT                   /translation="MPKELFTAEIESSGHLKMQCSTRGFSFHVDEPKNLGGTDEAMNPV
FT                   EALLSAFGACQCIVAKSFARKHKINLIDIQVKMEGELDTDGFTGRNKNTKMGFSKITSK
FT                   FYIKADNTEQEIRDFIDFVESNCPVLDTILNAPEIVTEVYPSR"
FT   CDS_pept        complement(147471..147608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0147"
FT                   /product="Synaptotagmin-1 (Synaptotagmin I) (p65)
FT                   (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0147"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79298"
FT                   /db_xref="GOA:D3UYC0"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYC0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79298.1"
FT                   /translation="MKNKTSLLKHKLKNKNYSLIIWVLVLSIFNNLRIIICLKSYLLLK
FT                   "
FT   regulatory      complement(147540..147599)
FT                   /locus_tag="XBJ1_0147"
FT                   /regulatory_class="promoter"
FT   regulatory      147553..147612
FT                   /regulatory_class="promoter"
FT   operon          147759..148471
FT                   /operon="XBJ1_operon0030"
FT   CDS_pept        147759..148037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0030"
FT                   /locus_tag="XBJ1_0148"
FT                   /product="Insertion element IS1 1/2/3/5/6 protein insA
FT                   (IS1a/IS1b/IS1c/IS1d)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0148"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79299"
FT                   /db_xref="InterPro:IPR024431"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYC1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79299.1"
FT                   /translation="MTVTIEVTCRYCDQAEPVRKHGTGKAGFPRYYCKGCQRTFQLNYR
FT                   YNGHKPGMKEKIVDMAMNGSGVRDTGRVLGLGINTVMRTLKNSRQKK"
FT   CDS_pept        148082..148471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0030"
FT                   /locus_tag="XBJ1_0149"
FT                   /product="Insertion element iso-IS1n protein insB"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0149"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79300"
FT                   /db_xref="GOA:D3UYC2"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYC2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79300.1"
FT                   /translation="MDEQWFFIGNKKQRHWLWYAFDTKRKQVIAHVFDPRTDATCRKLL
FT                   NLLVPFNIRFITTDNGGSYAREVVPEKHRVGKIFTQRIERHNLNLRIHIKRLARRTICY
FT                   SRSMEIHEKLIGAYIEKHHYNPLES"
FT   regulatory      149682..149741
FT                   /regulatory_class="promoter"
FT   operon          149765..150603
FT                   /operon="XBJ1_operon0031"
FT   CDS_pept        149765..150214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0031"
FT                   /locus_tag="XBJ1_0150"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0150"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79301"
FT                   /db_xref="GOA:D3UYC3"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYC3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79301.1"
FT                   /translation="MLGKQLWESDIIIKRQQPCLPLVHSELAGRLHVEYRRVMNGVFWV
FT                   GAPWHDLPERYGPWKTVYNRFNRGSKSGIIDKIFNRLLSVLDEKGLIDWSEICLDGSNI
FT                   RISKDAAGAKKNISILLAIMCWVAHVVVMIQKSIWQLTERAFHLT"
FT   CDS_pept        150214..150603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0031"
FT                   /locus_tag="XBJ1_0151"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0151"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79302"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYC4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79302.1"
FT                   /translation="MLTVGQAHESQSAIPLLDGVGVQRKNGFMKWRGKAVLADKGYSGG
FT                   KPRSYLRKLRLKSIILYKVNEKGSSDGCTQFDEPICRNRNVVERCFGFLEGNRRITTRY
FT                   EKTARNYLSMVKLGSIRLFCRRLYN"
FT   regulatory      150627..150658
FT                   /regulatory_class="terminator"
FT   regulatory      150696..150755
FT                   /regulatory_class="promoter"
FT   operon          150812..154475
FT                   /operon="XBJ1_operon0032"
FT   CDS_pept        150812..151540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0032"
FT                   /locus_tag="XBJ1_0152"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0152"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79303"
FT                   /db_xref="GOA:D3UYC5"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYC5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79303.1"
FT                   /translation="MNIRNRTPNFDDVANIVKILGITSNNGESFDRDLHLYSLIEKPWG
FT                   FEYRVYCDSIFDVWKLHISPQEKTSMHCHIQKDTVLICLNGSGVTKFLDGDEFNISVGQ
FT                   VVYIERGVFHQTISTGNDYLELIEVENPRNKFDLLRLSDDYGRAAQSYENVSLNHDLLS
FT                   PLKLISPGAYIRNVDINSKFSFFLEKLNIDILDDENILFIVSLSIDSHLSGKINIFLKE
FT                   DVKCRSYIGQQVLLISRKNK"
FT   CDS_pept        151552..152127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0032"
FT                   /locus_tag="XBJ1_0153"
FT                   /product="Peptidase C56, PfpI"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0153"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79304"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYC6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79304.1"
FT                   /translation="MLDKFKLVIITGPGFQDHDLVYTYYRSIEEGYDVSIATKDGESVI
FT                   GKYGISVPMDKRAKQNITFDDLNEEKFDLVILTGGHEAPDRVRQDQRVKDFVSNMSKQE
FT                   KVVAGLCHGPWIMISAGVMKGKLACAYVGLKDDMENSGANVIEADVVVDKNIITCSYYS
FT                   ECGKFMKETFAAVKRWNKGEKLTEPLVV"
FT   CDS_pept        152131..152868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0032"
FT                   /locus_tag="XBJ1_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0154"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79305"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYC7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79305.1"
FT                   /translation="MIIALDFDGVVVDAIDECLLVSWNTFNGKGYQQFNKNTLESIPRS
FT                   FREKFLNYRSYVRHDGHFIVPYYLNDEVFVNKDSFENVYSRISTSDKDRFRNSFIEYRI
FT                   KVRNTYPKVWTSLHKFLMDIETLLNSGNEFIIVSGKDSSSIHFLLCMIGVEFPISKIYG
FT                   RMTNKSETLKSINNKAYMKGEKFIFIDDNLDNVKEAINNDIPSVWAEWGYNTKEQFCEA
FT                   KQLKIPSLKQKDLSDLIKSLHQY"
FT   CDS_pept        152879..153592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0032"
FT                   /locus_tag="XBJ1_0155"
FT                   /product="ThiJ/PfpI"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0155"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79306"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYC8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79306.1"
FT                   /translation="MINNVKRALIIVTSHAILGKTGRQTGFYYEELATPYWEFVDAGYT
FT                   VDIASINGGTAPADPSSVKSSDQQPKSVRRFLNDKSCMNKVNTTKSILNIDPNSYQIVF
FT                   LPGGHGTMWDFAQSMSLATLLSKLYQNGAVLGSVCHGAAGLLNVKTADGIPLVENRKIN
FT                   SFTEAEEQASGLDNVVPFILETELKKLGAHFECAANFEPYVVSDGRLITGQNPASSGLV
FT                   AAAILKAANHLYNKE"
FT   CDS_pept        153600..154475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0032"
FT                   /locus_tag="XBJ1_0156"
FT                   /product="Cyclic imide hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0156"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79307"
FT                   /db_xref="GOA:D3UYC9"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR037950"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYC9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79307.1"
FT                   /translation="MTKEILCGFGVGVDAVAGWLSSYGGEDSPSDISRGMFAGEIGVPR
FT                   LLNLFKKFDIPTTWFIPGHSIETFPEQMKMVVDAGHEIGVHNYSHENPIDMTPEQERIV
FT                   LQKSIDMVTKLSGKKPTGYVAPWWEFSPSTTDLLLEHGIKYDHSLMHNDHLPYYVRKGD
FT                   YWTKIDYTKHPDEWMKPLIRGKETDLVELPASWTVDDIPPFMFMKNKANSQGFMNPRDI
FT                   EQLWRDQFDWVYREMEYGIFTFTIHPDVSGRPHVLMMLERLLVHMLGHPGVKFMTLNDI
FT                   ADDFKKRNPR"
FT   regulatory      complement(154485..154514)
FT                   /regulatory_class="terminator"
FT   regulatory      154493..154529
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(154520..155419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0157"
FT                   /product="putative LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0157"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79308"
FT                   /db_xref="GOA:D3UYD0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYD0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79308.1"
FT                   /translation="MSYLIQLRSFLDVYRSGSISKAATRLGVSQPAVSAHVHSLESFMG
FT                   SVLFTRRSHGVIPTAEADDLVLQIGTHLDAIETKLSLIRGKSKKIEGVVKIIAPADFLW
FT                   AKSANILSSIINKQLRFKLLIGDRKKIYSSLNDGDSDLAFTTSCPDENKFGFEIIGKEK
FT                   LIIVTSASIAAELKNKSISPEILEKYPLISYDNQLPLIRDYYKLVFGVEADILPSITIS
FT                   DLRVIGRIISDNNGWTVMPEYLCEDGFKSRKVFKINHNTNIPENNFYLVWNKSALRHPR
FT                   VLYVKNHIINLAQQGYFG"
FT   regulatory      complement(155495..155554)
FT                   /regulatory_class="promoter"
FT   regulatory      155507..155566
FT                   /regulatory_class="promoter"
FT   CDS_pept        155602..156783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0158"
FT                   /product="Major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0158"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79309"
FT                   /db_xref="GOA:D3UYD1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYD1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79309.1"
FT                   /translation="MPFVIYIFSLCAFALGLTEFLVIGLVSAISTDFHTSVESVGLTVT
FT                   AYAVGATIGAPFLTAVTTRWSRKGVMLTTMMIFSIGSLAATFSSSVEMMIVSRFVAGLA
FT                   HGLFLAVSASVATDLVPPEKSGAAVACVFTGLTLALALGVPIGTYLGSVVSWKFSFSLV
FT                   TIFGLIGLIGLIFLMPANTGNKNDVIAHPVKSLSYIFSPTLLLGALVTVLGYTGAFTLY
FT                   TYISPFLYQVTKVSIQTASYMMLIYGGFAAAGNIIGGKMTDAIGADRSVMIILLSLSAD
FT                   LLLMYFFGQSLIIMGILIAIIGAISYAAVPAMQARVISIAKYNVPEAIPVASGLNIAGF
FT                   NAGIALGSVVGGIIISYLSIAYLALGGVVISLAGICVMIFLPRPTKILISQDE"
FT   CDS_pept        complement(155739..155867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0159"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79310"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79310.1"
FT                   /translation="MENVAARLPIEKIIIVVSITPFRDHLVVTAVRNGAPMVAPTA"
FT   regulatory      156835..156894
FT                   /regulatory_class="promoter"
FT   operon          156914..158133
FT                   /operon="XBJ1_operon0033"
FT   CDS_pept        156914..157069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0033"
FT                   /locus_tag="XBJ1_0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0160"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79311"
FT                   /db_xref="GOA:D3UYD3"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYD3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79311.1"
FT                   /translation="MATVEVKCRFCNQTKAVKKYGKGKGVTSVIVAFPVIALSNWIILI
FT                   APAMPG"
FT   CDS_pept        157093..157596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0033"
FT                   /locus_tag="XBJ1_0161"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0161"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79312"
FT                   /db_xref="GOA:D3UYD4"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="InterPro:IPR024431"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYD4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79312.1"
FT                   /translation="MNNSGIRDTARALHISINAVVRTLKNSAKMGNLDNLEIQLICEVD
FT                   EMWSFVGNKKQQRWLYYAWEPRLKRIIAHTFGRRNKKTLKKLLKKLARFNVAFWCTDNL
FT                   NAYNMLQTNKHLIGKSFTQRIERENLTIRNRIKRLNRKTLGYSKSPEMHDKVIGTFIER
FT                   EYYI"
FT   CDS_pept        157615..158133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0033"
FT                   /locus_tag="XBJ1_0162"
FT                   /product="transposase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0162"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79313"
FT                   /db_xref="GOA:D3UYD5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYD5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79313.1"
FT                   /translation="MHNPSIQWSGDITSIRIKEGWRYLAVVIDLFSRRVVGMAISSSPN
FT                   AELVCRALNNALETRYIEGRLIFHSDQGSQYSSKKFRRLLWRNQVIQSMSRRGNCDDNF
FT                   PMERVFRSLKSEWIPPEGYLDIHDAIRDITQYLGGYYNHQRPHRFNGGMSSVEYERGWE
FT                   EAKNMSDIF"
FT   operon          complement(158144..161000)
FT                   /operon="XBJ1_operon0034"
FT   CDS_pept        complement(158144..158383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0034"
FT                   /gene="yhgG"
FT                   /locus_tag="XBJ1_0163"
FT                   /product="putative transcriptional regulator with
FT                   DNA-binding Winged helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0163"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79314"
FT                   /db_xref="GOA:D3UYD6"
FT                   /db_xref="InterPro:IPR015102"
FT                   /db_xref="InterPro:IPR023732"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYD6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79314.1"
FT                   /translation="MISLLKIRDAVALNGRTDARSLSHQFSTPLPMVEAMLKQLVTMGK
FT                   LEEVDTSSCLSGGCKQCPETQKCTIKVYQLMVKN"
FT   regulatory      158225..158260
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(158393..160705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0034"
FT                   /gene="feoB"
FT                   /locus_tag="XBJ1_0164"
FT                   /product="ferrous iron transport protein B (FeoB family)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0164"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79315"
FT                   /db_xref="GOA:D3UYD7"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYD7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79315.1"
FT                   /translation="MKQLTIGLIGNPNAGKTTLFNQLTGSRQRVGNWAGVTVERKTGRF
FT                   TTDEQQIELVDLPGTYSLTTISEQTSIDEQIACHYILSGEADMLINVVDASNLERNLYL
FT                   SLQLIELGIPCIVALNMLDIAKNQHINIDIAALEQRLGCPVIPLVSTRATGIDTLKKAI
FT                   DHYQPSSQPVRIEYPDSLLQEVNHLASQITQNFNPQQRRWLTLQVLEGDIYSRERAGLT
FT                   QSQLAESKMRLQQQQLDEPELVIADSRYQAINALCLAVIDTHAATPHKLTQVMDKVILN
FT                   RWLGVPIFLFVMYLMFVLAINLGGALQPIFDGASTAIFIDGMRWLGHTLHFPDWLTVFL
FT                   AQGVGGGINTVLPLVPQIGLMYLFLSFLEDSGYMARAAFVMDRLMQSLGLPGKSFVPLI
FT                   VGFGCNVPSVMGSRTLDAPRERLITIMMAPFMSCGARLAIFAVFAAAFFGKSGASIVFS
FT                   LYILGITVAVLTGLLLKHTLMRGEASPFVMELPVYHVPHAKTLLLQSWQRLKGFVIRAG
FT                   KVIVAASILIGALNSFSFSGKAVDNINESALASVSKVITPLLYPIGVHSDNWQATVGLI
FT                   TGAMAKEVVVGTLNTLYTAENLNQAPFNPDEFHLLNELKGAVAETWDSLKETFTLSALS
FT                   NPIEASKGDGNMDSGAMGTMSAKFGSAISAYSYLIFVLLYVPCVSVMGAIARETSRGWM
FT                   LFSILWGLDVAYSLAAVFYQVTTFSAHPQSSLITILAVIVFNVLVFIGLRRARSRVTMT
FT                   FNNTAGRSCECSNGSCH"
FT   CDS_pept        complement(160770..161000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0034"
FT                   /gene="feoA"
FT                   /locus_tag="XBJ1_0165"
FT                   /product="ferrous iron transport protein A"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0165"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79316"
FT                   /db_xref="GOA:D3UYD8"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYD8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79316.1"
FT                   /translation="MSLLPNRSYKILGFSAQISPAYRQKLLSLGMLPGSTFQVIRVAPL
FT                   GDPVQIETRRVNLILRKKDLAFITLDNTPLE"
FT   regulatory      complement(161147..161206)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(161299..161330)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(161370..161897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0166"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79317"
FT                   /db_xref="GOA:D3UYD9"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYD9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79317.1"
FT                   /translation="MNKYAKSSFDLLSNIRFFSLATHHPDSGSPWSASLLYVPRYDPLR
FT                   LIWYSKLITRHSHEISINPLVSGSLYHNRVNPDTSLDLAGAQFIGQAHEIPDNELQETY
FT                   DYYFNFLFPDENIRKKKARPLSEFHGHGRRRFYELDVQEWWVYDSELWHNQQDDGRVFV
FT                   PLSELTHPPENQ"
FT   regulatory      complement(161961..162020)
FT                   /regulatory_class="promoter"
FT   regulatory      162359..162418
FT                   /regulatory_class="promoter"
FT   CDS_pept        162498..162701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0167"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79318"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYE0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79318.1"
FT                   /translation="MGLGQYFLDHQCVDINHAVLNQVQRQHADLMSFARITRHLTTACK
FT                   EYKISYTIPLFGYIQFFVNFPT"
FT   CDS_pept        complement(162585..162725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0168"
FT                   /product="transposase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0168"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79319"
FT                   /db_xref="GOA:D3UYE1"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYE1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79319.1"
FT                   /translation="MCHYLNGTLRRKVNEELNVAKQWNGVTNFVFFARRGEMTSNPREA
FT                   H"
FT   regulatory      162759..162818
FT                   /regulatory_class="promoter"
FT   operon          162882..164067
FT                   /operon="XBJ1_operon0035"
FT   CDS_pept        162882..163040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0035"
FT                   /locus_tag="XBJ1_0169"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0169"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79320"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYE2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79320.1"
FT                   /translation="MVNSSVKSEGKLAVMMIFCFQLLSVTQTDMIKMRVSDGRELVLKF
FT                   EENKVNH"
FT   CDS_pept        163053..163823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0035"
FT                   /locus_tag="XBJ1_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0170"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79321"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYE3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79321.1"
FT                   /translation="MEFDSNSHENAIQEAQRILKEAQTDLALRLEKAVEGVREVAQETM
FT                   HTIGQGGQRALWRTSYFFDSYEDVYQRINREDARVFLAAWSVARGGLFENNVIKKIVDI
FT                   YIDKLLEPHERDQAFLNELYEKLVRSSTIMMHLVAKFKTSGLAKNAVVSAITEAIYVAV
FT                   IKKAFIREGFKKFGMSITLAFQFYGYFDKAAVSASKLKRECPVLYWSFYANEIEMLYFI
FT                   FEPLFKHGISTIKKGKGSNVDDVYLAIMEIVGYN"
FT   CDS_pept        163855..164067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0035"
FT                   /locus_tag="XBJ1_0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0171"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79322"
FT                   /db_xref="GOA:D3UYE4"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYE4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79322.1"
FT                   /translation="MFSKGWLRREIMSWLKGIYSYIIWSFIPTLCVFSWSLFAFVIFPN
FT                   HWGLLTVVGIIIVLLFTAYFAFKSN"
FT   regulatory      complement(164048..164090)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(164096..164575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0172"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0172"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79323"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYE5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79323.1"
FT                   /translation="MSYMIYLTLNGKKQGLISAGCSTLDSIGNRYQKGHEDQIQVLSLD
FT                   HSMTRDQNVSHHPIQFIKPIDKSSPLLSIAIDSNESLNGGFIFYRTSSSGQLELFYELK
FT                   ITEATIVDISCVYPNSINSNDKMPYEKVQLKYKSIAWSHITAGTSAYSIWDERIY"
FT   regulatory      complement(164641..164700)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(164688..165008)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0173"
FT                   /product="transposase (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ79324.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   regulatory      complement(164745..164777)
FT                   /locus_tag="XBJ1_0173"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(164978..165319)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0174"
FT                   /product="transposase (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ79325.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   regulatory      complement(165450..165509)
FT                   /regulatory_class="promoter"
FT   operon          complement(165515..167158)
FT                   /operon="XBJ1_operon0036"
FT   CDS_pept        complement(165515..166297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0036"
FT                   /locus_tag="XBJ1_0175"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0175"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79326"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYE8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79326.1"
FT                   /translation="MKFLCNKRVLSPLLAVFFIQGCAQSGSFSPPINGENVHFMATIPD
FT                   ELDALPISAMYRSKICRKERRTANMKSYSVPGFHHATYPLSIGQSNQVEVSVPKEGGGK
FT                   CDWKLSNLTFEVKLKDTSTIAPLIDDNFGFKTTFVIDGNAPQEFDGGYIKKTGNLNEEI
FT                   TLFPLLRERFLGGHSQSFYLVGEHDVMTYKMDNGRKIHLNVLYEKKFLTHWNGGKNKDA
FT                   DTSMTYPDGTIIYNGDVIPDFDKLMRILESRNSKQTKM"
FT   regulatory      complement(166318..166377)
FT                   /operon="XBJ1_operon0036"
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(166394..167158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0036"
FT                   /locus_tag="XBJ1_0176"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0176"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79327"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYE9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79327.1"
FT                   /translation="MKFLCNKSAFSSLLAVFFIQGCAQSDSFSPPMNGENIHFTATMPD
FT                   ELDALPISAMYRSEICRKERRTANMKSYSVPGFHRATYPLSIGQPNQVEVSVPKEGGGK
FT                   CDWKLSNLTFEVKLKDTSTIAPLIKNNFGFKTTFVIDGNAPQEFDGGYLKINGNLHEKI
FT                   ILFPLLTKLFLSVNETSFYLIGKGDPLTYKVGATKNINLSYIYIKKMLSVWTDRKNNDR
FT                   PFMTYPNGDIVYGEVRPEYEILMRILESRNSK"
FT   CDS_pept        167131..167343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0177"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79328"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYF0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79328.1"
FT                   /translation="MRFYCIEISWVFSLYHSTEFNLTGPKSKWATVRLSLNYYFLVYLL
FT                   FLDSRMPINFLYSGLTSPETISPLG"
FT   regulatory      complement(167179..167238)
FT                   /regulatory_class="promoter"
FT   operon          complement(167256..174485)
FT                   /operon="XBJ1_operon0037"
FT   CDS_pept        complement(167256..168020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0037"
FT                   /locus_tag="XBJ1_0178"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0178"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79329"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYF1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79329.1"
FT                   /translation="MKFLCNKNVLSSLLAVLFIQGCAQSDSFSPPINGEHVHFIATIPD
FT                   ELDALPISAMYRSEICRKERRTANMKSYSVPGFHHATYPLSIGQSNQVEVSVPKEGGGK
FT                   CDWKLSNITFEVKLKDTSTIAPLIDDNIGFKTTFVTDGNAPAVFDGGYLKINGDLHEKI
FT                   ILFPLLTKSFLNGNENTFYLIGKGSPLTYKIGTAKKININYIYIKQMLSVWTGRKNNDM
FT                   PFMTYPNGDIVSGEVRPEYKKLMGILESRNSK"
FT   CDS_pept        complement(168004..169950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0037"
FT                   /locus_tag="XBJ1_0179"
FT                   /product="putative Lipase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0179"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79330"
FT                   /db_xref="GOA:D3UYF2"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYF2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79330.1"
FT                   /translation="MSNANSVYCHNCPGMLKNKIEIQLVDEHNKPISKMDYILKNSKVE
FT                   RPGKTDENGMIRADKLPASPIRLFLRGQKLADEMETRPLRTLRGESHSTVKPDAESKGY
FT                   FYRYAVIGELCDKAPNIAKWEQAKFGLPYYHFPKENEFKGLEFYGEDFNQRHVIEVCPF
FT                   RAWSLILKHTPNYDIVNAYNLGLMSLLVYKNEVMVNPDSPDINMRKFINTPDTTTSFFY
FT                   QQCFDLSKTPVINDHSVYPAIVNDVPFKERYRPAIFLDVEQVETPETFEHDTQMFFVEN
FT                   ETQIIAAWRGTASSRDALTDGTYRPIPCPENILPGGKAKVHKGFLEAYQCMEKYFINEI
FT                   KQIKESSQHINLKKLFICGHSLGGALALLHATELRNNNPLLYTYGMPRVLTGSGVKALT
FT                   SLNHFRHVNDADSVTSVPFDTNMDNWLFEVYGPLGTIFGFSWTLATLPTIPIQKSLPEM
FT                   GEVYYHQGNTVSFFQARQMGEERIPSKNGVGFTGKKRWRMNGIYKFYLVPSIANSLDKG
FT                   LENEQQEYVDSLKGDKSVLDEIFPQWNNPDLDTIITTATDHFMGSKYQAIINNQLLSFL
FT                   EPTKTPKLIASKEKFDELIHHQDASPLNAKRNTTFMALENNLHDIFKQDVNQDELLKHA
FT                   LERYKEGANEISM"
FT   CDS_pept        complement(169966..170760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0037"
FT                   /locus_tag="XBJ1_0180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0180"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79331"
FT                   /db_xref="InterPro:IPR025391"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYF3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79331.1"
FT                   /translation="MENAIPAEDTESPVSWQEWLNKSNDAPVFFILNSLAKPDPVAHFY
FT                   LNDWVEEAFPLYSGTPMRKMLKQSPWLVQAKVNHLFQIGAVLDKHELSDNSWGWAYRSH
FT                   KSWQEQLTHWQRRQLVTLNGEQVIFRMMDTRVFGAMVSAFTPSDWSLMLTPVTELMIDL
FT                   SQTTHFHRPKECGQGNDDIPFTLGEHLQLVWLHSPYGLKVLSSSLYNDLWENHGVMAKK
FT                   LDQPEGSLEPRIEQWLRQKLEAGQRIENMSGQNYLLAMEQEK"
FT   CDS_pept        complement(170769..172691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0037"
FT                   /locus_tag="XBJ1_0181"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0181"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79332"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYF4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79332.1"
FT                   /translation="MMNMLSSAKSGLRFTFQVAGLPEDTFSVGEFSLQEGLSELFTLNL
FT                   TLVKTHTLNPFKPQTEVDLTALLMQEAVLQIFNGELAQRKITGIISHADWAGTDGNKTL
FT                   YTLTVRPALWRLTLNQDREYVTQKRESDYAFFNRLAAEEGISFWFEDETAFFSDSHLGM
FT                   TAGLPLTYSPQPETAHGIDTIYQVRLGVGMSPQRSLHKDFNYDNPRYHLSHMESSEGFR
FT                   DFGTQTPYTVFESYGRFQKDAAAKPFLKYRHEALDNQKKTGSGNSNCIKLMPGKIFEIK
FT                   NHPHAPLNARWQIVGISHHGRCPQALGHDGGDGTTLSNQFSFIDGLADWRPPFYYKPLA
FT                   DGDETAIVVGPEGEEIFVNKDGAIKIHFHWNRYDNADDGASCWVRVAQGWNGHGFGFMA
FT                   IPRIGQEVIISYLNGDIDRPIVTGSVYNGLNRPPLDLPAQKTRTTFKTKTHKGKGFNEL
FT                   RFEDAKGSEEVYIHGQKDFTAHIENDAYWHIKHDQKQRIDNNRYHDIRADDHHQVAGSR
FT                   KITTEGDVSHRIAGSQHIQTGDATVIDSGQEIHLKSGGKMVLEAASEITLKVGGSFLKV
FT                   TPGGILSSPINVGQGSGGSGRGVNLQLPEGVEPLPEVEMVFPAHPYCPELAQQDVSPVI
FT                   KPAKE"
FT   CDS_pept        complement(172728..174485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0037"
FT                   /locus_tag="XBJ1_0182"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0182"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79333"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYF5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79333.1"
FT                   /translation="MKNNKESMYLRERAYMRELAQRVAKESPHLADFLLASHDPDIERV
FT                   FEAFALLIAHLRDKLEDDFPEITHGILSRIWPLALSPIPPTTVMQFHPTDGEHQGAVDI
FT                   PAGTPVSAHVNGQLLTFKTCRSLHIEPLIVLDRAVKKTGTHSEIVLTLCQTGIPSPVWQ
FT                   SGSLSFFLGTDSEQAALLSLWLDQHISDVSLRVRGEQRELSCFPYGWHNLFDTPILPME
FT                   KHTYAGLQSLIEYYALPQLYNFMTVDISDYCREVPLNADGTFELIFRFEGELPLEDVDD
FT                   AFMLGCVPAIHLENLTSLPIPLTPENHRYPLPLGESVRLFRLRDIQVIQQPDEKQQRGT
FT                   PYRYLPIDQFTPAMGWLAEDGEADTFYYLLQTARDLPGRLTHQLHFFDLTGRPAVNLPE
FT                   IAVACHSWGYHEQAIALEKGTLTVMQEGSPSHLNVHNITPVATDYPSMLQDNSGWPLLS
FT                   CLSSPPMLLFTTESLKHFLRLFDPYAELNRPLSRHIRRHIDGIVRVEERLTDRMYKGRP
FT                   VRGHLLSLTLNPDGYANPGEMYRFCRLINQAMACFVGQSTFVKLNVYTPNCHKALWEFW
FT                   EVYGLRRDM"
FT   regulatory      complement(174512..174571)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(174780..174860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0183"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79334"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYF6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79334.1"
FT                   /translation="MLRKGQYSQPEDKTLSPAEMFYRLTP"
FT   CDS_pept        complement(175081..177423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0184"
FT                   /product="Protein yhgF"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0184"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79335"
FT                   /db_xref="GOA:D3UYF7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYF7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79335.1"
FT                   /translation="MNESLSRIIAGELQAQPQQVLAAITLFDEGNTVPFVARYRKEATG
FT                   GLDDTQLRQLESRLGYLRELSDRRQTILKSIEEQGKLTVELAEAINTTQSKTELEDLYL
FT                   PYKPKRRTRGQIAIEAGLEPLADLLWQDPQQTPELAAAAYVDADKGVTDTKAALDGARY
FT                   ILMERFAEDAALLVKVREYLWKNAHLAAKVVEGKEEEGAKFSDYFDHHEPIATVPSHRA
FT                   LAMFRGRNEGILQLALNADPQFEEAPKESYCEQIITDHLNLRLNNAPADSWRKAVVSWT
FT                   WRIKVLLHLETELMGTLREKAEDEAINVFARNLNALMMAAPAGMRATMGLDPGLRTGVK
FT                   VAVVDSTGKLIATDTVYPHTGQEVKAAAAVAALCTKYQVELVAIGNGTASRETERFFAN
FT                   IQKQYPDVKAQAVIVSEAGASVYSASELAALEFPDLDVSLRGAVSIARRLQDPLAELVK
FT                   IDPKSIGVGQYQHDVSQTQLAKKLDTVVEDCVNGVGVDLNTASVALLTRVAGLSKSVAQ
FT                   NIVNWRDENGRFDNRNQLLKVNRLGPKAFLQCAGFLRINQGDNPLDASTVHPETYQVVE
FT                   KILATTEQSLSELMGNPGALRGLQAQDFTTDKFGIPTVTDILKELEKPGRDPRPEFKTA
FT                   TFTDGVETMKDLRAGMILEGTVTNVTNFGAFVDIGVHQDGLVHISSLSDRFVENPHTVV
FT                   KTGDIVKVKVMDIDLNRKRIGLTMRLDEQPGEAPARRSGSQSSNPRNSNERNGNGRNRQ
FT                   TSRSPGSTALSNSAMSDALAAAFGKKR"
FT   regulatory      177568..177627
FT                   /regulatory_class="promoter"
FT   regulatory      complement(177630..177689)
FT                   /regulatory_class="promoter"
FT   CDS_pept        177664..178146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greB"
FT                   /locus_tag="XBJ1_0185"
FT                   /product="transcription elongation factor and transcript
FT                   cleavage"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0185"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79336"
FT                   /db_xref="GOA:D3UYF8"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYF8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79336.1"
FT                   /translation="MAKSNYITREGWHALDQELKYLWKVERPNVTQAVSDAAALGDRSE
FT                   NAEYIYGKKRLREIDRRVRFLSKRLDALQIVDPDPRQEGKVFFGAWVKVENEKAEEHIF
FT                   RLVGPDEFEPAKKWISIDSPVARALLGKQVDDEITVMTPNGMAIYWILEIGYQPLG"
FT   regulatory      178170..178229
FT                   /regulatory_class="promoter"
FT   operon          178307..180024
FT                   /operon="XBJ1_operon0038"
FT   CDS_pept        178307..179026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0038"
FT                   /gene="ompR"
FT                   /locus_tag="XBJ1_0186"
FT                   /product="response regulator in two-component regulatory
FT                   system with EnvZ, regulates ompF and ompC expression (OmpR
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0186"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79337"
FT                   /db_xref="GOA:D3UYF9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYF9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79337.1"
FT                   /translation="MQESYKILVVDDDMRLRALLERYLSEQGFQVRSVANAEQMDRLLT
FT                   RESIQLIILDLMLPGEDGLSICRRLRSQHNPIPIIMVSAKGEEVDRIVGLEIGADDYLV
FT                   KPFNPRELLARMRAVMRRQSHELPGAPTPDNAVVKFGKFKLDLGTREMFHEDEQLSLTS
FT                   GEFSVLKVLVSHPREPLSRDKLMSLARGREYGAMERSIDVQVSRLRRLIEEDPAHPRYI
FT                   QTVWGLGYVFVPDGSKV"
FT   CDS_pept        179089..180024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0038"
FT                   /locus_tag="XBJ1_0187"
FT                   /product="EnvZ"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0187"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79338"
FT                   /db_xref="GOA:D3UYG0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYG0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79338.1"
FT                   /translation="MLGSLMISYLAAQRLVEMEKLSFAIVFFYVFASVFTAASAVSITF
FT                   WFYLRAQRQPLRTMQKAVREMEKGKIAAPLPEAGAPAIRSLIRAFNQMSTAHKALETDR
FT                   ASLIAGVSHDLRTPLTRIRLALELIEGKDNFLRESINRDIEECNAMIDQFIDYQRSGQN
FT                   MPMLCCELNGLLDEAITVENDGVGNIENHLSANPVVIMANPLSIKRVLSNMFTNAHRYG
FT                   QGWIRVSSGVTEKFGWFQVEDNGTGMTEEESATLFQPFTQGQRVHNNGGAGLGLAIIRR
FT                   IVDIHDGYIEVGRSEKGGLSMRVYIPRVTK"
FT   regulatory      180048..180107
FT                   /regulatory_class="promoter"
FT   operon          180218..184774
FT                   /operon="XBJ1_operon0039"
FT   CDS_pept        180218..181249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0039"
FT                   /gene="pstS"
FT                   /locus_tag="XBJ1_0188"
FT                   /product="high-affinity phosphate transport protein (ABC
FT                   superfamily, peri_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0188"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79339"
FT                   /db_xref="GOA:D3UYG1"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYG1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79339.1"
FT                   /translation="MRTTVASIMAAALAMTSLSSFAASSLTGAGATFPAPVYTKWADSY
FT                   QKETGNKINYQGIGSSGGVKQIIAHTVDFGASDAPLSHEKLEADGLFQFPTVIGGIVLA
FT                   VNISGIKSGQLVLDGKTLGDIYLGNIKKWNDPAITKLNPGLRLPDQNIAVIRRADGSGT
FT                   SFVFTSYLSKVNSLWKEKVGVGSTVKWPAGLGGKGNDGIAAFVQRLPGSIGYVEYAYAK
FT                   QNNLAYTKLISADGKVVAPTEANFSAAAKGADWSKSFAQDLTAQKGDNVWPITSTTFIL
FT                   IHKQQKNAANGIEVLKFFDWAYEQGGKQAKDLDYSVLPQDVIGQIRAAWKRDIKDSSGN
FT                   PLY"
FT   CDS_pept        181352..182308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0039"
FT                   /gene="pstC"
FT                   /locus_tag="XBJ1_0189"
FT                   /product="high-affinity phosphate transport protein (ABC
FT                   superfamily, membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0189"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79340"
FT                   /db_xref="GOA:D3UYG2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYG2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79340.1"
FT                   /translation="MAERKTALKAPSKNGDIIFSALVRLAALMTLFLLGGIIISLIIAA
FT                   WPSIKTFGFGFLWNKDWDAPAEQFGALVPIYGTLVTSLIALIIAVPVSFGIALFLTELA
FT                   PNWLKRPLGVAVELLAAIPSIVYGMWGLFVFAPLFATYFQQPVGDVLSSIPIVGELFSG
FT                   PAFGIGILTAGIILAIMIIPYIASVMRDVFEQTPVMMKESAYGIGCTTWEVIWRIVLPY
FT                   TKNGVIGGVMLGLGRALGETMAVTFIIGNTYQLDSLSLYMPGNSITSALANEFAEAESG
FT                   LHTAALMELGLILFVITFIVLALSKLMILRLAKNEGR"
FT   CDS_pept        182310..183218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0039"
FT                   /gene="pstA"
FT                   /locus_tag="XBJ1_0190"
FT                   /product="high-affinity phosphate transport protein (ABC
FT                   superfamily, membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0190"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79341"
FT                   /db_xref="GOA:D3UYG3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYG3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79341.1"
FT                   /translation="MTTGNNPQPRAVGAINTAEMNNRRRMQAWRRQKNRIALLLSMATM
FT                   VFGLFWLIWILFSTVTKGIDGMSLALFTEMTPPPNTEGGGLANAIVGSGLLIFWATVFG
FT                   TPLGIMAGIYLEEYGRRSWLAEVTRFINDILLSAPSIVVGLFVYSVIVTKMQHFSGWAG
FT                   VIALALLQIPIVIRTTENMLKLVPDNLREAAYALGTPKWKMISAITLKASISGIMTGVL
FT                   LAIARIAGETAPLLFTSLSNQFWSTDLSQPIANLPVTIFKFAMSPFSDWQQLAWAGVLL
FT                   ITLCVLLINIVARVLFKNKKH"
FT   CDS_pept        183264..184040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0039"
FT                   /gene="pstB"
FT                   /locus_tag="XBJ1_0191"
FT                   /product="high-affinity phosphate transport protein (ABC
FT                   superfamily, atp_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0191"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79342"
FT                   /db_xref="GOA:D3UYG4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYG4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79342.1"
FT                   /translation="MNKANDIAGSKIQVRDLNFYYGKFHALKNITLDIEQNKVTAFIGP
FT                   SGCGKSTLLRTFNKMYELYGEQRAEGEIILDDTNILTDKQDIALLRAKVGMVFQKPTPF
FT                   PMSIYDNIAFGVRLFEKLPRAEMDERVQWALTKAALWNETKDKLHQSGYSLSGGQQQRL
FT                   CIARGIAIRPEVLLLDEPCSALDPISTGRIEELISELKSEYTVVIVTHNMQQAARCSDH
FT                   TAFMYLGELIEFSDTDTLFTTPRKKQTEDYITGRYG"
FT   CDS_pept        184058..184774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0039"
FT                   /gene="phoU"
FT                   /locus_tag="XBJ1_0192"
FT                   /product="transcriptional repressor for high-affinity
FT                   phosphate uptake"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0192"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79343"
FT                   /db_xref="GOA:D3UYG5"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYG5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79343.1"
FT                   /translation="MDNLNHSKHISGQFNAELEHIRTELMTMGGLVEEQLSKAILAMHN
FT                   QDGELARQVIEDDQKVNMMEVTIDEACVRIIAKRQPTASDLRLIMVISKTIAELERIGD
FT                   VANKICQTALEKFSHQQQPLLVSLESLGRHAIQMLHDVLDAFARMDLEEAIRIYHEDKK
FT                   VDQEYEGIVRQLMTYMMEDPRTIPSVMTALFCARSIERIGDRCQNICEFIFYYVKGQDF
FT                   RHVGGDQLEKLLTKDQ"
FT   regulatory      184783..184831
FT                   /regulatory_class="terminator"
FT   regulatory      184807..184866
FT                   /regulatory_class="promoter"
FT   operon          184932..187345
FT                   /operon="XBJ1_operon0040"
FT   CDS_pept        184932..185780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0040"
FT                   /locus_tag="XBJ1_0193"
FT                   /product="putative amino acid-binding protein (ABC
FT                   superfamily, peri_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0193"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79344"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYG6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79344.1"
FT                   /translation="MKFRNQSRVATVALLTSLALVSGVAKADKLDDIKKTGTVRIAVFD
FT                   SNPPFGFIDPQTKKLAGYDVDIANAVASDLGVKLELRPTNPANRIPLLSSKKIDLIAAN
FT                   FTITDERAKQVNFSIPYFATGQKFIARKGVLKTPDDIAKLRIGADKGTVQEITLRERYP
FT                   TAKVISYDDTPLAFAALRNGNVQAITQDDAKLVGLLANVPEAQKADFEISPFSITREYQ
FT                   AVAATKGEDRLINAVNQTLLKLEKDGDAEKIYNRWFGAETKSAQPRGDFKFAPLDSQAK
FT                   P"
FT   regulatory      185811..185841
FT                   /operon="XBJ1_operon0040"
FT                   /regulatory_class="terminator"
FT   CDS_pept        185857..186594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0040"
FT                   /locus_tag="XBJ1_0194"
FT                   /product="putative glutamate/aspartate transport protein
FT                   (ABC superfamily, membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0194"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79345"
FT                   /db_xref="GOA:D3UYG7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYG7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79345.1"
FT                   /translation="MFEQFITEHLLAPEYLRWLWQGFLITLWLSVCTIISSTLLGFMIT
FT                   AARDSQIKPLRWLVTAYTTVFRNTPLLVQLFFWYFASGQILPQAAMIWLNTSHEIPIAG
FT                   LTLAWPSFEFLAGFIGLTLYSAPFVAEELRAGIQGIGRGQKYAAHALGLTDWQAMRYVV
FT                   LPQALKIAMPPLLGQYMNIVKNSSLTMAIGVAELSYASRQVETQSLQTFEAFGVATVLY
FT                   IAVIAIMEGWGQWRQQRILVRGY"
FT   CDS_pept        186596..187345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0040"
FT                   /locus_tag="XBJ1_0195"
FT                   /product="putative high-affinity glutamine transport
FT                   protein (ABC superfamily, membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0195"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79346"
FT                   /db_xref="GOA:D3UYG8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYG8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79346.1"
FT                   /translation="MDFTVITENWRYLLLGTFPDGPLEGAALTLVISIMAGVISIVLGT
FT                   VAGVALAMLRGFWVNLLAAILGFFRAIPVIMLIFWTYFLLPVVLGMEIPEITTVVCALA
FT                   LITSAYLAHGVKAGILAIGEGQWRAGLSLGFNRWEVLWYIVLPQALRMMVPSFINQWIA
FT                   LIKDTSLAYIVGVAELSFLATQVNNRSMVYPMEVFLFVALVYFVMCLSLELIANSVARR
FT                   FSMQRQRTTLFGFWRKKTLIMIPKINI"
FT   regulatory      187376..187412
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(187428..187586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0196"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0196"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79347"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYG9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79347.1"
FT                   /translation="MLLFHLDILEEIIKYLLMKNSYQPIRKNYCFLKFWINLLLQIKHF
FT                   LTYFITQ"
FT   regulatory      187529..187588
FT                   /regulatory_class="promoter"
FT   CDS_pept        187656..191441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0197"
FT                   /product="putative invasin"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 9529069; Product type pf : putative
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0197"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79348"
FT                   /db_xref="GOA:D3UYH0"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR003535"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR024519"
FT                   /db_xref="InterPro:IPR038177"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYH0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79348.1"
FT                   /translation="MFSYFSKIIRFVIVLYVLILPSTMMNAFADGNVLIEKTDNHHVSN
FT                   KTSDIDFSVNDSSKKFLNSTTNKKDTIQKNEDISEPDTPNSIARHLQTAGNMLSSSPSQ
FT                   LAEQAKSYALGKLNSTVNNEAQKWLSQFGTARINFALDKKGKLENSAFDILFPLYDNKA
FT                   DWLLFSQVGYRNKDSRNTLNFGLGGRYFQNNWMYGLNTFFDHDFTGKNRRLGLGGEIWG
FT                   DYLKLSANAYYRLSDWQHSRDHKDYYERPANGYDINGEFFLPAYPNLGAKLTYEQYFGD
FT                   NVTLFNRDTKQKNPSLAKLGLTYTPIPLVTIGVDYKQGGSGHTETQFLANFNYRLGVPL
FT                   SVQLSSDNVASMRTLAGSRYDLVERNYNIVLDHQKKQNLQLSLPGEIVGYSHEQKTVTA
FT                   KFHDSSIKKVEWISNGTFTDNKGQLSDNKDHTATITFPKYSPDGNNNYPILAIGMLENN
FT                   QKLPPVQMHVIVRPFVVKKAEEGTSYITPAGPLPASGKDKDAYTITPVITFDTPVGAPV
FT                   KNATIDDVKWITEPPADGKSGLKLSWEKQETTKTDENGKLQAVTLTSTKPQQNVKVYLQ
FT                   MGDADKEKQLVGTVSFGEDTARFHVNSIQVEPKETLTADGIQAYTYTALVLDGNNQPVK
FT                   RQKIDKVHWDHDKEDKTGLKWKSRGDTTDEEGKLTAELISSDPVKDVMVTLSIEGNTDK
FT                   SAKADKSVSFDAANVNLGLSKVSPILVRDTYTLKVTAKDASDNPETNKKVTWPQSQSLP
FT                   QGVILTPASSITDGNGEATATLTSTEEQTVDVTVSVEGVGEKKTSVEFKWPTITFQPAS
FT                   PKNGVVADGKKGYQFIAKVVGADGQTPYTDKVFQFKWHLQLSQDAVQGKTYLLHEVTDN
FT                   QNKTWTAQLASTQTQPKPVEGAKVCLAIEGGPSTSMACSEPVSFVPLPANVEIKSIEVN
FT                   FDPQKPLKGNWSDSYLYKALVFDKNTKEKLANYKFKPSEIHWSRDPDSGKVDDQSLALF
FT                   DQDLETDPDGYLTVKLKSYVGIKGVKVKLMISTLYGNEPGAAETAVDFEVAPQLAGLYL
FT                   FKKSDPTNVNKFFPEQERPYNAIGGDMRGELRTLDNKPLDNPEYTWEPKSTDTILPGEN
FT                   KGTFMINNFGKVTINAQVKTSYGNNLFYERWYVYKINMLRLFNRAGQRDSLYDLFDEKI
FT                   RCENIASSKAYTPNLKNIKGSGKGEALSEEFPNAYSWGLFDGLDFPNTREKEYFARFRV
FT                   DKGESPSNGYELYNAAYDKMMDSSITSAFLICVTGH"
FT   regulatory      191595..191651
FT                   /regulatory_class="terminator"
FT   regulatory      191695..191754
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(191706..191846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0198"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79349"
FT                   /db_xref="GOA:D3UYH1"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYH1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79349.1"
FT                   /translation="MQYFIEFYSNFIKKYFYSLYGFIYNEIFIHILLILSKFNTQYAIL
FT                   N"
FT   operon          191924..195226
FT                   /operon="XBJ1_operon0041"
FT   CDS_pept        191924..193504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0041"
FT                   /locus_tag="XBJ1_0199"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0199"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79350"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYH2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79350.1"
FT                   /translation="MASNITTSPASKSKIIVGQLLTANITFESDIAMSTNISFELTNPV
FT                   NLTISNTDFSVLDNSKSFTVTTKFHISENINEGDTVSFLIKPNDHAIALGFKKQTISYF
FT                   PHDVDRHSLNIHFDQTVVDALTTDKPNIPPNGQSYSLATALVTDRKGKPLAGETITIIG
FT                   GFAANLDKVRIFSSNKNVQSEIKKNSLYGQSSIDINTDKYGKLEFYVYPSDKSQFVFDL
FT                   QARITDATQFVYSEDRLYILNDDQGDPFNADQQTLAPPDILERQGDKLTESDGSSTFTA
FT                   LIDNYEGESENDSILFFVDGKYAHQQFLTSKKKYNHGYTFQLPYSILPLNKYAGFSYII
FT                   VTVDGNLKFSAGMDIMYNGGSKNQPLDNVPRVYDMCTVYSSFGYSNASDLVLYNDMVNC
FT                   FTISRHLKTKLKAGLYVAITGTNDPTDKTKVPFGTEVTLTLYIDSYKKKTNQIFKIKMP
FT                   TQPDEGSKNIATYIIPIPYKYVNDVVTFPNGAAGSIYFDYQINESGKISYGNIWMASID
FT                   TTLCIDPDD"
FT   regulatory      193560..193619
FT                   /operon="XBJ1_operon0041"
FT                   /regulatory_class="promoter"
FT   CDS_pept        193649..195226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0041"
FT                   /locus_tag="XBJ1_0200"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0200"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79351"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYH3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79351.1"
FT                   /translation="MSNTINVSVDDKSNIVIGQVLILNVVFKSDSNIPINSKFELKNLM
FT                   NATASNICFSIKNSDNYHSVTTELHIDKNLRTGDIVSFDIVPNAHAVGFSTKTINYTAH
FT                   EVDLDSLGIYFEEDVIPALMTDEVNIPPNGKLYTRAIAMVKNINGYPLSEVPITIIGGY
FT                   LPNLDKVKIFLSNQDPNTEVSKQSLYGEQSIVLNTDKSGKLEFYIYLSDKSQFVLDFKA
FT                   RVSGKTGFVFSRNKLYIIDDDPGAPSNIAKQTLNSPNIIDYSGELRGNDSSSTFLVSID
FT                   SYNNAKEDDTILFYVDGKYSQQKIVVNDIKNLHNYFIHLPYTIFPLNKFVTFSYVVVSI
FT                   NGNIQSSAGSYVKYVGGGKNQPLDDLTRVYDMCTVYSSFGPFIPSNLVFKDDIVHYFTI
FT                   SRYMNNKEHDGLFVVITGTNDPTDKTKVPFGSEVTLSFRIDSYKKQVYKTFTKTMPTQP
FT                   DQGSKNTATLIFGISYEDVSHVESDSNSVAGRIYFDYQINELGKITYGKIWKARIDTVP
FT                   PSPDGDTD"
FT   regulatory      195530..195589
FT                   /regulatory_class="promoter"
FT   CDS_pept        195614..196309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0201"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0201"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79352"
FT                   /db_xref="GOA:D3UYH4"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYH4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79352.1"
FT                   /translation="MRIFMSIKEFIYNVRLNSLLIELMNLDHRLKINDSSLKEEIGYKQ
FT                   FKYHFNPVTSKVYFLLGIIGFSLVLSSSMLLAVLISYVIDSGVNKLAIITCMLLVFSIL
FT                   SLIFFGFLSLGKGNKEGIYIHRILYQSTLVISVLLLLFDSSPFLHFFYYALVMVFSLLI
FT                   KFIMNSYFYFNAVRDMKLFRITHIFLTKDTQEILNMTRKESKKRIKEVEFQRRREIKEK
FT                   KRVKEAAGK"
FT   CDS_pept        196443..196598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0202"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79353"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYH5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79353.1"
FT                   /translation="MRNHLRDSLIATGGFVGRGMTGTIRNSENILTSGNYMIGSIVSVA
FT                   YENPVS"
FT   regulatory      196565..196624
FT                   /regulatory_class="promoter"
FT   operon          196653..197535
FT                   /operon="XBJ1_operon0042"
FT   CDS_pept        196653..197303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0042"
FT                   /locus_tag="XBJ1_0203"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0203"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79354"
FT                   /db_xref="GOA:D3UYH6"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYH6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79354.1"
FT                   /translation="MNMKDFILNTEFKKLLGKAKDLEAKIKNADPVLKNITLNDLSYNK
FT                   YFSYPGRFKIGFIIFFIMIVYMAFFSGVAVAIPSLLMENPSYEIKAFSFILSLIISAFI
FT                   SFSHIGLTLSGYYYGPVVQKYTNTVVFFFSLFISYLKGVYDSDFFYFSAIALCCLFIKL
FT                   MLNSKYYSGFILAKMFIRVERVIFNDELDKIKGFNKKQLREYSRSIKSKNRKK"
FT   CDS_pept        197347..197535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0042"
FT                   /locus_tag="XBJ1_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0204"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79355"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYH7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79355.1"
FT                   /translation="MDIKHILTNNQFRSILTLYKITDNRIRNSDSLLVDEPDIVRIKDK
FT                   ITSANESAQKSLCYLTH"
FT   regulatory      197554..197613
FT                   /regulatory_class="promoter"
FT   CDS_pept        197643..198980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yieG"
FT                   /locus_tag="XBJ1_0205"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0205"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79356"
FT                   /db_xref="GOA:D3UYH8"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYH8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79356.1"
FT                   /translation="MSTLNSGPANQQGLLQRVFKLEEHGTTVRTEMIAGFTTFLTMVYI
FT                   VFVNPQILAVAGMDIKAVFVTTCLIAAFGSIMMGLMANLPVAVAPAMGLNAFFAFVVVG
FT                   AMGISWQVAMGAIFWGAVGLLILTIFRVRYWMIANIPLSLRIGITSGIGLFIAMMGLKN
FT                   AGIIVPNPDTIVSIGNFASHNVLLGTLGFFIIAILAARNFHAAVLVSIVVTTVIGLMMG
FT                   YVEYHGIFDLPPSVMSVVGNVDVKGALDIALSGVIFSFMLVNLFDSSGTLIGVTDKAGI
FT                   ADSSGKFPRMKQALYVDSISSVAGSYVGTSSVTAYIESSSGVSVGGRTGLTAIVVGMLF
FT                   LLVMFASPLASMVPAYATAGALVYVGVLMTSSLTRVKWNDLTESVPAFITAVMMPFSFS
FT                   ITEGIALGFIAYCAMKLGTGKWREISPCVIVVTLLFVLKMAFVDAH"
FT   regulatory      198988..199055
FT                   /regulatory_class="terminator"
FT   regulatory      complement(198991..199023)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(199038..200507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0206"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0206"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79357"
FT                   /db_xref="GOA:D3UYH9"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYH9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79357.1"
FT                   /translation="MRFFDTSSYRMPLFLWITGYALLWVVASYTLDPTVPYDAVEALNW
FT                   GINGEWGSPKNPWLVGSVMLPAIHISTISLSFYWYLTHFLAIAIGMLGVWRLAFRLTGK
FT                   VELAWLAMLTLNLSGIINFDIIPYNDNYLLVMLWPWALLFFLRAIDDHPKWWLAFALTT
FT                   GLATMGKYSSLSIIGSVFLLSLFVPRVRRSYREPLFYLAIALWFMLILPNVWWLVHNDF
FT                   AAFKWVDSQIQQGFNLHTTRAVLSVFYPLLIVGAFIYLSGGRIGWPKQQSNALANIVIL
FT                   LPLLLIYGWFSFNQGGRMTEWLQPFMTVAPALLVGSLTVLPRKPLKNTLRGLAVFAVLV
FT                   WIGYVGVMITNVRGAGQKFVGIKTFANQLDQRWNELYPTPLRYVGGEYLHQWLTFYSHY
FT                   RPETIQPWELGNGEPPNVYNRHIKESSIVKEGALLVGEKGKSCEQENFQSTLKQWPVLV
FT                   ISYKEEFSFRPQPSAKTETVCIGFVTPENNQ"
FT   regulatory      200498..200557
FT                   /regulatory_class="promoter"
FT   regulatory      complement(200542..200601)
FT                   /regulatory_class="promoter"
FT   CDS_pept        200655..201173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0207"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0207"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79358"
FT                   /db_xref="GOA:D3UYI0"
FT                   /db_xref="InterPro:IPR007336"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYI0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79358.1"
FT                   /translation="MNQLKKKSPAKFSAGKQKRKSREELNAEGRERKRQKKHSGHPSGN
FT                   RNHGNDSNKNRSGDKQGQDPRIGSKVPVPLIIGEKVVVKPVVEKPKASQKPRLSPQEEL
FT                   AMLEQDEYLDELLARLEKGEELSQEENAYVDEKLDRIDELMEELGINLEEDDSEEEKKE
FT                   DIMQLLKGK"
FT   regulatory      201224..201283
FT                   /regulatory_class="promoter"
FT   regulatory      201234..201274
FT                   /regulatory_class="terminator"
FT   CDS_pept        201388..202761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemN"
FT                   /locus_tag="XBJ1_0208"
FT                   /product="coproporphyrinogen III oxidase, O2-independent,
FT                   SAM and NAD(P)H dependent"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0208"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79359"
FT                   /db_xref="GOA:D3UYI1"
FT                   /db_xref="InterPro:IPR004558"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYI1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79359.1"
FT                   /translation="MSEPVIVWDLPLVQKYNYSGPRYTSYPTALEFNQQYDNTAFAQAA
FT                   ARYPDRPLSLYIHIPFCHKLCYFCGCNKLVTRQKHKADDYLNILEKEITARARLFSQRK
FT                   VSQMHWGGGTPTYLDKTQISRLMSVLRSHFDFLPESELSIEIDPREIELDVIDHLRHEG
FT                   FNRLSMGVQDFNKEVQHLVNREQDEDFIFELVNRARETGFISTSIDLIYGLPKQTSESF
FT                   AFTLQRVLALSPDRLSVFNYAHLPDLFAAQRKIKEHDLPSAEQKLDILQGTIATLTGNG
FT                   YQFIGMDHFARPDDELAIAQREGVLHRNFQGYTTQGECDLLGMGVSAISMLGDSYSQNQ
FT                   KDLKIYYAAVEEQGHALWRGLVLTQDDCIRRDVIKDLICNFRLTFADIEQRYGLNFANY
FT                   FAEDLQLLAPLVEDGLVDITEKQIQVLPKGRLLIRNVCMCFDSYLRNQMRQRQFSRVI"
FT   operon          complement(202778..205279)
FT                   /operon="XBJ1_operon0043"
FT   CDS_pept        complement(202778..204208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0043"
FT                   /gene="glnG"
FT                   /locus_tag="XBJ1_0209"
FT                   /product="response regulator in two-component regulatory
FT                   system with GlnL, nitrogen regulation (EBP family)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0209"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79360"
FT                   /db_xref="GOA:D3UYI2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYI2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79360.1"
FT                   /translation="MQRGKVWIVDDDSSIRWVLERALSGAGLECVSFENADSVLTALSQ
FT                   NCPEVLLSDIRMPGLDGLNLLNQIKQSHPQLPVIIMTAHSDLDAAVSAYQQGAFDYLPK
FT                   PFDIDETVTLVERALSHYREQHQSSRNPQVAASVSEIIGEAPSMQEVYRIIGRLSRSSI
FT                   SVLINGESGTGKELVAHALHRHSPRASSPFIALNMAAIPKDLIESELFGHEKGAFTGAN
FT                   QVRHGRFEQANGGSLFLDEIGDMPLDIQTRLLRVLAEGQFYRVGGYAPVKVDVRIIAAT
FT                   HQNLEQRVTEGKFREDLYHRLNVIRVQLPPLRDRVEDISRLAHHFLQQTAKELGVEAKV
FT                   LHPDTEIALMRLSWSGNVRQLENVCRWLTVMAASKEVLVQDLPADLIENPPTEQIGNLP
FT                   SSCSALPEHWPRQLAEWAQNALKEGRTDLLSDALPLLERTLLNCALEYTNGHKQEAARL
FT                   LGWGRNTITRKLKELGIA"
FT   CDS_pept        complement(204233..205279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0043"
FT                   /gene="glnL"
FT                   /locus_tag="XBJ1_0210"
FT                   /product="sensory kinase (soluble) in two-component
FT                   regulatory system with GlnG, nitrogen regulation (nitrogen
FT                   regulator II, NRII)"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0210"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79361"
FT                   /db_xref="GOA:D3UYI3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYI3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79361.1"
FT                   /translation="MMVDFPKAEHILDSLINSVLVLDNDLIIRYANHSAMQLLAQSTRK
FT                   LFGTPLPVLFSYLSLDTELMRSSLIRGHGFTDNEVILVINNHSHVMSLSAQPISEQFIL
FT                   LELAPMDSQRRLSQEQIQQAQQAAARELVRGLAHEIKNPLGGLRGAAQLLAKALPDPSL
FT                   REYTQVIIEQADRLRALVDRLLGPQHPGTRISQSIHYVVERVYQLVSLEMPANVTLIKD
FT                   YDPSLPELAHYPDQIEQVLLNMTRNALQALGEKGGTIILRTRTAFQITLHGERYRLVAR
FT                   IDIEDNGPGIPPNIQDTLFYPMVSGHEGGTGLGLSIARNLIDQHAGKIEFTSWPGHTEF
FT                   SIYLPIKK"
FT   regulatory      complement(205300..205359)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(205391..205422)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(205469..206878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="XBJ1_0211"
FT                   /product="glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0211"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79362"
FT                   /db_xref="GOA:D3UYI4"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYI4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79362.1"
FT                   /translation="MSVEHVLSMIEEHQVKFIDLRFTDTKGKEQHITIPSHQIDEDFFE
FT                   DGKMFDGSSIGGWKGINESDMVLMPDPTTAMRDPFFDDATLILRCDILEPGTMQGYSRD
FT                   PRSIAKRAEDFLRASDIADTVLFGPEPEFFLFDDIRFGNSISGSYYHIDDIEAAWNSGT
FT                   RYEGGNKGHRPGIKGGYFPVPPVDSSQDLRSAMCLTMEKMGLVVEAHHHEVATAGQNEI
FT                   ATRFNTMTKKADETQIYKYVVHNVAHSFGKTATFMPKPLVGDNGSGMHCHMSLSKNGTN
FT                   LFAGDKYGGLSELALYYIGGVIKHARALNAFTNPTTNSYKRLVPGFEAPVMLAYSARNR
FT                   SASIRIPVVASAKARRIEVRFPDPAANPYLSFSALLMAGLDGIINKIHPGDAMDKNLYD
FT                   LPAEEAQEIPTVASSLDDALAALDADREFLTRGGVFTDDAIDAYIKLLHGEIERVRMTP
FT                   HPLEFELYYSV"
FT   CDS_pept        complement(207390..210344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0212"
FT                   /product="putative Outer membrane autotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0212"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79363"
FT                   /db_xref="GOA:D3UYI5"
FT                   /db_xref="InterPro:IPR004899"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR013425"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYI5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79363.1"
FT                   /translation="MKIYRYAVLPMALKVALFFSGISGNAIAASTCGPTISQNRTTPCY
FT                   LSNNENLTIDKGVSIIVPTEGFMASQYDKYSGKTSAVNVGNEDIKDPLITVHNIENNGI
FT                   LKGTNGLVVTPSGLVEKLVNRGTISTISGGPALSGVTVAGTLKTLENYGSIIDPAGAGG
FT                   SIFIIPELVIKNPHYGKIDTIQNQKGGSIQGIIMNGGTLTNLNNYGILSQSSSSNFLPP
FT                   GALTAAYGADVGIFNNYGTVAVSNKGIIVSQGSTLKGLNNQVGSKGIIAGVNAIEVTGQ
FT                   GPASDSKKIQPSRIKKITNASTIYGNTKGIYVDDKGVIETITNTDTGVIKGIIFSIHNK
FT                   GTITNGIDNAGTIDGNVELGSARLYLSGPKAILKGDVSGTKDSIVTIGNMNRTDKAKNL
FT                   DFTYTHNMNVGTVKISSGNKLRLGDGHTTGKISGNIVNDGEFYFNRSDKVIYGHNISGA
FT                   GSVHQVGSGTTIFQRANNYAGATTVQQGTLLQGAEKSFSPLSSYTIGQRGTLDMGGFNT
FT                   TIPALNNSGRVVMGGDSNAVGSMLTITGDYRSNNGTVSLSTVLGDDSSKTDRLVVNGKT
FT                   SGTTHLVIKNVGGKGAKTNEGIKVVDMKGAAGGNFSLAGDYSHKGNPTLVTGAHAYRLY
FT                   KNSADNSLYLRSSSDNSKPTYQAGVSVYESYGRMLQIMNAPESLRDRTGGRKDRVLGTG
FT                   EFRSSAAEDSTDDSTSQMPTGVWGRITASYGKLSPRVSTSDANATTYNMVRAQIGMDKR
FT                   FYENNQGSVTGGGFLQYSKIDADVGSPHGDGNIRANGYTFGATSTWYGKNKFYVDGLAQ
FT                   MTYFDNDLHSKTAGRALGNSKSALGYALGLEAGQEIGLNQKWSMTPQAQLVYSSINMNG
FT                   FHDPFGAKIRFDRSQSLKLRVGTTIDYRQKATRLYGFFNINQEVLGRNDSAKVADVAFI
FT                   SGNDRTWGDGGAGGSYSWDNGKSFVYAQASASTSLNNFADSYDLKGQVGLRTTW"
FT   regulatory      complement(210492..210551)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(210857..210901)
FT                   /regulatory_class="terminator"
FT   operon          complement(211001..214376)
FT                   /operon="XBJ1_operon0044"
FT   CDS_pept        complement(211001..212764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0044"
FT                   /locus_tag="XBJ1_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0213"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79364"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYI6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79364.1"
FT                   /translation="MSNKLPAPILPQINNDTLDLKKIEGDIIIKIDNSAQVFFDRDSIM
FT                   ACFNTICGESYTVRNYTESYFEIKIPKNKISPGQYLVHYTVINNDDNISYSPITHIKVI
FT                   DGTPTTPPSDKEPFIVMGARYADLAVANGLKTPQRLTAWTKEGKPHPVTWTYIGGTPSF
FT                   TSPFSHINSPFFYDSAPWLPISVQDEQGNKLKINPINVFGNGGTLGLPKADFNDPLEEQ
FT                   YPSAFAVLLNDNTMVGWGGTFGNSYTQSGVKTITTNGPSYAGLNVDSGTLWYHGDSNHS
FT                   NFPTGSFDDVGAGGNSFFAISHTNQQMEAWGAMTGIFNYPGDGKNVFVGNSFAITIYNP
FT                   GTEQIQSLWGSSMENWQLDPDPRYSSVSKPRYITSMARGFAVIDESGDLSTWGDSSVFV
FT                   GFNPSHQDFIQAASITPFLMNFNVPFGNYAVHRDGTLYAWSVPASSSDGDSCSNGVDIA
FT                   TTKQKFLMPGGTPPHGKIYWDGIQNYNDGPVFEEFMALKDVVQITCSANASAALRQDGT
FT                   VLTWQNAEPSNVNFIPQPEIKNVRAIYSTGTAFLALTADNKVHTWGGSDGGGDSNEVQA
FT                   LLQGKLTYYMD"
FT   CDS_pept        complement(212817..214376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0044"
FT                   /locus_tag="XBJ1_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0214"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79365"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYI7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79365.1"
FT                   /translation="MSSPVSLSVPYGSSVIIGQRLNLNVTLTSDVKISDNTYIQIINAD
FT                   NKVTLLDSSRSDEDSGLFTLFLEISPDINDGDSINFGLYISSNVSFPNTTVMYTGRTLK
FT                   NDSLTLSYDKNALEVPTQPNYPPSGNEGKSRTRVMATVRDEQGNPIPKVFVFISSLNPK
FT                   DIEKVNLYQSDNKTKIGIEKNINDEGIFLSTDWHGNLVFYIYAKELQPISLEFYTRIFG
FT                   ITNEIPADSALNIVNDKPENPNDYLAAPGIEGYDNGGELTNHGQTNFLIDIPPYPGAQK
FT                   GDMIKIRINNVSTIYEYPLLQLSELGNYSSFSMPYFAFTVGAVSTFSYVVFRQGRDTLY
FT                   SRSLTLTYTGESWPKPVYYDKCVVYSSFGVNDPNNIIEEADPKDCEHATSHNTVNCKAI
FT                   SKSHDLDDPALFVQITGTNDITDKTKPPLGSMVDLTLHIKSNPRTVIKTYSKQIPSVAG
FT                   PDGQTTTTTINIARKFVRDCHEFKDCTAGRIEFSYQVRSENTHSQTWIGRIDTASTGED
FT                   DC"
FT   regulatory      complement(214403..214462)
FT                   /regulatory_class="promoter"
FT   operon          complement(214478..217747)
FT                   /operon="XBJ1_operon0045"
FT   CDS_pept        complement(214478..215995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0045"
FT                   /locus_tag="XBJ1_0215"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0215"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79366"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYI8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79366.1"
FT                   /translation="MIKVSVSVKPNSDVIISQEFIAEIKLTSNIPIDNSISISLENTSY
FT                   ISPVGKISSFTPSYNNTSGSFFVRLLVSDKITSGELVSFDIKSSYFGTKHVEYVAKHIQ
FT                   QETLSLKFYKKYLPTPDQPNFPSQGEICSKVMTTIKSSDGQPLSGTPIFIPYLYNFKDF
FT                   DIYDSEKNKIEVTSAPMKGFFINSNEKGEVIFYVYPHIGVATKITLDSMIYNATSSIHS
FT                   MNELYVASSQPQGNDSLLDPPDIENIHGENLTSPNSFIFKTKVDQYDNAKSQDTILFFV
FT                   NNIFTGYAFTIESIDDLGGYSIKLPYKIFEKYKDVACSFYYIIFSVNENVYYSYPLSIV
FT                   FKGGVPNTPQPDINRIYNTCVVYNSAGISPDNILQEMDYVDSTEISNYRNNPDNAGLFV
FT                   QIMGTNDLKDNSNVPLGSEVFLNLYINSSTKTVHHSLKKTMQNLPDGNNNSAKLIFNIP
FT                   HSCLIDCLAYPDRGGDIYFDYQIGFDNDDDLTYGKVWQGRIDTPIID"
FT   CDS_pept        complement(216034..216234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0045"
FT                   /locus_tag="XBJ1_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0216"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79367"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYI9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79367.1"
FT                   /translation="MIHLTQETLELNIMGKFGKEKLTQKDLKLKITKNKTIITTIKIEE
FT                   EKTIEYKPKFIFKSILFKKEE"
FT   CDS_pept        complement(216152..217747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0045"
FT                   /locus_tag="XBJ1_0217"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0217"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79368"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYJ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79368.1"
FT                   /translation="MENTIISSIPTKSNIAKVQLLKMTITFLKTPEGNFSPNASFDIIK
FT                   SVNLKPVHPSYTIQTGGSIEIAFTLEKELADRSTVSFDIVPHNASGFLTTSFSYTVVEI
FT                   DNNSLSLTFGNEYLNAITKVENVSSNIPPTGKIYSKVFATIKAKNGGQSVSGIPITIMS
FT                   DHNTSLDNVRTFRENKSQSSEITKKTLYNRPVFYLETEQDGMVVFYVYPDNNTEFILNL
FT                   QARVTDTQSFQLSKNSLFVIDDDPTNPGNLSNINTDFLAPPSILEVSDGALIGDPDSTT
FT                   FSVEVDPYNHPNRNDTILFYVNGSYSNQKIIVENKNNLGNYFIDLPYSIIPKNENIELS
FT                   YIVVTHDAKIKKSASLGFTYSGGGKSAPLDDINRIYDPCVVYSSFGASQGTALIHQGDL
FT                   INYFSISHDSNKKKSTALFIEIEGTNDITDKTKVPLGYNVVVTLYIDSYNKQFQHSFKV
FT                   ITMPATPVPHSSHTATHIFEIPIDYLNNIESYPNSSAGNIYFDYYAYDPSDPGNSGTKY
FT                   YGKIWQGKIDTERP"
FT   regulatory      complement(217773..217832)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(217849..217893)
FT                   /regulatory_class="terminator"
FT   regulatory      218057..218116
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(218082..218204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0218"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79369"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYJ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79369.1"
FT                   /translation="MDAFFGLAINQIVQFGLSSLQVIYYLEQLFREFYNELIFN"
FT   CDS_pept        218348..218566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0219"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0219"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79370"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYJ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79370.1"
FT                   /translation="MSRARVQSFFWRSLDTLYGLEGLKPLSSGRPRRWPFELICSLLRH
FT                   LISDSPDVLGYQRSRGVIDIINYKSMR"
FT   CDS_pept        complement(218598..218675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0220"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79371"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYJ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79371.1"
FT                   /translation="MMKDNYQLITKSYFMGMVIYLKSYF"
FT   regulatory      218720..218779
FT                   /regulatory_class="promoter"
FT   operon          218863..221022
FT                   /operon="XBJ1_operon0046"
FT   CDS_pept        218863..219912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0046"
FT                   /locus_tag="XBJ1_0221"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0221"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79372"
FT                   /db_xref="GOA:D3UWQ9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWQ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79372.1"
FT                   /translation="MIAPMKINLTDAQKDALELMHDTTRDGRVRDRIKAVLLASEGWTA
FT                   QMIAQALRIHESTVSRHLKDYFSEEKLAPENGGSESRLSAEQTTELVEYLMANLMHTTA
FT                   QIVAYVRARWQVTFTVAGMTKWLHRQGFSYKKPMGAPHKFDADKQQQFIETYNALKEEC
FT                   GQNAPILFIDAVHPTLSTKLSYGWMKSGRKHVKVVETTGSRTRLNIMGALNLQRIEETI
FT                   VREYPTINAKNVVLFFGSIRETYPLSQKIHIILDGAGYHRSGVVQFFAEVLNIELHYLP
FT                   PYSPNLNPIERLWKYVNEQVRNNVYFPDTKTFRETLRHFFHVTLPEKAKELTTRLTDNF
FT                   QILKPASSS"
FT   CDS_pept        219913..221022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0046"
FT                   /locus_tag="XBJ1_0222"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0222"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79373"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYJ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79373.1"
FT                   /translation="MRIDSINFKPLPIDFEIESIEVTNFTSQHSLPGDGNSAYEYRAKI
FT                   INKTNGKKISNYSFDPKQVNWSREPKRSPKLVDEKDLVLFDPEFTTNSEGYLTIKLKSL
FT                   VGIKNIEVNLNITSPHGDVSKNAKLVDFEVSPQPAGLFMYREGKKDTINLFTKEQERPY
FT                   NAVGTLHNGELRTKDNKLLSNSENGKLVKVHDYEYDDPDGILSYNNKHDPNFAFENVGK
FT                   ATVKALVQTLNRDNEVVYERLYAYNFNILRLFTAIDQMNDPYVPGISNISCESDNKMGG
FT                   KTPKLSDVIGPKTLSDEFRNAFSWGLFHRVQLPHDIDKKDFAKFAIIDENAPPNNPYAP
FT                   YSIYDAVHGNIIDPTNSNVLLICLWKQGG"
FT   CDS_pept        complement(221233..221403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0223"
FT                   /product="transposase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0223"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79374"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYJ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79374.1"
FT                   /translation="MRPGFLNYAPSLHDLEEIMAERSIVIDHSTLYRWVIRLISLLNKA
FT                   LRQHKRTVERR"
FT   regulatory      222039..222098
FT                   /regulatory_class="promoter"
FT   CDS_pept        222183..224006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="XBJ1_0224"
FT                   /product="GTP-binding elongation factor family protein with
FT                   P-loop containing NTP hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0224"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79375"
FT                   /db_xref="GOA:D3UYJ7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYJ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79375.1"
FT                   /translation="MSINNLRNIAIIAHVDHGKTTLVDKLLQQSGTFGERAATTERVMD
FT                   SNDLEKERGITILAKNTAIKWNDYRINIVDTPGHADFGGEVERVMSMVDSVLLLVDAMD
FT                   GPMPQTRFVTQKAFAHGLKPIVVINKVDRPGARPDWVVDQVFDLFVNLGATDEQLDFPI
FT                   VYASALMGIAGNEHTDMAEDMTPLYQAIVDHVEPPKVDLDGPFQMQISQLDYNNYVGVI
FT                   GIGSIKRGTVKPNQTITIIDSEGKTRNGKVGKVFSHLGLDRIESAQAEAGDIIAITGLG
FT                   ELSISDTLCDTSAVEALPALAVDEPTVSMYFCVNTSPFCGREGKYVTSRQILDRLRKEL
FT                   VHNVALRVEETEDPDAFRVAGRGELHLSVLIENMRREGFEMGVSRPKVIYREIDGRKQE
FT                   PFEQVTLDIEEQHQGDVMQALGERKGEMRDMLPDGKGRVRLDYSIPSRGLIGFRTEFMT
FT                   MTSGTGLLYATFSHYDDIRPGEIGRRQNGVMISNGQGKAVAYALYSLQDRGKLFLGHGT
FT                   EVYEGQIIGIHSRSNDLTVNCLTGKKLTNVRASGTDEATTLSPYLKKTLEQALEFIDDD
FT                   ELVEVTPQSIRLRKRHLTENDRRRANRGKEM"
FT   regulatory      224039..224095
FT                   /regulatory_class="terminator"
FT   regulatory      224143..224202
FT                   /regulatory_class="promoter"
FT   operon          224222..225400
FT                   /operon="XBJ1_operon0047"
FT   CDS_pept        224222..224881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0047"
FT                   /gene="yihX"
FT                   /locus_tag="XBJ1_0225"
FT                   /product="putative enzyme with a phosphatase-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0225"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79376"
FT                   /db_xref="GOA:D3UYJ8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYJ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79376.1"
FT                   /translation="MIKVQNDNRQSGGIMLYIFDMGNVIIDIDFKRVLAVWSNLSGTPL
FT                   ATLTTRFSMGEAFEQHECGQITDTAFAEALCDEMEVSLSFEQFTEGWHALFIDVRQDVI
FT                   ELMNKLREQGHRVVVLSNTNRLHFDYWPHHYPEIAASTDFLYLSQDLGMRKPNSDIFKY
FT                   VLGAEGVTAVQAVFFDDVLVNVEAARKIGINAIHVTDRSVIPDYFKAHDFSLPSET"
FT   CDS_pept        224963..225400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0047"
FT                   /gene="dtd"
FT                   /locus_tag="XBJ1_0226"
FT                   /product="D-Tyr-tRNA(Tyr) deacylase"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0226"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79377"
FT                   /db_xref="GOA:D3UYJ9"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYJ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79377.1"
FT                   /translation="MIALIQRVTQAKVVVEDETIGEIEQGLLVLLGVEKEDNQQKAQRL
FT                   CEKVMGYRVFSDEQGKMNLNVQQANGSLLVVSQFTLAADTQKGLRPSFSGGAEPQKADE
FT                   FYRYFVEQCRVTGVKTETGQFAADMKVSLINDGPVTFWLQV"
FT   CDS_pept        225514..226431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yiiD"
FT                   /locus_tag="XBJ1_0227"
FT                   /product="putative acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0227"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79378"
FT                   /db_xref="GOA:D3UYK0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYK0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79378.1"
FT                   /translation="MYHLRVPQTEQELETYYQFRWEMLRKPLHQPIGSEKDGYDSMAHH
FT                   QMVVDEHGNPVAVGRLYINADSEGAIRFLAVHPNVQQKGLGTLIAMALESVARQEGVKR
FT                   IVCSAREDAVDFFNKLGFKNRGLINGARTSPINHFLMIKPIMSLDDILHRPDWCAELQQ
FT                   AWYQQIPLSEKMGLRITQYTGQRFITTMPEAGNQNPHHTIFAGSLFSQATLTAWGLIWL
FT                   LLQERQLGGNIILVDANIRYRQSITGRPSAIADFNNMSGDLARLARGNKARVKLEVQVS
FT                   GEQGVGSVFTGTYLVLPVERSVTV"
FT   CDS_pept        complement(226421..228232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0228"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0228"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79379"
FT                   /db_xref="GOA:D3UYK1"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYK1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79379.1"
FT                   /translation="MKWLGKFFVTLLLLLILAIIVIYIVVQTHWGTKQLNQWLNRQGHY
FT                   EISIDSISHNWLQPATLTLNNVNIHDKQSAFSLNVSTVNLDLKWQHLLTPRNLHRLTLQ
FT                   QGKLILAGDQLPPLLQADILQLNQMNIQLENPHTQIKGENITGGITPWMPAAGNPFGNG
FT                   QYQFSASTMSFNGIPFEKVIMQGSYQNKTLTIDTFGAAFLQGAISGDGRQLSDGSWRWN
FT                   NLLISNIRWQSPMTLSTLQEKTRHLPAIHVKDLNITNAKLQGKNWSVDYLDTTIKNLGL
FT                   VNGSWEAKDGLIDFNVMNMAFNNAQFSNTLGQLHFSGDTFTVAHLTTHYQKGLFNIQSE
FT                   WDRKNRQLTFNNSSVTGLVYDLPPTWRNDIKNAAPGWISGLTLNDISVNNTLLIDVNPD
FT                   FPFQLTTLSGHVDTMNILKNGRWGLWEGQASLQAASGTFNKIEITRPYLQLHATDDRLT
FT                   IDKLNAFNGHGLLQASGSAEQQTAQKPFELNFKGMNADLGILPRWGWIPLTMQGEGNFS
FT                   LALTGNLSADDIKGTINGTLTAEDKSSNKDSQSIVQGLILSSNCSPAGTVDGAAIAPST
FT                   EAHTAEAGNTRAESETAESKTCLKIKL"
FT   regulatory      226451..226488
FT                   /regulatory_class="terminator"
FT   regulatory      complement(228345..228404)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(228374..228406)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(228436..229821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yicE"
FT                   /locus_tag="XBJ1_0229"
FT                   /product="putative purine/xanthine transport protein (NCS2
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0229"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79380"
FT                   /db_xref="GOA:D3UYK2"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYK2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79380.1"
FT                   /translation="MVTSSREHSTSEAPEASGSELIYRLEDKPPLLHALFAASQHLLAM
FT                   FVAVITPAMLICQALGLPELDTQRIISMSLFASGVASLIQIRSWGPVGSGLLSIQGTSF
FT                   NFVAPLIMGGLALKNGGADIPTMMAALFGTLMMAAITEVLLSRVLHLARKIITPLVSGI
FT                   VVMIIGLSLIQVGLTSIGGGYSAIQNGTFGVPENLLLAGAVLAVIVLLNRQRNPYLRVA
FT                   SLVIAMAVGYLLAWYMGMLPHATPRTDTPVITVPSPFYYGLSFDWNLLIPLILIFMVTS
FT                   LETIGDITATSDVSEQPISGPLYMKRIKGGVLANGLNSIVSAVFNTFPNSCFGQNNGVI
FT                   QLTGVASRHVGYIIASMLILLGLFPAVAGFVQHIPEPVLGGATIVMFGTIAASGVRIVS
FT                   REPLNRRAIMIIALSLAVGLGVSQQPLILQFAPEWMKNLLSSGIAAGGLTAILLNLIFP
FT                   QEK"
FT   regulatory      complement(229846..229905)
FT                   /regulatory_class="promoter"
FT   regulatory      229895..229954
FT                   /regulatory_class="promoter"
FT   CDS_pept        230064..231278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltS"
FT                   /locus_tag="XBJ1_0230"
FT                   /product="glutamate transport protein (GltS family)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0230"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79381"
FT                   /db_xref="GOA:D3UYK3"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYK3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79381.1"
FT                   /translation="MYQMDIYGTLVAATLVLLLGRKLVQSIPFLEKYTIPEPVAGGLLV
FT                   AIVLLAVKQSTDWEISFDLSLKDPLMLMFFATIGLNANLASLKAGGKFLVLFVFVVIGL
FT                   LLVQNTVGIALAKMLGLDPLMGLLAGSITLSGGHGTGAAWGKVFSERYGFDNATEVAMA
FT                   CATFGLILGGLIGGPVARFLVKNTKAPGLGVDDAEIPTAFEKPYTGRMITPLVMLETIA
FT                   LISICLLAGSYIEKQLEHTMFELPTFVCVLFVGVILSNGLSLLGFYRVFDRAVSVLGNV
FT                   SLSLFLAMALMSLKLWQLASLALPMLVILVVQSIVMALYAIFVTYRVMGKNYDASILSA
FT                   GHCGFGLGATPTAIANMQAITDRCGPSHMAFLLVPMVGAFFIDIVNAAVIKIYLLLPIF
FT                   PSIAG"
FT   regulatory      complement(231307..231342)
FT                   /regulatory_class="terminator"
FT   regulatory      231320..231355
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(231401..233482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="XBJ1_0231"
FT                   /product="DNA helicase, ATP-dependent resolution of
FT                   Holliday junctions, branch migration"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0231"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79382"
FT                   /db_xref="GOA:D3UYK4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYK4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79382.1"
FT                   /translation="MKGRLLDAIPLTTLRGVGASQVTKLAKLGLVNLQDLLLHLPLRYE
FT                   DQTRLYSINDLLPGVYATVTGEVLRTHVTFGRRRIMTCQISDGTGVLTLRFFNFTAAMK
FT                   NNLAEGKHVIAYGEIRRGNQGPEIIHPEYKTQQHAERIQLQDTLTPIYPTTEGVRQTTL
FT                   RKLIEQALELLDTCVINELLPEEFSRKLISLPNALHTLHRPPPDVSLTDLDNRRHPAQR
FT                   RLILEELLAHHLSMLAVRAGAQRFHAQQLTADNSLKQQLISQLPFVPTGAQVRVVAEIE
FT                   QDLEKNVPMMRLIQGDVGSGKTLVAALAALRALVHGKQVALMAPTELLAEQHANTFRQW
FT                   FEPLGIQVGWLAGKQKGKARQAQQEAIANGQVSMVVGTHAMFQEQVRFSGLALVIIDEQ
FT                   HRFGVHQRLALWEKGCEQGFHPHQLIMTATPIPRTLAMTAYADLDTSIIDELPPGRTPV
FT                   TTVAIPDTRRNEIIQRIKSACLDEGRQAYWVCTLIEDSEVLEAQAAQATSEELALILPD
FT                   LKIGLVHGRMKPAEKQTIMDAFKRGELQLLVATTVIEVGVDVPNASLMIIDNPERLGLA
FT                   QLHQLRGRVGRGAVASHCVLLYKTPLTNTAKIRLQVLRDSNDGFVIAQKDLEIRGPGEL
FT                   LGTRQTGNAEFRIADLLRDQGMLSEVQRISSYIHQHYPEHAKALIERWLPDRSQYSHA"
FT   CDS_pept        complement(233505..233630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0232"
FT                   /product="putative tRNA/rRNA methyltransferase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0232"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79383"
FT                   /db_xref="GOA:D3UYK5"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYK5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79383.1"
FT                   /translation="MAAVSRHKRPEQPLIDQQGQIIASESWWAAMQATTAPLTGK"
FT   operon          complement(233661..236741)
FT                   /operon="XBJ1_operon0048"
FT   CDS_pept        complement(233661..235769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0048"
FT                   /gene="spoT"
FT                   /locus_tag="XBJ1_0233"
FT                   /product="bifunctional: (p)ppGpp synthetase II;
FT                   guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase"
FT                   /EC_number="2.7.6.5"
FT                   /EC_number="3.1.7.2"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0233"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79384"
FT                   /db_xref="GOA:D3UYK6"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYK6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79384.1"
FT                   /translation="MYLFESLNQLVLKYLPEDQIVLLKQAYVVARDAHEGQTRSSGEPY
FT                   ITHPVAVSCILAEMRLDHETLMAALLHDVIEDTPATFQDIEQLFGTAVAGLVEGVSKLD
FT                   KLNFRNKKEAQAENFRKMIMAMVQDIRVILIKLADRTHNMRTLGSLRPDKRRRIARETL
FT                   EIYSPLAHRLGIHHLKTELEELGFEALHPNRYRVIKEVVKAARGNRKEMIQKILSEIEG
FT                   RLTDAGIQCTVSGREKHLYSIYRKMHLKEQRFHSIMDIYAFRVIVNNLDTCYRVLGQMH
FT                   SLYKPRPGRVKDYIAIPKANGYQSLHTSLIGPHGVPVEVQIRTEDMDQMAEMGVAAHWA
FT                   YKEQGESGTTAQIRAQRWMQSLLELQQSAGSSFEFIESVKSDLFPDEIYVFTPEGRIVE
FT                   LPAGASPVDFAYAVHTDIGHACVGARVDRQPYPLSQTLSSGQTVEIITAPGARPNAAWL
FT                   NFVVSSKARAKIRQLLKNLKRDDSVGLGRRLLNHALGNGKKITDIPQESITKELVRMKL
FT                   ATLDDLLAEIGLGNAMSVVVARNLLGATEKIPNNNNSTRKLPIKGADGILITFAKCCRP
FT                   IPGDPIISHISPGKGLVIHHESCRNIRGYQKEPEKFMPVEWDKDVNSDFIAEIKVDMFN
FT                   HQGALANLTAAINDANSSIQSMNTEEKDGRVYCAFIRLTTQDRIQLANIMRKIRVMPDV
FT                   MRVSRNRN"
FT   CDS_pept        complement(235788..236063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0048"
FT                   /gene="rpoZ"
FT                   /locus_tag="XBJ1_0234"
FT                   /product="RNA polymerase, omega subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0234"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79385"
FT                   /db_xref="GOA:D3UYK7"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYK7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79385.1"
FT                   /translation="MARVTVQDAVEKIGNRFDLVLVAARRARQLQSGGKDPLVAEENDK
FT                   MTVIALREIEQGLINNKILDVRDRQEQQEQDAAEIKAVSVIAEGRR"
FT   CDS_pept        complement(236118..236741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0048"
FT                   /gene="gmk"
FT                   /locus_tag="XBJ1_0235"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0235"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79386"
FT                   /db_xref="GOA:D3UYK8"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYK8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79386.1"
FT                   /translation="MNQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRPTR
FT                   PGENHGEHYFFVTVDEFQNMISHDEFLEYAGVFGNYYGTSRKIIEDTLASGVDVFLDID
FT                   WQGAQQVRQKMPAARSIFILPPSKEELLRRLRGRGQDSDEVIDKRMSQAVAEMEHYGEY
FT                   DYVIINDDFNTALADLQSIIRSERIRLDRQAQRHDALISKLLAG"
FT   regulatory      complement(236935..236994)
FT                   /regulatory_class="promoter"
FT   regulatory      236963..237022
FT                   /regulatory_class="promoter"
FT   CDS_pept        237048..238907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0236"
FT                   /product="DNA ligase (modular protein)"
FT                   /EC_number="6.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0236"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79387"
FT                   /db_xref="GOA:D3UYK9"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR020923"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYK9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79387.1"
FT                   /translation="MLNFLIMILALLFGIPVALAGMAEQVPAEFTESVETGSTGNMADC
FT                   PVWPQEKIQREMQHLTRQMAEWDQLYRQQGISEIDDEFYDQLLEILTLWRTCLHQTSDS
FT                   TFSVAVPREGKQPHPVQHTGLNKLKGVKEIHQWLQGRSVVWLQPKVDGVAVTLVYEKGR
FT                   LVGLISRGNGSEGTNWMDKSSFITDIPKQIKNAPERLVLQGELFWQQDNHRQSVAGGQG
FT                   ARSKVAGLMMRKSSAPELGQIGIFIWGWPDGPNEMAVKLERLASMGFPTAQQYSHRIFS
FT                   AEDAEKRWSSYFIQPLPFATDGVVLRQETEPTGRQWRAGSNSWAIAWKYPLQQQLTTVR
FT                   DVNFKIGRTGRISVLLELEKVKLDDRQVRRVNLGSVSRWRQWNVYPGDKVTVALAGHGV
FT                   PKLDKVVWRIAERPDIQPPNAQDFHSLSCLVSHDSCQQQFIARLTWLGENLNMQGIGQG
FT                   TWAALVKHGLVTHLTDWLALDIAQLTEVPNIGIKRAELIFAQFQQARLQPLSSWREAIG
FT                   LPYANRFTDEMGWQQDLLLSKTGAKNSLTTKQTAKIAAFLQHPEIKTLVHALTVHGIGE
FT                   KQESEENTVGEKKEVESVSYSEAREQEHASDALNNVSAQNPHN"
FT   regulatory      complement(238682..238721)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(238882..239499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yicG"
FT                   /locus_tag="XBJ1_0237"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0237"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79388"
FT                   /db_xref="GOA:D3UYL0"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYL0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79388.1"
FT                   /translation="MLLSVLYIIGITAEAMTGALAAGRRKMDVFGVIIIASVTAIGGGS
FT                   VRDIILGHYPLGWVENPAYIVTVACAAVITIWVAPMMKHLRRLFLILDAIGLIVFSIIG
FT                   AQIALDMNHSPIIAAIAAVITGVFGGVLRDMFCNTIPLVFQKEIYAGVSFAAAWLYIGL
FT                   LHTPLHPNSVVLITLTAGLAARLIAIRYRLGLPIFNYEGSEH"
FT   regulatory      239558..239617
FT                   /regulatory_class="promoter"
FT   CDS_pept        239639..240940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0238"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79389"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR022223"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYL1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79389.1"
FT                   /translation="MVFKERQITFDNRSHQITNINIWTPDSQWLVYDVRPSGASFTGLT
FT                   IEKIHVGSRQVKVIYQAQDDAHVGVVTVNPQEPVRYAFIHGPEKPDTQWQYDFHHRRGV
FT                   IVSDAQPNVAVNIEALDITPPYTSGALRGGTHVHVFSPDGNRLSFTYNDHVMHERDPAL
FT                   DLRNVAVAIPLRAVIPPKKHPREYDGSYFSVIVSRTTPQPRSGSDEINRAYEEGWIGQR
FT                   GYPKENGQWQRWALAFIGDTCAENGEKIPEIYLVDLPDNNEDYAIEGKQPLAGTETTLP
FT                   APPAGVKQRRLTFTHQNRWPGVVNVPRHWLRTSPDGSKIGFLMKDEAGIVQLWYISPNG
FT                   GVPVQITHSTHHIQSAFNWDRRGRFIAFVCDNSIMLCDSQNGEMHRLTARTDDAPSADA
FT                   IVISPDDRYVAFMRDIDGYRQILVVETGITDVGE"
FT   regulatory      complement(239686..239745)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(240941..241213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0239"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0239"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79390"
FT                   /db_xref="InterPro:IPR010780"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYL2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79390.1"
FT                   /translation="MTHSGPYQGYYSGAKASIGMLKDDSTGWVMKPLLAVDLPFSAFLD
FT                   TLLFPYDYTRSSKDQAEHSPKHRLEKLEQRSTATATAPENTNSET"
FT   regulatory      240964..241012
FT                   /regulatory_class="terminator"
FT   regulatory      complement(241493..241559)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(241652..242701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0240"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0240"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79391"
FT                   /db_xref="GOA:D3UWQ9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWQ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79391.1"
FT                   /translation="MIAPMKINLTDAQKDALELMHDTTRDGRVRDRIKAVLLASEGWTA
FT                   QMIAQALRIHESTVSRHLKDYFSEEKLAPENGGSESRLSAEQTTELVEYLMANLMHTTA
FT                   QIVAYVRARWQVTFTVAGMTKWLHRQGFSYKKPMGAPHKFDADKQQQFIETYNALKEEC
FT                   GQNAPILFIDAVHPTLSTKLSYGWMKSGRKHVKVVETTGSRTRLNIMGALNLQRIEETI
FT                   VREYPTINAKNVVLFFGSIRETYPLSQKIHIILDGAGYHRSGVVQFFAEVLNIELHYLP
FT                   PYSPNLNPIERLWKYVNEQVRNNVYFPDTKTFRETLRHFFHVTLPEKAKELTTRLTDNF
FT                   QILKPASSS"
FT   regulatory      complement(242778..242837)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(243160..244359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="avtA"
FT                   /locus_tag="XBJ1_0241"
FT                   /product="valine-pyruvate aminotransferase"
FT                   /EC_number="2.6.1.66"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0241"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79392"
FT                   /db_xref="GOA:D3UYL4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYL4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79392.1"
FT                   /translation="MNDLNQGLRTPGTIMLGGGNPAHIPEMDDYFQQILADLVSSGQLT
FT                   ETLCNYDGPQGKNTLIAALAQELQEKLGWEIHPQNIALTNGSQSAFFYLFNLLAGRSED
FT                   GSMKRVLFPLAPEYIGYSDSGLDEGLFVANKPNIELLPNGQFKYRVDFDHLNISEDISL
FT                   ICVSRPTNPTGNVITDEELLRLDGLAQQHQIPLLIDNAYGVPFPGIIFNDATPLWNPNI
FT                   ILCMSLSKLGLPGSRCGIIIANEKIISAVSNMNGVISLAPGGVGPAIALEMIRRNDLFR
FT                   LSQNVIQPFYKTRVDNVIEIIRRHMSEDLCLIHKPEGAIFLWLWFKNLPITTEVLYQRL
FT                   KKRKVLMVPGHFFFPGLEHNWPHAHQCMRMNYVPDLEKIEEGIRILSEEIEIAHREATR
FT                   "
FT   regulatory      complement(244510..244569)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(244616..245203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="XBJ1_0242"
FT                   /product="3-methyl-adenine DNA glycosylase I, constitutive"
FT                   /EC_number="3.2.2.20"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0242"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79393"
FT                   /db_xref="GOA:D3UYL5"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYL5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79393.1"
FT                   /translation="MEFINKESIRCGWVTADPDYLAYHDNEWGKPLKNSQQLFELLCLE
FT                   GQQAGLSWLTILKKRQGYRKCFHQFDPVKIAGMDENDVEQLLKDPAIVRNRTKINAIIH
FT                   NARIYLQMADQGEDFSSFIWHFVDDSPLINHWKSRTDVPVRTPISDDLSNALKKRGFKF
FT                   IGSTTCYAFMQAAGLVNDHLTSCLCRKIEINA"
FT   regulatory      245233..245292
FT                   /regulatory_class="promoter"
FT   regulatory      complement(245235..245294)
FT                   /regulatory_class="promoter"
FT   operon          245408..248395
FT                   /operon="XBJ1_operon0049"
FT   CDS_pept        245408..246316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0049"
FT                   /gene="glyQ"
FT                   /locus_tag="XBJ1_0243"
FT                   /product="glycine tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0243"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79394"
FT                   /db_xref="GOA:D3UYL6"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYL6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79394.1"
FT                   /translation="MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTC
FT                   LRALGPEPIAAAYVQPSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKA
FT                   LGLDPTVHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEV
FT                   TYGLERLAMYIQGVDSVYDLVWSDGPLGKTTYGDIYHQNEVEQSTYNFEHADVDFLFTC
FT                   FEQYEKEAQELLALEAPLPLPAYERILKAGHTFNLLDARKAISVTERQRYILRIRTLTK
FT                   SVAEAYYASREALGFPMCKKN"
FT   CDS_pept        246326..248395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0049"
FT                   /gene="glyS"
FT                   /locus_tag="XBJ1_0244"
FT                   /product="glycine tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0244"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79395"
FT                   /db_xref="GOA:D3UYL7"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYL7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79395.1"
FT                   /translation="MIQQTFLVEIGTEELPPKALRSLAESFAANFEAELKNANLGHGEI
FT                   SWFAAPRRLALKVANLAVAQADREVEKRGPAIAQAFDAEGKPTKAAEGWARGCGITVDQ
FT                   AERMVTDKGEWLLYRAQVKGREAKELLADMVSSSLGKLPIPKLMRWGDKETQFVRPVHT
FT                   VTMLLGSDVIDGEILGIKSDRIIRGHRFMGEAEFAIDNAEQYPTILQERGRVIADYYAR
FT                   KALIKRDAEQAAMQLGGVADLTDSLLEEVTSLVEWPVVLTAKFEEKFLEVPAEALVYTM
FT                   KGDQKYFPVYDKSGKLMANFIFVANIESSDPQQIISGNEKVVRPRLADAEFFFKTDRKQ
FT                   RLEDNLLRLETVLFQKQLGTLRDKTDRIQALAGWIAEKIGADVTHATRAGLLSKCDLMT
FT                   NMVFEFTDTQGVMGMHYARHDGEAEDVALALNEQYQPRFSGDELPSTAVSCAVAIADKM
FT                   DTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKKLPLDLQTLAEEAVRLYGDKLTN
FT                   ENVVDDVVEFMLGRFRTWYQEQGYSVDAIQAVLARRPTQPADFDARMKAVTHFRTLDEA
FT                   VSLAAANKRVSNILAKSEEKLNDCVLASVLKAAEEIQLATHLVVLKDKLAPLFAEGNYQ
FT                   DALVELASLREVVDAFFDNVMVMDEDQQVRINRLTLLSELRELFLRVADISLLQ"
FT   regulatory      248413..248460
FT                   /regulatory_class="terminator"
FT   tRNA            248595..248671
FT                   /gene="ProTGG"
FT                   /locus_tag="XBJ1_tRNA0002"
FT                   /product="tRNA-Pro"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   regulatory      complement(248671..248701)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(248739..248894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0245"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79396"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYL8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79396.1"
FT                   /translation="MNKEKDNELSNQGNSVPERITDSFRDEIQIDEQFYQTDRDITSMF
FT                   KIGIKE"
FT   regulatory      249130..249189
FT                   /regulatory_class="promoter"
FT   operon          249350..255055
FT                   /operon="XBJ1_operon0050"
FT   CDS_pept        249350..250960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0050"
FT                   /gene="dppA"
FT                   /locus_tag="XBJ1_0246"
FT                   /product="dipeptide transport protein (ABC superfamily,
FT                   peri_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0246"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79397"
FT                   /db_xref="GOA:D3UYL9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYL9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79397.1"
FT                   /translation="MATSSKKKFSLLKLGIGLVALAVTASVQAKTLVYCSEGSPEGFNP
FT                   QLFTSGTTYDATSRQIYNRLVDFKAGTTNVIPSLAERWDVSDDGKAYTFYLRKGVKWHS
FT                   TKEFKPTRDFNADDVIFTFMRQKDKNHPYHKVSGGSYEYFIGMDLDNIISKIEKVDDYT
FT                   IRFVLSRPEAPFLADLAMDFASVLSKEYADVMMKAGTPEKVDLDPIGTGPFQLQQYQKD
FT                   SRILYKAFKDYWEGPAKIDRLVFSITPDASVRYAKLQKNECQVMPYPNPADISRMKQDK
FT                   NIVLKEQAGMNVGYLSFNVDKKPMDNLKVRQALAMAVNKDAIIDAVYQGAGQKAKNLIP
FT                   PTMWSYDDDIKDYAYDPAKAKELLKEAGFPNGFETDLWAMPVQRPYNPNARRMAEMIQA
FT                   DWAKIGIKAKIVSYEWGEYLKRAKDGEPQTVMMGWTGDNGDPDNFFGTLFSCAAKEKGS
FT                   NYSKWCYKPFEDVIKPARETADNAKRTALYKQAQVVMHEQVPALIVAHSTVYEPIRKEV
FT                   KGYLVDPLGRHLFYNVTLD"
FT   regulatory      250987..251027
FT                   /operon="XBJ1_operon0050"
FT                   /regulatory_class="terminator"
FT   CDS_pept        251104..252123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0050"
FT                   /gene="dppB"
FT                   /locus_tag="XBJ1_0247"
FT                   /product="dipeptide transport protein 1 (ABC superfamily,
FT                   membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0247"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79398"
FT                   /db_xref="GOA:D3UYM0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYM0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79398.1"
FT                   /translation="MLQFILRRLGMVIPTFIGITLLTFAFVHMIPGDPVLIMAGERGVS
FT                   AERHAELMAAMGLDKPLWEQYFHYINGIFHGDLGISLKSRIPVWDEFVPRFKATLELGV
FT                   CAMLLAISVGIPVGVLAAVKRGSVFDHTAVGVSLTGYSMPIFWWGIMLIMLVSVQWNLT
FT                   PVSGRISDSVFLDDSYPLTGFMLIDTLFWGEEGDFIDAVMHMLLPAVVLGTIPLAVIVR
FT                   MTRSAMLEVLGEDYIRTARAKGLSRMRVIIIHALRNALLPVVTVIGLQVGIMLAGAILT
FT                   ETIFSWPGLGRWLIDALQRRDYPVVQGGVLLVATMIILVNLVVDLLYGVVNPRIRHKK"
FT   CDS_pept        252134..253036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0050"
FT                   /gene="dppC"
FT                   /locus_tag="XBJ1_0248"
FT                   /product="dipeptide transport protein 2 (ABC superfamily,
FT                   membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0248"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79399"
FT                   /db_xref="GOA:D3UYM1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYM1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79399.1"
FT                   /translation="MTQTTEPAVSGAPKLMTPIQEFWHYFKRNKGAVVGFAYIVLMLLV
FT                   ALLANVLAPHGPAEQFRDSLLVPPIWQDGGSWQFILGTDDVGRDILSRLMYGARLSLLV
FT                   GCLVVVMSLVMGIILGVLAGYFGGLVDTIIMRIVDIMLALPSLLLALVLVAIFGPSIVN
FT                   ASLALTFVALPHYIRLTRAAVLVEVNRDYVMASQVAGAGAIRQMFINILPNCLAPLIVQ
FT                   ASLGFSNAILDMAALGFLGMGAQPPTPEWGTMLADVLQFAQSAWWVVTFPGLAILLTVL
FT                   AFNLMGDGLRDALDPKLKQ"
FT   CDS_pept        253047..254027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0050"
FT                   /gene="dppD"
FT                   /locus_tag="XBJ1_0249"
FT                   /product="dipeptide transport protein (ABC superfamily,
FT                   atp_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0249"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79400"
FT                   /db_xref="GOA:D3UYM2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYM2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79400.1"
FT                   /translation="MALLNVDQLSVHFGEENAPFRAVDRISYSVEQGQVVGVVGESGSG
FT                   KSVSSLAIMGLVDYPGRVMAEKLEFNGRDLTKISEKERRQLVGAEVAMIFQDPMTSLNP
FT                   CYTVGFQIIEALKVHQGGSRKTRYQRAVDLLTLVGIPDPASRLDVYPHQLSGGMSQRVM
FT                   IAMAIACRPKLLIADEPTTALDVTIQAQIIELLLELQQQENMALVLITHDLALVAEAAH
FT                   HIIVMYGGQVVEAGKATEIFRAPRHPYTQALLRALPEFSTDKSRLASLPGVVPGKYDRP
FT                   TGCLLNPRCPYANEHCRQVEPALKTVGESQVKCHMPLDDEGRPTV"
FT   CDS_pept        254024..255055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0050"
FT                   /gene="dppF"
FT                   /locus_tag="XBJ1_0250"
FT                   /product="dipeptide transport protein (ABC superfamily,
FT                   atp_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0250"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79401"
FT                   /db_xref="GOA:D3UYM3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYM3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79401.1"
FT                   /translation="MSEQNIRNQNRREQEKATAPLLKATELKKYYPVKTGMFAPERMVK
FT                   ALDGVSFELEKGKTLAVVGESGCGKSTLGRLLTMIEKPTEGELYYQGQDLLVPDKQAEK
FT                   LRRQKIQIVFQNPYASLNPRKKVGQILEEPLLINTSLAAAERKEQVLKMMEKVGLKPEY
FT                   YQRYPHMFSGGQRQRIAIARGLMLNPDVLIADEPVSALDVSVRAQVLNLMMDLQQDLGL
FT                   SYVFISHDLSVVEHIADEVMVMYLGRCVEKGSKDQIFNNPRHPYTQALLSATPRLNPAL
FT                   RRERIKLTGELPSPMNPPPGCAFAARCRRAFGHCTQFQPKLRKYDEQLVACFAIEQDEN
FT                   SSR"
FT   regulatory      255138..255197
FT                   /regulatory_class="promoter"
FT   CDS_pept        255249..255956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0251"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0251"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79402"
FT                   /db_xref="GOA:D3UYM4"
FT                   /db_xref="InterPro:IPR033419"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYM4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79402.1"
FT                   /translation="MKLRVKRSLTIKQMAAVTGVALITIAIFITIQLSHLLQQRKDDYI
FT                   SQLNNAAAQVQVPLAEALLNSDLNKAKTLLIGLKTSGILGRADVVSPNNARVMSLDFAT
FT                   YRPIPELAKQIFGIPVEVQIPLHIYGITPQTEASQGYLILQVDSNRVYRFALNTLALML
FT                   TTYLLLALILTVAISWCVNRIIIHPLRDVARALNEEQPTAPILCPKNHQDDELGLLVKG
FT                   YNRQIDKQKLRLK"
FT   regulatory      255958..256017
FT                   /regulatory_class="promoter"
FT   CDS_pept        256067..257551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhjJ"
FT                   /locus_tag="XBJ1_0252"
FT                   /product="putative peptidase with LuxS/MPP-like
FT                   metallohydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0252"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79403"
FT                   /db_xref="GOA:D3UYM5"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYM5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79403.1"
FT                   /translation="MQGKKIGYLIGGAILATSYLAQAEILQPDPAWQQGKLENGFSWQA
FT                   LQTPQRPNDRIQLRLIVKTGSLAEKTQQHGYTYLIPKVVLFSSKDLSSQKLENLWRNAI
FT                   DSKNPLPPAIVSYDFTLYSLSLPNNRPDLLKDALVWLSDIAGGAVFTPETLAQAMKATD
FT                   HSVATLPADIQDPVWRMRLQGSTLLDHDPGASVSMPVDVKKIEAFYRQWYTPDAMTLYV
FT                   AGHVDSRVLSERINQVFSPLKGKRQTPVAVATLLPLKSETLGVVSDKAQQDRLSLVWNL
FT                   NWQPINDSQTLLQYWLNDLAREALYRYLQLGREEKQADMKLDLDCRILYQRANCFLNMD
FT                   TSSDKLTESTLYLASELASLRENGLPQEQFDELYAQKRLQLQQLFAVYARTNTDLLINQ
FT                   RLISQQNNVVDIAPEQFQRLRQTFLSSLTPPLLNKKLKEMLSQDISFILVQPKDETAVN
FT                   VNQLRNGFNQIMRPGPVPETPAIDTKQDADIKKGAE"
FT   regulatory      complement(257361..257405)
FT                   /regulatory_class="terminator"
FT   regulatory      257558..257598
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(257621..258511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0253"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0253"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79404"
FT                   /db_xref="GOA:D3UYM6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYM6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79404.1"
FT                   /translation="MMNNQLNRIQTFIAVVDCGSFTRAAERLLISKAMTSIHVKRLEES
FT                   LNIPLLIRNSRGVALTEAGQFLYNEFSEIFINIQSSLDNVAEQYLSLSGTLHITSTIEF
FT                   GDRFLLPLIGEFCKIHPQLNVSYDAGSALNDLISDRLDLAIRLGVLRDSSLKSRKIADF
FT                   KIYMVASPDWLEKNKLETVNDLKDVDWIANSNLQTPTHWELSHSTLPSIDIRAKARFNA
FT                   NSSTSIKTMAIAGFGVTVLPEWMIETELQSGNLVRLFPEYSLPKQPVTIVYPNGHQIQR
FT                   KCRVFIDYLIDKLKL"
FT   regulatory      258496..258555
FT                   /regulatory_class="promoter"
FT   operon          258598..260348
FT                   /operon="XBJ1_operon0051"
FT   CDS_pept        258598..259947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0051"
FT                   /locus_tag="XBJ1_0254"
FT                   /product="putative Drug transporter"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0254"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79405"
FT                   /db_xref="GOA:D3UYM7"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYM7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79405.1"
FT                   /translation="MTYRYRIAIIFLVGFFIDCINIFMSAIALPDIARNLSVSESTVTW
FT                   VANSYLLGLTLIIPISNWLASRFGTRQIMTASMLVFSIAAFFAGMATHFFSLALFRFIQ
FT                   GLGGGLLIPVGQALTLSLFKKQERAKISTIIMAVALIAPAVSPGVGGIIVDHFSWHWVF
FT                   FSNIPFSLIAALLSFLWIKTEKTTAPKPDLSGLFLVSLSLASLLLGLSLYAEASTKLVP
FT                   YILVITGVLFALLYVRHYRRINNPVLDLNILTNIRMRFSIWVYYAVPGVFTGVNLLNIF
FT                   YLQQELNWSAEKAGLLMLFYAAGSFCAILICGRIYNQLGSVRLFFAGLVLHAAGIAILV
FT                   TVNTPQDQPLLIMAYLLMGIGGGIGANTAQTTAMLDFEGENLSRASTIWNLNRQICFSI
FT                   GATIFAMIFNVLQHQTTPATAYHLTFIIAAISGLLPLLKLRQLAKSRETV"
FT   regulatory      complement(258759..258818)
FT                   /regulatory_class="promoter"
FT   CDS_pept        259944..260348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0051"
FT                   /locus_tag="XBJ1_0255"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0255"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79406"
FT                   /db_xref="InterPro:IPR016918"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYM8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79406.1"
FT                   /translation="MNNQKELIAHQSIMELHQWIEDVFTNDQQKGAVSLEKLLSCFSPE
FT                   FSMITTRGHIAFFVQVSELFHQNIGYKPSLKIEIDSIKTLVNTGDTVVCQYRETHCMNG
FT                   INQSRWSVVIIEFKEGNALWRYLHETSIVV"
FT   regulatory      260387..260416
FT                   /regulatory_class="terminator"
FT   operon          complement(260437..261524)
FT                   /operon="XBJ1_operon0052"
FT   CDS_pept        complement(260437..260643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0052"
FT                   /locus_tag="XBJ1_0256"
FT                   /product="putative tautomerase K2"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0256"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79407"
FT                   /db_xref="GOA:D3UYM9"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR018191"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYM9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79407.1"
FT                   /translation="MPFVNIRITREGATAEQKKQLIEGATQLLVDVLGKNPATTFVIID
FT                   EVETDNWGIGGKSVTEVRAAAKK"
FT   CDS_pept        complement(260667..261524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0052"
FT                   /gene="yhjD"
FT                   /locus_tag="XBJ1_0257"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0257"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79408"
FT                   /db_xref="GOA:D3UYN0"
FT                   /db_xref="InterPro:IPR005274"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYN0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79408.1"
FT                   /translation="MPRDFVPFIAHLIRAAQRFNDRMGSQFGAAITYFSFLSLIPILML
FT                   SFAIAGFVLASNPDLLTRLINGIANSISDPSLANTLKNSVDTAVNQRTTVGLTGLAIAL
FT                   YSGVNWVGNLREAILAQSRDVWERHHAEKEKIYSQYIRDFFSLFGLLFALVITLSLTSI
FT                   AGSAQATLVHAFGLEGIEWLRPAWTLIGMTISISANYLLFLWILWILPRHQPERKALFQ
FT                   GTLMAAIGFEIIKYIMTIMLPKLASSPSGAAFGSVIGLMAFFYFFARLTLFCAAWIATA
FT                   EKTS"
FT   regulatory      complement(261593..261652)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(261619..261660)
FT                   /regulatory_class="terminator"
FT   operon          complement(261686..267904)
FT                   /operon="XBJ1_operon0053"
FT   CDS_pept        complement(261686..266134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0053"
FT                   /gene="xhlA"
FT                   /locus_tag="XBJ1_0258"
FT                   /product="Hemolysin XhlA(TpsA-related protein)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15659065; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0258"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79409"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYN1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79409.1"
FT                   /translation="MQEKKFKLSPTGKLAVSMAIILTTCSVSFANGITPGGDAGHRPDV
FT                   TLADTGATVVNIVAPSDSGLSHNQYEDFNVNQMGAVLNNSLIDGSSELAGQLSANSNLN
FT                   GQAASVILNEVISRNPSLLLGQQEIFGIAADYVLANPNGITCNGCGFINTNQASLVVGN
FT                   PLVENGVLQGFNTFNNQNALSIKNNGLSHTDVLNLIAPKIDSHGREITAKIINITTGNN
FT                   QISADGKILASQQADVGVLDSYYLGSMQAGRIRLLNTAEGSGVNLQGKMTANDSIDIKS
FT                   YGDVNLQAANLKGGDITLQGNNVLSQGRLNQSSSDKDGSDNHQGSFSGLYAQQKQISES
FT                   IARTQLEGKNITLVAKQNNRVMATDIVGDNVTLTGADLKLDGQQLHQLTSNTKNEWKLS
FT                   WQYDVTEESEKYHHEGNTIKAHENVHLTASEGNAEVLGSKISAGNKLSVSARKDVKLAG
FT                   LLESEVTAEKGYKKNHTVGLQTGNWNKNHTAQRSIGSELSAGGDLGINAGANAEIIGSQ
FT                   VNSGKNLIVSAGQQAKITAQSLVDNQSIAKNKKYWGGIAGGSNKDNLNKEETHHISDIN
FT                   ANGHLLLSGMNGVTITGSKVRAQQGAYVEANDGQLIIDNVVNNSYKKVNERTGTIFNIT
FT                   KNSNQEHNTQQTTSNSQLVSDTDLKLLSNKDINIIGSLVKSAGELQMNTSGNINVLAYG
FT                   EQNSHHQEKTDLNWQYYAHEAEDKQYRVGIGLEHTRDGQKTDVTTQRPSELNGGNLTLN
FT                   ASENVTVTGSKLVTTQGDAKVTGNNINLLSGENRTSTENSQVKGRGGLFLTGGMDRLGG
FT                   GIEGGYASHGQSQNQTTAVVSKTQVTGNLELNATGELKQQGTQHQINGVYQANAGSIKN
FT                   LATENTESNSTNQLQVDSEISGSADYSATTRPAEKTAKAASEKKLDTSIAKIGLPNAGL
FT                   ELAAKGNSHYTGNSQSNAVVTSIQAGNVKVTTNGDVYDQGTQYQANTGDVSLTAGSHTS
FT                   EAAYNRKDSHSSDTTGNARLRVYTSTGSDISVNGKGDGSYQATSNSSANAVTSGVQAQN
FT                   GIDIQVTRDARYQGTSMNAGSGSTNINAKENIQFDQATNRNEQNRTGHNGEISLTVGTN
FT                   PDGKNFSASAGGGYNTDQQTSTTAQTSTLTAGQGVNLNAGNNLALKGSDVSGKQVDLTA
FT                   QRGKIELTSAQDTINNNGWNVGLKGKGGMSSKARNNESGDSAGSVNAATDNSTGSSEAG
FT                   NKIIDNKYNIGGEVKFGVNRLDTMTYHNGHVSGGNVTLTSGGDTSLKGTNVTADRVTGN
FT                   VGGNLNVESLKDSTHSLNVGLDAGLGYSKTVKGDDKATLPVPTANSSSSETAPETAAAD
FT                   GKKEVPGLKDQLTAAFKGYSGKLKGNYDTLDREATGEQSTLTGTHGVNLDVAGKTYLVG
FT                   GKIDSAQGTVSVNTQQIGHQPVTGYDKGRNLGVNLPDSMVGLAGAAQKDIFSGKIPFVK
FT                   NESHDTATPATHSGIKGHQLD"
FT   CDS_pept        complement(266234..267904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0053"
FT                   /gene="xhlB"
FT                   /locus_tag="XBJ1_0259"
FT                   /product="XhlB (TpsB protein)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15659065; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0259"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79410"
FT                   /db_xref="GOA:D3UYN2"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYN2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79410.1"
FT                   /translation="MIKKTAIFILLCTALQVKASPEELNVILPTDETRRTLQDSSREID
FT                   QLIEQRRHQGLVNRSGALSPQTVSPVLVEAPVCLDIRGVYLQGITLLTLTDLNTLSTLP
FT                   DNCITSNDINKLSAEITNLYIAKGYITARVQFIPPSHHGELGINVVEGFIEAIEGGDRW
FT                   INSRMLFPHLTNKPLNLSQLDQGLDQANRLQSNKATLDILPGKVNGGSVIRLSNQHSTP
FT                   WRISTITDNYGQKSTGKWISRLNASMDSPLGLSDFISLSGISTVDNPDTQYNRAATLFY
FT                   SLPYGAATFSGFTSYSRYISHPKLQHNVHKLYGNSQQSGMRMDWVFHRNQSQISTLNTQ
FT                   LVYKNFNNYFDSAKLSHSSQTLTVFSLGISHLQIIANGLITFDAGIEQGTPWFSAQTST
FT                   DNLNKQFTKGKLSVNLQQRFRLFDMSYRLNNQFYTQYSPNGLPGVEWLNITDRNAVRGF
FT                   SKNTLSGDNGWYLRNTLSHSIPILKGSLDLRAGVDIGRVKGYLSQNGWQSSAGLSTGLT
FT                   WRYQRLLADIEVSRGKLLSHQNRDKDESMQLLTRVSYTF"
FT   regulatory      complement(267974..268033)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(268225..268359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0260"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79411"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYN3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79411.1"
FT                   /translation="MHDDLLNNRTKTAYNILTSNFSKIHAEFIEHSDMSTPSHNMQSK"
FT   CDS_pept        complement(268621..269139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0261"
FT                   /product="Hemolysin-coregulated protein Hcp(probable Type
FT                   VI secreted cytotoxin system component)"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 15659065; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0261"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79412"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYN4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79412.1"
FT                   /translation="MPTPCYISINGKTQGNITAGAFTAESVGNIFVQGHEDEMLVQEFD
FT                   HIVTVPTDPQSGQPSGQRAHKPFRFTVALNKAVPLLYNALASGEMLPTVELKWYRTSIE
FT                   GKQEHFFTTKLEDATIVDIDCKMPHCQDPSKAEFTQLIRVSLSYRKINWEHTTAGTSGS
FT                   DDWRAPIVA"
FT   CDS_pept        complement(269183..269338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0262"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79413"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYN5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79413.1"
FT                   /translation="MIIKFLFVIELELALQFANYFALHDFSFIIRSECSAATVLFNYRM
FT                   KLSLTE"
FT   regulatory      269939..269998
FT                   /regulatory_class="promoter"
FT   operon          270061..288501
FT                   /operon="XBJ1_operon0054"
FT   CDS_pept        270061..270558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0054"
FT                   /locus_tag="XBJ1_0263"
FT                   /product="conserved hypothetical protein (probable
FT                   component of the SST VI cluster)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0263"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79414"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYN6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79414.1"
FT                   /translation="MSKNSPGSVAPKERINIKYVPNTGDQTAEVELPLNLLVVGDLKGK
FT                   KEDTPIEERQTVSVNKNNFNAVMNEANINLTFNVPNRLDEKNEEDMPVNLEIKSLSDFS
FT                   PDNIAKKVPELNKLLELREALVALKGPLGNIPAFRTRLQSLLDDESVREQLLKELEIVN
FT                   KK"
FT   CDS_pept        270579..272057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0054"
FT                   /locus_tag="XBJ1_0264"
FT                   /product="conserved hypothetical protein (probable
FT                   component of the SST VI cluster)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0264"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79415"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYN7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79415.1"
FT                   /translation="MAQHEENSTALASGATTSLLDEIMSQARITPENDGYYIAKQGIAA
FT                   FISSILDTGANEEPINKLVVDKMIVELDKKLSEQMDEIMHAKPFQELESSWRSLKILVD
FT                   RTDFRENIKINIIHATKDEMLEDFEFSPEIIQSGFYKHVYSTGYGQFGGEPVAAVIGNY
FT                   AFTNSSPDIKLMQYVSAVGAMAHSPFLSSVSPEFFGVNSFTDLPAIKDLKSVFEGPSHT
FT                   KWRALRESEDSRYLGLTAPRFLLRLPYSSVENPIKNFNYQENVSRDHEHFLWGNTAYLM
FT                   ASCLTDSFAKYRWCPNIIGPQSGGTVSDLPVHLYEAMGQVQAKIPTEVLITDRREFELA
FT                   EEGFITLTMRKGSDNAAFFSANSVQKPKVFPNTREGKIAETNYKLGTQLPYMFIINRLA
FT                   HYIKVLQREQIGSWKERQDLERELNMWLKQYIADQENPPTDVRSRRPLRAAEIKVLDVE
FT                   GDPGWYQVAMQVRPHFKYMGASFELSLVGRLDKE"
FT   CDS_pept        272060..272500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0054"
FT                   /locus_tag="XBJ1_0265"
FT                   /product="conserved hypothetical protein (probable
FT                   component of the SST VI cluster; lysozyme-related protein)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0265"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79416"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYN8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79416.1"
FT                   /translation="MAALYSWNRGSSASLFERIQGKGSGSSRQSRMRSLLDSIKKHLKE
FT                   VLNSRPGACQSAIDLGVIDLNDATATSVDFKQSIEWAIEECIRNYEPRISAVSVSAIND
FT                   DSDPLLLSFHISAEILLDDINDIVEFSIQLDNNRRYCLERTQ"
FT   CDS_pept        272501..274333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0054"
FT                   /locus_tag="XBJ1_0266"
FT                   /product="conserved hypothetical protein (probable
FT                   component of the SST VI cluster)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0266"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79417"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYN9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79417.1"
FT                   /translation="MSFEKYFRDELNYLRQLGKEAAVERPHLAAFLSEQGSDPDVERLL
FT                   EGFAFLTGNLRAKIDDQFPELTHGLLNMLWPNYLRPTPSMTIIEYTPDESVVTKATPVK
FT                   RGTQIMSNTLSTHDDIYSNEKSGGKRDEQGRCTFTLCRDVWLFPLSIQDISVNNSNEQG
FT                   IIGLNFASKTELSLHELELDKLRFYLSGDDYTTSQLYFWLCYYFRKAELVVGDKVIPLP
FT                   DFDFVPVGFEREDALLPYPKNAYMGYRILQEYFCFAESFLFFDVKGFPTLPEDLKTKDF
FT                   KLNLHFSQALPPEAKIRHDTFRLHCTPAINLFPMDSEAIELNGSQAEYPLKASYSLPDN
FT                   YDIFSVDGVESWLAGENGERSRARIGERVYTPFESFNHQIDDEDERSMRYYRLRVKESP
FT                   FRRGLEHFISFVRGDESDLLRLKLKENVSISLTCTNRELPLQLRVGDINYPSIGSPTFA
FT                   TFRNITRPSVPLYPLLDGGLHWSLLSNMSLNYMSLLDKDALKQVLRTYDFPSIHNRQSK
FT                   RSSQKRLDAIEKIETEPTDRLFRGQPVRGLRSTLYIRQQAFSSEGELYLFSTILSRFFS
FT                   LYASVNAFHMLKVINLDNQECYEWPVQIGQHSLM"
FT   CDS_pept        274297..275349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0054"
FT                   /locus_tag="XBJ1_0267"
FT                   /product="conserved hypothetical protein (probable
FT                   component of the SST VI cluster)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0267"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79418"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYP0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79418.1"
FT                   /translation="MAGTDRSTLIDVITEQDPATPLALDISQYNFYQLVELLNQLAVAW
FT                   EKTGETDRPDRESVRFRASASLAFPTRDVISLSQTRRGYFELEVSFMGLHGSQSPMPGY
FT                   YLDSLAWEEAQNENRLTDFLNLFNHRLITLLHQIWRKYRYYVCFKKGGEDHFSQRMFSL
FT                   VGLGSDVNRRMLNINHSKMLAYAGLLASPGRSPEVICSLVSHCFDLQDVTLHGWQFRKV
FT                   TIPLDQQNRLGSERKGQVIGDSKLSMLGQNFTIGSWVGDYSGKFLLSINNLTRDRFLSF
FT                   LPDGKNYAPLVMFISFVMRSQFAWELRLGLAENQVSGMVLGAQQNNHLGWTSFLGEPEK
FT                   KPFVTISVME"
FT   CDS_pept        275355..276650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0054"
FT                   /locus_tag="XBJ1_0268"
FT                   /product="Conserved hypothetical protein with FHA domain
FT                   (probable component of SST VI cluster)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0268"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79419"
FT                   /db_xref="InterPro:IPR017735"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYP1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79419.1"
FT                   /translation="MEKQQPTLSLRVLNSEQLESGRSASCLFSAQGGTVGSSESHLWSV
FT                   QDQQGNIHPSQFSVQWRDGAFCLQVLAEPVQINNAALTPQSSLIRLQQGDQIKAGNLSI
FT                   KIHISFSDADRVDPSTVSPESLVSSYSNPLDAMMEGAVVQKAVFADDNSIAPTIQHSFS
FT                   DDPLRVLDSESLTTLKQQVEADDTEQLLPPDHFQSPPFANPISDNRGSVMDQEFLDLPG
FT                   ITSERQYADMDVDHVAITPLMRGLDAQLPLHDSQQANDFLQEMGKTMKAAIEGLLALQR
FT                   EQHGLRDKQLRPIEDNPLRLNMDYDTTMQVMFSDQKSPVHLSAPAAVSESLHNLQLHYQ
FT                   ANREAISAALDTMLEAFSPDQLLRRFSHYRRSNEVRNKDAAWAWEMYTNYYRELASSRQ
FT                   QGFEKLFREVYEQAYDRALRQGLEDSSNETFR"
FT   CDS_pept        276634..277188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0054"
FT                   /locus_tag="XBJ1_0269"
FT                   /product="conserved hypothetical protein (probable
FT                   lipoprotein of SST VI cluster)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0269"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79420"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYP2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79420.1"
FT                   /translation="MKRSASHRVWAVGILLLSAMLLNGCSGAWNATKKVGQVIWDPSTP
FT                   VGKPDEQASVANITLLAEPNINPNESGEAAPVEMNLVYLSEDSRFLAADYDQLESDKLE
FT                   KALGKNYIDHQDYTLLPGQYKPLSTLILEKNNRYIGVIVHYADANQSEWKKIIRVKDIG
FT                   RHYNILVHVRNNDVELRKEEE"
FT   CDS_pept        277191..278543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0054"
FT                   /locus_tag="XBJ1_0270"
FT                   /product="conserved hypothetical protein (probable
FT                   component of SST VI cluster)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0270"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79421"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYP3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79421.1"
FT                   /translation="MPGKNRVIWHEGLFIKPQHFQQQQKHNDYLAHSLVSVLAAYGHGF
FT                   SSLSINQDLLNLGRIGITEASGIMQDGTIFSAPSQDLLPKPLDIESVNDLKSKDIYLAL
FT                   PMSSDTIREIADKEAEMQSAVRYRELPSDVRDLHTKGGDSFALNLAQLTPVLMQGSEDM
FT                   SAYTAIPLCRIKEKQKDGTIVLDSEFIPTCLSIFVADKLRRFMVEIDGLLTERSRTLAK
FT                   RIGSPGQQGVADVAEFMMLQLLNRVQPLFNHYAKQTVLHPLHLYTQLLQTCGELRTFTD
FT                   ASRLPGNVLAYDHNNLTDTFQDAMHAIRDALNVVLTPRATSIVLKQNEGGIRVATLHDN
FT                   DLLRKAEFVLAISASTPQEQLRRQFVQQTKVTSMEKIRDLVSVQLPGVPLIALSAAPRQ
FT                   LPYHSGYTYFRLDQKSPAWKEIQQGNSIAFHVSGDFPDLDMQLWAIRGGKE"
FT   CDS_pept        278546..279313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0054"
FT                   /locus_tag="XBJ1_0271"
FT                   /product="conserved hypothetical protein (probable
FT                   component of SST VI cluster)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0271"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79422"
FT                   /db_xref="GOA:D3UYP4"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYP4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79422.1"
FT                   /translation="MSDINVGSPSLEKSETLKTFQRQYQLPLRGESLNPMIDAATPLLG
FT                   MVLRLQDMSDQALPDKLYQQVVTDIRAIEQFLQTKGYEPGAIVSFRYVLCTFIDETALG
FT                   HGWNSQNGWLKQSLLVHFHNETWGGEKVFVLLERLMGETQRYQHLLEFIYLCLCLGYRG
FT                   RYKVSTQKSDDFDRLFRRLQQQLHSLRGEAPPTTLYVDINERDERYRLSRRWTIKHLFW
FT                   ISVGLLAAIYSFYAIRLGDQTQDILKQLSNLLR"
FT   CDS_pept        279323..282037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0054"
FT                   /gene="clpB"
FT                   /locus_tag="XBJ1_0272"
FT                   /product="putative ClpA/B-type chaperone (Putative ATPase
FT                   with chaperone activity; probable component of SST VI
FT                   cluster)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0272"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79423"
FT                   /db_xref="GOA:D3UYP5"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYP5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79423.1"
FT                   /translation="MIQIDLPTLVNRLNPMTRHALEAAAASCVSQQQPEITVAQLLFQM
FT                   IDTPLSDVRLILNKADIDKDLLKEQLDQMMPHHQAIVQTYPNFSPMLVEWLQDSWLLAS
FT                   TEMQHTELRGGVMLIALLFSPMRYLTPQPARMLAGINRELLRQNFTEWTNGSAEQPFSG
FT                   DDKNGQGVHPANSDSLLARFTQNMTEQARQGKLDPVLCRDNEIDLMIDILCRRRKNNPI
FT                   VVGEAGVGKSALIEGLALRIINDRVPDKLRHSELMTLDLGALQAGAAVKGEFEKRFKGI
FT                   MAEISQSSKPIILFIDEAHTLIGAGNQAGGLDISNLLKPALARGELKTIAATTWSEYKK
FT                   YFEKDAALSRRFQLVKVSEPSAEEATVIMRGLRAIYEQAHGVLIDDEALKASAVLSDRY
FT                   LSGRQLPDKAIDVLDTACARVAINLTSPPRQISSLTTELHQMQMEIDVLKREQRMGLNE
FT                   HADRLEELQNQQVEIQEELVTLEKNWRQQQELVTQIIELRGQLLADSDESVAAETTDKT
FT                   IENAVEETAQDAKEQEAIAQDEPEAAADEQSLIEKLALLNAQLTELQQKQTLVSPHVDK
FT                   TQIASVIAEWTGVPLNRLSQSELSIVTELPTHLGQSIKGQDVAIQNLHKHLLTARADLR
FT                   RPGRPLGAFLLVGPSGVGKTETVLQIAELMFGGRQYLTTINMSEFQEKHTVSRLIGSPP
FT                   GYVGYGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGELADGEGRIIDCK
FT                   NVVFFLTSNLGYQTIVDHAEQPDQLNDLLYPELAAFFKPALLARMEVIPYLPLGHETLK
FT                   TIIQSKLARLDSLLSQRFNAEVTISDDVSEEILQRATRAENGARMLESIIDGALLPPVS
FT                   LLLLQKMAAGTAISAIRLTVAEHEFHAEVEEAE"
FT   CDS_pept        282037..282831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0054"
FT                   /locus_tag="XBJ1_0273"
FT                   /product="conserved hypothetical protein (probable
FT                   component of the SST VI cluster)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0273"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79424"
FT                   /db_xref="GOA:D3UYP6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYP6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79424.1"
FT                   /translation="MKQRLKSALALLDDDTIEQLVDHFLLVSQSSRFDALLVFLLNTNE
FT                   NRLECYNLPELHQASSRRLNVDIDDVNNPLIQVLRKGTPTVWDSLNHGARIDDVHFRTF
FT                   VAELPHNCGLYAIPLFDCNGQACGVIAIFAEHVSHFINNENMFGLYCHVMQHRLKKLQE
FT                   LEQLRGQLRQIRQVFQVQQQKEKQLDELLASLSGSKPAGVSRISVDYSHIDNLPKAIEE
FT                   FESAVLVQRQRQYGNDTRLIAQSLGIATRTLVYKLAKYGCRL"
FT   CDS_pept        282828..283493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0054"
FT                   /locus_tag="XBJ1_0274"
FT                   /product="conserved hypothetical protein (probable
FT                   component of the SST VI cluster)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0274"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79425"
FT                   /db_xref="InterPro:IPR017738"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYP7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79425.1"
FT                   /translation="MNIVLIISSLLASLTGDPKLANLVEPKEVVAPKEEYTDEMQKCRF
FT                   EPSPLVRLACYDRTVNNLKFNALQIPMENMGLVWRQAMEQEMKRTDYSTGFIVTQGENG
FT                   EAPVILTTPAVGVPPPRPVLMLSCIDRITRLQVALPKPMGSGTVTVTTDKTQFKTEWFL
FT                   REHGYLWESSRGLPGIEEIKRLMNSDQMTITARTGSPITFNISQLEQAAKPLRDACRW"
FT   CDS_pept        283499..284935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0054"
FT                   /locus_tag="XBJ1_0275"
FT                   /product="Conserved hypothetical protein with ImpA
FT                   domain(probable component of SST VI cluster)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0275"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79426"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017739"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYP8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79426.1"
FT                   /translation="MDIRTQFDWFGALLAPLSDEQTGKALSESDPAWEFIDGEMVKFGS
FT                   LSHGTLEVDALQRQALQLFSEHSKDFRLMVHLLRTLQHAGHPAELILAIELLTEYVKNY
FT                   WEKAWPVKPVLKRRLAQQVIKRFESAQSSFTDQASKSQRDEAQGALAHLAQCWHASEPD
FT                   LAKDVDQLRTRYNRQPEARTAPTQTAPTTPEAASVAPSPQSPEQAPMPEVAVNSSSDKA
FT                   WKQTLMTVADLLCERYPESPIGYSLRRHAVWHTITTAPMANATGKTPLAPASADRTADY
FT                   LARLPTADNKLLAQIEQSLALAPYWLDGHAIAAQAAEQRGYSRVAQAMRDELKAFLARL
FT                   PVLKTLSFSDLSPFISPDTLDWLTPEPDTSGSPGAASADQEAIWHCFQQQGLEAALQML
FT                   EEHQQSLTEPRDQFYGQLFTAQLLEEAGMTALAHQHYRNLLHTGQHMLLTEWEPSLLTL
FT                   LAEKIPSPAKDTASHRSVNT"
FT   CDS_pept        284932..288501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0054"
FT                   /locus_tag="XBJ1_0276"
FT                   /product="Conserved Hypothetical protein (probable
FT                   component of SSt VI cluster)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0276"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79427"
FT                   /db_xref="GOA:D3UYP9"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYP9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79427.1"
FT                   /translation="MKWPSLSSLAPLKSALPALSKFKSLPRLKATMALALALIPCLLLI
FT                   AVWVWGPEWKLRNDTPLDSLAARWLATALIILMVLLWIGIKAWRRLRQLEKLNLDVELK
FT                   GVDPVRVDIEHQARYLDHWKAQLQRHLDSYNYLYQRPWYMMVGSQQSGKTTLIKEGYKL
FT                   SDIAAPEYLRQDGDIALRLRCWLGEKAVIIDPDGGLIDQPVPVNSDKPQINSRLWESLL
FT                   NWLTENRQRQPLNGIILTVDTLRLLTDNREQRDRYVREIHQRLQNLRLTFHSQLPLYLV
FT                   MTKIDLLHGFEAMYPSLDRRQRDQILGVTFSLNNRDEKAWHSELAQFWQQWMANLNGAM
FT                   PDMMLNGVDAGQRSALFSFTRQVQGLHSYIAQMLEDILYNDEHHRPMLRGVYLTSARQV
FT                   GQMDDLFTQSASAQYHLGSQAFPTWPAGDTLPYFTQSLFEEVLLAEPNLAAENRLWLSR
FT                   NRRQLYTFATISALVIAAMWGGWHYFYQKNYRAGEEVLAQAKNFLSVPPPDGDDRYGNL
FT                   QLPLLNPIRDATLAYGNYHEKKSFLTDMALYQGDGVGPYVEGTYLKLLEQRFLPSLMQG
FT                   LLDDLNRAPAGSEEKLEILRVMRMMEDGSKRNNGLVGQYMRARWSKAFHGQRDLQAQLL
FT                   THLDYALAHTDWKGQRDKDNQDALARFAPFIKPMKQAQQELSALTINQRVYQNLRLKAQ
FT                   DTLSAPVNLRDQIGPSFDSVFIAGNESRLVIPQFLTRHGLTDYFVRQDKELVELTEMDS
FT                   WVLNLPLKTNKYSDTDQGNIQREITELYVGDYTATWRAAMNNLEVRDFEDLPQAISAIE
FT                   QVISGEQPIKRALQILSDNTRPPELVSGLSDKEKQALLAQSDYRLLNRISRDFAPETGV
FT                   LVEHGDKGSALQSVYQKLMALHRYLLAIQNSPVPGKAALQAVQLRLDQNNSDAIFEVQQ
FT                   MAKNLPEPLNRWVGDLAEQAWRVVMMEAVRSLEVEWNESVVKQYKTYLAGRYPFNPAAT
FT                   EDVPLSEFDRFFRPDGTLDTFYKQSLKPFVENNLTTGTDGRELIRADVLKQLAMADRIR
FT                   TTFFTPQNGLGTAFAIEPVSLTGNKRRGLLNLDGQLVDYAHGRSNVAHLVWPNSMRAGT
FT                   ESRLTLMPDRSNAAPRSLSFTGPWAQLRLINSGKLTNVQPGAFDVRFAVDGGEITYRIY
FT                   VDESDNPFAGGLFSQFRLPDTLY"
FT   regulatory      288539..288570
FT                   /regulatory_class="terminator"
FT   operon          288584..293421
FT                   /operon="XBJ1_operon0055"
FT   CDS_pept        288584..289975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0055"
FT                   /locus_tag="XBJ1_0277"
FT                   /product="Conserved hypothetical protein with ImpA
FT                   domain(probable component of SST VI cluster)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0277"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79428"
FT                   /db_xref="GOA:D3UYQ0"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR021069"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYQ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79428.1"
FT                   /translation="MSEHPENLIIRAGGSPQNLPEFAVIRDEINKISHPAQPEVNWVLV
FT                   ESLSLTLFRRNGVDLQTAIYYTLARMQLNGLAGFTEGCELLAGVIVSEWDALWPPQPAV
FT                   RTDLLEWFHTRTGSQLRQMDFGTGDLRMIYRAERALQLIIDRLQQSDLKRLPRVENLLW
FT                   FFQNAAKKLEKPRPAAKPVQSPVQMPPLVYLSQSDTEPEIPPPSAPPRPDRPPEADSPR
FT                   VRVQFPEPPRGWNAWQGFGLGAVLGLLVLVGGWLLFYKPLQQQLSAITASPAGARLAWL
FT                   TEPALAGYQGQLDRLAETPLLATWDAARTLTGTAAQQWPDSAEQKNATHQWTQAMTARI
FT                   DSIPLKGSWHTTRDQLQQLADKILLQERTRGSFTLSYLKTAVYDLQRSHGSEVPLEELL
FT                   RQLNGRVVNGEPVPPVLLKGIDDRFNALLGRYDRLRQAAENPAEKQAGKQTTHHESTVI
FT                   PDGGH"
FT   CDS_pept        289991..293062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0055"
FT                   /locus_tag="XBJ1_0278"
FT                   /product="Putative Rhs accessory genetic element (modular
FT                   protein)"
FT                   /EC_number="3.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0278"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79429"
FT                   /db_xref="GOA:D3UYQ1"
FT                   /db_xref="InterPro:IPR002196"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR033907"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYQ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79429.1"
FT                   /translation="MSMKKNMAKLKKGRALIQQGQQAAQLAKHVTGKLGGGLGGAAAGT
FT                   AGLIPGGGFGGGIGGGSAGTGAAGLIPGGGFGGGLGGAGGGAGQGLAARAASGQSGAAK
FT                   ALQKAGQLLGGGGGMAPSGLQFTLTAGGLPPETFVVTDFALTEGFSRPFSLHVGLASAD
FT                   PAIDFPAVLDRSATLTILQEGVEQRSITGIVARFEQGNTGLHQTTYQMSLYPDLWRTTL
FT                   RQNSRIFQQLDIAAILTTLLKEHGIRDVVFSLRHPHPAREFCVQYQESDFAFLQRLTAE
FT                   EGIFYFFECGNGRNTLVFADDAGSVPPGIVLAYQPGEGSTTGTPSVGSFTCSAQVRPAQ
FT                   VQLKDYTFKNPAWPAEFSQQMKEDTLQQMYYEHYDYPGRFKDEAHGQAFTRYRLEALRS
FT                   DAVTGQASGQAIAVQPGKLFTLFNHPREDLNQPWQVVGASHTGSQPQARETASSDSGTT
FT                   LHSQFSFIRHNQHWRPAPLPKPTIDGPQIAKVVGPAGEEIFCDQYGRIRLQFPWDRYGK
FT                   SDDQSSCWIRVSQPWAGQGWGMLAIPRIGQEVVVDFLHGDPDQPIVTGRTYHASNIPPG
FT                   ALPGSKTQMAFRSKTHKGEGYNELLFEDAKGSERLALHAQKDMHTTVKDNQSLVVEAGD
FT                   RTLTVQTGDEHKTVKQGNLTETICQTRSTEANVIQVKAKAGKAGLGTQLYQAEDNITLQ
FT                   VGKGSIEMTPEHIRVAFGSSVILLNSSGVFVDGPAIGLNNGSAGAGLPPAAADGGDSAS
FT                   ESGSLLPAAVMAAGLGPMGMAALGSMGLISSASAATPASAPRPMPTPADGAGRQAAPAD
FT                   SQATPASAPRSMPVPVNGAGRQAVPAGSQVAAPSAPPVSATNLTTSTKKTMGQDGLDLL
FT                   KGIESLRLKPYDDQTGKTVTKWTKGATIGYGKLIEKKDWDTYKDGITEDEAEELFKKTL
FT                   APFEKTVNDGITKEINQNQFDALTMFAYNIGAKGFNDSSVLKLVNDENAKTDYDTLDDA
FT                   WKAWNKSQGKVNQGVINRRAAELKIYNEGVYERW"
FT   CDS_pept        293056..293421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0055"
FT                   /locus_tag="XBJ1_0279"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0279"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79430"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYQ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79430.1"
FT                   /translation="MVKKSLLSFLGVMLLACSSMLFAAYTDVFETKTYHITINVLCPEG
FT                   NVSCDNVIYTGVRKKDNASITLKGTTLNKDCNTGTCDFYGYEFKNKDVTYTIYQYGSLE
FT                   ISKKGEVIFSEDRISKE"
FT   regulatory      293426..293473
FT                   /regulatory_class="terminator"
FT   regulatory      293609..293668
FT                   /regulatory_class="promoter"
FT   operon          293690..299164
FT                   /operon="XBJ1_operon0056"
FT   CDS_pept        293690..294145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0056"
FT                   /locus_tag="XBJ1_0280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0280"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79431"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYQ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79431.1"
FT                   /translation="MSDPLDLSPFHFNAGTIKLPASWQDSSILVLNSPDDKNGTSFTIS
FT                   RDSLPWGLAFNQFAEREMTAIGKQLKDYEVLAHEAGELNGHETETFEFRWRAPSGPVHQ
FT                   LMMMLNAPGQVLIFTGTCQGEMTPAQKAQMQAMMATFQLRSEQKGSE"
FT   CDS_pept        294160..298737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0056"
FT                   /locus_tag="XBJ1_0281"
FT                   /product="Putative membrane protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0281"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79432"
FT                   /db_xref="GOA:D3UYQ4"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR028048"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYQ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79432.1"
FT                   /translation="MSVSQNVMMGAAAAQRPSPPPATNRRPSPAQGDRRVPAPPRTEKS
FT                   TSDKTLEFLQSETFENATLATSGTFAVATGAAVPFAVGLAAGAAGAAAGAYVGDKIGHA
FT                   IAAGMGMSTVATEGENPAREGDAIAHQNKNAGLWGALGGILLGAVAAIAVAALVIATGG
FT                   AALVVVAAAAAAGGFVGGACAGIGAAIGQYGSNTGTIVAGSPDVFFEGKPVARVGDPVA
FT                   CSDHPPGVIAEGAKTVFANGQGIARLGHRTTCDANINSAAGSISITQATDGKYPIMEES
FT                   NKGLQWAVVIAGLLPLPRNKKGVTKSDKPKESTQKNSKKPKEEDCCGDPVDMATGDFLQ
FT                   QWPLLSLPGTLPLSLTRTYRSTADFAGLFGAKWADDWSQHLVLDGEATRFTDADGVVYT
FT                   FHTPEEKVFSVNLHAGHYLLFGELRGSLHLFDRQTQLTLSFEQRDGKRRLLSAISDRYD
FT                   NRITFHYDDLNDEGIPQLAQVTHSDGYRLLLDYHQHRLVTVEYLTDELRQRLVTCQYDE
FT                   QGYLSECATFQHSHLWHEYDTHGHMTRWHDADATDVSMGYDTRGRVVSVSTPQGYWQDR
FT                   FLYDEVNRVTTYRDAEGGCTRYWYNGDGQITRKLDPLERETVLEWDLSHKLSETDPLGR
FT                   KTTFEYSPYGELTQLTLPAGEVFIYDYDEYGQLVQATLPAGKSWGFHYSEQGALDAVTD
FT                   PQGRREEYRYNLHGELLRRVLPDGTQWRYEYEQHRLHQVLQPNGYTTRYDQDGLGRLRG
FT                   VTDALGQQTRYQHSAFHASPAGSVTEIELPDGVKQHIDYDSERRVTAVTDGEGNTTRYA
FT                   YGAFDLLTRMTRPDGTTLHFEYDRLIRLNRVTMATGETYRYERDLAGQIIRETDFTGRT
FT                   VEYIYDRAGRRTLTRYPNGQLIRFCYTAEDLLSRQEHWLAGASSCELQVATEYTYDVHR
FT                   RLTRAVSPDAVVEFDYDEAGNLTGERLNGREISREWNELTGLPAVETLDGHTLHFDYNR
FT                   MGALTGFRFDRHSPLTLSHDPLGRETARESGEGFILASRYTATGMLAHQSAGRVTAMFR
FT                   ETLQQNDPHFPPQATAVNRSWQYDRAYNLRVIDDGRWGQTRYRYNSNNQITETLYQGAR
FT                   PYEEQFRYDANGNLSQHIPVDAQGAVTQITQHQQAGRVIRRGDVSYRYDDSGRLVEKTA
FT                   QRDGFRPQVWRYRWDALNQLTQCETPDGSRWYYQYDAFGRRIRKLKVHDGKLAAANLQR
FT                   WLDGKPDLTPKPRTMMGQDYLWSGDQLIEETPLYADGTPAEDQRIRWLYEPGKLTPSAR
FT                   YERGKLHYIVSDHQGTPREMLNEEGGLVWAQRLTTWGRAEKSQVLASNDADYHVSCNLR
FT                   FVGQYEDEESGLYYNRFRYYDRETGQYLTPDPIGLLGGLNPYGYVHNPTNFIDPLGLAG
FT                   ENCGKPKPNRRQALNKAKDLAGIPRSQKPDRQWTVGNDPKRRGQTNYQYSEDLGSHGRY
FT                   YEYKDAHGHKKVVLEHTADPRATHPHAHAGQAKTGADPRTYDFKENRYQKITDPKTDDH
FT                   HIYYE"
FT   CDS_pept        298712..299164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0056"
FT                   /locus_tag="XBJ1_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0282"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79433"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYQ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79433.1"
FT                   /translation="MITIFIMNSKLEEKMLLARAKRYINNIQGIEKISISLSNNDKEFQ
FT                   WHKEIINSILKGKEIPECKLELPVSEEDIYSYLQSKIHIGECNSYYMFFEGMVKFSFNI
FT                   IDLKRFLSSCYALKKTFDLYVLLLNPMKVIAISEEEYELSFYNKTM"
FT   regulatory      complement(299166..299205)
FT                   /regulatory_class="terminator"
FT   regulatory      299181..299215
FT                   /regulatory_class="terminator"
FT   operon          complement(299238..300169)
FT                   /operon="XBJ1_operon0057"
FT   CDS_pept        complement(299238..299435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0057"
FT                   /locus_tag="XBJ1_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0283"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79434"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYQ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79434.1"
FT                   /translation="MTLTVDAYGEPDIVFGHFDIFQCLAAMFCRFDFPLVLVQQRDTLD
FT                   QGEIFHVVTAGTGLGDDKSN"
FT   CDS_pept        complement(299441..300169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0057"
FT                   /locus_tag="XBJ1_0284"
FT                   /product="transposase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0284"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79435"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYQ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79435.1"
FT                   /translation="MGTDTPEPAALTPNIVLYDHQASRSGTCAADYLAGFQGYLQVDGY
FT                   QGYEQTGARLVGCMAHARRKFMEAKQAQGKNKTGKADIALSLIQSLYRVEHQVKGLSPA
FT                   EKYRIRQEKALPIWDKLSAWLVKTRSQVIPKSKLGEAVTYLSNQWAKLIRYREDGRLSI
FT                   DNNRAERAIKPFVIGRKAWLFSHTSRGAQASAILYSVIETAKANGLIPFDYVMTCLDEL
FT                   CQPTPDLEKLLPWKKVISKV"
FT   CDS_pept        complement(300206..300508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0285"
FT                   /product="Insertion element iso-IS1n protein insB
FT                   (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0285"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79436"
FT                   /db_xref="GOA:D3UWL6"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWL6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79436.1"
FT                   /translation="MKRIVAHVFGDRSRKTLDKLLTLLSSFTIRFYCTDDYVVYDPLPE
FT                   EEHLTGKAFTQRIERTNLTHRTRIKRLNRKTIGYSKSEEMHDKVIGTFIEREHYF"
FT   regulatory      complement(300236..300295)
FT                   /locus_tag="XBJ1_0285"
FT                   /regulatory_class="promoter"
FT   operon          complement(300625..302504)
FT                   /operon="XBJ1_operon0058"
FT   CDS_pept        complement(300625..300780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0058"
FT                   /locus_tag="XBJ1_0286"
FT                   /product="Insertion element iso-IS1N protein insA
FT                   (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0286"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79437"
FT                   /db_xref="InterPro:IPR024431"
FT                   /db_xref="UniProtKB/TrEMBL:D3UX17"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79437.1"
FT                   /translation="MAYTYQACKPGVKEQIVDIAMNNGGIRDTARILKVATATVMKTLK
FT                   TSDPET"
FT   CDS_pept        complement(300717..301736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0058"
FT                   /locus_tag="XBJ1_0287"
FT                   /product="transposase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0287"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79438"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYR0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79438.1"
FT                   /translation="MKIDIDALPNDPAELKRLLIKQSQRLAFLEEQFRLAQQKRFGASS
FT                   EAFPGQGELFNEAEEIALPAETAAAQETLIPPRRKPTRNPLPKDLPRETVFHDIAEEEK
FT                   QCVCCGGRLHQMGADRSEKLLFIPAQIRVVEHVRPKYACRECEKSGIQTPVKQASLPAM
FT                   PIKKGMATSSLLSQLITNKYQYGLPLYRQESVFKQYGIDLSRQTQSDWILKSAQLFTPL
FT                   VARFREMLLQQPVLHADETPVKVVTSEKTTHYMWVYCGSCIKWLVAVICFRLFKDEVWP
FT                   KLMSIAVIATNQNRSKDMGKEMADILVIAVIAAVRSFSWRIPIRPANPALKNRLSISR"
FT   CDS_pept        complement(301807..302160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0058"
FT                   /locus_tag="XBJ1_0288"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0288"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79439"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWS6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79439.1"
FT                   /translation="MKMFVDVPEVYLCRSFIDFRKSINGLAVWVELEMQLSPTQTALFL
FT                   FCNKKRDKLKILYWDKTGFALWYKRLENAKFKWPTAVNSASLTLTEQQLHGLLSGYDVI
FT                   GHQPFSVQDCHVA"
FT   CDS_pept        complement(302157..302504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0058"
FT                   /locus_tag="XBJ1_0289"
FT                   /product="putative Transposase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0289"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79440"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWS5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79440.1"
FT                   /translation="MMEKTHMSQSRFTQAEWRDLFEQQKKSELTVPQFCQKIGVSTTRF
FT                   YHHRQRTSHPPEKPSGLASPSAFIKVSTAQKKSASSSILPILFETPHGTLRFPAGTDKH
FT                   VIIAIIRGLAA"
FT   operon          302619..303326
FT                   /operon="XBJ1_operon0059"
FT   CDS_pept        302619..302795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0059"
FT                   /locus_tag="XBJ1_0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0290"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79441"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYR3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79441.1"
FT                   /translation="MSGIEGRIRKALEQGQVVEMSSVPIYKDPSRIPAGITMKAEGSGG
FT                   FYEYVTVLNPPGM"
FT   regulatory      complement(302702..302761)
FT                   /regulatory_class="promoter"
FT   CDS_pept        302799..303326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0059"
FT                   /locus_tag="XBJ1_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0291"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79442"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYR4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79442.1"
FT                   /translation="MSIESLNNILPLPIHPNENGQNRKWSLIDERHAFPKDYIDFITQY
FT                   GTGRIADFITIFNPFSEDDDLNFFRQKEWIIEDFNSLVESDPDYYPFILYPKKDGLLPI
FT                   GVTDNGDYIFWVVSSDDSELWKVAIIAARAPEVEYRQENFTDFLEGVLSRKIKCMSFPD
FT                   GFPPNSIEFDRI"
FT   regulatory      303334..303375
FT                   /regulatory_class="terminator"
FT   operon          303397..305960
FT                   /operon="XBJ1_operon0060"
FT   CDS_pept        303397..304467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0060"
FT                   /locus_tag="XBJ1_0292"
FT                   /product="Rhs-like core protein (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0292"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79443"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYR5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79443.1"
FT                   /translation="MTQSQQAGRVIRRGDVSYRYDDSGRLVEKTVQRDGFRPQVWRYRW
FT                   DALNQLTQCETPDGSRWYYQYDAFGRRIRKLKVHDGKLAAANLQRWLDGKPDLTPKPRT
FT                   MMGQDYLWSGDQLIEETPLYADGTPAEDQRIRWLYEPGKLTPSARYERGKLHYIVSDHQ
FT                   GTPREMLNEEGGLVWAQRLTTWGKAEKSQVIASNDPDYHVGCHFRFMGQYEDEESGLYY
FT                   NRFRYYDRETGQYLTPDPIGLLGGLNPYGYVDNPVNFIDPFGLAKCHLDNPKKKVNSAD
FT                   VGDFVRTPTSHPDDFTKIKGGNYKNKNTNEIWSKSNTTHSDKEGEWKVGIGKAEPKPRH
FT                   KITIGMSDGKIIKIDK"
FT   CDS_pept        304439..305026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0060"
FT                   /locus_tag="XBJ1_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0293"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79444"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYR6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79444.1"
FT                   /translation="MEKSLKLINNNFSLSEFNFSGFSSSVNWVGFFERKHDFSYHLIDE
FT                   SIELFSDFFEGKHASPTIITALSFDDDKEDDIETIARYQEIYHSVKEKNLLLPMTESYE
FT                   NYLYGETLLPAHSLSFSFTKNDFIDLSKLIMCHAGVIGQVCFYINPALNIGVYPHEDTG
FT                   FGCIALNGEKNTCIDFLTYCKKNENFNVVIDN"
FT   CDS_pept        305056..305649
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0060"
FT                   /locus_tag="XBJ1_0294"
FT                   /product="Rhs protein (fragment)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CBJ79445.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        305631..305960
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0060"
FT                   /locus_tag="XBJ1_0295"
FT                   /product="Rhs protein (fragment)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CBJ79446.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        305890..306267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0296"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79447"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYR9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79447.1"
FT                   /translation="MGWRAKIAISSLNYLHQTQYLSVRGEYEEIITGKGTPRVHKDTGI
FT                   QKNLEDRKGKTNKFWIGAKEWQVVHSGKGLDPHHRILEQTLPNGQKIYGYVLNHDYEKV
FT                   YKFPSPWYPDGGKYPGHKSMK"
FT   CDS_pept        complement(306077..306388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0297"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0297"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79448"
FT                   /db_xref="GOA:D3UYS0"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYS0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79448.1"
FT                   /translation="MITQVKKVNIIGYSAFYIINIYAIFTVDHSIAILLNNLMFIISLT
FT                   CALDIYHHRGTKDSEIYRLFRNHDLIHIHIFFDHSVMFVLVCDGVGQALFLNELLAIL"
FT   regulatory      306292..306351
FT                   /regulatory_class="promoter"
FT   CDS_pept        306437..307033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0298"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79449"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYS1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79449.1"
FT                   /translation="MQSSVKVKKEDTITISYYINGICAFEFNGHIIDKENTLTNSQGFS
FT                   FVIKTSDEPPLTIIAILKEWVKGNDFIYWKNNKCIEAKNLWLTACLYWQQIFPPKPNKI
FT                   LNASLSLEGINNYLDFFCMLGEAFWGKRGYIGRDFHGFDDLLGDLSYEKSEINIYIENM
FT                   NKLKLFLERISPPDYNYHEIFMGILVNRKCNINKK"
FT   regulatory      complement(306479..306538)
FT                   /regulatory_class="promoter"
FT   regulatory      307214..307247
FT                   /regulatory_class="terminator"
FT   regulatory      307225..307284
FT                   /regulatory_class="promoter"
FT   operon          307304..307998
FT                   /operon="XBJ1_operon0061"
FT   CDS_pept        307304..307579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0061"
FT                   /locus_tag="XBJ1_0299"
FT                   /product="Insertion element iso-IS1N protein insA"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0299"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79450"
FT                   /db_xref="InterPro:IPR024431"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYS2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79450.1"
FT                   /translation="MAKVEVDCRYCHQSEDVKGQGKGHRGYPRYRCYACSKVFQLAYTY
FT                   QACKPGVKEQTIDMAMNNSGIRDTARVLKVATATVMKTLKNSTPGT"
FT   CDS_pept        307576..307998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0061"
FT                   /locus_tag="XBJ1_0300"
FT                   /product="Insertion element IS1 1/5/6 protein insB"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0300"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79451"
FT                   /db_xref="GOA:D3UYS3"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYS3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79451.1"
FT                   /translation="MTTLPLDGDDIHLICEVDEQESFVGSQKNQRWLWYAWEPRMKRIV
FT                   AHTFGDHSRKTWEKLLALLSPFNIRFYCTDDYAVYDCLPEEVHLTGKIFTQRIERTNLT
FT                   HRTRIKRLNRKTIGYSKSEEMHDKVIGTFIERENYI"
FT   regulatory      308016..308075
FT                   /regulatory_class="promoter"
FT   operon          308127..310288
FT                   /operon="XBJ1_operon0062"
FT   CDS_pept        308127..308558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0062"
FT                   /locus_tag="XBJ1_0301"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0301"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79452"
FT                   /db_xref="InterPro:IPR025633"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYS4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79452.1"
FT                   /translation="MTWIKPSFLWMMYRAGWGTKDSGQERILAIDITHEGFREILQQGV
FT                   ISHYDPDLFYSQEEWKKEVQQSDVVIQWDPERDIHLNKLEQRTIQIGLRNQAVERYVNK
FT                   WIINIEDITNRAHQIHELVKMNKLDMAYNLLPEETIYLE"
FT   CDS_pept        308598..308885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0062"
FT                   /locus_tag="XBJ1_0302"
FT                   /product="Rhs element Vgr protein (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0302"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79453"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYS5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79453.1"
FT                   /translation="MIFQIYSFLRAAHTLTVGGVMNTAVALSQSEQVGVHKSVIVGNTL
FT                   SIKAGDVIELQCGASTLRMDSSGKITLIGTEFKFEASGPVQITGKDIDLN"
FT   CDS_pept        308901..309926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0062"
FT                   /locus_tag="XBJ1_0303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0303"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79454"
FT                   /db_xref="InterPro:IPR018683"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYS6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79454.1"
FT                   /translation="MEFRNLTPFAVMNYSMLDVADTEHRVMVMKIGYQLLPDRRGHCLA
FT                   ELLPAPPLCLQDEYRGQMNASQVLQESDLAPFKPRCDVIVNGTAYAPDNRPCTAFPVRL
FT                   HVQSKQGQTLLDKTLTVTGEREFIRDAGGQWQLTDPKPFSTLPLDYRYAFGGECKIQAD
FT                   DKAVAQLKESDRLTSAQRQQHPDGEKAPVAHAACETNPLGMGFITPWYANAKPLTRCPA
FT                   PRISAPEVPFTAPHFAKQLAGTLSADTPACQPQGLGFLGRPWLPRRQLAGTYDADWRAP
FT                   ACHPAGASSVYFAAAARREDVARADAPRYVNARQRGADAASDLSAECENRAAHSGGGSA
FT                   I"
FT   CDS_pept        309454..309990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0062"
FT                   /locus_tag="XBJ1_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0304"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79455"
FT                   /db_xref="InterPro:IPR018683"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYS7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79455.1"
FT                   /translation="MTEKKRRLLTPPVKPIRWEWDLSRRGMPTPNHLPVAQPPALARRR
FT                   YRSRHRILRNSWREHYLPIHPPASRRGWAFSAGRGCPAASLPALTMPTGGHLHVTLPGH
FT                   RPFILLRLHDGRMLPVPMRLDTLMLDSEALTLHLTCRLNVKTALPIRVAEARFEINPDA
FT                   PLLKMAPPEEEKKDG"
FT   CDS_pept        309983..310288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0062"
FT                   /locus_tag="XBJ1_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0305"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79456"
FT                   /db_xref="InterPro:IPR025425"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYS8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79456.1"
FT                   /translation="MADNYIVRTAGEWLIVGLLPDVCKTPMGASTPPIPYPVVAKLADS
FT                   SAPEMLWKAFVIQGLKLISLLGSQLSVLSGLFMHIRLLCGRKMRVTTGVKCPRHVS"
FT   CDS_pept        310135..310380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0306"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79457"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYS9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79457.1"
FT                   /translation="MESLCYTGLEADIFARESTVGTVWFVYAYQATMRQENEGNNGCKM
FT                   STSRQLACILNVWYWVVCKELAIFSKQVHNGAHLGT"
FT   tRNA            310460..310535
FT                   /gene="GlyGCC"
FT                   /locus_tag="XBJ1_tRNA0003"
FT                   /product="tRNA-Gly"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   regulatory      310462..310521
FT                   /gene="GlyGCC"
FT                   /locus_tag="XBJ1_tRNA0003"
FT                   /regulatory_class="promoter"
FT   CDS_pept        310557..310709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0308"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79458"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYT0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79458.1"
FT                   /translation="MKVCKPQKKGPKGPFYVPVIMTKIHSHPALFSRSLITPGLRLPEP
FT                   FGYLG"
FT   regulatory      complement(310571..310597)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(310715..311359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0309"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0309"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79459"
FT                   /db_xref="GOA:D3UYT1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041347"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYT1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79459.1"
FT                   /translation="MTDREKVGRRERKKLMLRDALIKTSYELFAIKGFDETRVEDITEK
FT                   VDVSTRTFFRYFSSKEDVVLDYQEAEHKDFIAALIRRPPHEPALSALRHTAVEIMRKCE
FT                   GGSYGFNTNCFMTLQDLIRNHPLVRAKNLQRGEDRKPPIISLIAQRMGTDPKIDIRPGI
FT                   LAGVLDYAHWATYDVWKRKKHSSMRYSDVLDEVFLIIENGLNFPANNQPDI"
FT   regulatory      311412..311471
FT                   /regulatory_class="promoter"
FT   regulatory      complement(311439..311498)
FT                   /regulatory_class="promoter"
FT   operon          311668..319990
FT                   /operon="XBJ1_operon0063"
FT   CDS_pept        311668..318822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0063"
FT                   /locus_tag="XBJ1_0310"
FT                   /product="putative non-ribosomal peptide synthetase"
FT                   /EC_number="5.1.1.11"
FT                   /EC_number="6.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0310"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79460"
FT                   /db_xref="GOA:D3UYT2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYT2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79460.1"
FT                   /translation="MSIATDIGEPTSYERDLWVEELHDPHCHQFTVALSELLPRSIDLV
FT                   NLKGVAEQVLESEQASHKSFHEQEGHLVLKKAPVVVCAELYEFKNEDDFALFFNEWSRK
FT                   IWDLSVSPLVEIAIGQTDQATILMVRAHHIVADGWGLNLLSKKILGAYADNHLGLNEQL
FT                   KGVKRYATKYPTLQGSKLDEAIHDVVVKIADTDPVLFPKSGAALSTSPSYIRPFKISAH
FT                   EVAHGIENGFTPFLAVSTALAVLLSNAYGSEKFFIGVPFLNRTDAEITSVSHRANILPV
FT                   KVEVLPQNTLRAIYSQIKDFIVFLKDKESVPLGGIISALASSSRQLFDVTMSYLRYPEW
FT                   GAIAGFEEKTQNIAHMHTQDAIAIHLYTYGNNADVWGDVCLNSSVFDTEDSANAFLDTF
FT                   IHLINNFGNNVDKHVSEVNLLTSKQMEQLRQYENGPTKQYSVNETVVSLFEAKAEQFPE
FT                   NIALRDQIGTSLSYSQLNAWSSTIAAALEGRGIGQGDIVAVSVERSPEMLAAIFGVLKT
FT                   GAAYLPIDSDYPEDRIQYMLNDSNAKLVISNLPHVMKSDDPRLFRLDALPTELPSHHQY
FT                   RSKAQPHEPAYVIYTSGSTGRPKGVIVEHHSVVNRLEWMQEIHPLTSDDVILQKTSISF
FT                   DVSVWELFWWAMTGASVALLKQGAQRDPRELIQTISTLGVTVAHFVPSMFEPYVQTLTD
FT                   DRQSLLSVSSLKCLFTSGEALTPAVVNKYRKLFGRDTRPPRLINLYGPTEATVDVTYYE
FT                   LNLEQDSDINAVPIGFPINNTSVRIASLHGVRQPIGISGELQIGGVQLARGYLNRPELT
FT                   AERFIIDQNDSCSRWYRTGDLAAWAEDGSILYLGRMDGQVKIRGNRIELGEIKNALLNL
FT                   PEVLNAEVIVEDDARGKHLIAVYVGRQDLNERDIRAKLGKQLPSFMVPARFVRLGGIPL
FT                   TPNGKFDRASALREVSGNKASPQTVKLDESETIVAKIWEKVLGRSNIGADDDFYTLGGD
FT                   SILMLKVRSELESHGYDVGLSDLAQYTTVCSLGNVLESVSRVLSSPKEALPPFALISAT
FT                   DQKMLSSVYDDAYPVSQLQLGLLFHSREMEGARTYKDVFRYTLKSAWNEAAFRSALQGL
FT                   VRRHPALRTVFNLSDYHLPLQLIRPEILIDDVLSIKTPDVVEYEHTVLAHMDKWSRYNY
FT                   SFLSGPLFHVAIFANSESNYIDLVFSFHHAILDGGSVANLIRELLLSYSQGNDGANLGY
FT                   PEDELPNPSIFVQNEIETLEASESKNYWKEYLSGATNTLPIGLAGYSTAPVKRIFSYRF
FT                   LIDPVLDVALNQLARTIRVPIKHLYLAAHCTTIALMSGKEEIVTGVVTHTRPEIKHSER
FT                   ILGLFLNTLPLRVDIKNWNWLQVVEGLYRNEKRSHKHRCFPLSQIQADNELLSVQTAFN
FT                   YVHFHILQDISAKSGIEIVAFDPKEETNFDILVNVMRDVDGERTSVRVDLNGSIYAREQ
FT                   GAVFSRLFNRVLERIAYQPELPVSLSHSITEVGCLVERTSDKVFISLPAMIRNSVQRDP
FT                   DAVAITYDNVEWSYQQLWDAATEIAFLLSERGVHKQDVVGIALPRSFEQIATVLAILRI
FT                   GAICLPIDLSYPASRIELILKIANPAVVVTDHSITELPTSVRMLFLEHDSIAATAERDD
FT                   ATIDSADAAYILFTSGSTGTPKGVTMLHRGLTNLVGWQNKISSGAKVTSTLQFSPLSFD
FT                   VSFQEILSTLSSGATLHLISEMERRDPVALVRHLDRKGVERIFLPYIALQQLAETAVML
FT                   EFFPKKLRVIVSSGEQLRVTKEIRTLVDNLPGGILENQYGPTETHVVTSYTMSSDPSQF
FT                   PALPPIGIPITGVGIVILDESSNVVPDGVPGEICVFGDALASGYYRSPEETKKKFIAHA
FT                   DVPGGMFYRTGDIGIRSACGEIISLGRKDTLVKVRGYRVELSEIELKILEFFEKIKKNV
FT                   EVAVVARPRDDLDSYLIAYLVGKEDGIALEELRQFIGAELPAYMVPTHITWINELPKTP
FT                   SGKRDDAMLRKLDIQLVSEKNYRGPAGEYESRLCELTAELLKIPEIAPEQSIFDCGATS
FT                   LTAMRIVVLVEKLYGINVPLSAFVSAPTIAKLAMLIQNGGGQFKFDPLVPLRKAGNSRP
FT                   LFLVHPMGGNILSYLRMLPYLPSDQPLYALQASGVDAGSSPITTIEEQAAFYIEAIKRI
FT                   QPTGPYVIGGWSYGGFIAFEMANQLIRSGEMVSNILILDTMALSSQAKGQASDDALLSW
FT                   FFWELLWTSKGSSLPVHVVPSYIESLQEKFEYITDHATQIGAIPEGSTKAVMQRLFEVY
FT                   SANWQAAAEYNAQCPNLDVTLIRAKQPLPQILQEMHNTIRSEYHDPLNGWGGKTSGRVN
FT                   LIEVDGDHLTIMEEPFVGPMVSAIITEINKVKGVNANV"
FT   CDS_pept        318809..319990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0063"
FT                   /locus_tag="XBJ1_0311"
FT                   /product="putative FAD-dependent monooxygenase"
FT                   /EC_number="1.14.13.90"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0311"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79461"
FT                   /db_xref="GOA:D3UYT3"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYT3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79461.1"
FT                   /translation="MLMSRKPSALIVGTGIGGLSCAIALKKIGWSVRLFEKTDSLRATG
FT                   SGLSVMSNASSAMKKLLDIDLGLKNYGAEVRNFEIRHSSGLLLKRLPVQKISDEQGTPS
FT                   ICISRENLQRALLDQLGDADISFGKRVTGYNETSDAVHINFEDGTVSSGDIIVGADGFY
FT                   SAIRDAIGTESIIQEAGYICWLALVKYSHPKITPGYVAHYWGRGKRMGIVDIGDGWVYW
FT                   WGTANMSNDDAKRWKGTNRDVAEFYAGWPDLVQDIINSTDSESIITVDAKDRTFPEHWT
FT                   KGRVTLLGDAAHPMLTSLGQGAGISIEDAAVLGYVLKNTEDYRVALRRYEAIRQPRARA
FT                   IVNTSRSLSDIEQHDRFFPCLERDVSMLLTSKKSMRKRLQDSLLFDDLAIQAQ"
FT   CDS_pept        complement(320206..323574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0312"
FT                   /product="putative oxyreductase protein"
FT                   /EC_number="1.2.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0312"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79462"
FT                   /db_xref="GOA:D3UYT4"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYT4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79462.1"
FT                   /translation="MTQHYPSKFVTGTDALAELLLAQAELDKSHNLNTAGFVAGYRGSP
FT                   LARLDQALWQHGKELAQSNIRFQPAINEDLAATALIGTQKVESDPDRNVIGVFGMWYGK
FT                   GPGVDRSGDALRHGNAYGSSPHGGVLVILGDDHGCVSSSMSHQSDLVLMAWSMPILHPA
FT                   SVSDYHDVGLWGWAASRASGAWVGFKAISEVVESSAIRKSKPFPEYKTPEIDSGPDGLH
FT                   WRWPDLPGPQIEKRLAYKLKAVEAFARANPIDQLLAPCAHPRALLVTVGKAHRDVLEAL
FT                   RAGGLTPSQLAKQGVAFVHVRLVYPLSPLLSDLASQVTDIFVIEEKNAVVEILLARHLV
FT                   NSQKNIKLIGKHNHLGQQFLPADIELRPSLITPLLSGWLNKLDLFLSVPLEWATKTTPH
FT                   DLTLPKRTPYFCAGCPHSTSTRLPEGSQAQIGIGCHVMAAWMDRNTGFGLVQMGGEGAD
FT                   WVGHSPFINRPHLFQNLGDGTYFHSGHLSIRQSIAAGNHITYKLLFNQAVAMTGGQPLD
FT                   GNLTIPQIVALMLAEGVKEVAIVTDDIDKYQDKNLLTAKVTLYQRDYLEEVQKRFREIA
FT                   GVTVIIYDQACATELRRKRKRGLEPKATRRAVINELVCEGCGDCQVQSNCLAVIPVKTS
FT                   LGTKRKIDQHVCNSDLSCLKGFCPSFVTVENANPRHDLSKIIPQGDLDKLLRELPQPIL
FT                   IISDNPYEILLVGVGGTGIVTAGNLLAIAAEADNYSVSLLNFTGFAQKGGEAITHVRLC
FT                   HDMNKLHQVRIDRGRANLIIAADLVAATGQNSLTVMSKSATKCVLNTHETQIGTMLRAP
FT                   TLNLDHPKMMTTLHQHCQTLNSIDAEIMAADLVGDRNQTNIVLIGYAWQLGKIPITLSA
FT                   IDHTIQALGNAADSARRAFHIGRIAAVQPDILNERLHIKPQESIKTLDDLIMHRYQFLV
FT                   DYQNEGYAQRYLSRVAQIQLVTQQIDAEEIAKAVAENLFKLMAYKDEYEVARLYAKSDF
FT                   FENLRSQFDNTDNIRFHFSLPLFNRKDPRTGERGKREYGTWIIPIFRVLAACKPLRGTM
FT                   FDIFGYQEERRQERNLLLEYERLLDFLIEKLNRDNLAICQQLAELPDQVRGFGHVKQKA
FT                   IKNMMERKEALLEKL"
FT   regulatory      complement(323601..323660)
FT                   /regulatory_class="promoter"
FT   tRNA            323909..323984
FT                   /gene="GlyGCC"
FT                   /locus_tag="XBJ1_tRNA0004"
FT                   /product="tRNA-Gly"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   CDS_pept        324038..324223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0313"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79463"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYT5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79463.1"
FT                   /translation="MTHISYLNKVHRNLITINPAKISSYLMIPSYYLASQACRKSANYS
FT                   GADGLGLITSLIFMKS"
FT   regulatory      complement(324147..324177)
FT                   /regulatory_class="terminator"
FT   regulatory      324220..324279
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(324232..324450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0314"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79464"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYT6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79464.1"
FT                   /translation="MFRSGAARKKIPRYSSKAVGKQKWINPAIIELVDGLEQWSYICVR
FT                   HKMTNDQKNVTNIQNIDLLLYGLVKDN"
FT   CDS_pept        324385..324576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0315"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0315"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79465"
FT                   /db_xref="GOA:D3UYT7"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYT7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79465.1"
FT                   /translation="MFAYGLAGIAGNFLSGSAATKQLRWTLVFITIGITAAVLLFSPLG
FT                   GSIAGSNYLIRTIYHYHK"
FT   CDS_pept        complement(325026..326183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0316"
FT                   /product="putative electron transport protein yjeS"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0316"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79466"
FT                   /db_xref="GOA:D3UYT8"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYT8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79466.1"
FT                   /translation="MATPLDLNLLATNIKQWSLSLGFQQVGICDTDLSAEEPKLQEWLD
FT                   KQYHGEMDWMARHGMMRARPHELLPDTLRVISVRMNYLPAKAAFASTLNNPELGYVSRY
FT                   SLGRDYHKLLRQRLKKLGEQIQDYCSAHEYQGTLNFRPFVDSAPIMERPLAAKAGLGWV
FT                   GKHSLILNRESGSWFFLGELLINLPLPIDAPQEEQCGRCVACMTTCPTGAIVEPYTIDA
FT                   RRCISYLTIELDGVIPEELRPLMGNRIYGCDDCQLICPWNRFSQLTDEVDFSPRAALHT
FT                   PKLLDLFSWSEEKFLRITEGSAIRRIGYLRWLRNISVALGNALYQDDIVLALKKRIGLS
FT                   EVLDEHIHWAIDQQITRRNANTIEVQTSQQKRLIRAITKGIPRDA"
FT   regulatory      326305..326364
FT                   /regulatory_class="promoter"
FT   operon          326389..331096
FT                   /operon="XBJ1_operon0064"
FT   CDS_pept        326389..326853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0064"
FT                   /gene="yjeE"
FT                   /locus_tag="XBJ1_0317"
FT                   /product="putative enzyme with nucleoside triP hydrolase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0317"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79467"
FT                   /db_xref="GOA:D3UYT9"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYT9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79467.1"
FT                   /translation="MKELVLLLPNENATVALGNAVAATGDRGYVIYLYGDLGAGKTTFS
FT                   RGFLQALGHQGHVKSPTYTLVEPYALLPRPVYHFDLYRLSDPEELEFMGIRDYFHQDAI
FT                   CLVEWPQQGAGFLPDADIELHLSYDSEGRRARFVALSEYGENLLDNLKSL"
FT   CDS_pept        326868..328193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0064"
FT                   /gene="amiB"
FT                   /locus_tag="XBJ1_0318"
FT                   /product="N-acetylmuramoyl-l-alanine amidase II, a murein
FT                   hydrolase"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0318"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79468"
FT                   /db_xref="GOA:D3UYU0"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYU0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79468.1"
FT                   /translation="MMNAFFVKVIKKWQAHWVMSCVLFVMLSQLIMMTATAATLSNIHV
FT                   NNSPSEATVTLGFTGGHPDYRFFPLHAPERLVVDIRQSGHVMGLPMRLSGQNLVKVIRT
FT                   SQSPDAQHKRLVLELAHQATATSSVKESASEYQVMFTLKTNSATAKSTTNSTSMLKGNT
FT                   SLHESKQLLANNAQSPKQEIKQTPAHHDQGVKKQATKAAQGKYPIVIAIDAGHGGTDPG
FT                   AIGQGGLKEKNVTISVARKLEVLLHNDPMFKPVLTRGGDYFISVAGRSEVARKHKANML
FT                   VSIHADAAPNRSARGASVWVLSNRRANSELGNWLEQHEKQSELLGGAGDVLSNGINPLL
FT                   SQAVLDLQFGHSQRVGYDVAVQVLSQLSHIGSLHKRRPEHASLGVLRSPDIPSILVETG
FT                   FISHLSEEELLGSNDYQARLAQAIHFGLRHYFQANPLQTSPM"
FT   CDS_pept        328219..330162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0064"
FT                   /gene="mutL"
FT                   /locus_tag="XBJ1_0319"
FT                   /product="enzyme in methyl-directed mismatch repair,
FT                   stimulates binding of Vsr and MutS to heteroduplex DNA"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0319"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79469"
FT                   /db_xref="GOA:D3UYU1"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYU1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79469.1"
FT                   /translation="MAIRILPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDIE
FT                   IERGGAKLIRIRDNGCGIDQQDLTLALARHATSKIASLDDLEAIVSMGFRGEALASISS
FT                   VSRLTLTSRTESQTEAWQAYAEGRDMEVTVKPAAHPVGTTVEVLDLFYNTPARRKFLRT
FT                   EKTEFGHLDEVVRRIALARLDVAINLHHNGKLVRQYRPAKEESQHERRLAAICGMAFVQ
FT                   QALALSWQHDSLSIKGWVADPMSDTVGGDIQYCYVNGRMMRDRLINHAIRQAYQDLLQG
FT                   EKQPAYVLYLEIDPHQVDVNVHPAKHEVRFHQARLVHDFIYQGVAAVLKQRGKGAELAL
FT                   GCEEPAASWVPENRLSAGENHFLQQNTASLKASPPSRAAAAPSVSSGGHDKEQPQLDRP
FT                   HSGNDTRQLHHGENYQKKQGELYQKMMQSAPEEKRPLFPERAVSVREKAAPIPVGAALL
FT                   QGKNISYSFGKVLSIHAASYALIESPLGIGLLSLPVAERWLKQVQLTPGELGLKSQPLL
FT                   IPLKLSLSQAEIDALKQNSELLKTFGIESTVAHGKVTIHAVSLPLRQQNLPKLLPELLN
FT                   YLVEQPSACAEQVAIWLSRHVGSEHETWNIAQAVQLLADVERLCPQLVESPPEGLLQLI
FT                   DLQAVVALLNHE"
FT   CDS_pept        330200..331096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0064"
FT                   /gene="miaA"
FT                   /locus_tag="XBJ1_0320"
FT                   /product="delta(2)-isopentenylpyrophosphate tRNA-adenosine
FT                   transferase"
FT                   /EC_number="2.5.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0320"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79470"
FT                   /db_xref="GOA:D3UYU2"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYU2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79470.1"
FT                   /translation="MGPTASGKTALSIALHQHLPVELISVDSALIYREMNIGTAKPTAA
FT                   EQAQAPHRLVDILDPAEIYSAADFRRDALKEMADITAAGRIPLLVGGTMLYFKALLEGL
FT                   SPLPSSNLEIRAQIEQQAAKHGWEALHRQLQEIDSVAAARIHPNDPQRLTRALEVFRIS
FT                   GKTLTALTEMSGEILPYRVHQFAIAPASREILHQRIAARFEQMIKSGFEDEVKALYARS
FT                   DLHTDLPSIRCVGYRQMWSYLSGEISHDEMVYRGICATRQLAKRQITWLRGWDNVTWLD
FT                   SDQPEQALNTVMQVIST"
FT   operon          331205..332885
FT                   /operon="XBJ1_operon0065"
FT   CDS_pept        331205..331507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0065"
FT                   /gene="hfq"
FT                   /locus_tag="XBJ1_0321"
FT                   /product="host factor I for bacteriophage Q beta
FT                   replication, plays a role in degradation of RNA
FT                   transcripts"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0321"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79471"
FT                   /db_xref="GOA:D3UYU3"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYU3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79471.1"
FT                   /translation="MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVIL
FT                   LKNTVSQMVYKHAISTVVPSRPVSHHGNNPNVTTGVGNYHAGVNPAAPQESDGAE"
FT   regulatory      331512..331571
FT                   /operon="XBJ1_operon0065"
FT                   /regulatory_class="promoter"
FT   regulatory      331538..331574
FT                   /operon="XBJ1_operon0065"
FT                   /regulatory_class="terminator"
FT   CDS_pept        331605..332885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0065"
FT                   /gene="hflX"
FT                   /locus_tag="XBJ1_0322"
FT                   /product="putative GTPase subunit of protease with
FT                   nucleoside triP hydrolase domain, together with HflC-HflK
FT                   involved in stability of phage lambda cII repressor"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0322"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79472"
FT                   /db_xref="GOA:D3UYU4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYU4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79472.1"
FT                   /translation="MFDRYEGGELAVLVHVFFSQEKDTENLSEFESLVTSAGVSPVQIV
FT                   TGSRKAPNPKYFVGEGKAEEIAEAVKNSGADVVLFNHALSPAQERNLERLCQCRVVDRT
FT                   GVILDIFAQRARTHEGKLQVELAQLRHLSTRLVRGWTHLERQKGGIGLRGPGETQLETD
FT                   RRLLRDKIKQILGRLGKVEKQREQGRQARNKADIPTVSLVGYTNAGKSSLFNRITSAEV
FT                   YTADQLFATLDPTLRRIDVNDVGTVVLADTVGFIRHLPHDLVAAFKATLQETRQARLLL
FT                   HVVDAADSRLDENIVAVDSVLEEIEANEIPSLLVMNKIDMLEDFVPRIDRDEENRPIRV
FT                   WLSAQTGAGIPLLFQVLTECLSGEIAHYELHLPPEAGRLRSRFYQLQAIEREWIEDGGQ
FT                   IGIEVRMPMVDWRRLCKQELNLLDYVV"
FT   regulatory      332895..332954
FT                   /regulatory_class="promoter"
FT   operon          333193..335450
FT                   /operon="XBJ1_operon0066"
FT   CDS_pept        333193..334437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0066"
FT                   /gene="hflK"
FT                   /locus_tag="XBJ1_0323"
FT                   /product="with HflC, part of modulator for protease
FT                   specific for FtsH phage lambda cII repressor"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0323"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79473"
FT                   /db_xref="GOA:D3UYU5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYU5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79473.1"
FT                   /translation="MAWNQPGNNGQDRDPWGSSNNNGGNSGGNNKGGRNRGATNLDDLF
FT                   RKLSEKLGGFGGKKGGNGSEQGPKFGGRIIGLAVAAAVAVWVVSGFYTIKETERGVVIR
FT                   LGKFSHVVQPGLNWKMTFIDRVRAVNVESVRELATSGVMLTSDENVVRAEMNVQYRVTD
FT                   PAAYLFNVTSPDNSLSQATDSAVRGVVGKYTMEKILTADRTIVRNDTQKVLEETIRPYN
FT                   MGITLLDVNFQTARPPEEVQVAFDDVIAAREEEQKTIREAESYKNAVLPMAKGDAQRMI
FT                   EDARAYKVSVVLNAQGEVASFAKILPEYKAAPEITRERLYIETMEYVLSNTRKVIANEK
FT                   SNNMLVLPLDQVFRKQAEVPKTQSSDAKVAPEKSGSTHFAPEQGQTGYNNSSNNHSSYG
FT                   NPSSLRGETPRQGRP"
FT   CDS_pept        334440..335450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0066"
FT                   /gene="hflC"
FT                   /locus_tag="XBJ1_0324"
FT                   /product="with HflK, part of modulator for protease
FT                   specific for FtsH phage lambda cII repressor"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0324"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79474"
FT                   /db_xref="GOA:D3UYU6"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYU6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79474.1"
FT                   /translation="MRKSFVFAIAIILVVLYTSIFIVYEGQRGIVLRFGKVARDAENKP
FT                   LVYQPGLHFKIPFIETVKTLDARIQTMDIKADRFLTRENKDLIVDSYLKWRIKDFSRYY
FT                   LATGNGEIAQAELLLKRKFSDRLRSEIGRLDVRGIVTDSRGRLTTDVRNSLNLGTNDGG
FT                   TAETADNPVASAAANVGQETKDKQPILNQNSMAELGIEVVDVRIKQINLPQEISEAIYQ
FT                   RMRADREAEARLLRSQGLEEAEKIRAVADKTATEIKAKSNREALILRGEGDAEAAKLFA
FT                   DAFNKDPEFYAFIRSLRAYEKSFKNDGNNIMVLSPDSDFFRYMKAPFKQHSNTND"
FT   regulatory      335528..335565
FT                   /regulatory_class="terminator"
FT   regulatory      335614..335673
FT                   /regulatory_class="promoter"
FT   CDS_pept        335698..336996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="XBJ1_0325"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0325"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79475"
FT                   /db_xref="GOA:D3UYU7"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYU7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79475.1"
FT                   /translation="MGKNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLV
FT                   INGEKTVLHLIPSGILRENVISIIANGVVLAPDALMKEMNALESRGIPVRERLLISEAC
FT                   PLILPYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAVKLQ
FT                   EIIEYHNFQLVNYYNEPAVDYQKTLDDILAVADILTNMVVDVSDLLYKATQKGELVMFE
FT                   GAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGIIKAYSTRVGAGPFPT
FT                   ELFDETGEYLRQKGQEFGATTGRSRRTGWLDIVAIRRAIQINSLSGFCMTKLDVLDGLK
FT                   EVKVCIGYRMPDGSVIDTTPLAAENWEGLEAVYETLPGWDESTFGVKDHSLLPEAALSY
FT                   IKRVEELTGVPVDIISTGPDRAETMILRDPFDA"
FT   regulatory      337027..337055
FT                   /regulatory_class="terminator"
FT   regulatory      337076..337135
FT                   /regulatory_class="promoter"
FT   operon          337217..340124
FT                   /operon="XBJ1_operon0067"
FT   CDS_pept        337217..337636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0067"
FT                   /locus_tag="XBJ1_0326"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0326"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79476"
FT                   /db_xref="GOA:D3UYU8"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYU8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79476.1"
FT                   /translation="MQLTSFTDYGLRALIYMASLPEGQMTSITEVTEVYGVSRNHMVKI
FT                   INQLSNLGLVNAIRGKNGGISLGKPASEIKIGDVVRSLEPLSLVNCSACYITPACRLKL
FT                   VLNQAVENFLQELDKHTLADMVKDNRPLYQLLLAK"
FT   CDS_pept        337692..340124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0067"
FT                   /gene="rnr"
FT                   /locus_tag="XBJ1_0327"
FT                   /product="RNase R, 3'-5' exoribonuclease"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0327"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79477"
FT                   /db_xref="GOA:D3UYU9"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYU9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79477.1"
FT                   /translation="MSKDPFQEREAEKYESPIPSREYILDILSKHTTPVSRQELAKELQ
FT                   LTSADAQEAFRRRLRAMERDGQLIFTRRQCYALPERLDLLKGTVIGHRDGYGFLRAEGH
FT                   KEDFYLPAEQMKMAIHGDVILAQPLQPDRKGRVEVRIVRVLEPKNSQIVGRYFVDAGMG
FT                   FVVPDDSRLSFDILIPKEEICGARMGNVVVVELTSRPTRRTKAIGKIVEVLGETMGTNM
FT                   AVEIALRTHEIPHSWPPMVEKQVVDLDENVPDSAKKGRVDLRGLPLVTIDGEDARDFDD
FT                   AVYCERKRGGGWRLWVAIADVSYYVRPQTPLDTEARSRGNSVYFPSQVVPMLPEILSNG
FT                   LCSLNPEVDRLCMVCEMTISAQGKLSSYKFYEAVMNSHARLTYTKVWKILQGDQELREH
FT                   YQPLVTHIEYLHELYQALEQAREQRGAISFESEEAKFIFNAERRIERIEPVTRNDAHKL
FT                   IEECMILANIAAARFVEKNNEPALYRVHDQPREESILNLRSVFNELGLSLLGGMKPEPK
FT                   DFAQLMKDVAERPDHELLQTMLLRSMKQAIYDPENRGHFGLALSSYAHFTSPIRRYPDL
FT                   ALHRAIKYLLAQENGVVEQHWTPTGGWHNDMDHMLQLGNHCSMTERRADEATRDVADWL
FT                   KCDFMQDQVGNVFTGLITSVTGFGFFVRLNELFIDGLVHVSTLDNDYYRYDNVGQRLIG
FT                   ESSGQTYRLGDEVEIRVEAVHMDERNIDFTLLSSTRKARNQGKTARDKSKRGTPERNSG
FT                   KKGYDHKKSANFEPDNASSKKKKAEKPKASKKKTSDKTKKITAKLKAKRVKKTQEKS"
FT   regulatory      340126..340185
FT                   /regulatory_class="promoter"
FT   regulatory      340141..340172
FT                   /regulatory_class="terminator"
FT   CDS_pept        340211..340948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0328"
FT                   /product="putative tRNA/rRNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0328"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79478"
FT                   /db_xref="GOA:D3UYV0"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR024915"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYV0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79478.1"
FT                   /translation="MSEIIYGIHAVKALLDREPQRFMEVYVLKGREDRRLTPLLRELED
FT                   IGITVQLANRQWLDTQTESAVHQGIIAKVKPGRQYQESDLPDFLSQLDRPFLLVLDGVT
FT                   DPHNLGACLRTADAAGVDAVIIPRDRSAQLNATTKKVACGAAENVPLIRVTNLARTLRL
FT                   LQESNIWIVGTAGEATHSLYQSKLTGPVALVMGAEGEGMRRLTREHCDELISIPMAGSV
FT                   SSLNVSVATGVCLFEIMRQRSAQ"
FT   regulatory      340955..340996
FT                   /regulatory_class="terminator"
FT   regulatory      341004..341063
FT                   /regulatory_class="promoter"
FT   operon          341155..342599
FT                   /operon="XBJ1_operon0068"
FT   CDS_pept        341155..341553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0068"
FT                   /gene="rpsF"
FT                   /locus_tag="XBJ1_0329"
FT                   /product="30S ribosomal subunit protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0329"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79479"
FT                   /db_xref="GOA:D3UYV1"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYV1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79479.1"
FT                   /translation="MRHYEIVFMVHPDQSEQVPGMIERYSATITNAQGQIHRLEDWGRR
FT                   QLAYPINKLHKAHYVLLNVEAPQEAIDELETNFRFNDAVIRSMVMRVKHAVTEPSPMVK
FT                   AKDERRSRDLVLEEDMADDADEAGDSEE"
FT   CDS_pept        341559..341876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0068"
FT                   /gene="priB"
FT                   /locus_tag="XBJ1_0330"
FT                   /product="primosomal replication protein N"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0330"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79480"
FT                   /db_xref="GOA:D3UYV2"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR023646"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYV2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79480.1"
FT                   /translation="MAANRLVLSGTVCKVPIRKVSPSGIPHCQFVLEHRSQQQEAGCSR
FT                   QSWCKVPVIASGQLLQEFTHSITVGSRITVSGFINSHQGRNGLSKLVLHAEQIELIDSG
FT                   D"
FT   CDS_pept        341881..342108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0068"
FT                   /gene="rpsR"
FT                   /locus_tag="XBJ1_0331"
FT                   /product="30S ribosomal subunit protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0331"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79481"
FT                   /db_xref="GOA:D3UYV3"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYV3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79481.1"
FT                   /translation="MARYFRRRKFCRFTAEGVQEIDYKDIVTLKNYITESGKIVPSRIT
FT                   GTRAKYQRQLARAIKRARYLSLLPYTDRHQ"
FT   CDS_pept        342147..342599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0068"
FT                   /gene="rplI"
FT                   /locus_tag="XBJ1_0332"
FT                   /product="50S ribosomal subunit protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0332"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79482"
FT                   /db_xref="GOA:D3UYV4"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYV4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79482.1"
FT                   /translation="MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIE
FT                   FFEARRVELEAKLADVLTAAEARAAQINALGSVTIASKAGDEGKLFGSIGTRDIADAVS
FT                   AAGVAVSKSEVRLSNGVLRTTGEHEVHFQVHSDVFAQLNVNIVPEA"
FT   regulatory      342623..342676
FT                   /regulatory_class="terminator"
FT   regulatory      342640..342699
FT                   /regulatory_class="promoter"
FT   CDS_pept        342765..343385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fklB"
FT                   /locus_tag="XBJ1_0333"
FT                   /product="FKBP-type 22KD peptidyl-prolyl cis-trans
FT                   isomerase (rotamase)"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0333"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79483"
FT                   /db_xref="GOA:D3UYV5"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYV5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79483.1"
FT                   /translation="MTTPSFESIEARASYGIGLQVGQQLQESGLQGLEPEALLAGLCDA
FT                   LENRSPAIPVEELHRALREIHERADSVRHEHQQTMAEEGKKFLAENAEREGVSSTESGL
FT                   QFSVLTQGDGAIPARSDRVRVHYTGRLMDGSVFDSSVQRGTPAEFPVSGVIPGWIEALT
FT                   LMPVGSKWELYIPHNLAYGERGAGASIPPYSTLIFEVELLEIL"
FT   regulatory      343399..343446
FT                   /regulatory_class="terminator"
FT   regulatory      343422..343481
FT                   /regulatory_class="promoter"
FT   CDS_pept        343529..344269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ"
FT                   /locus_tag="XBJ1_0334"
FT                   /product="protein that acts on
FT                   3'-phosphoadenosine-5'-phosphosulfate with sugar
FT                   phosphatase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0334"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79484"
FT                   /db_xref="GOA:D3UYV6"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYV6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79484.1"
FT                   /translation="MLQQICQLAREAGAAIMVVYQDEQPLKVEHKMDDSPVTAADIAAH
FT                   KIIKAGLMRIAPDIPLLSEEDPPVWEERKNWQRYWLVDPLDGTKEFIQRNGEFTVNIAL
FT                   IEDGVPVMGVVYVPVLNVLYAGQGHQAWKETNGQTIPIKVAAAVLPTVVISRSHIDEEL
FT                   KDYLTQLGTHQTVSVGSSLKFCMVAEGKAQLYPRFGPTNIWDTAAGHAVAIAAGAHVTD
FT                   WEGKKLNYAPRESFLNPGFRVTIF"
FT   regulatory      complement(344280..344326)
FT                   /regulatory_class="terminator"
FT   regulatory      344300..344331
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(344364..344906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0335"
FT                   /product="Protein ytfJ precursor"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0335"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79485"
FT                   /db_xref="InterPro:IPR006513"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYV7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79485.1"
FT                   /translation="MLYAILSLTSVFASAHNIAVGQPVPTVSVTDKGELLLNNDKFSYQ
FT                   NWNSTELPGKVRTIQHIAGRSSAKEMNDPLIQALKQADLPKEKYQTTSIVNTDDAIFGT
FT                   SVFVRNSLEDSKKEFPWSQFIVDSEGLAKKAWGLEPKSSAIIVLDKNGNVKFVKDGKLS
FT                   NEDITHVLNLIKEELNN"
FT   CDS_pept        344779..344946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0336"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0336"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79486"
FT                   /db_xref="GOA:D3UYV8"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYV8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79486.1"
FT                   /translation="MNLSLLSSNSPLSVTLTVGTGCPTAMLWADANTEVKLSIAYNIMF
FT                   FIIFIPYLAW"
FT   regulatory      complement(345012..345071)
FT                   /regulatory_class="promoter"
FT   CDS_pept        345243..345449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0337"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0337"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79487"
FT                   /db_xref="InterPro:IPR009491"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYV9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79487.1"
FT                   /translation="MKIFHHYNPLKVALYVKTLFRGRLYIKDMGAFEFNYGKILPPKIK
FT                   DKRHLNVMSEINQQVLRLQAEMG"
FT   regulatory      complement(345507..345532)
FT                   /regulatory_class="terminator"
FT   regulatory      345519..345544
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(345549..346775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ytfL"
FT                   /locus_tag="XBJ1_0338"
FT                   /product="putative hemolysin-related membrane protein with
FT                   CBS regulatory domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0338"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79488"
FT                   /db_xref="GOA:D3UYW0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYW0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79488.1"
FT                   /translation="MADEGNLNAAHVLKLQETPGMFFTIVQIGLNAVAILAGVVGESAF
FT                   SPALKTLFSNFMRQEWADQLGFICSFIIVTSFFILLADLIPKRIGMIKPEAVAVRIVNP
FT                   MRFCLATFRPLVWLFNGLADCFFKIFKIPMARNEDITSDDIYAVVAAGALAGVLRKQEH
FT                   ELIENVFELESRTVPSAMTSRESVIYFDKNEDENSIKEKISTHPHSKFLVCDGGIDHVT
FT                   GYVDSKDLLNRVLNGQSLSLKDGVQTRNALMIPDTLSLSDTLESFKAAGEDFAIILNEY
FT                   ALVMGVITLNDVMTTLMGDLVDQGQEEQIVVRDENSWLVEGGTPIEDVLRVLDIDDFPD
FT                   SNNYETIAGFMMFRLRKIPKRTDFVKFSGYKFEVVDIDNYKIDQLLVTKIVDTPAQSNP
FT                   SPSSQAQVQ"
FT   CDS_pept        346714..346926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0339"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79489"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYW1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79489.1"
FT                   /translation="MPGVSCNLSTWAALRFPSSAMSFNLILLEAAREISDSEKNALIAH
FT                   SKSIINKLFNIRHPCFISSGRAGFI"
FT   regulatory      complement(346952..346988)
FT                   /regulatory_class="terminator"
FT   regulatory      complement(346968..347027)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(347036..347683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="XBJ1_0340"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0340"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79490"
FT                   /db_xref="GOA:D3UYW2"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYW2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79490.1"
FT                   /translation="MPNSANESQHVSTQDALLGRAIPLTVSPYHVITQHSINDIPENME
FT                   IAYIGMGCFWGVERLFWQQEGIYTTSVGYSGGTTPNPTYEEVCTGLTGHAEVVRIVFDP
FT                   TKITYGQLLTLFWENHDPAQGMRQHGDIGTQYRSAIYTISSQQYEQALATREQFQQAMN
FT                   ENGDQRTITTEIHAAKPFYFAEDYHQQYLFKNPEGYCGLGGIGVCLLPTHKN"
FT   regulatory      347701..347760
FT                   /regulatory_class="promoter"
FT   regulatory      complement(347735..347794)
FT                   /regulatory_class="promoter"
FT   operon          347820..353676
FT                   /operon="XBJ1_operon0069"
FT   CDS_pept        347820..349562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0069"
FT                   /gene="ytfM"
FT                   /locus_tag="XBJ1_0341"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0341"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79491"
FT                   /db_xref="GOA:D3UYW3"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYW3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79491.1"
FT                   /translation="MSRYPFIFVLCVSVATPSAYSANLRLKVEGLSGELEKNARVQLSN
FT                   ISTEEVAPDARFQARVEKAIQQGLRPLGYYDPTVEFTYQEKTPPSRPVLTANVTPGEPV
FT                   RVVEVNVDLEGSAKTDKDYAALIKKNMPKEGAILNHGEYEHFKGALNSLAVRKGYFDAV
FT                   MKKSELEVSQEQHKSYWNFDFDSGDRYRFGSVRYHGSQIRENYLNNLLPFKQGEYYTSD
FT                   QLAEFNSRLANTGWFNSVVVVPDFKVGHTSQDKLLPLDAFLVPSSANYVELGGGYATDV
FT                   GPRVKAKWKKPWLNSRGHSLSTNINLSAPEQVIDASYKMPLKSNPLEQYYELQTGYKRK
FT                   DINDTISDTATLNLSRNWDLFTGWQYGVNLRWSLSHFTQANVTNTTMLLYPGATVSRIR
FT                   QRGGTMPYWGDSQRYSIDFSDKTWDSNVDFLVLQAHHVWIRTYKDKHRFVVRGDLGWIE
FT                   TNEFNKVPPGLRFFAGGDRSIRGYKYQKISPKNSEGKLTGASKLAVGSLEYQYNIYGNW
FT                   WSALFVDTGEAVDDIKKSDFKTGAGIGVRWASPVGPIKFDLATPVGDASNHGIEFYIGL
FT                   GAEL"
FT   CDS_pept        349583..353326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0069"
FT                   /locus_tag="XBJ1_0342"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0342"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79492"
FT                   /db_xref="GOA:D3UYW4"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYW4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79492.1"
FT                   /translation="MTFLLLVGLLLITIVGLVGTQTGLHFMINSAARWVPGLDIANVSG
FT                   GWRDLTLKGVKYQMPGVSVSADNLYLSLRLSCLKHSHLCVNALTTEGVAVSVNTADLPP
FT                   SEKSPASEPLTELKTPYPISLDLLSLKNIHVKVDDIVIALDEFKTGAQWREKQLTLKPT
FT                   KISNLLVALPKTRPEQSGTVQKGKQKPEPEKSLGETLKALFAKPFLAELPNVPIPLDIM
FT                   AENIHGSQLRLTGDTDITINDLRLQASNQGQQVDVKTFSVSAPEGSLSLQGTAGLSEQW
FT                   PVKLVIKSNTNLNELKGQKLDLTLNGALLQQLNLALHLSGPIIANLSAQTELAKAGLPV
FT                   RLTLESKQLQWPLTGEPEYRLDGVKLRLNGKASGYDLSLRSDIKGRDIPPALLMLDAKG
FT                   NEELLRLTRLRLSALQGKAEITGIVDWSKAISWNANLILDGINTAKQWPEWPAKMNGKM
FT                   AIRGSLYGGSWQLQIPEIALDGYVKQNIVKAHGKASGNAAGQWNIPQFDLTFGRNRLNV
FT                   QGQLTDEKWKLDGEINAPQLNGLLPGLSGVVIGNVKLRGNMKAPQIVADLNARNVRWQN
FT                   DLKVDSATIKGDVRSAEQIEGQLSVAVHQLKQADLIINNLMLNAKGTEKQHDLHLNIEG
FT                   NPVSGQLALSGRFDRSQERWQGTINNTYFDTPVGEWRLNKAMVIDYLNPQQKVTIGTHC
FT                   WLNPNAQICVPKPIEAGASGHAEVVLKRFDLAMIQPFLDKMTQVKGVFSGNANVKWTAG
FT                   QALPQAKVVLQGNGVQLHQMVEGAALPVDFETLTVNAGLTNGKANVAWLFKLAGNGQLN
FT                   GNVQVDDLEGRRKLSGNVDIRALSLKLIKPILGKDEKAEGGLNANLRFGGNVKNPLLFG
FT                   QLKTDDLQIVSHWLPFDITQGQLAIYFDGVRSGLEGVIKTPKGQLNLNGNADWRNLNAW
FT                   YAKIAANGEKLRVTVPPMVKIDVSPNLVLEATPDLLKLDGNVDIPWARITVQELPESAV
FT                   GISSDEVMLDKNLQPIEKKKSSILVKSNLNIRIGDDVRLNAFGLKAQLKGVLKVIQDKQ
FT                   GLGLNGQIDIPDGRFHAYGQDLLVRKGTIIFSGPPEQPMLNIEAIRNPDSTANKVVAGV
FT                   KVTGLADKPKVEIFSEPAKSQQEALSYLLRGEGLEKSGSDNNQMTSMLIGLGVSQSGQL
FT                   VGKIGETFGVSDLALDTQGVGDKSQVVVSGKITNNLQVKYGVGIFDSLATLTLRYRVMP
FT                   RLYLDAVSGIDQALDLLYEFEF"
FT   CDS_pept        353329..353676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0069"
FT                   /locus_tag="XBJ1_0343"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0343"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79493"
FT                   /db_xref="GOA:D3UYW5"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="InterPro:IPR039126"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYW5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79493.1"
FT                   /translation="MRVIVYGSLRRKQGNHHWMTYAQLLGEHRLEGYEIYDLGHYPAVI
FT                   RGEGTIECEVYRITPSILTELDALKKNYQEYERELIKTPYGSAWIYLYRLPVDGLHRIT
FT                   CGDWIKRHEEE"
FT   regulatory      complement(353665..353716)
FT                   /regulatory_class="terminator"
FT   regulatory      353684..353721
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(353746..354276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /locus_tag="XBJ1_0344"
FT                   /product="inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0344"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79494"
FT                   /db_xref="GOA:D3UYW6"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYW6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79494.1"
FT                   /translation="MSLNNVPAGKELPEDIYVIIEIPANADPIKYEVDKESGALFVDRF
FT                   MSTAMFYPCNYGYINNTLSLDGDPVDVLVPTPYPLQPGSVIRCRPVGVLKMSDESGEDA
FT                   KLVAVPHTKLSKEYDHIKDVNDLPELLRAQITHFFEHYKDLEKGKWVKVDGWDNVEAAK
FT                   AEILSSFERAAKK"
FT   CDS_pept        complement(354379..354552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0345"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79495"
FT                   /db_xref="GOA:D3UYW7"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYW7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79495.1"
FT                   /translation="MPIIYIVPLSSIHTLFLFIFVHEIILFMTHEPDRNVNNKKVNNHF
FT                   LSNTTDFITPNY"
FT   regulatory      complement(354487..354546)
FT                   /locus_tag="XBJ1_0345"
FT                   /regulatory_class="promoter"
FT   regulatory      complement(354627..354656)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(354691..355695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbp"
FT                   /locus_tag="XBJ1_0346"
FT                   /product="fructose-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0346"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79496"
FT                   /db_xref="GOA:D3UYW8"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYW8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79496.1"
FT                   /translation="MKTLGEFIVEKQQDFPHATGELTALLSAIKLGAKIIHRDINKAGL
FT                   VDILGTSGVSNVQGEVQMKLDLYANEKLKAALKARGEVAGIASEEEDEIVVFDGDRAEN
FT                   AKYVVLMDPLDGSSNIDVNVSVGTIFSIYHRITPIGQPVTEDDFLQPGNRQVAAGYVVY
FT                   GSSTMLVYTTGYGVHTFTYDPSLGVFCLTHEKVQFPAKGNMYSINEGNYIKFPMGVKKY
FT                   IKYCQEQDEATQRPYTTRYIGSLVADFHRNLLKGGIYIYPSTASNPTGKLRLLYECNPI
FT                   AFLAEQAGGKASDGKNRILDITPTQLHQRVPFFVGTKSMVEKAESFMAEFPGE"
FT   regulatory      355781..355840
FT                   /regulatory_class="promoter"
FT   CDS_pept        355867..357237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpl"
FT                   /locus_tag="XBJ1_0347"
FT                   /product="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate
FT                   ligase"
FT                   /EC_number="6.3.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0347"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79497"
FT                   /db_xref="GOA:D3UYW9"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYW9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79497.1"
FT                   /translation="MRIHILGICGTFMGGLAILARSLGHEVTGSDANVYPPMSTLLEKQ
FT                   GIELIQGYDPSQLDPEPDMVIIGNAMTRGNPCVEAVLDRGIPYTSGPQWLHDHVLPERW
FT                   VLAVAGTHGKTTTAGMLAWILEACGYKPGFLIGGVPGNFDVSAQIGESPFFVIEADEYD
FT                   CAFFDKRSKFVHYGPRTLIMNNLEFDHADIFENLAAVQKQFHHLVRVVPGSGKILVPDN
FT                   DINLKHVIGMGCWSELEHVGETGNWQTKKVSQDSSIYQVFHQSEQVGEVNWSLVGEHNM
FT                   HNGLIAIAAAHHVGVQPADACQVLGDFINARRRLELRGEVNGISVYDDFAHHPTAILVT
FT                   LAALRSKVGGVARILAVLEPRSNTMKMGMSKNDIAPSLGRADEVFLYQPANIPWQVAEI
FT                   AEHCIQPARWSADIDALVRMIVEAAQPGDYILIMSNGGFDGIHEKLLTELGKKVHEA"
FT   regulatory      357259..357298
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(357364..357834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argR"
FT                   /locus_tag="XBJ1_0348"
FT                   /product="transcriptional repressor of arginine synthesis
FT                   (ArgR familiy)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0348"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79498"
FT                   /db_xref="GOA:D3UYX0"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYX0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79498.1"
FT                   /translation="MRVPSKQEDLVKAFKALLKEEKFSSQGEIVAALQEEGFENINQSK
FT                   VSRMLTKFGAVRTRNAKMEMVYCLPAELGVPTATSPLKNLVLDVDYNHCVVVIRTSPGA
FT                   AQLIARLLDSLGKAEGILGSIAGDDTIFTTPAQDFTTKQLYEAILDLFDQEL"
FT   regulatory      complement(357862..357921)
FT                   /regulatory_class="promoter"
FT   CDS_pept        358363..359301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="XBJ1_0349"
FT                   /product="malate dehydrogenase, NAD(P)-binding"
FT                   /EC_number="1.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0349"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79499"
FT                   /db_xref="GOA:D3UYX1"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR023958"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYX1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79499.1"
FT                   /translation="MKVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAAD
FT                   LSHIPTEVKVTGFAGEDATPALVGADVVLISAGVARKPGMDRSDLFNINAGIIRNLVQQ
FT                   VAKACPKALIGIITNPVNTTVAIAAEVLKKEGVYDRNRLFGITTLDIIRSNTFVAELKG
FT                   KNSEELEVPVIGGHSGVTILPLLSQIQGVSFTDEEVEALTKRIQNAGTEVVEAKAGGGS
FT                   ATLSMGQAAARLGLSLIRGLQGESNVIECSYVEGDGKYARFFAQPVRLGKNGIEERLDI
FT                   GKLSDFEQKSLDSMLGVLKKDIELGEKFING"
FT   regulatory      complement(359350..359386)
FT                   /regulatory_class="terminator"
FT   regulatory      359358..359402
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(359414..359680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsB"
FT                   /locus_tag="XBJ1_0350"
FT                   /product="transcriptional activator of maltose metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0350"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79500"
FT                   /db_xref="GOA:D3UYX2"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR038722"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYX2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79500.1"
FT                   /translation="MISMKSDWHPADIIAALRKRGTTLAAVSREAGLSSSTLANTLSRP
FT                   WPKGEWIIANYLGLHPAEIWPSRYFDPHTGELLERKIREKKNN"
FT   regulatory      359676..359735
FT                   /regulatory_class="promoter"
FT   regulatory      complement(359858..359917)
FT                   /regulatory_class="promoter"
FT   operon          359868..360671
FT                   /operon="XBJ1_operon0070"
FT   CDS_pept        359868..360215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0070"
FT                   /locus_tag="XBJ1_0351"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0351"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79501"
FT                   /db_xref="GOA:D3UYX3"
FT                   /db_xref="InterPro:IPR003314"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYX3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79501.1"
FT                   /translation="MKKEWYTAMELTGVGELPRSPQGVNARAKREEWLRQKRAGVQGRA
FT                   IEYHYSCFPESTLSALELHEISPEYQVQKQDPLSIWVSAFNLLSDEEKEAITEVILRDG
FT                   IRSFLEKIIAT"
FT   regulatory      360231..360263
FT                   /operon="XBJ1_operon0070"
FT                   /regulatory_class="terminator"
FT   CDS_pept        360291..360671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0070"
FT                   /locus_tag="XBJ1_0352"
FT                   /product="Complete genome; segment 16/17"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0352"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79502"
FT                   /db_xref="GOA:D3UYX4"
FT                   /db_xref="InterPro:IPR003314"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYX4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79502.1"
FT                   /translation="MKKDWYSAKELIGLAGLPSSPQGVNLMARREGWEQRRKRGVQGKA
FT                   LEYHVNSLPEEVLNVLAVSESSVEYYRNKRQDPFMIWIEAYYQLTKPERERMVKFILRK
FT                   GLASLVQYIGIQEVENKDSIPD"
FT   regulatory      complement(360643..360687)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(360699..361670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispB"
FT                   /locus_tag="XBJ1_0353"
FT                   /product="octaprenyl diphosphate synthase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0353"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79503"
FT                   /db_xref="GOA:D3UYX5"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYX5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79503.1"
FT                   /translation="MNLESIIKLTADDMAAVNETILNQLNSDVALINQLGYYIISGGGK
FT                   RIRPMIAVLAGKALHCEKEKHIKVAALIEFIHTATLLHDDVVDESDMRRGKATANAMYG
FT                   NAASVLVGDFIYTRSFQMMTDLDSMRVLKLMSDATNVIAEGEVMQLMNCNDPDTSEDDY
FT                   MRVIYSKTARLFEVAAHSAAILSGATPEQEAALRDYGRYLGTAFQLIDDLLDYDSDDST
FT                   LGKNTGDDLNEGKPTLPLLHAMHHGVPEQSALIRSAIEQGNGRHLLDTVLATMKQCGSL
FT                   KYTRQRAEEEADKAISALQVLDESPYKAALVGLAHVAVQRLS"
FT   regulatory      complement(361707..361766)
FT                   /regulatory_class="promoter"
FT   regulatory      361795..361854
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(361869..362351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0354"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79504"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYX6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79504.1"
FT                   /translation="MPKQTHHQNVLHPDVCFQNRDRYESSRQPFCVPLICSPKILSDAS
FT                   DFNISEPLTVALLLTAVFTTTKLNDFNFLATAMSNNFSFNFNAFNYWSADLNIFTISDH
FT                   QNLVKLNSFTGCDVQLFQANCLTFAYSVLFTTTLENCVHINSAFRAPPKISFQSAL"
FT   operon          361923..363817
FT                   /operon="XBJ1_operon0071"
FT   CDS_pept        361923..362231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0071"
FT                   /gene="rplU"
FT                   /locus_tag="XBJ1_0355"
FT                   /product="50S ribosomal subunit protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0355"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79505"
FT                   /db_xref="GOA:D3UYX7"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYX7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79505.1"
FT                   /translation="MYAVFQSGGKQHRVSEGQTIRLEKLDIATGETVEFDQVLMVANGE
FT                   DIKIGAPVVEGVKVKAEVVAHGRGEKIKIVKFRRRKHSRKQQGHRQWFTDVKITGIA"
FT   CDS_pept        362252..362509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0071"
FT                   /gene="rpmA"
FT                   /locus_tag="XBJ1_0356"
FT                   /product="50S ribosomal subunit protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0356"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79506"
FT                   /db_xref="GOA:D3UYX8"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYX8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79506.1"
FT                   /translation="MAHKKAGGSTRNGRDSESKRLGVKRFGGESVLAGSIIVRQRGTKF
FT                   HAGSNVGCGRDHTLFALADGKIKFEVKGSKNRKFISIVAE"
FT   regulatory      362518..362577
FT                   /operon="XBJ1_operon0071"
FT                   /regulatory_class="promoter"
FT   regulatory      362533..362576
FT                   /operon="XBJ1_operon0071"
FT                   /regulatory_class="terminator"
FT   CDS_pept        362639..363817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0071"
FT                   /gene="obgE"
FT                   /locus_tag="XBJ1_0357"
FT                   /product="putative GTP-binding protein with nucleoside triP
FT                   hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0357"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79507"
FT                   /db_xref="GOA:D3UYX9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYX9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79507.1"
FT                   /translation="MKFVDEASILVVAGDGGNGCVSFRREKYIPKGGPDGGDGGDGGDV
FT                   YLLADENLNTLIDYRFEKSFRAERGQNGQSRGCTGRRGQDITIKVPVGTRVRDIATGEV
FT                   LADMVRHEQRQMVAKGGFHGLGNTRFKSSVNRAPRQKTMGTPGESRELMLELMLLADVG
FT                   MLGMPNAGKSTFIRSVSAAKPKVADYPFTTLVPSLGVVRMDNEQSFVVADIPGLIEGAS
FT                   EGVGLGIRFLKHLERCRVLLHLIDLCPLDESDPVENARIIIKELHKYSEKLAEKPRWLV
FT                   FNKVDLTDPEEAKQRAKAIADELGWEGDYYMISAVNRQGVKELCWDIMEFMKAQPRHMD
FT                   VEAEAQPEKVEFMWDDYHKEQLQQSSDADVDDDLDDDWDEGDEEGIEFIYKH"
FT   regulatory      complement(363830..363874)
FT                   /regulatory_class="terminator"
FT   regulatory      363842..363893
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(363877..365415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacB"
FT                   /locus_tag="XBJ1_0358"
FT                   /product="D-alanyl-D-alanine carboxypeptidase,
FT                   penicillin-binding protein 4"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0358"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79508"
FT                   /db_xref="GOA:D3UYY0"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYY0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79508.1"
FT                   /translation="MDHRLLFPEFHLSIIDVNIFRILSPSYARSMALLKITSRIACMLS
FT                   FSLSIFSANASSIEEDAQYLPAGTDFSFIAQKIGSKTPLLDYNGQQLALPASTQKIVTA
FT                   LAALLQLGKDYRFITTLESNADISDGILRGNLTARFVGDPTLTRSQLRNMVETLKQSGI
FT                   KQIDGDLIIDSSIFSSHDKAPGWVWNDMTQCFSAPPAAAIVDKNCFSVSLYSSEQPGEL
FT                   AFVRVPSFYPVNIFSEVKTLSKGSPEAKYCELDVTSGELNRFTLTGCLTQRSEPLPLAF
FT                   AIQNGASYAGAILKNELHIAGIELKGHLRRQSDPEQPEKILALNESAPLHVLLKTMLKK
FT                   SDNMIADTLFRTLGHRYFNVPGTWRTGSDAIRHILKQKAGIDLGSTIMVDGSGLSRHNL
FT                   ITPATMMEILQFIAQHNDDLDFISMLPKSGYDGTLSYRPGLHEAGVNGKVFAKTGSLQG
FT                   VYNLAGFITAASGQKIAFVQFISSYSVLPDDQRTRRIPLARFESHLYKSLYQNH"
FT   regulatory      365428..365487
FT                   /regulatory_class="promoter"
FT   regulatory      complement(365444..365503)
FT                   /regulatory_class="promoter"
FT   CDS_pept        365600..366076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="XBJ1_0359"
FT                   /product="transcription elongation factor, cleaves 3'
FT                   nucleotide of paused mRNA"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0359"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79509"
FT                   /db_xref="GOA:D3UYY1"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYY1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79509.1"
FT                   /translation="MKQIPMTVRGADKLREELENLKNVRRPKIITAIADARAHGDLKEN
FT                   AEYHAAREQQGFCEGRIQEIEAKLSNAQVIDITKMINNGRVIFGATVTVLNMGSDEEQT
FT                   YRIVGDDEANIKENLISVNSPIARGLIGKEVDDVAVISTPGGKVEYEVLNVEYL"
FT   regulatory      complement(366152..366191)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(366231..366524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhbY"
FT                   /locus_tag="XBJ1_0360"
FT                   /product="putative RNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0360"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79510"
FT                   /db_xref="GOA:D3UYY2"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYY2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79510.1"
FT                   /translation="MTLNKKQVQYLKSLAHSLKPVVMIGNNGLTEGVLAEIEQTLSHHE
FT                   LIKVKVAGEDREIKTLIAEAIVRETGAYNVQIIGKMLVLYRPSKERRISLPK"
FT   regulatory      366512..366571
FT                   /regulatory_class="promoter"
FT   regulatory      complement(366617..366676)
FT                   /regulatory_class="promoter"
FT   operon          366659..369253
FT                   /operon="XBJ1_operon0072"
FT   CDS_pept        366659..367288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0072"
FT                   /gene="ftsJ"
FT                   /locus_tag="XBJ1_0361"
FT                   /product="23 S rRNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0361"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79511"
FT                   /db_xref="GOA:D3UYY3"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR004512"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYY3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79511.1"
FT                   /translation="MANKKRSASSSRWLQEHFSDKYVLQAQKKGLRSRAWFKLDGIQQS
FT                   DKIFKPGMTVVDLGASPGGWSQYVVNQIGDRGRVIACDLLPMDPIVGVDFLQGDFRDEL
FT                   VLKALLERVGDNKVQVVMSDMAPNMSGTPAVDIPRSMYLIELALGMCRDVLAPGGSFIV
FT                   KVFQGEGFDEYLREIRSLFTKVKIRKPEASRARSREVYIVATGRKL"
FT   CDS_pept        367337..369253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0072"
FT                   /gene="ftsH"
FT                   /locus_tag="XBJ1_0362"
FT                   /product="ATP-dependent zinc-metallo protease"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0362"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79512"
FT                   /db_xref="GOA:D3UYY4"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYY4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79512.1"
FT                   /translation="MSDMAKNLILWLVIAVVLMVLFQSFGPGDSSGRRVDYSNFISELS
FT                   QNQVREVRISGRDIDYSKKDDGKKYSTYMPIQDEKLLDTLLNKQVKVIGEPPEQQGLLA
FT                   TLFISWFPMLLLIGVWIFFMRQMQGGGGKGAMSFGKSKARMLTEDQIKTTFADVAGCDE
FT                   AKEEVGELVEYLREPGRFQKLGGKIPKGILMVGPPGTGKTLLAKAIAGEAKVPFFTISG
FT                   SDFVEMFVGVGASRVRDMFEQAKKSAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQ
FT                   MLVEMDGFEGNEGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMR
FT                   RIPLDTDVDASIIARGTPGFSGADLANLANEAALFAARGNKRVVSMVEFEKAKDKIMMG
FT                   AERRSMVMTEEQKESTAYHEAGHAIIGRLVPEHDPVHKVTIIPRGRALGVTFFLPEGDQ
FT                   ISASRQKLESQLSTLYGGRLAEEIIYGVDSVSTGASNDIKVATSIARNMVTQWGFSEKL
FT                   GPLLYAEEEGEIFLGRSVAKAKHMSEDTARLIDQEVKAIVDRNYQRARKILMDNLDILH
FT                   SMKDALMKYETIDVSQIDDLMNRTTVRSPAGWEGDNNNGGNNRHNMSSPQQTVKPADGN
FT                   PTA"
FT   regulatory      369288..369333
FT                   /regulatory_class="terminator"
FT   operon          369373..371603
FT                   /operon="XBJ1_operon0073"
FT   CDS_pept        369373..370230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0073"
FT                   /gene="folP"
FT                   /locus_tag="XBJ1_0363"
FT                   /product="7,8-dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0363"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79513"
FT                   /db_xref="GOA:D3UYY5"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYY5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79513.1"
FT                   /translation="MKLTARGSVLDLSRPQVMGILNVTPDSFSDGGNHSTFDAALRHAA
FT                   TMIEEGAAIIDVGGESTRPGAVDVSEQEELDRVVPVVEALARRFDAWISIDTSKAIVMQ
FT                   ESAKVGAHMINDIRSLQEFGALDAAVKTGLPVCLMHMQGQPSTMQAEPYYEDAVWETKT
FT                   FLTRQIDRCVAAGIAKNKLILDPGFGFGKNLSHNYQLLAHLEEFHHLGLPILAGMSRKS
FT                   MIGQLLHVPPQECVTGSIACAVIAAMQGAQIIRVHDVKETVQTMQIVQATLSAKNILAV
FT                   KNTL"
FT   CDS_pept        370266..371603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0073"
FT                   /gene="glmM"
FT                   /locus_tag="XBJ1_0364"
FT                   /product="phosphoglucosamine mutase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0364"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79514"
FT                   /db_xref="GOA:D3UYY6"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYY6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79514.1"
FT                   /translation="MSSRKYFGTDGIRGKVGDSPITPDFVLKLGWAAGKVLARHGSRKI
FT                   IIGKDTRISGYMLESALEAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHN
FT                   PYYDNGIKFFSIDGTKLPDNVEEAIEAEMEKPLTCVESAELGRANRIVDAAGRYIEFCK
FT                   GTFPSEQSLNGLKVVLDCANGATYHIAPNVLRELGANVVTIGCEPNGININEECGATDV
FT                   RLLQKRVQEEQADVGLAFDGDGDRIIMVDHLGQKVDGDQILYIIAREALRQGQLRGGAV
FT                   GTLMSNIGLELALKQLGIPFERAKVGDRYVLEKLQEKGWRLGAENSGHVILLDKTTTGD
FT                   GIVAGLQILSAMVRNNMSLHDLCSGMKLLPQILVNVRFAGDNDPLQSESVLEAVKSVEA
FT                   ELNGRGRVLLRKSGTEPLIRVMVEGEDEELVTALAHRIADAVKKTG"
FT   regulatory      371626..371685
FT                   /regulatory_class="promoter"
FT   CDS_pept        371782..372120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="XBJ1_0365"
FT                   /product="preprotein translocase, membrane component,
FT                   transport across inner membrane (General Secretory
FT                   Pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0365"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79515"
FT                   /db_xref="GOA:D3UYY7"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYY7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79515.1"
FT                   /translation="MYEALLGVFLLAGLGVIALVLLQQGKGADMGASFGAGASATLFGS
FT                   SGSSNFMTRMTAIFATLFFVISLILGNMSSNRTGSDSKWENLAEPVKVEKQAEVPASPA
FT                   KPNSDIPQ"
FT   tRNA            372222..372311
FT                   /gene="LeuGAG"
FT                   /locus_tag="XBJ1_tRNA0005"
FT                   /product="tRNA-Leu"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   tRNA            372369..372445
FT                   /gene="MetCAT"
FT                   /locus_tag="XBJ1_tRNA0006"
FT                   /product="tRNA-Met"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   regulatory      372587..372646
FT                   /regulatory_class="promoter"
FT   operon          372699..378875
FT                   /operon="XBJ1_operon0074"
FT   CDS_pept        372699..373121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0074"
FT                   /locus_tag="XBJ1_0366"
FT                   /product="YhbC-like protein (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0366"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79516"
FT                   /db_xref="GOA:D3UYY8"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYY8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79516.1"
FT                   /translation="MISAPVEALGFELVGLEFIRARVSTLRVYIDSEEGITVDNCADVS
FT                   HQVSAVLDVEDPISVLYNLEISSPGLERPLFKAEHYQRFMGEEVSLVLRMAMQNRRRWQ
FT                   GIIKVVDGEMITVTVDGKDEVFALSNIQKANLVPHF"
FT   CDS_pept        373143..374651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0074"
FT                   /gene="nusA"
FT                   /locus_tag="XBJ1_0367"
FT                   /product="transcription pausing; L factor"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0367"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79517"
FT                   /db_xref="GOA:D3UYY9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYY9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79517.1"
FT                   /translation="MNKEILAVVEAVSNEKSLPREKIFEALEIALATATKKKYEQEIDV
FT                   RVCIDRKSGDFDTFRRWVAVEEVTLPTREITLEAAKYEDPEMELGGYIEDQIESVTFDR
FT                   ITTQTAKQVIVQKVREAERAMVVDQFREQQGEIVTAQVKKVNRENITLDLGNNAEAVIL
FT                   REDMLPRENFRPGDRVRGVLYDVRPEARGAQLFITRSRPEMLVELFRIEVPEIGEEIIE
FT                   IKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSSELGGERIDIVLWDDNPA
FT                   QFVINAMAPADVASIVVDEDNCTMDVAVESSNLAQAIGRNGQNVRLAAQLLKKHRGDDK
FT                   WELNVMTAEELQAKHQAEAHASIDTFTKHLDIDVDFATVLVEEGFSTLEELAYVPINEL
FT                   LAIEGLDEETVEVLRERAKAALTTLELAQKESLGDQQPAEDLLNLSGMDRTLAFNLAAH
FT                   GICTLEDLAEQGIDDLSDIEGLSDEKAGELIMAARNICWFGDDA"
FT   CDS_pept        374677..377451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0074"
FT                   /gene="infB"
FT                   /locus_tag="XBJ1_0368"
FT                   /product="protein chain initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0368"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79518"
FT                   /db_xref="GOA:D3UYZ0"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYZ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79518.1"
FT                   /translation="MTEVTVKLLAEEIQTSVERLIQQFADAGIQKTATDSVSQREKESL
FT                   LAHLNREQGGSGGQPGKLTLQRKTRSTLNVPGTGGKSKSVAIEVRKKRTYVNRDAIEQS
FT                   PTEEQAKREAEEQARREVEEKARLETEAKKFAEEQAKRDAEEQAKREAAKSAQREAEEK
FT                   AKREGVDMTQREAAEKEKVTKQHTENKPKSVQTEPAVQSEKARREAEAANLKRKAEEEV
FT                   RRKVEAEAKRVAEEARRMAEENKDKWSETAEPSENTDDYHVTTSQHARAAEDENDAKVE
FT                   GDRRTRSRGGKATRQKKNNKHSESKADREEARAVGRNKGKQRKPSTLQQSFTKPVAAVN
FT                   RDVVIGETITVAELANKMAVKGSQVIKTMMKMGAMATINQVIDQETAQLVAEEMGHKVI
FT                   LRRENELEEALMSDRDTGETLAESRAPVVTIMGHVDHGKTSLLDYIRSTKVASGEAGGI
FT                   TQHIGAYHVQTEKGMITFLDTPGHAAFTSMRARGAKATDIVVLVVAADDGVMPQTVEAI
FT                   QHAKAANVPVVVAVNKIDKPDADPDRVKNELTQYGIIPEEWGGENQFMSVSAKAGLGID
FT                   ELLECILLQAELLELNAVRTGMANGVVIESFLDKGRGPVATILVQSGTLNKGDIVLCGF
FT                   EYGRIRAMRDELGLEVTSAGPSIPVEILGLSSVPSAGDEATVVRDEKKAREVALYRQGK
FT                   FREVKLARQQKSKLENMFANMEEGKVSELNIVLKTDVQGTCEAICDSLLKLSTDEVKVK
FT                   IIGSGVGGITETDATLAAASNAIILGFNVRADASARRIIESESVDLRYYSVIYSLIDEI
FT                   KQAMSGMLAPEYKQQIMGLAEVRDVFKSPKFGAIAGCMVTEGSIKRNNPIRVLRDNVVI
FT                   YEGELESLRRFKDDVNEVRNGMECGIGVKNYNDVRVGDMIEVFEIIEIKRSIV"
FT   CDS_pept        377518..377928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0074"
FT                   /gene="rbfA"
FT                   /locus_tag="XBJ1_0369"
FT                   /product="ribosome-binding factor, role in processing of
FT                   10S rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0369"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79519"
FT                   /db_xref="GOA:D3UYZ1"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYZ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79519.1"
FT                   /translation="MAREFSRTQRVAQEMQKEIAIILQREVKDPRIGMATVSGVEVSRD
FT                   LAYAKVFVTFLNVLVEGQDSDMVNVGIKALNEASGFIRSLLGKAMRLRVIPELTFSYDS
FT                   SLVDGMRMSNLVTKVVKNDEQRRVSTDHNEEK"
FT   CDS_pept        377928..378875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0074"
FT                   /gene="truB"
FT                   /locus_tag="XBJ1_0370"
FT                   /product="tRNA pseudouridine 5S synthase"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0370"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79520"
FT                   /db_xref="GOA:D3UYZ2"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYZ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79520.1"
FT                   /translation="MGRRRRGRAIHGVLLLDKPQDISSNDALQKVRRIFDASKAGHTGA
FT                   LDPLATGMLPICLGEATKFSQFLLDSDKRYRVIARLGQRTDTSDSHGKVICEREVQITQ
FT                   PQLAAALDTFRGDTMQVPSMYSALKHQGKPLYEYARQGIAIEREARPITVYELQFIRWE
FT                   GDELELEIHCSKGTYIRTIIDDLGELLGCGAHVIYLHRLQVANYPTHRMVTLEQLHELK
FT                   KQAEEQEVDAGELLDPLLLPMDTAVAHFPVIQLASVVAAYLKQGQPVRSKHSLTSGEWV
FT                   RVTEGDENKFIGIAVIDDGGLVAPRRLVVEIEQL"
FT   regulatory      378970..379024
FT                   /regulatory_class="terminator"
FT   regulatory      379001..379060
FT                   /regulatory_class="promoter"
FT   operon          379080..381731
FT                   /operon="XBJ1_operon0075"
FT   CDS_pept        379080..379349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0075"
FT                   /gene="rpsO"
FT                   /locus_tag="XBJ1_0371"
FT                   /product="30S ribosomal subunit protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0371"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79521"
FT                   /db_xref="GOA:D3UYZ3"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYZ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79521.1"
FT                   /translation="MSLSTEAKAQIVAEFGRGTNDSGSSEVQVALLTAQINHLQGHFSE
FT                   HKKDHHSRRGLLRMVAQRRKLLNYLKRKDLARYTALIERLGLRR"
FT   regulatory      379364..379423
FT                   /operon="XBJ1_operon0075"
FT                   /regulatory_class="promoter"
FT   regulatory      379370..379400
FT                   /operon="XBJ1_operon0075"
FT                   /regulatory_class="terminator"
FT   CDS_pept        379587..381731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0075"
FT                   /gene="pnp"
FT                   /locus_tag="XBJ1_0372"
FT                   /product="polynucleotide phosphorylase, has polyadenylase
FT                   activity"
FT                   /EC_number="2.7.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0372"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79522"
FT                   /db_xref="GOA:D3UYZ4"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYZ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79522.1"
FT                   /translation="MLNPIVRKFQYGQHTVTIETGMMARQATAAVMVNMDDTAVFVTVV
FT                   GQKKMKAGQDFFPLTVNYQERTYAAGRIPGSFFRREGRPGEGETLVARLIDRPLRPLFP
FT                   EGFLNEVQIIATVVSVNPLVNPDIVAMIGASAALALSGIPFNGPIGAARVGYINDQYVL
FT                   NPTSDELKNSRLDLVVAGTAGAVLMVESEAELLTEEQMLGAVVFGHEQQQIVIDHINAL
FT                   VAETGKEKWDWAPESINQPLHDRVAELAESRLGDAYRITEKQERYAQVNTIKEEVSAII
FT                   VAEAVEKGVELEKSEVLDVLSVLEKNVVRGRVLRGEPRIDGREKDMVRALDVRTGVLPR
FT                   THGSSLFTRGETQALVAATLGTERDAQVIDELMGERADRFLFHYNFPPYSVGETGMVGS
FT                   PKRREIGHGRLAKRGVLAVMPTANEFPYTIRVVSEITESNGSSSMASVCGASLALMDAG
FT                   VPIKAAVAGIAMGLVKEGDNFVVLSDILGDEDHLGDMDFKVAGSRDGISALQMDIKIEG
FT                   ITSEIMQVALNQAKGARLHILGVMEQAIQSPRNDISEFAPRIHTIKINPDKIKDVIGKG
FT                   GSVIRALTEETGTTIEIEDDGTVKIAATDSDKAHHAIRRIEEITAEVEVGRIYNGKVTR
FT                   IVDFGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQLAQEVPVKVLEIDRQGRIRLSMK
FT                   EAVTNITTDEALQSPESSVE"
FT   regulatory      381734..381791
FT                   /regulatory_class="terminator"
FT   regulatory      381756..381815
FT                   /regulatory_class="promoter"
FT   CDS_pept        381861..382745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nlpI"
FT                   /locus_tag="XBJ1_0373"
FT                   /product="NlpI lipoprotein believed to be involved in cell
FT                   division with transferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0373"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79523"
FT                   /db_xref="GOA:D3UYZ5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023605"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYZ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79523.1"
FT                   /translation="MNSFLRWCYVAVIFLLVGCGSTGWRKNEMIAIPLQPTLQQEVILA
FT                   RMEQILASRSLTEDEYAQLLYERGVLYDSLGLRALAQNDFSVALSIRPDIPEIFNYLGI
FT                   YFTQAGNFDAAYEAFDSVLELDPTYNYARMNRGITLYYGGRYRLAQDDLQAFYQDDPND
FT                   PFRSLWLYLVEDKIDPKVAMTNLSRHFDKANRGLWGWNIVEFYLGKISEKTLMDRLKEN
FT                   SSDNTSLAEHLSETDFYLGKHYLSLGDEDNAVALFKLTVANNVHNFVEHRYALLELALL
FT                   GQRQDDLSESNQQ"
FT   regulatory      382765..382824
FT                   /regulatory_class="promoter"
FT   regulatory      382773..382814
FT                   /regulatory_class="terminator"
FT   CDS_pept        382916..384904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deaD"
FT                   /locus_tag="XBJ1_0374"
FT                   /product="cold-shock DeaD box ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0374"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79524"
FT                   /db_xref="GOA:D3UYZ6"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028618"
FT                   /db_xref="InterPro:IPR034415"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYZ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79524.1"
FT                   /translation="MTTETEISFADLGLSAPILAALGDMGYEKPSPIQQQCIPHLLNGR
FT                   DVLGMAQTGSGKTAAFSLPLLHNIDAELKAPQILVLAPTRELAVQVAEACSEFSKQMRS
FT                   VNVVALYGGQRYDVQLRALRQGPQVVVGTPGRLLDHLKRGTLDLSNLKGLVLDEADEML
FT                   RMGFIEDVENIMSQIPAEHQTALFSATMPEAIRRITRRFMNDPQEVRIQSSVTTRPDIS
FT                   QSYWSVHGVRKNEALVRFLETEDFDATIIFVRTKNATLEVAETLERHGYNSAALNGDMN
FT                   QALREQTLERLKDGRLDILIATDVAARGLDVERISLVVNYDIPMDAESYVHRIGRTGRA
FT                   GRAGRALLFVENRERRLLRNVERTMKLTIPEVELPNAELLSQRRLEKFAAKVQQQLESS
FT                   DLDQYRALLSKLSTNDELDMETLAASLLKMAQGERPLILPPDPVRRPRREFNDRDDRRR
FT                   DGFSSRERNDRGDRNDRGDRADRGDKGDRPRRERRDVGDMELYRIEIGRDDGVEVRHIV
FT                   GAIANEGDISSRYIGNIKLFATHSTIELPKGMPGDLLSHFTRTRILNKPLNMQLMGDAQ
FT                   PFERRERRGGGSGRTGNGSNASNGGNGSTGGNGSNGGNAPRRDREGFGNGGRRFSTERR
FT                   GDRVNSRGRSGDESNSAPRRRQNSGNA"
FT   regulatory      complement(384936..384973)
FT                   /regulatory_class="terminator"
FT   regulatory      384948..384985
FT                   /regulatory_class="terminator"
FT   operon          complement(385010..387429)
FT                   /operon="XBJ1_operon0076"
FT   CDS_pept        complement(385010..385729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0076"
FT                   /gene="yehT"
FT                   /locus_tag="XBJ1_0375"
FT                   /product="putative response regulator in two-component
FT                   regulatory system"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0375"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79525"
FT                   /db_xref="GOA:D3UYZ7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYZ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79525.1"
FT                   /translation="MNVLIVDDEPLARENLRYLLEEETDIQIIGECANAVEAIGAIHRL
FT                   KPDVVFLDIQMPRITGLEMVGLLDPEHRPYIVFLTAFDEYAVQAFEEHAFDYLLKPPEK
FT                   ERLSKTLQRLRSGYQKQNLADLQQEDEPLKYIPCTGHNRIWLMQLDEVLYVTSRLSGVY
FT                   VMSANKQEGFTELTLRTLETRTSLTRCHRQYLVNMTHLREIIFGENGQAELVLRNNEHI
FT                   PVSRRYLKPLKEVLGLN"
FT   CDS_pept        complement(385732..387429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0076"
FT                   /gene="yehU"
FT                   /locus_tag="XBJ1_0376"
FT                   /product="putative sensory kinase in two-component
FT                   regulatory system"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0376"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79526"
FT                   /db_xref="GOA:D3UYZ8"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYZ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79526.1"
FT                   /translation="MHEFNLVLLLLQQMCVYLVIAWLLSKTPLFIPLLQVSVRLPHKLM
FT                   CYVIFSIFCIMGTYFGLSVNDSIANTRAIGAVLGGFLGGPAVGAMVGFTGGLHRYSLGG
FT                   MTAFSCMVSTIVEGILGGLVHSYLMKRGQINKLLNPWTAAIVTFLAECIQMSIILLLAN
FT                   PFSDALKLVKNIAAPMIIANSIGAAMFIRILLDRRAIFEKYTSAFSAQALKIAVCTEGI
FT                   LRKGFNEDNSMRVAKVIYQELEIGAVAITDRDKLLAFIGIGSDHHLSGTPIVSEQSHRA
FT                   IENNEVVYADGNETPYRCSLSPICKLGSALVIPLRGENQQVIGTIKLYEAKNCLFSSIN
FT                   RTLGEGIASLLSAQILAGQYERNKQSLLQSEVKLLHAQVNPHFLFNALNTLQAVIRRDS
FT                   QQAGQLVQYLSTFFRKNLKRPEEIATLENEIEHVNAYLQIEKARFRERLQIAIAIPESL
FT                   RCAKLPAFSLQPMVENAIKHGTSQLLDTGRVTIRAHQKANLLLVEIEDNAGLYCLKKIG
FT                   DGLGMSLVDKRLRLRYGERYGMRVDCQPEKFTRVILCLPLEKETDKAV"
FT   regulatory      complement(387452..387511)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(387605..390592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0377"
FT                   /product="putative invasin"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0377"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79527"
FT                   /db_xref="GOA:D3UYZ9"
FT                   /db_xref="InterPro:IPR003535"
FT                   /db_xref="InterPro:IPR008541"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015217"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR024519"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR038177"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYZ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79527.1"
FT                   /translation="MHRKFDKSWPQNQYPLLKRMAWANIIIQLAFPVAGTFTPIIAAAK
FT                   THTTSHDQQLTALPIKPYILKSGETIDLIAKRYSLTVDDLKKINQLRTFSKPFSTLGIG
FT                   DEIDVPRPRLNKFLPCNYSPLDESDSKDETNSRLSNAAIRVGDVLKSNDISNSAKIQLN
FT                   GLAVSEVNQQIQNWLGHYGTARVQINISDRGRLDGSQLDMLLPLYDTKNQLTFTQFGLR
FT                   RLDKRNTINLGVGQRRFFDGGMLGYNAFFDYDFTGENTRIGLGAEYARDYLKLGANGYF
FT                   RLSNWKESPLLTDYDERPANGFDLRIQGYVPALPQLGGKLMYEHYFGDEVGLLNQNHRQ
FT                   KDPSAFTVGINYTPIPLLTFGIDRKQNTSGGGETLFNIELNYEIGTPWEKQIDPDATDF
FT                   KRTLQGSRYDLVDRNNQIVLEYRKREVIHLTMDRLITGHAGDIKPLHLTVVSKYGLKNI
FT                   QWEAVNLFADGGEIERQGGSHYLLTLPEYHHQGNNTYILSAVAYDEHGNASQRVETQVQ
FT                   VLPAAVRDNKSTFTAKDNELLADDRATTMLKLTLEDKEGKPIRDVADDIKWVTNQLGGE
FT                   GSDPTIGKIKETQPGVYEAILTAGKKIGILKITPEVDGVHIKPLKITFVHPDAPFVKNL
FT                   TIVGKLEIGQKLSATYTFNPNGGEKVDKSRYVWGDKGNIDITNSHTIVESGKLPNYTLE
FT                   LSDAGRVKAVAVQAQNGLGLIGNTMIVNTSMSQESGNRTHGGSEGGKVRGIADDIAATV
FT                   NTDNTKKSNTITLTVQTFNHGQPVRNVAVEVQATQAINRQNKPQTITVLIGGKPALYQG
FT                   VTDEQGVLSIPITDPNGNGVKTSFKITAYGSAKPKTQELIFTVPTSPDTPLANFWGHMS
FT                   ESVMGANGAVFMRPQLQVELKGKMKGLATFFESGEIWPRRVYKGAEWYCGKIHANLPTQ
FT                   EDLQSLYRAYSANEMHDLHGWPQHRSYRSSTPAEGNKVHIAVNIDNGFAHPIEDNIVSD
FT                   YVICRQ"
FT   CDS_pept        391483..392076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fimB"
FT                   /locus_tag="XBJ1_0378"
FT                   /product="tyrosine recombinase, regulator of fimA"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0378"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79528"
FT                   /db_xref="GOA:D3UZ00"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ00"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79528.1"
FT                   /translation="MRKYITQDEWNRVFSVLNNGTNKERDQCLLYLTYIHGLRVSELTS
FT                   LKVSDIDIAGKTIYIKRLKNGFSTTHPISKTEKELILKWLKIRNNNSVYCASLWLFPSR
FT                   KGGKLSRQWVHVLMGRYGEQAGLSIRLHPHKLRHSCGFELANQGLDTRLIQDYLGHRNI
FT                   RHTMHYTASNPERFQKAWQQNQQLKIDSGKYPAP"
FT   regulatory      392212..392253
FT                   /regulatory_class="terminator"
FT   regulatory      393090..393149
FT                   /regulatory_class="promoter"
FT   operon          393225..395076
FT                   /operon="XBJ1_operon0077"
FT   CDS_pept        393225..393458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0077"
FT                   /locus_tag="XBJ1_0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0379"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79529"
FT                   /db_xref="InterPro:IPR013517"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ01"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79529.1"
FT                   /translation="MRKDEHFDPILISTGQHDEMLYFTLSVAAADFNQDGKFDFATIAY
FT                   SVPNYFVAKQARIVVHINQIKRDVAVGDTDGA"
FT   CDS_pept        393448..394236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0077"
FT                   /locus_tag="XBJ1_0380"
FT                   /product="putative 3-oxoacyl-[acyl-carrier-protein]
FT                   reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0380"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79530"
FT                   /db_xref="GOA:D3UZ02"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ02"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79530.1"
FT                   /translation="MERSLAGKAVIITGAGSGIGLAATTEFLNAGAYVIGADINLEKLY
FT                   ELQRGEYLFPYQFNVRDPSDIDGLINTAISQFGKIDILINNAALVEPRKSFLDVTDDDW
FT                   NSTIETNLLGYIRMARGVLPYMCNQKKGILLHIASEAALMPNLILPDYSILKSSVLTLS
FT                   KVISREFGKYGIRSNVISPAFIHTSIYDKPEGLITQLEQKYKVGREEALQRYIEEVDIA
FT                   VGRLGQPEEVAVLLLFLASESAAFITGANYLVDGGVTPFI"
FT   CDS_pept        394291..395076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0077"
FT                   /locus_tag="XBJ1_0381"
FT                   /product="putative 3-oxoacyl-[acyl-carrier-protein]
FT                   reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0381"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79531"
FT                   /db_xref="GOA:D3UZ03"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ03"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79531.1"
FT                   /translation="MNINLKGKIALVTGSTAGIGLAIAQGMHKAGASVILNGRSEERLI
FT                   QAVNKFNCLDRVFTVAADVGTKEGCELINKNFPDIDILVNNAGIFSPKPIFEISDDEWI
FT                   NYFNINVLSGIRLARSYIPLMIGKRWGRVVFISSESALQIPVEMPHYGLTKTAQVAAAR
FT                   GFAQAATGTGVTVNSVLPGPTESEGVERFVRELITDPTLSMEEAGKRFIETARPASLLG
FT                   RLATAEEVANAVLFLASPLASAITGTALRVDGGVIQSIL"
FT   regulatory      395085..395136
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(395125..396033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0382"
FT                   /product="Regulatory protein, LysR:LysR, substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0382"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79532"
FT                   /db_xref="GOA:D3UZ04"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ04"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79532.1"
FT                   /translation="MVLRNLEDLSVFIRIIDTGSFTATAQALGLSPTTVSKQIARLEKN
FT                   LGVVLFVRSTRSLRITPEGKAIAEKVRAALTLVEEATEIAKDGSESLTGLIRLTAPVPL
FT                   GRTYVAAAIAEFRKKYPSVGFILHLTDKIVDLYKVEMDLAIRVANLTDSGLIARRLTDN
FT                   KRILVASPDYLRLHGELQHPEELINHHCLLFSASGNKSTIWSLHDRKGTKAISLSSDLI
FT                   ANNGDVLRTWCTAGLGIALRETWDVVDLIRAKKLIQILPEWQEETSPINLVRAGKRPVP
FT                   QRIKSFIEFLTEEWRIPPWEK"
FT   regulatory      396049..396108
FT                   /regulatory_class="promoter"
FT   regulatory      complement(396056..396115)
FT                   /regulatory_class="promoter"
FT   CDS_pept        396158..397333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0383"
FT                   /product="Major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0383"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79533"
FT                   /db_xref="GOA:D3UZ05"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ05"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79533.1"
FT                   /translation="MPFVIYVFSLCAFAIGFTEFITIGLISVMSANLDADVTSIGLTVT
FT                   AYALGVVIGAPILTALASNWSRKRLLLTAMLVFTIGNLIAAASANLALLLAARLLSGLA
FT                   HGVFFAVASGVATRLVPSERAGTALALVFGGVTIAMSLGVPAGTWLGSILDWRVIFLII
FT                   SACGLLGTLGIGFKMPKDAGEQIVKTSASWRHLTILFDRRLLAGASVPMLSYTASFALY
FT                   TFITPILLSITGVSVETASGVLLAYGIGAAVGTVWGGRLTDRQGMDLASLILLVGIAVV
FT                   LAAMSFSLTHSLLMIGLTALLGLATYGAIPPLQSRILMLAKRHTPYAMDIASGMNIAAF
FT                   NAGVVLGSVIGGATVREWGLETLTWIGAVTGVLAIVSLVWQMVIPSMREQR"
FT   regulatory      397378..397416
FT                   /regulatory_class="terminator"
FT   CDS_pept        397422..397634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0384"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79534"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ06"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79534.1"
FT                   /translation="MEICYIASMRNCVIFHFVSGIFSNEIYKIKSLFVFIIYLNDFTNS
FT                   DYYIFNSDAVFNISITFVCDLYLKF"
FT   operon          397858..400946
FT                   /operon="XBJ1_operon0078"
FT   CDS_pept        397858..398847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0078"
FT                   /locus_tag="XBJ1_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0385"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79535"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ07"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79535.1"
FT                   /translation="MASKNYLETPKFIHNLWTQNEDDEYYLRFTKGLYEVDKNDARDFM
FT                   TIRGYCTGNNTITDIHEKTGMPKDRIVDIISSLHEIGMLRNEEIVSEENFFDKIIIACE
FT                   MWAEQIEETHLFNKFLYGDVSYNVLLGFMLENYHYIKLFPETISSAIKNTTNESVKNIL
FT                   EEYRLQEAGHEIFMLRCLLKMGMRKEEVETSIPLVSTSNLINMMKYLFGKYPESVFLVA
FT                   KVIESHDYDENEVKIAIDNINKTYNLKQGTLEPFFEHSKIDYELGHSQLLEKAKSLINF
FT                   NDVDKVSYVLNAIHDIKHAIDLQCLEIEEYYTKQGNYIPRQRVDYFGV"
FT   CDS_pept        398849..400021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0078"
FT                   /locus_tag="XBJ1_0386"
FT                   /product="Qsc4"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0386"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79536"
FT                   /db_xref="GOA:D3UZ08"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ08"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79536.1"
FT                   /translation="MIPILISALTSGVSMAVFFTAISWFVEGSFHSTTLVSVVLSSGYI
FT                   LTFFILPKIGFFIDSNSAKKALNNIYILGLLNSVVFLFLTNINLNEIVLIATVIILTSI
FT                   FTFIRSSDQVIRATYIKRVVSSEELYNANKNLELIRQGITFLSGGVAFFILEDKSISNV
FT                   CIVSIFCFSISIFINVCVKKDNTDKFDRVIENNSRIKNTYKIGYDFFNGEVKRHVVLLS
FT                   IFPYICVVSLNSIYPALFNVINSQIQYYALLVVPYGVGAIMGSLIGSKRSYLSLKNNYI
FT                   IFGTISIIGLFLPVFFNHLYSVYLCLFLIALSHSRIRVIRNTIIMNEAGNQILGRLLSF
FT                   NEMIFITLSVGLSVLLGVLSDFLGFWVAWFMVIFLNVTVLFFILLSKDKK"
FT   CDS_pept        400069..400449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0078"
FT                   /gene="yhbT"
FT                   /locus_tag="XBJ1_0387"
FT                   /product="putative sterol carrier protein, SCP"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0387"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79537"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ09"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79537.1"
FT                   /translation="MLGKIHSHLVSQEPTLLRLSLKVTPFALPHQVLEQLLGWQFHGVL
FT                   AEGELAFLESRREDPDTLFFQHRLRIEGNTELGLHVKNLVDAIRLGSMPSILRLGLLCL
FT                   AEFIKAGQKEGVDQHDRALSSC"
FT   CDS_pept        400443..400946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0078"
FT                   /gene="yhbS"
FT                   /locus_tag="XBJ1_0388"
FT                   /product="putative acyl-CoA N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0388"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79538"
FT                   /db_xref="GOA:D3UZ10"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ10"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79538.1"
FT                   /translation="MLIRVEIPVDAMGIDRLLRQSFETSAEAELVYRLREDGLLTLGIV
FT                   ATDDEGYVIGYVGFTSVDVNGQDHQWVGLAPLAVAEPYRRQGIGEKLVYEGLDSLNEFG
FT                   YGAVVVLGEPAYYRRFGFRLAKEYQLHCQWPECEDHFQIYTLADVSLEDCHGLITYSDH
FT                   FDHE"
FT   CDS_pept        complement(400915..401259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0389"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0389"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79539"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR022992"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ11"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79539.1"
FT                   /translation="MKSTHWYLYLIRTRNNSLYTGITTDIARRFMQHVSGKGAKALKGK
FT                   GPLTLVYHSLVEDQGMALKLEYRVKKLSKKQKERLITLQPVCIATYLSEMLVPKIAQSV
FT                   ITHDQNGRNT"
FT   regulatory      401113..401159
FT                   /regulatory_class="terminator"
FT   regulatory      401246..401305
FT                   /regulatory_class="promoter"
FT   regulatory      complement(401370..401429)
FT                   /regulatory_class="promoter"
FT   CDS_pept        401536..401787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0390"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0390"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79540"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ12"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79540.1"
FT                   /translation="MKSVKYIVCILALSAISFGSMAATEVQYAKGEKVGVVSVTGAETL
FT                   DSLTAELSKKADKAGASYFRVISANGQNKLSGVAEIYK"
FT   regulatory      401818..401877
FT                   /regulatory_class="promoter"
FT   regulatory      401838..401875
FT                   /regulatory_class="terminator"
FT   CDS_pept        401904..402335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0391"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0391"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79541"
FT                   /db_xref="GOA:D3UZ13"
FT                   /db_xref="InterPro:IPR011194"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ13"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79541.1"
FT                   /translation="MELNENFLTIRRYLAKQHVFTLCTSSSQDLWCASCFYAFDADSMA
FT                   FWFMTEPDTRHGQMMQQNPVVAGTVAGQTRNIAQIKGIQFRGEITPLTGEAETLARARY
FT                   CRRFPVALAAKSPIWRLSLSEIKMVDNTLGFGKKLHWQR"
FT   regulatory      complement(402405..402446)
FT                   /regulatory_class="terminator"
FT   operon          complement(402460..403454)
FT                   /operon="XBJ1_operon0079"
FT   CDS_pept        complement(402460..402846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0079"
FT                   /locus_tag="XBJ1_0392"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0392"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79542"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ14"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79542.1"
FT                   /translation="MSRSIHTENAPAAIGPYVQGVDLGSMVITSGQIPVDPKTGDIPED
FT                   ITAQTRQSLENVKAIIEQSGLKVADIVKTTVFVKDLNDFTTVNAAYETFFTEHNAPFPA
FT                   RSCVEVARLPKDVKIEIEAIAVRS"
FT   regulatory      complement(402887..402946)
FT                   /operon="XBJ1_operon0079"
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(402990..403454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0079"
FT                   /gene="pyrI"
FT                   /locus_tag="XBJ1_0393"
FT                   /product="aspartate carbamoyltransferase, regulatory
FT                   subunit (allosteric regulation)"
FT                   /EC_number="2.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0393"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79543"
FT                   /db_xref="GOA:D3UZ15"
FT                   /db_xref="InterPro:IPR002801"
FT                   /db_xref="InterPro:IPR020542"
FT                   /db_xref="InterPro:IPR020545"
FT                   /db_xref="InterPro:IPR036792"
FT                   /db_xref="InterPro:IPR036793"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ15"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79543.1"
FT                   /translation="MTQDHQLQVEAIKCGTVIDHIPAHIGFKLLSLFKLTETEQRITIG
FT                   LNLPSNQLGRKDLIKIENTFLTEQQANQLAMYAPHATVNNIENYEVVKKIPINLPKQID
FT                   NVLVCPNSNCISHNEPVESSFYVIPTADDVIVRCKYCEKEFDRQAVINND"
FT   CDS_pept        403463..403600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0394"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79544"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ16"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79544.1"
FT                   /translation="MNTVQVFLLRILGDQGHVPILSHKIWHFTLHKSVFDASSDTLFEL
FT                   "
FT   regulatory      complement(403617..403676)
FT                   /regulatory_class="promoter"
FT   regulatory      403717..403776
FT                   /regulatory_class="promoter"
FT   operon          403877..405899
FT                   /operon="XBJ1_operon0080"
FT   CDS_pept        403877..404608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0080"
FT                   /locus_tag="XBJ1_0395"
FT                   /product="putative D-alanyl-D-alanine dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0395"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79545"
FT                   /db_xref="GOA:D3UZ17"
FT                   /db_xref="InterPro:IPR000755"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ17"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79545.1"
FT                   /translation="MFLSIAMENNTVDKIAVEKLFDWEVINGMPINECHEPLEIITDTD
FT                   KLRQQSAYFFAGIKGSIEYCTVRENVARKLVIASQLLPPHLGLLVLDGWRSRETQQALQ
FT                   EQTQIKIADQYRHLSVEEQKALLQQFVAPAPTEQHQISPHLTGGSVDVTLFDVASGKPL
FT                   FLGTEFDEVTELSYTAALEKEPEKNMPAILYRRLLYNAMIQVGFTNLPTEWWHYDYGNS
FT                   LWAFYKNDIAIYGAVDGTRNR"
FT   CDS_pept        404682..405899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0080"
FT                   /locus_tag="XBJ1_0396"
FT                   /product="YjcL protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0396"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79546"
FT                   /db_xref="GOA:D3UZ18"
FT                   /db_xref="InterPro:IPR008537"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ18"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79546.1"
FT                   /translation="MNNTLITSDNSLMLWAFIMIAVAVAIMVEQRYRWASKIPGAVIAL
FT                   IIAVFASNLNIIPTEAPVYDAVWGYIVPLAIPLLLFKTNLHSIIKESWRLLILFLISSV
FT                   ATMIGAIVSFRLFKEHIPELDKISGMISASYTGGGVNFAAMAAKLEPSQSMTASTIVAD
FT                   NMMMAGYFIILIALSGWTVARKFWGSPHTDAIDNDPDLDKSQTFAAAYWKPKNIALKDI
FT                   ALSLAWSIFIVALSFQLSTWLKALLGQPNSIYQELLFSLISDKYLILTTVTFTLVSIFK
FT                   ETFSKLNGTQELGTYAIYMFFVVIGIPASIEAIISHAPLLFAFVFVIAMINLLLTFAAG
FT                   KVFKFSLEENILACNANIGGPTTAAAMAISRGWVNLVGPIMVIGTVGYVIGNYVGTFVY
FT                   FIVGRM"
FT   CDS_pept        complement(406077..406286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0397"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79547"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ19"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79547.1"
FT                   /translation="MIHCDTYSVLRQRKNRSIAIESTMSAPQINHTISIGNFIGNCFIT
FT                   DYEFGMIFVMLTITIETFRPQGVT"
FT   CDS_pept        406089..406214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0398"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79548"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ20"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79548.1"
FT                   /translation="MRPKRLNRYRKHHENHPKFVVSYKTVAYKITNRNSMVNLRS"
FT   regulatory      406089..406122
FT                   /locus_tag="XBJ1_0398"
FT                   /regulatory_class="terminator"
FT   regulatory      406227..406286
FT                   /regulatory_class="promoter"
FT   regulatory      complement(406431..406490)
FT                   /regulatory_class="promoter"
FT   CDS_pept        406459..408777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeP"
FT                   /locus_tag="XBJ1_0399"
FT                   /product="putative formate dehydrogenase (C-terminal),
FT                   related to acid resistance with formate dehydrogenase/DMSO
FT                   reductase, domains 1-3 and ADC-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0399"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79549"
FT                   /db_xref="GOA:D3UZ21"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ21"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79549.1"
FT                   /translation="MKFKSKIEPYHSAAGGWGSLEATTRFVFDSKQALKNMVNLMRMNK
FT                   AKGFDCPGCAWGDDNKSLFSFCENGAKAMTWEATRRHVDQAFFAAYSVSKLYQQSDYFL
FT                   EYQGRVVEPMRYNHQTDHYEPISWDDAFTLIAKHIKAMENPNQLELYTSGRASNEASWL
FT                   YQLFGRVLGTNNFPDCSNMCHEASGYGLLKSLGVGKGTIRLNDFDHADAIFVFGQNPGT
FT                   NHPRMLHSLRHAAERGARIVTFNTLRERGLERFADPQKPLEVITPKAGAISHRYYQPKL
FT                   GGDMAVVRGMVKALLETHNAFLAAGKSGIFDLEFISTHTEGVDAYLQEVAVTEWAFIEN
FT                   QSGLTQAQLREAATIYQHADRVICTWAMGITQHKHSLDTVREIANLQLLFGQLGKSGAG
FT                   LCPVRGHSNVQGNRTMGINEQPTKAFLDSMAEHFGFEPPRAHGHHVVKALSAMLRDEVR
FT                   VLIALGGNLAAAAPDSPRTEEALRHCDLTVHISTKLNRSHLITGKKEALILPALGRTEQ
FT                   DIQLSGAQFITVEDSFSMVHASEGLNKPLFDTQRSETAIIAGIANAVVGNTATINWLEL
FT                   AGNYNKIRDHIAATIPGFADFNKKCEQPGGFYLGNAAAELRFSTPSKKAQFSDASLPES
FT                   LFPQLGETDVPFTLQTLRSHDQYNTTIYGLDDRYRGVYGQREVLFMNPEDIALLGYQAG
FT                   DRVDIETVWNDGIERKVYGFKLVPYAIPCGNLAAYYPETNPLVPMDSIGNGTGTPTSKS
FT                   VPVKLSLTEIGEAEPQRLV"
FT   regulatory      complement(408788..408820)
FT                   /regulatory_class="terminator"
FT   regulatory      408802..408832
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(408918..409859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="XBJ1_0400"
FT                   /product="aspartate carbamoyltransferase, catalytic
FT                   subunit"
FT                   /EC_number="2.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0400"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79550"
FT                   /db_xref="GOA:D3UZ22"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ22"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79550.1"
FT                   /translation="MANPLYRKHIISINDLSRTDLELVLQTAAALKANPQTELLKHKAI
FT                   ASCFFEASTRTRLSFETAIQRLGASVVGFADSNNTSLGKKGETLADTISIISQYTDAIV
FT                   MRHPQEGAARLASEFSGHIPVINAGDGANQHPTQTLLDLFTIQETQHKLDNLKIAMVGD
FT                   LKYGRTVHSLTQALAKFSGNHFCFIAPDALAMPSYILHMLDEKQVSYSIHHNFEDVMPE
FT                   LDILYMTRVQKERLDPSEYANIKAQFVLHAADLVNVKENLKVLHPLPRIDEITVDVDKT
FT                   PYAYYFQQAGNGIFARQALLALVLNENVVIEK"
FT   regulatory      complement(409920..409979)
FT                   /regulatory_class="promoter"
FT   regulatory      410332..410391
FT                   /regulatory_class="promoter"
FT   CDS_pept        410430..411176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0401"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0401"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79551"
FT                   /db_xref="GOA:D3UZ23"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ23"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79551.1"
FT                   /translation="MKTYIFDLDGTIITNGQPIHNVIAEKIKQLCSSGSVIFASARPIR
FT                   DMLPLLPHELHNCLMIGCNGGMAWQNGDFLFSHSFNPEHFSRVIAFLKEEKIPYVIDGV
FT                   WYFSVSEINHDFHNYMRTLSTYEKEEKELLSEKITKILVLDGESRTKIDRFLEREGFKY
FT                   NINHHKADNLFDITPQSEDKYQSLCKLGVDFNNAIVFGNDENDYAMLDNAKISVFIGAM
FT                   KDYPNANFYCRTEYIPSILGEVTDSF"
FT   CDS_pept        complement(411661..412398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0402"
FT                   /product="Regulatory protein, LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0402"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79552"
FT                   /db_xref="GOA:D3UZ24"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ24"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79552.1"
FT                   /translation="MIFNQKEMNIIQARDFMNEILVSKTTTNILRQMIQKDTVIKSPIG
FT                   TYVGIESFIALLKIWHRAFPNLVYKENNLYVHNENIIIDWEAEGKHLGEFYSISATGKQ
FT                   VTCQGTTEIVMNDGKIIDYHTKINIQNIISQLIGLPCSPTLDIRNIEIYNLINNILGYQ
FT                   LSCRQIECLSLSTLNTSIKEIARLLSIESNTVKTHLKRAFEIIGISNKKMLMEFIIERQ
FT                   AIEILVRLGLFLRVQIKRNNYFE"
FT   regulatory      complement(412607..412666)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(412699..412737)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(412776..413219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0403"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0403"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79553"
FT                   /db_xref="GOA:D3UZ25"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ25"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79553.1"
FT                   /translation="MLNGTQLRYAALIARYSLAIAYLVAVADRFGLCGEYGDPQITWGN
FT                   FTVFLGVVKHLTPWAPDFMIPIFGWGATILEVALPIFLIIGFKIKETALVSAALLLIFA
FT                   VTMTTTGLLKSVFDYSVLSAFSCSLLLYCFEKFRVSEDKKQLN"
FT   regulatory      complement(413252..413311)
FT                   /regulatory_class="promoter"
FT   operon          complement(413332..418736)
FT                   /operon="XBJ1_operon0081"
FT   CDS_pept        complement(413332..413754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0081"
FT                   /locus_tag="XBJ1_0404"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0404"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79554"
FT                   /db_xref="GOA:D3UZ26"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ26"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79554.1"
FT                   /translation="MNYAKISPKIMNPLYKCYDEIQKCELDQSLILLVEMRTSQINGCA
FT                   YCCRLHAEMGRKLGIEEEKLDKLPGWFNSRIYNQKEVLALEWCEALTIGLRDKDLNDLR
FT                   ERLEELFSEKELVDLTSAISVMNALNRMAISIGDHS"
FT   CDS_pept        complement(413830..414945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0081"
FT                   /locus_tag="XBJ1_0405"
FT                   /product="Flavoprotein monooxygenase:NADH:flavin
FT                   oxidoreductase/NADH oxidase precursor (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0405"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79555"
FT                   /db_xref="GOA:D3UZ27"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ27"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79555.1"
FT                   /translation="MKIQCIGAGPAGLVFSILAKMQDHNRDVVVYERNLSNVTTGWGLV
FT                   LSEPMLQQLANIDPSIVEQLRPHISTLNHIDIYIKEKTFRSSGYQFLAISRLEMINTLR
FT                   KKALDLGIKINYDSSLNAEDLINLPADLTVISDGANSKIRHQLKNEFDTNINEGKNLYL
FT                   WLGTSHLFNDTFNFIFEQTETGWFWAHCYKFENNHSTFVVECTHETWVKTGFAHMDEKQ
FT                   TIAFLEKVFHRHLCGHPLQINDTCREKAYWRRFVTPVSKHWSHDKKVLLGNAAHSAHFS
FT                   IGSGTKLAIGDAIALAENLKSSNKLDSACFTDYQHNRQNESSNLHIAAQSSQSWFENVE
FT                   SLIENDPLEFSISLLLRSGRLSRDELTINLL"
FT   CDS_pept        complement(414991..416352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0081"
FT                   /locus_tag="XBJ1_0406"
FT                   /product="putative Succinate-semialdehyde dehydrogenase
FT                   [NAD(P)+]"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0406"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79556"
FT                   /db_xref="GOA:D3UZ28"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ28"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79556.1"
FT                   /translation="MTINENIDITVQQTETASYIDNLVVQGKIAQKELEKQSDEDIDNV
FT                   LHHLAKIFSTHCREWAEKELAVTRIGNADDKEHKLALVVNQVFKGLYGTKTHGRLGGTQ
FT                   RLIEYASPVGLIFAVVPLTNPIPNSLFKIMLSIKTRNAIIFSYPGKTGKLADEFIGLVQ
FT                   QVLTEHGLPVSLVQVCTPPSHDKTHMLMQHPGVDMILATGGRNLVHAAYSSGKPAFGVG
FT                   PGNVPVYISRSAHIQKAAANIVNGKIYDNGIVCGSESNLIVHPASKNDLISALEANGAA
FT                   ILTSSEVEQAIQTLFNPETQYVSRENIGVCAASLAAKANISRTYPIKLLVIPAEIGRHD
FT                   FLSNEKMAPVLTLYTADEENGVSLAYSLICNEGAGHTAVIHSEDPEEIHQFSTVMPAGR
FT                   ILVNTSATQGMLGETTELPVSFMQGSGTFGHNHSTDPIIWKHLVNIKRVAHGLH"
FT   CDS_pept        complement(416387..417118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0081"
FT                   /locus_tag="XBJ1_0407"
FT                   /product="putative oxidoreductase, NAD(P)-binding domain"
FT                   /EC_number="1.1.1.184"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0407"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79557"
FT                   /db_xref="GOA:D3UZ29"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ29"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79557.1"
FT                   /translation="MKTCLITGANRGIGFEIAKKLGERGHRVILSGRDIPALEHSVSQL
FT                   TQMGITADLLHLDVTDPESIKSAANLLLSANTTLDVLINNAGVFLDSIQKPSETSLDDI
FT                   HKSLTVNLVGPWLVTQAFLPLLNRSEEARLIFISTDLAALSQAADPHSKYNRIEGPAYR
FT                   ASKAALNMLALQWAKEFRDSKISVSVCSPGWCRTGLDSQISSEQAPNSAAEGADTVVWL
FT                   ALDKGREQHGHFYSARQTIDW"
FT   CDS_pept        complement(417120..418736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0081"
FT                   /locus_tag="XBJ1_0408"
FT                   /product="putative o-succinylbenzoate--CoA ligase"
FT                   /EC_number="6.2.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0408"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79558"
FT                   /db_xref="GOA:D3UZ30"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ30"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79558.1"
FT                   /translation="MITPEEIKKIISSENIGAGNFIHHLNNYFSEREMSPKITCDVPTY
FT                   DNPEEEKSQFEINDLVKISDQLSGAYIALGVQKREPVALYFDDTIDYLIHFIALNNIGS
FT                   FPIFVNGDLSSHIAMSFMQNSGTKFIISTEERIHSLGDKAAGIQFVTPNELNLLKKPIS
FT                   RYYQHHANDIILLGHTSGTTGLPKPVIFTHESMFHGILKEVAKQRGKQILSMFPHSHGA
FT                   SMTLIMLTLTRGAAIHIQSKKTAFDILDSIEQIKPDTVAAFPKIFVDLCREDLDDWDLN
FT                   SISHWVSTGDANHEPHIRKLISYGHHFVDGKKARGSFFIDNLGSSEFAFAMFRNIHQPK
FT                   TDRYDRCIGIPFSWVDAAILDADGNVLPNNQVGMLGVISKSVTTGYWNNHLLTEKNRVN
FT                   GYWLTGDLVYRTNDGFFYHVDRTSDWIKTPQGPLYSTQCEEWLLKNIDSIFDISIVATS
FT                   LPNGDQQTTAIVELKAGHEISPATLLQNINACHQEKQWPLIDNIVYQSADNDLGVTGKK
FT                   LKRKIRDRMPEDNSMVTEEGN"
FT   regulatory      complement(418775..418834)
FT                   /regulatory_class="promoter"
FT   operon          complement(418849..423808)
FT                   /operon="XBJ1_operon0082"
FT   CDS_pept        complement(418849..419445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0082"
FT                   /gene="pabA"
FT                   /locus_tag="XBJ1_0409"
FT                   /product="aminodeoxychorismate synthase subunit II,
FT                   component of p-aminobenzoate synthase multienzyme complex"
FT                   /EC_number="4.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0409"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79559"
FT                   /db_xref="GOA:D3UZ31"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ31"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79559.1"
FT                   /translation="MYFIIDNYDSFTYNIAQYLGMLGIEVLVKKNDRITLEYIEQHNPT
FT                   GLIISPGPCTPNEAGISTLAIQHFAGKIPILGICLGHQCIAQEFGGKVLRANKVYHGHT
FT                   STITHNDKNLFANLPQDIKVGCYHSLVVDDLPECLTVTARSCDEYNDIMALKHNDFPIY
FT                   GVQFHPESILSDFGLDMLKNFIKITQEWKPMNRIQ"
FT   CDS_pept        complement(419466..420968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0082"
FT                   /locus_tag="XBJ1_0410"
FT                   /product="Anthranilate synthase component 1 (Anthranilate
FT                   synthase component I)"
FT                   /EC_number="4.1.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0410"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79560"
FT                   /db_xref="GOA:D3UZ32"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ32"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79560.1"
FT                   /translation="MLNLNEFLAYGEEGYNLVPVWKNIKKTQISPISIYETLANKSYSY
FT                   LFELSEKYEDKYRATYSIVGLPCHQRIEIKDYSIKVFDENNAQTHITDIPPLDALRQIL
FT                   TSYRVPKIDQLPNYAGGLFGYFGFETTRLIEPKLQANTRKKTLVDLPDILQIVSQELIV
FT                   VDHINDLIYVIVHAKPTKSQNFTDANLRINQIISELEKIPYQQQANFSPSTTTDRTTWF
FT                   KDMESHFPQHDFQMAVNKIKEYIKAGDAMQVVLSQAMSRPLKANAIQLYQALTSMTNTP
FT                   YCYLMNVEDSHIVGASPEMMVSLHQNKLISHPMAGTRHRGMNQQEDDALKAELLADNKE
FT                   IAEHIMLVDLARNDIGRVAKTGSVTVNNLLSVEYFSHVMHIVSEVSGEKMDGIDEIDVI
FT                   SSTFPAGTLSGAPKIRALEIIHELEPYGRGVYGGCLGYITWNGDINLSITIRTGLLHQG
FT                   QLYVQAGAGIIDASRAEREWQETIEKNSMMMHAAYQAEQFSL"
FT   CDS_pept        complement(420955..422565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0082"
FT                   /locus_tag="XBJ1_0411"
FT                   /product="putative coenzyme A ligase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0411"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79561"
FT                   /db_xref="GOA:D3UZ33"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ33"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79561.1"
FT                   /translation="MSLATFSTFEAIASTTKSINLAQRFVMENSSLDKDCFIGPDGSLS
FT                   YSQLAFFVQKSASAMSLKKIEKNTAVILCLNDSRELAIIFFASLAIGALPVVINPKLPA
FT                   NTLDYILGEFDTPFIFLDEDNQISIAAEAKENTIRIKRSADLSAFCDWMPENTNDKWHD
FT                   FLEKTHFEPAFIQYTSGSTGKPKGVIHSVTSILSSCEHFSKHQLGLTTTDIIYSTPKTF
FT                   FGYGMGNTLFFPLFIGATAIIDSLWPSITRVTDNIKQFQPTVLLAGPMIFRLLLEDDEF
FT                   KQNCHLRLVVSSGSMLPAPLKESWFQRLNIVIHDAFGATETCHAFATTYGHPSRSGSIG
FT                   KFIAGCTGKIVDKDGKTVPAGETGVLMLSSESLALGYWNNHQDTKIKFSNGWYRTGDLF
FT                   SQDDEGFLYYHGREDEQFKVLGRWLVPVEIEKLVHSAFPEIGDAFMIPWMDSIQECRPV
FT                   LCLKTSSSEFEAISQQIANFISHQVESYKHPYVYLNLEQFPLNGNGKIDRKSMIEIARQ
FT                   KITDQNMSSHPRRINYAQS"
FT   CDS_pept        complement(422588..423808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0082"
FT                   /locus_tag="XBJ1_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0412"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79562"
FT                   /db_xref="GOA:D3UZ34"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR039068"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ34"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79562.1"
FT                   /translation="MNSIIKTDIKESMYNIFTENTDNIWSDWLDEKELKKLTDHPVLQS
FT                   FNDSTASEEMLKTFLIQHCYYSRHFTRYLIALISKLDVFEDIKDLLHNLLEEMGLEDEN
FT                   KITHAELFQRTLKTVGADINSQKPFENTTAMVDAMFSFCLSDDPLEGLSAMCLGAEAIV
FT                   PLIYKPVLNRLMTLNYNKDATEFFTLHIEEDEDHAIKMFEIIDRLTRQDESLRLKAINI
FT                   GSEMIRKRVKMLDSVWESEIVRKNNVEKADLNNQKNDLSFNSSDFWRVNHKSTPSIPEK
FT                   LIHKNVINSHSHGENKFSEERKHKVNIVNLPTKTISMTLGHLEPGQSTNLHRHNYETVI
FT                   YIIEGDGVSKIGNNDVAWSAGDAIYIPSWVEHKHSSVNQNQCLYIACENAPLLQNIGNI
FT                   ALREELE"
FT   regulatory      complement(423898..423957)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(424047..424078)
FT                   /regulatory_class="terminator"
FT   operon          complement(424297..426801)
FT                   /operon="XBJ1_operon0083"
FT   CDS_pept        complement(424297..425211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0083"
FT                   /gene="elaC"
FT                   /locus_tag="XBJ1_0413"
FT                   /product="binuclear zinc phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0413"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79563"
FT                   /db_xref="GOA:D3UZ35"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ35"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79563.1"
FT                   /translation="MELKFLGTSAGVPTKERNVTSLVLDLRGIRNALWMFDCGEGTQHQ
FT                   ILNSSIKIPKLEKIFITHLHGDHIFGLPGLLCSRSMGGSTDPVTLYGPKGIRQFVETTL
FT                   QLSGSFLTYPLDIVEVQSGLLFDDGELKVTAYALNHRVECYGYRIEEHDKPGGLNTQRL
FT                   NQDNIPRGSWMQTLKQGGTVTLEDGRTVCGKDYLGAPISGKSLAIFGDTTPTPEALKLA
FT                   ANVDVMVHEITLEDALAEKANNNGHSTTKQAATLARDAKAKHFIATHISGRYGIEDCPR
FT                   LLAECREIFPNTDLAEDFAIFIV"
FT   CDS_pept        complement(425224..426801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0083"
FT                   /gene="rtcR"
FT                   /locus_tag="XBJ1_0414"
FT                   /product="sigma N (sigma 54)-dependent transcriptional
FT                   activator of RNA 3'-terminal phosphate cyclase (EBP
FT                   familiy)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0414"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79564"
FT                   /db_xref="GOA:D3UZ36"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009715"
FT                   /db_xref="InterPro:IPR017183"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ36"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79564.1"
FT                   /translation="MKRRVVIGILGTKLDRRGKKANRWTKWRPTIGMCQQAELPIDRLE
FT                   LLYQTNDYGLAQRVKEDIAETSPKTKVVLQELKIEDAWDFEEVYTAQLDFAVRYPFDTE
FT                   NEEYLVHITTGTHVAQICWFLLTEARYLPAQLLQTSPRNGDRESHPEGNYTIIDLNLSR
FT                   YTTLTSRFLHEQQEQVAFLKSGIATRNANFNRLIDQVERVALRSSAPILLTGPTGAGKS
FT                   FLARRIYQLRQSRHLIQGRFVEVNCATLRGDNAMSTLFGHVKGAFTGAIQPRTGLLREA
FT                   DGGILFLDEVAELGLDEQAMLLKAIEEKSFLPYGSDKEVHSNFQLIAGTHRDLHTWVVQ
FT                   GKFREDLYARINMWTYQLPGLAQRREDIEPNIEYELARYAQMQQTQVRFDKEARLIYLH
FT                   FACSEQAQWRGNFRELGASVTRMATFAENGRINQHLVEEEITRLKQNWQDNGLSSLLPN
FT                   HLPEVDLFDRQQLETVIKICRESASLSEAGRKLFAVSRQQKKQPNDADRLRKYLARFGL
FT                   GWDSIQND"
FT   regulatory      complement(426843..426902)
FT                   /regulatory_class="promoter"
FT   CDS_pept        427280..427411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0415"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79565"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ37"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79565.1"
FT                   /translation="MCSPLGFALMFGFPSEGNIKKENNNDEKNQIIAGTNWLTGKRG"
FT   operon          427353..432224
FT                   /operon="XBJ1_operon0084"
FT   CDS_pept        427353..428927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0084"
FT                   /locus_tag="XBJ1_0416"
FT                   /product="Band 7 protein (modular protein)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0416"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79566"
FT                   /db_xref="GOA:D3UZ38"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ38"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79566.1"
FT                   /translation="MMKKIKLLQGQIGLLAKEGEYQQILTAGKYRFIDWFNKLRLTVFE
FT                   LNSNEIEAKLAEHLRQYHTDWVAQHCDDIQLTEDEIGLLYEHDLLTEILPPATRRLYWK
FT                   NGDQRRIEVCPTTEQEVSSQLVSLLQPSKIRKRNVKGLESVLITQIPAWHIGVLKSDGI
FT                   VQQLLQPGLKGYWRFGHDISVELVDTRSWPQVEESLAEYFRHQHIDWVEQYCDEIQIAD
FT                   DEMGLLYEHDVLVEILSPATRYLYWKNGNPRCVEVLKASELEVSSELASVLVSSMVRKH
FT                   SVKGIDSVLIAQVPAWHVGILKVDGVAQKLLQPGQAGYWQVGHDVTVEIVDTRLQALEV
FT                   GGQEILTRDKVNLRINLSANWRYHDVLMAYEQLSEPVAYLYRELQFALREMVGTRSLDE
FT                   LLEDKQAIDELINEKVQRITAGFGLEVVSLGVKDIILPGEMKTILSRVVEAEKAAQANV
FT                   IRRREETAATRSLLNTAKVMENNPIALRLKELETLESIAERINQISVYGGLDQVLNGLV
FT                   QIKGEQK"
FT   CDS_pept        428924..430165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0084"
FT                   /gene="rtcB"
FT                   /locus_tag="XBJ1_0417"
FT                   /product="putative PLP-dependent transferase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0417"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79567"
FT                   /db_xref="GOA:D3UZ39"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ39"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79567.1"
FT                   /translation="MTTIEMKTNAYNLLTQENGAQIKMWTNGVPVDPKAITQLQNTAKM
FT                   PFVFKHLAVMPDVHVGKGSTIGSVIPTRGAIIPAAVGVDIGCGMIAVRTSLVASDLPDS
FT                   LLNIRHAIEAAVPHGRTVNRGGRDKGSWHRAPELVDQHWATLADGFKCITDKYPKLLNT
FT                   NNHQHLGTLGTGNHFIELCLDEADRVWVMLHSGSRGVGNAIGNLFISLAQKDMQQHIAN
FT                   LPDRDLAYFEEGSRYFDDYMEAVGWAQDYARQNREVMMHHVLEALSREIPKPFTTQEEA
FT                   VNCHHNYVQREQHYGEEVLVTRKGAVSARKGQMGIIPGSMGAKSYIVRGLGNEESFCSC
FT                   SHGAGRVMSRTEAKKRFTVSDQKRATAHVECRKDSDVIDEIPMAYKDIDAVMEAQSSLV
FT                   EIVHTLRQVVCVKG"
FT   CDS_pept        430183..430989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0084"
FT                   /locus_tag="XBJ1_0418"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0418"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79568"
FT                   /db_xref="InterPro:IPR018775"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ40"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79568.1"
FT                   /translation="MEVMEKKTTAVSSVMRTRIKQELAGIEKRYGVQILYACESGSRGW
FT                   GFASPDSDYDVRFIYVHPVDWYLIVEAGRDVIELPISDELDICGWELRKTLKLLKQANP
FT                   TLMEWLDSPIIYQADPAATNGLKTMVPHFFSGIKARYHYLSMAKKNFRGYLQGEEVRLK
FT                   KYFYVLRPLLAVRWIEMGKGVPPIDFETLVAGTVDDPQLKAEISDLLRSKRLANESEYG
FT                   LRKLRVHAFIESELDETLSRCELKDKRERSYALLDDYLRRWVMKRV"
FT   CDS_pept        431033..431578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0084"
FT                   /gene="kptA"
FT                   /locus_tag="XBJ1_0419"
FT                   /product="2'-phosphotransferase"
FT                   /EC_number="2.7.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0419"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79569"
FT                   /db_xref="GOA:D3UZ41"
FT                   /db_xref="InterPro:IPR002745"
FT                   /db_xref="InterPro:IPR022928"
FT                   /db_xref="InterPro:IPR042080"
FT                   /db_xref="InterPro:IPR042081"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ41"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79569.1"
FT                   /translation="MAQVDTKISKFLSYVLRHQPESIGLTLDNEGWADIGELIKCAEKH
FT                   GKHLNYALIATIVETNDKKRFAISDDQKRIRAVQGHSNQKVNISYQAQVPPTVLYHGTA
FT                   IRFLDSIFQQGLVAGSRHYVHLSADEATAIKVGQRHGKPDILKINAQLMHEQGFKFHQA
FT                   DNGVWLTKSVPVKYISFN"
FT   CDS_pept        431601..432224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0084"
FT                   /locus_tag="XBJ1_0420"
FT                   /product="putative LysE family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0420"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79570"
FT                   /db_xref="GOA:D3UZ42"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ42"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79570.1"
FT                   /translation="MLVTDALLAFIVAATLLTSTPGLDTALVLRTAAVEGGKKALHAAL
FT                   GINAGCFIWGAMVAFGLGTLIAVSEQAFNILKWCGALYLCWLGIQMIVRPSQSLAGETA
FT                   SSPVKTQNWFIRGMLGNVLNPKIGVFYVSFLPQFIPQGHSPVLWIFGLVSIHILLGTIW
FT                   SLLLIYATRPLSHLLRRENVIKWMNRATGGLFLFFAFKLVLSRR"
FT   CDS_pept        432254..432373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0421"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0421"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79571"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ43"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79571.1"
FT                   /translation="MFLWVAFIVAAPAVRESLQAEQVLKLQLQAEALARPEPV"
FT   regulatory      432463..432522
FT                   /regulatory_class="promoter"
FT   CDS_pept        432554..433018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0422"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0422"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79572"
FT                   /db_xref="GOA:D3UZ44"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ44"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79572.1"
FT                   /translation="MIELREMTTAEFELFRLLFINEYALDLASTRGYPADVSLKKASQL
FT                   IDVTQSQATEKVINKFWCIVKSDHELPVIGYLWIELKEKAAWVCDFSLLPEWRHKGLGK
FT                   ATLDKMKSNLISMGITEVGLRVAPNNPVAKALYEKSGFHITGFNMSKTLS"
FT   regulatory      complement(433008..433037)
FT                   /regulatory_class="terminator"
FT   regulatory      433020..433049
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(433048..433302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0423"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79573"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ45"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79573.1"
FT                   /translation="MSGVGLHSIAGVVEQISDPILGGGSFRSNGAVKALIELDVILQGP
FT                   KIGRNHSYRLNPQFGWKGMVNNHKETLTNGLSVIQGGRA"
FT   regulatory      433383..433442
FT                   /regulatory_class="promoter"
FT   regulatory      complement(433442..433501)
FT                   /regulatory_class="promoter"
FT   CDS_pept        433470..433739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0424"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0424"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79574"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ46"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79574.1"
FT                   /translation="MEIIPAQLAKNQFGDLLMKVQRVAVVISPEEYDQFTQLKLQNLKA
FT                   VLAESIAQADRGELHSIDDVFAPFTVEFPRREPHYLLPGSFDWY"
FT   CDS_pept        complement(433910..434080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0425"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79575"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ47"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79575.1"
FT                   /translation="MKKTKNYYREVSTHPFDMEKISLTKFLNKHIEDDSFYLFKFCLKI
FT                   IFNKMLNYIFK"
FT   regulatory      434466..434525
FT                   /regulatory_class="promoter"
FT   CDS_pept        434703..435776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeiC"
FT                   /locus_tag="XBJ1_0426"
FT                   /product="putative sugar kinase with ribokinase-like
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0426"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79576"
FT                   /db_xref="GOA:D3UZ48"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ48"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79576.1"
FT                   /translation="MPSRENQILRLIKQDPFIQQQEIADILGVSRSCVAGHIMNMNKKG
FT                   HIKGKGYIFPSPNNAYAVTIGAANMDFTSYASEKLVYEDSNPGKIISTPGGVGRNIAQN
FT                   IAALKSESHFISVVGNDYNGKVLFEQTKLAGVNIRYFHKLDEEKTSICNSIIDENGKCI
FT                   VSVNDMDIMEKLTPTLLSQSEELIRRASVLVIDCNLTEGALEWLFNHAGNVPIFIDTVS
FT                   TFKATKIRHWLSYIHTLKPNRSEAEILSGIEIETQKDAAIAASWFHQQGVQRLILSMGA
FT                   EGVYYSELDNKSGYSRAITTSVLNASGAGDAMMAGLAHCWLQSMSLEDSIRYAQRCSAL
FT                   TLSSEDTWILPNKSSIP"
FT   regulatory      complement(435775..435806)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(435818..436831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argI"
FT                   /locus_tag="XBJ1_0427"
FT                   /product="ornithine carbamoyltransferase 1"
FT                   /EC_number="2.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0427"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79577"
FT                   /db_xref="GOA:D3UZ49"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ49"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79577.1"
FT                   /translation="MNPFYRRNLLRLHDYTPSEINVFLTLSSELKSNKKSGKESPLLSG
FT                   KNIALIFEKDSTRTRCAFEVAAHDQGASVTYLSSNGSQIGHKESIKDTARVLGRLYDGI
FT                   QYRGYGQEVVETLAKYAGVPVWNGLTNEFHPTQLLADLLTMQEHSQKPLTEIKLAYLGD
FT                   ARNNMGNTMLEAAALTGMELRLVAPKTCWPDAALIAECQTLAEKTGGRIALTEDIATGV
FT                   KDADFLYTDVWVSMGEPKTVWQERIALLKPYQVNMDVIQLTENPEVKFLHCLPAFHDEE
FT                   TTLGKQLAEEFNLYGGLEVTSEVFESKHSIVFDQAENRMHTIKAVMVATLAKELSF"
FT   regulatory      436017..436049
FT                   /regulatory_class="terminator"
FT   regulatory      436819..436878
FT                   /regulatory_class="promoter"
FT   regulatory      complement(436865..436924)
FT                   /regulatory_class="promoter"
FT   CDS_pept        437065..437496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0428"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0428"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79578"
FT                   /db_xref="GOA:D3UZ50"
FT                   /db_xref="InterPro:IPR009671"
FT                   /db_xref="InterPro:IPR016716"
FT                   /db_xref="InterPro:IPR036701"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ50"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79578.1"
FT                   /translation="MADPHALEEQREETRLIIEELLEDGSDPDALYIIEHHFSAENFDL
FT                   LEKAAVEAFKLGYEVTDAEELETEDRVVLMCCDIISESRLDAELINTQVEQLMNLVEKL
FT                   GVNYDGWGTYFEDPNAPDDEDEDEDEAEDFPEQDERKLH"
FT   regulatory      complement(437514..437546)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(437576..438079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0429"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0429"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79579"
FT                   /db_xref="GOA:D3UZ51"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ51"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79579.1"
FT                   /translation="MTATTTQNYVIRPITPQDNTGIAAVIRQVSAEHGLTADRGFAVAD
FT                   PILDTLYEVYNQPRSAYWVIEMDGEVVGGGGVAPLAGGDDDTCELQKMYLSSVLRGKGI
FT                   ARQIVKQSLEFGIEQGFKRCYLETTEILQTAIKLYEKLGFSHLGEPLGNTGHCDCEIRM
FT                   IKVL"
FT   regulatory      complement(438216..438275)
FT                   /regulatory_class="promoter"
FT   operon          complement(438324..440679)
FT                   /operon="XBJ1_operon0085"
FT   CDS_pept        complement(438324..439097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0085"
FT                   /gene="fliY"
FT                   /locus_tag="XBJ1_0430"
FT                   /product="cysteine transport protein (ABC superfamily,
FT                   peri_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0430"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79580"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ52"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79580.1"
FT                   /translation="MKAFLSLLLAGATALTISAPSYAGKDLDAIKASGVFKVGTEGTYP
FT                   PFTYHDQANKLTGFDVDIAREVARRLNVKPEFMEVKWDGLIAGLDAKRFDAVINQVGVT
FT                   PEREAKYSFSIPYTASQVVLITRDNNSDIKTFADIKGKRSAQSLTSNYGQLATSNGAHL
FT                   VSTDGFNQAIDLVATGRADATLNDRLSFLDFKKQRPDAPVKIVAQQADASKSAVLLRKG
FT                   DPELIAVINKALQDMKDDGTYARISEKYFGTDISK"
FT   CDS_pept        complement(439179..439943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0085"
FT                   /gene="yecC"
FT                   /locus_tag="XBJ1_0431"
FT                   /product="putative amino acid transport protein (ABC
FT                   superfamily, atp_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0431"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79581"
FT                   /db_xref="GOA:D3UZ53"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ53"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79581.1"
FT                   /translation="MIQLSNIEKSFDGQKVLKNISLTIKEGSLTALIGPSGSGKSTLLR
FT                   CINLLEIPQAGTLEIGKEQITFTGKERLPHREIQRFSLQTGMVFQNFQLFPHLTVIENI
FT                   IEGLIYVQKWPLERARERAQELLKKVGMSHKADVWPNTLSGGQQQRVAIARAMAPSPKV
FT                   LLCDEPTSALDPELSKEVVSVLKHLAEEGTTMVMATHDLRLAANLAHNVIFLESGEIVE
FT                   SGTAQTMFTRPNKQRTGEFISTLTETLPDWEI"
FT   CDS_pept        complement(439927..440679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0085"
FT                   /gene="yecS"
FT                   /locus_tag="XBJ1_0432"
FT                   /product="putative amino acid transport protein (ABC
FT                   superfamily, membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0432"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79582"
FT                   /db_xref="GOA:D3UZ54"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ54"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79582.1"
FT                   /translation="MLYKYVYPPYKQEEYMTPSWLSLALDSLWPMLYAGLTFTIPLTLI
FT                   TFALGISLGFIVALIRLYGSKPLVAVVRFYVWLIRGTPLLVQLFLIFYALPSVGITLEA
FT                   FTSAVIGFTLNVGAYTSEVIRAALISVPKGQWEASHSIGMSWWQSLRRIVLPQAARVSI
FT                   PPLSNTFISLVKDTSLASVITVPEMFLAAQRIAAVTYQPLILYTEAAILYLLLSSVLSA
FT                   LQVRLEKKFSQQFSQHRSSKEAKNDSAL"
FT   CDS_pept        complement(440765..440827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0433"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79583"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ55"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79583.1"
FT                   /translation="MVLSYNFILYKDGIVLQYHH"
FT   CDS_pept        complement(441079..442062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0434"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0434"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79584"
FT                   /db_xref="GOA:D3UZ56"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ56"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79584.1"
FT                   /translation="MAYKQLTETERYQIFSLKEAGFSQREISKSLNRNPSTISRELRRN
FT                   REAKKYTPEQAQLKAVARRQCATKAVKMKPEIEMWIKQLIWQDLSPEQTVGYLKRENII
FT                   SLHHETVYRLIYKDKINGGNLWQHLRIAKKPYRKRYGSYERRGKIKNRVSIDKRPKLVD
FT                   KKQRIGDWEGDTIVGKNHKSALLTLVERKSLFTIIIKLENKTAEGVAKAATRHLSLIKH
FT                   KIKTMTFDNGLEFAEHELISKNLETKIYFAHPYSPWERGINENTNGLIRDYFPKGTDFN
FT                   KVSEREINLVANRLNNRPRKTRDYKTPNELFKGISSHLLRPLRCCA"
FT   regulatory      complement(442087..442146)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(442152..442192)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(442204..442977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0435"
FT                   /product="putative cysteine transport protein (ABC
FT                   superfamily, peri_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0435"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79585"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ57"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79585.1"
FT                   /translation="MNIILNILLATIIQLGITQLAYAKSTLDNIQSTGVFRIGTEGAYA
FT                   PFSYHDASGKLTGFDVEIGREIALRMKVKPEFIEGKWDGLIGGLDAGRSDAVMNQIAIT
FT                   PEREKKYSFSLPYVISEAVLITRKDNNDIKTFRDLKGRTSSHTLTNNFAQIARHYGAEI
FT                   IGTNGFSQEVELVSTGRADATINDKLSYLDYKKHRPDAPVKIVAADTNAAQTAVLLRKS
FT                   DPELKAAVDKAITEIKNDGTYQQIWDNYFGGEVAE"
FT   regulatory      complement(443010..443069)
FT                   /regulatory_class="promoter"
FT   CDS_pept        443302..443469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0436"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0436"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79586"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ58"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79586.1"
FT                   /translation="MNNLLSIMSFYSKTFMAISFIFQVAAAMQPEIYRVYIADIKFVDY
FT                   STNLNIGAKC"
FT   regulatory      443387..443446
FT                   /locus_tag="XBJ1_0436"
FT                   /regulatory_class="promoter"
FT   operon          443490..444499
FT                   /operon="XBJ1_operon0086"
FT   CDS_pept        443490..444170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0086"
FT                   /locus_tag="XBJ1_0437"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0437"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79587"
FT                   /db_xref="GOA:D3UZ59"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ59"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79587.1"
FT                   /translation="MVDSLPVCISFFLIFASIGALYQRHGIPLMETLVGSLLIYAAPLQ
FT                   VAAVGYLADGAVLSVIILALLINFRFFLMAMVMSQYFQGIPKRNILLAMLGFSASTYTV
FT                   AHSHISAENIKGGKSQFTFYLGIAIPCFVITFCATLLGYVSAEYLNYESLSLFLMMLVP
FT                   IHFASLTAKRAGKDMSVMATVMGGLCAPLLNEVNMKLVDLVIPILCGVFIALFERKTRK
FT                   DRSS"
FT   CDS_pept        444188..444499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0086"
FT                   /locus_tag="XBJ1_0438"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0438"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79588"
FT                   /db_xref="GOA:D3UW79"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW79"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79588.1"
FT                   /translation="MGLISFLLRVTPFLMNNNKSFKADSLFITSLDYAICFIIGTIIVN
FT                   ISLNNLSLSELINQFNINYFISLVTIVLAYFISKYMCSILKILFFSLVFFIVIHWLLR"
FT   regulatory      complement(444492..444539)
FT                   /regulatory_class="terminator"
FT   CDS_pept        444563..444697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0439"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79589"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW80"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79589.1"
FT                   /translation="MAYSEYNSTWLLYVKWPIRYVDYHCENRIFPDKGLPQGMEFKAL"
FT   operon          complement(444732..445417)
FT                   /operon="XBJ1_operon0087"
FT   CDS_pept        complement(444732..445070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0087"
FT                   /gene="chpA"
FT                   /locus_tag="XBJ1_0440"
FT                   /product="putative mediates thymineless death, part of
FT                   proteic killer gene system, growth inhibitor A"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0440"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79590"
FT                   /db_xref="GOA:D3UW81"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW81"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79590.1"
FT                   /translation="MKSKYVPEAGDIVWLDFDPQAGHEQAGHRPALVLSPAIYNGRIGL
FT                   MLCCPMTTKIKGYPFEVKVEGEGEGDSAVLADQVKSLDWRERNAKIKGKVSASVLSEVK
FT                   AKAKALIG"
FT   CDS_pept        complement(444941..445057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0087"
FT                   /locus_tag="XBJ1_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0441"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79591"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW82"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79591.1"
FT                   /translation="MYQKLAILYGLILIRKQGTSKQDTALHWFLALLFIMVG"
FT   CDS_pept        complement(445172..445417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0087"
FT                   /gene="chpR"
FT                   /locus_tag="XBJ1_0442"
FT                   /product="mediates thymineless death, part of proteic
FT                   killer gene system, suppressor of inhibitory function of
FT                   ChpA"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0442"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79592"
FT                   /db_xref="GOA:D3UW83"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039052"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW83"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79592.1"
FT                   /translation="MSQVIVKKWGNSPSVRLPVSIMKAASLNVDDTVEITVEDGRIVIV
FT                   PVRAKEYTLDALLSGVTNENIHEEISFGKPTGKELL"
FT   regulatory      445305..445364
FT                   /regulatory_class="promoter"
FT   CDS_pept        445422..445676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0443"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79593"
FT                   /db_xref="GOA:D3UW84"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW84"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79593.1"
FT                   /translation="MPSQRLCSFYILNNKPNVSTLSIHYSLLSGVRFKSLTDAIDTGMS
FT                   SDRSFFHVMAGLAEMERELTVESIRAGRETVKKHKIKFI"
FT   regulatory      complement(445445..445504)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(445693..445728)
FT                   /regulatory_class="terminator"
FT   regulatory      445705..445740
FT                   /regulatory_class="terminator"
FT   operon          complement(445760..449135)
FT                   /operon="XBJ1_operon0088"
FT   CDS_pept        complement(445760..448657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0088"
FT                   /gene="valS"
FT                   /locus_tag="XBJ1_0444"
FT                   /product="valine tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0444"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79594"
FT                   /db_xref="GOA:D3UW85"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW85"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79594.1"
FT                   /translation="MEKTPANQTQSEPSLDKTYNPTEIEQPLYNHWEKNGYFKPNGDTS
FT                   RESFCIVIPPPNVTGSLHMGHAFQQTIMDTMVRYQRMQGKNTLWQAGTDHAGIATQMVV
FT                   ERKIAAEEGKTRHDYGRDAFIDKIWQWKAESGGNITNQMRRLGNSVDWERERFTMDEGL
FT                   SKAVKEAFVRLYQEDLIYRGKRLVNWDPKLRTAISDLEVENREVKGSMWHLRYPLADGA
FT                   KTAEGKDYLIVATTRPETLLGDTGVAVNPEDPRYKDLIGKEIILPLMNRRIPILGDEHA
FT                   DMEKGTGCVKITPAHDFNDYEVGKRHSLPMINILTFDGDIRDEAEIFDTNGESSDVYSA
FT                   DIPAEYRGMERFAARKAIVAEFEKQGLLVETKPHDLTVPYGDRGGVVIEPMLTDQWYVR
FT                   TAPLAKVALEAVENGDIQFVPKQYENMYYSWMRDIQDWCISRQLWWGHRIPAWYDAQGN
FT                   VYVGRDEEEVRRENNLSADITLTQDEDVLDTWFSSGLWTFSTLGWPEQTEALKTFHPTN
FT                   VLVSGFDIIFFWIARMIMMTMHFIKDENGKPQVPFKTVYMTGLIRDDEGQKMSKSKGNV
FT                   IDPLDMIDGISLENLLEKRTGNMMQPQLAEKIGKRTEKQFPEGIEAHGTDALRFTLAAL
FT                   ASTGRDINWDMKRLQGYRNFCNKLWNASRFVLMNTEGQDCGQNGGEMSLSLADRWILAE
FT                   FNQTVKTYREALDTYRFDIAANILYEFTWNQFCDWYLELSKPAINKGSEAEVRAARHTL
FT                   IEVLEGLLRLAHPIIPFITEIIWQRVKVVKGINADTIMLQPFPEFDQTKVDELALNDLE
FT                   WIKEAIIAVRNIRAEMNIAPSKPLEVLLRDANADAQRRVAENLNFIQSMGRLTSVTVLA
FT                   AGEEAPVSVTKLINGTEILIPMAGLIDKDVELARLDKEIEKLDKEINAIEAKLANDGFV
FT                   SRAPEAVVAKERERLAINHAAKEKLLAQKETIAAL"
FT   CDS_pept        complement(448671..449135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0088"
FT                   /gene="holC"
FT                   /locus_tag="XBJ1_0445"
FT                   /product="DNA polymerase III, chi subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0445"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79595"
FT                   /db_xref="GOA:D3UW86"
FT                   /db_xref="InterPro:IPR007459"
FT                   /db_xref="InterPro:IPR036768"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW86"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79595.1"
FT                   /translation="MKNATFYLLEKLSQEQLSSSDELQPHEWLACQLAADQWRAGKRVL
FT                   IACESQQQAEKLDEALWQREPSQFVPHNLAGEGPRYGAPVELCWPQKRSNAPRDILVTL
FT                   LPHFADFATAFHEVIDFVPIDENLKQLARERYKVYRSVSFNLTMATPPTY"
FT   regulatory      449060..449119
FT                   /regulatory_class="promoter"
FT   CDS_pept        449155..449328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0446"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79596"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW87"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79596.1"
FT                   /translation="MGYRKMMGKAIQKGIAAAIPLIPLIPLIPLDYTFYVELLGDKKGA
FT                   GVLIIRIQTCTI"
FT   regulatory      complement(449163..449222)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(449179..449214)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(449296..450804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="XBJ1_0447"
FT                   /product="aminopeptidase A, a cyteinylglycinase"
FT                   /EC_number="3.4.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0447"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79597"
FT                   /db_xref="GOA:D3UW88"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW88"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79597.1"
FT                   /translation="MEFSVKSGSPEKQRSACIIVGVFEPRRLSPIAEQLDKISNGYISA
FT                   LLRRGELEGKVGQSLLLHHVPNVLSERILLVGCGKERELDERQYKQIIQKTISTLNETG
FT                   SMEAVCFLTELHVKGRNNYWKVRQAVETAKESLYVFDQLKSSKNELRRPLRKIVFNVPT
FT                   RRELTSGERAIQHGLAIASGIKASKDLANMPPNICNAAYLASQARQLADTADNLNTKVI
FT                   GEEQMKELGMNSYLAVGQGSQNESLMSVIEYKGSKDANAKPIVLVGKGLTFDAGGISLK
FT                   PGEGMDEMKYDMCGAASVYGVMRVIAELQLPLNVIGVLAGCENMPGGRAFRPGDILTTM
FT                   SGQTVEVLNTDAEGRLVLCDVLTYVERFDPELVIDVATLTGACVIALGSHYTGLMSNHN
FT                   PLAHELLNASEQAGDRAWRLPMADEYFEQLDSNFADMANIGGRAGGTITAGCFLSRFTT
FT                   KYNWAHLDIAGTAWRSGKAKGATGRPVALLAQFLLNRAGLNADD"
FT   regulatory      449339..449388
FT                   /regulatory_class="terminator"
FT   regulatory      450799..450858
FT                   /regulatory_class="promoter"
FT   regulatory      complement(450975..451034)
FT                   /regulatory_class="promoter"
FT   operon          451085..453261
FT                   /operon="XBJ1_operon0089"
FT   CDS_pept        451085..452185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0089"
FT                   /gene="yjgP"
FT                   /locus_tag="XBJ1_0448"
FT                   /product="putative transmembrane protein, transport"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0448"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79598"
FT                   /db_xref="GOA:D3UW89"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030922"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW89"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79598.1"
FT                   /translation="MIIIRYLVRETLKSQIAILFILLLIFFSQKLVEVLGAAVEGSVPA
FT                   NLVLSLLGLGVPEMAQLILPLSLFLGVLMTFSKLYTESEITVMHACGLGKGVLVKSALI
FT                   LALFTSMLAAANVLWFTPWSSKYQEQVLADAKANPSLAAIMEGQFKPSRDGNMVLYIGD
FT                   VKGNNFENVFLAQLRPVNNQRPSVVIADGGHMEERPNGNQVAVLHQGVRYEGTALMRDF
FT                   RITDFKNYQAVIGHKAADIDSDKVEQKTFSQLWHKGDEDSRAELHWRLTLIVSVLVMAL
FT                   LVVPLSAVNPRQGRVLSMLPAMLLYLIFFLLQSSLRSNGGRGKLDPAFWMWLVNGAYFA
FT                   LALALNMWDTVPMRKLRSRFKNQGAA"
FT   CDS_pept        452185..453261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0089"
FT                   /gene="yjgQ"
FT                   /locus_tag="XBJ1_0449"
FT                   /product="putative transmembrane protein, transport"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0449"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79599"
FT                   /db_xref="GOA:D3UW90"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030923"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW90"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79599.1"
FT                   /translation="MFGVLDRYIGRTILQTILMTLFTLVSLSGIIKFVDQLRKVGQGEY
FT                   SAFAAGIYTLLSVPKDIQIFFPMAALLGGLLGLGALATRSELVVMQASGFTRLQVAGSV
FT                   MKTAIPLVFLTMVIGEWVAPQGEQIARNYRSQKMFGGSLMSTAKGMWAKDGNDFVYIKS
FT                   VDKDNALRDVSIYHFDDNKKLLSVKYAATAVYDQNNRQWKLSQVEESDLRQIGRITGSQ
FT                   RISAEWKSLLTPEKLGVVALDPDALSIRGLQQYITYLKQGQQDAGRYQLNMWKKVFAPL
FT                   SVAVMMLMALSFIFGPLRSVAMGVRVIAGISTGFIFYVLNEIFGPLSLVYSMPPLLGAL
FT                   LPSLLFFVVSVYFLLHRK"
FT   regulatory      complement(453263..453314)
FT                   /regulatory_class="terminator"
FT   regulatory      453275..453326
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(453358..454575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampH"
FT                   /locus_tag="XBJ1_0450"
FT                   /product="beta-lactamase/D-ala carboxypeptidase,
FT                   penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0450"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79600"
FT                   /db_xref="GOA:D3UW91"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW91"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79600.1"
FT                   /translation="MNKQLYKLFAVSALSWALSACAAPDNAHQNNFPQSGKKTTKWQVF
FT                   EGNDNTKKMASSLVDQYAQSIFDEGNPLGMAMVIIDNNQVVHRSFGETYPGSGARPRQD
FT                   SVIRLASITKLMTSEVMIKLAQKERLKITDPLQKYTYHGVRVPDYAITQPIRLYHLASH
FT                   TSGLPREQPGGKWGRPVFIWPTQSNRWAWLKTAGMNAAPGTTASYSNLAYDLLADALSK
FT                   ATGEPYTRLLQEEITRPYRMKDTTLTPSRSQCARLMEGVKPSPCLSTIAAAGSGGIYST
FT                   PVDMQRWMQQFLSSHNQLRKKTASREQGIYFKRENLTSITGMDVAGQADGIGLGWVYMD
FT                   AKKGVPGIYQKTGGGGGFNTYMAMIPEQNIGVFVVMTRKEQSKFSRVTNGVNELVAALS
FT                   RNHGKL"
FT   CDS_pept        454618..454776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0451"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79601"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW92"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79601.1"
FT                   /translation="MLFLFLKQRDDSANNDTHKDTYKNIADNRHDCLPQSGMLLWNYIR
FT                   CLKVVYW"
FT   regulatory      complement(454654..454713)
FT                   /regulatory_class="promoter"
FT   tRNA            454969..455053
FT                   /gene="LeuCAA"
FT                   /locus_tag="XBJ1_tRNA0007"
FT                   /product="tRNA-Leu"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   regulatory      454978..455037
FT                   /gene="LeuCAA"
FT                   /locus_tag="XBJ1_tRNA0007"
FT                   /regulatory_class="promoter"
FT   CDS_pept        455172..456134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0453"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79602"
FT                   /db_xref="GOA:D3UW93"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW93"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79602.1"
FT                   /translation="MRVQLRVTFEVVARDWHASNQKWSASHSARVLKSLEDNIFAAIGK
FT                   RNIAELKTRDLLVPIKAVESSGRLEVAARLQQRTTAIMRFAVQSGLIDYNPAQEIAGAV
FT                   ATAKRQHRAALELNRIPELLHHIDHYSGRPLTRLAVELTLLVFIRSSELRFARWSEVDF
FT                   EKAMWTIPGEREPLEGVKHSQRGSKMRTPHLVPLSQQALAILEKIKSMNGNRELIFVGD
FT                   HDPRKPMSENTVNKALRVMGYDTKTEVCGHDFITLQSAGNTDLDNLERNIQGKIQHTDN
FT                   PRELVATELALNLLTEQIASSDVLSGSHLWWFKRNEPLC"
FT   operon          complement(456093..462248)
FT                   /operon="XBJ1_operon0090"
FT   CDS_pept        complement(456093..459242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0090"
FT                   /locus_tag="XBJ1_0454"
FT                   /product="Helicase, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0454"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79603"
FT                   /db_xref="GOA:D3UW94"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW94"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79603.1"
FT                   /translation="MADKHPSIIAPLTGLKDFQQRTVNYVFQQFYGDRQQNRFLVADEV
FT                   GLGKTMVARGIIAKTIEHLQDKVDRIDIIYICSNAAIATQNIKRLNVSNETQFSHSTRL
FT                   TFLPKQVRSLRKNRINFISLTPNTALDHTRSRGGHKEERAILYRILYDLPLAKGERRER
FT                   LRMGMLNLLQATASRHGWCSAVDQLSVDDIDRELAKDFRRKVLDDAELYDLLKEGCEYF
FT                   ADDDEDSETHNSELRYALIGKLRSKLASVCLSALEPDLVILDEFQRFKALLDGDDEAAL
FT                   LAKALFEQPDVRVLLLSATPYKMFTLDQESEEDNHYADFIRTLQFLYNDDSQIKDIQQH
FT                   LLDHRTALHTSENAAETKNALEHALLQVMCRTERVTMTQKLDAMTKEVLQPAIITPTDL
FT                   YHAAAVDGVAMEVQARDILEYWKSMPYLFNFLKHYELRTLIDKALKSPSDTLRKLVKSA
FT                   KPHLLTKKKREHYQPLDAANPRMRMLFEDTLDKGMWQLLWMPPSLPYTTPNGVYANKES
FT                   LTKTLVFSAWSAVPNAIATVCSYEAERRMVGAAPLILHSQFKKKVKSLLNFAKSSKDGR
FT                   LTGMPVIAWMLPSPTLARHIDPLEIARQNPGEPLSVKAVRAIATVKCEALLETLPNGGP
FT                   GSRADERWYWAAPALLDARTETPDWWLGEHGWYTGPSQNDPAENFQEHIDQFAEVANGK
FT                   ISLGPRPDDLAEVLCDFALASPGTCALRALSRIDTGLATDSAEILSAAAQIASGFRSLY
FT                   NQAESISLLRGSGDDTYWRLTLRYGIDGNIQAMLDEYVHTLLESMGLQHEPAEAQLAAI
FT                   APRIQAVVSLRTTQLNVDELKTKGGNYTWSDLYTRCRFALRYGQLRDDTDQAVAHAESV
FT                   KDAFNSPFHPFVLASTSIGQEGLDFHTWCHAVMHWNLPSNPVDMEQREGRVHRYKGHAV
FT                   RKNIAEHYGLSALHSLAESADPWTQLFALAASQRKAGQSDLIPYWIFEEGTSRVERRVP
FT                   ILPYSKESIKFKRLKRELALYRIVFGQPRQEDLLFGLKHIGDESLTDLAQWLISLEPPK
FT                   V"
FT   CDS_pept        complement(459232..461028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0090"
FT                   /locus_tag="XBJ1_0455"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0455"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79604"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW95"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79604.1"
FT                   /translation="MLNPNNRSLYTSALTSPPGMVFDEAIATSFSLDPAFLLQAPVYLA
FT                   FTATDSNRAQDPLSIFEAIRRYSERITVYVQKGRIQVPTKLKPNPLFGLLEDMIVESKA
FT                   KGRGVFHPKIWAIRFINPETDEVMYRLVVLSRNLTTDSSWDLSLQLDGYPVKRKQSANK
FT                   ALVHLFSVLPKRATGKMAKHRRKQAQRFADELLYIEWECPAGFDKVAFFLPGEGYEWKP
FT                   PEADRAVVISPFCTDEALRHIVEHCQQADALISRPDTLLALSKKTLNLFTRQLHLDDAA
FT                   EGQMHDESSPDEIIASGLHAKAYLFENGRDSELVLGSANATSAALLGKTNCEILVSLKG
FT                   KKKHTGTIDDLLSSDGMGSYLQDFDPAQPFEPDALRVKAECHLEQARTLLAEATLSLHG
FT                   HPGQNDQSWALWLIGEIPKLPGVVQATAWPITVSEVLSCNLQDPNKENKRELGEFSVQA
FT                   ITGLTAFSLKTSHPDVSLRFVLNLPIDSLPPDHNAMILQSSMRNQDFLRYLLMLIGETG
FT                   HQSFFAENTFGDGHFFTGLANGEEFSVLEELTRIYSREPERLNDIAALVENMRKGKNDM
FT                   IPQDFLALWAVFESAMGGRYGR"
FT   CDS_pept        complement(461022..462248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0090"
FT                   /locus_tag="XBJ1_0456"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0456"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79605"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW96"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79605.1"
FT                   /translation="MASALGWLDHDADTQAKTLNILALFQQKESRDELGIGSIRDSFAE
FT                   QLFPGTSTIQTRLRYMLFVPWIYLRLENKRIPAANFGTQADRDERALIITLSRLEDSAG
FT                   TFGKNSREKLKRLPSSVYWSGLRRWGIRETMWSQEEYHRRVDELYRERTEISEREYLEK
FT                   NRGDMGDTSAYKPAQSWHSSLPAPPPNFPNDATFALTRQEASFLRDRIQLSCKGSLLAW
FT                   LTLHSEPADVSSPWEHPDYARFPDELKELLTHARLFSYTMHGAALLYNYLLAKERSDND
FT                   LLSQHNNNFVDWFTALPRKEIATWSLGRMWELTAEPGYSISLKTRRFVEQWIALIQQSP
FT                   VTLLTSKEACDLIRAREITLKGPRSRFKNRRSLEQWSGYAGTLRLVYRWHNVQIVLKDL
FT                   AHGLRREEC"
FT   regulatory      complement(462410..462469)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(462458..462506)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(462592..463107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0457"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0457"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79606"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW97"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79606.1"
FT                   /translation="MQNKKRWEPDWFLQSLLNNHIDKLVEHYSCLRAFRTDLFYQDHTA
FT                   KFFLRDYRQLEAVVGFFWVIEWTEDHHYHAHVVFWLDGSKTQNTYPWAQQAGLQWSDIT
FT                   DRDGWYHRCEFKEHYEADINIPVRYSDPGSIANIRQVLAYMTKIQQKHGLLLYGCNEVP
FT                   GRPRRIDF"
FT   regulatory      complement(463222..463281)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(463267..463401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0458"
FT                   /product="transposase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0458"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79607"
FT                   /db_xref="GOA:D3UW98"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW98"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79607.1"
FT                   /translation="MVENAFAKIKHFRAIATRYDKLARNYASTLALAFTIVWLPMWVE"
FT   regulatory      complement(463271..463337)
FT                   /locus_tag="XBJ1_0458"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(463460..463987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0459"
FT                   /product="transposase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0459"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79608"
FT                   /db_xref="GOA:D3UW99"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW99"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79608.1"
FT                   /translation="MPRTMLSKPLWNKLAVLMQQSGYVYHKEEHYLTFERILYRMRTGC
FT                   PWRDAPTEFGKWNTIFKRFNDGSKKAIFNLLFKLLSENTDTEWLFIDGSIVRAHQHSSG
FT                   AASVEDEAIGKSRGGLSTKIHLAVDSYGLPVHFELSGGQVHDIVHAESLVEQSPPSDFV
FT                   IADKGYDSGHSL"
FT   CDS_pept        463986..464165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0460"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79609"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWA0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79609.1"
FT                   /translation="MMVWGNGFFAKTMIPEHHAVQILLIKRQQPLVTSRFMGDRLQRKD
FT                   LLLLVEIIRVIFLS"
FT   regulatory      complement(464015..464074)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(464271..464573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0461"
FT                   /product="Insertion element iso-IS1n protein insB
FT                   (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0461"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79610"
FT                   /db_xref="GOA:D3UWA1"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWA1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79610.1"
FT                   /translation="MKRIVAHVFGDRSRKTLDKLLTLLSSFTIRFYCTDDYVVYDPLPE
FT                   EEHLTGKAFIQRIERTNLTHRTRIKRLNRKTIGYSKSEEMHDKVIGTFIEREHYF"
FT   CDS_pept        complement(464690..464965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0462"
FT                   /product="Insertion element iso-IS1N protein insA"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0462"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79611"
FT                   /db_xref="GOA:D3UWA2"
FT                   /db_xref="InterPro:IPR003220"
FT                   /db_xref="InterPro:IPR024431"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWA2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79611.1"
FT                   /translation="MAKVDVYCRYCHKSEQVKGHGKGNGGHPRYRCYSCCKVFQLAYTY
FT                   QACKPGVKEQIVDIAMNNGGIRDTARILKVATATVMKTLKTSDPET"
FT   regulatory      complement(465145..465204)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(465272..465592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0463"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0463"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79612"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWA3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79612.1"
FT                   /translation="MKNTTTPTLEGHTITEYLGVVTGETILGVNIIKDFFAGVRDIIGG
FT                   RSGAYEKELKNAREIAFAEMNAQAQALGANAVVGIDIDYETVGKNGGMLMVTVSGTAVK
FT                   IV"
FT   regulatory      complement(465665..465724)
FT                   /regulatory_class="promoter"
FT   CDS_pept        466061..466183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0464"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79613"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWA4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79613.1"
FT                   /translation="MKSILAEKSEARNGFYYQFKKRRFYFFRCFNDFFMTKRLF"
FT   CDS_pept        complement(466085..466240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0465"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79614"
FT                   /db_xref="GOA:D3UWA5"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWA5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79614.1"
FT                   /translation="MNDLTHLASCLLIVDKIVILEQPLSHEEVIETAEKVKATFLKLVV
FT                   ETISRF"
FT   regulatory      466256..466315
FT                   /regulatory_class="promoter"
FT   regulatory      complement(466316..466375)
FT                   /regulatory_class="promoter"
FT   CDS_pept        466412..466582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0466"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79615"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWA6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79615.1"
FT                   /translation="MKVQLACDALIMCFGYINAKVCDCVRWQRKSILVGGLLGIIDKRY
FT                   DLHCSMSAKAC"
FT   regulatory      467106..467165
FT                   /regulatory_class="promoter"
FT   CDS_pept        467190..468611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0467"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79616"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWA7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79616.1"
FT                   /translation="MNLTDKTQFLLGINKSTSILHPYIRTIITFILSGTKQQINSYFNC
FT                   FLGRSPKYGEIPPFPAVDTLSIDILLNFYEATHRFLVNTSSGLAILEKMTKLIYAVAKE
FT                   KSSQSVLFFMSYFNTDINPRYAIDIANTFFDADNISLENSVYTQSLAYNTALTATKIGD
FT                   ISEAEHWLDYIDDDDKKNRIISIVTEIDKKQNARKKHPLNPKNIKIKNINEIETLDLIS
FT                   ICSFLDGCGDDWGFKELYRSGSYIFPSKILTTEMFKSLAVKGIITLTQQDFDNIENKLL
FT                   NDFDHIVNNFKFHLNVIGIIDNRKISIKIFLEEIDRRKDKFDASFEMWKEISTGYFHDA
FT                   MEYYLGNIRDSWSNEFMLNEKTIERLSTTCLSAKDLSYIASSSVRYSAGQHAIKYTQSN
FT                   RHTCNTLISSINKNIDWVESDKFLGKAYPRGKKQPVLSSERIIEHITNINPDDLYNNVP
FT                   KLTEPVIKDETESDK"
FT   regulatory      complement(468603..468638)
FT                   /regulatory_class="terminator"
FT   regulatory      468616..468651
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(468698..468970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0468"
FT                   /product="chromosome replication (initiation and chain
FT                   elongation) with nucleoside triP hydrolase domain
FT                   (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0468"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79617"
FT                   /db_xref="GOA:D3UWA8"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWA8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79617.1"
FT                   /translation="MLQELSTVDLLVIDEIGMQIESRYEKVTINQIVDRRSSSKRPTGM
FT                   LSNLDMNGMNTLLGERVMDRMRLGDSLWVIFNWGSYRSRIKGNEY"
FT   CDS_pept        complement(469008..469154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0469"
FT                   /product="PTS family enzyme IIB'BC, fructose-specific
FT                   (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0469"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79618"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWA9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79618.1"
FT                   /translation="MCISLSFVFGIEEFKESGTLAAALMQIGASSALSLMVPVLSGYPS
FT                   LSA"
FT   regulatory      complement(469457..469487)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(469671..469904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0470"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79619"
FT                   /db_xref="GOA:D3UWB0"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWB0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79619.1"
FT                   /translation="MLYPVYTPGNNFLSGILQSLLIFFTFNKILQTRKPALPSIKTHLK
FT                   TPFMLLCHTSGVIQALLSFLSPSTKTRHPILF"
FT   regulatory      469870..469929
FT                   /regulatory_class="promoter"
FT   regulatory      complement(469924..469983)
FT                   /regulatory_class="promoter"
FT   operon          470128..474136
FT                   /operon="XBJ1_operon0091"
FT   CDS_pept        470128..471243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0091"
FT                   /gene="potA"
FT                   /locus_tag="XBJ1_0471"
FT                   /product="spermidine/putrescine transport protein (ABC
FT                   superfamily, atp_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0471"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79620"
FT                   /db_xref="GOA:D3UWB1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWB1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79620.1"
FT                   /translation="MTENTSLTPLVELNTLSKGFDGKQVISQLDLIINDGEFLTILGPS
FT                   GCGKTTVLRLIAGLEDADSGKILLEGQDITDIPAEHRHVNTVFQSYALFPHMTVFENVA
FT                   FGLRMQKTPAKEIAPRVEEALRMVQLEEFAQRRPAQLSGGQQQRVAIARAVVNKPKVLL
FT                   LDESLSALDYKLRKQMQNELKALQRKLGITFIFVTHDQEEALVMSDRIVVMRDGYIEQD
FT                   GTPREIYEEPKNLFVARFIGEINIFDAKVQHRIDEQRIRADVEGHECDIFTSLPVTAGQ
FT                   ILKVLLRPEDLRVEEINHGEQVSGLVGYVRERNYKGMTLDSVVEMENGKMVMVSEFFNE
FT                   DDPDVDHSLNQKIAVTWVESWEVVLVDEEDA"
FT   CDS_pept        471227..472087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0091"
FT                   /gene="potB"
FT                   /locus_tag="XBJ1_0472"
FT                   /product="spermidine/putrescine transport protein (ABC
FT                   superfamily, membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0472"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79621"
FT                   /db_xref="GOA:D3UWB2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWB2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79621.1"
FT                   /translation="MKKTRKLFQNIVITGMVSWLMLFVFMPNLMIIGTSFLTRDDANLV
FT                   QMVFSLDNYSRLFDPLYAEVLLHSLNMAIVATLCCLVIGYPFAFFLARMPEKLRPLMLF
FT                   LLIVPFWTNSLIRIYGLKMFLSTRGYLNDFLLWLGIVDKPLRIMYTSEAVVLGLVYILL
FT                   PFMVMPLYSSIEKLDKPCLEAARDLGAGKLQTFIRIIIPLTMPGIIAGCLLVLLPAMGL
FT                   FYVADLMGGAKNLLIGNVIKSQFLNIRDWPFGAATSICLTLVMGLMLLVYYRAAKLLNK
FT                   KVELE"
FT   CDS_pept        472084..472863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0091"
FT                   /gene="potC"
FT                   /locus_tag="XBJ1_0473"
FT                   /product="spermidine/putrescine transport protein (ABC
FT                   superfamily, membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0473"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79622"
FT                   /db_xref="GOA:D3UWB3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWB3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79622.1"
FT                   /translation="MIGRLLRGGFMTLVYAYLYIPIVILIVSSFNQSRFGISWQGFTTE
FT                   WYNLLFNNDSLLQAAGHSLTMAVTSATFATLIGSLTAVALYRYSFRGKKFVSGMLFVVM
FT                   MSPDIVMAISLLVLFMLLGVSLGFWSLLFSHITFCLPFVVVTVYSRLKDFDVKMLEAAR
FT                   DLGAGELTILRKIILPLAMPAVMAGWLLSFTLSMDDVVVSSFVTGPSYEILPLKIYSMV
FT                   KVGVSPEVNALATILLVMSLILVLFSQFIMRDRTGKA"
FT   regulatory      472865..472924
FT                   /operon="XBJ1_operon0091"
FT                   /regulatory_class="promoter"
FT   regulatory      472876..472908
FT                   /operon="XBJ1_operon0091"
FT                   /regulatory_class="terminator"
FT   CDS_pept        473084..474136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0091"
FT                   /gene="potD"
FT                   /locus_tag="XBJ1_0474"
FT                   /product="spermidine/putrescine transport protein (ABC
FT                   superfamily, peri_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0474"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79623"
FT                   /db_xref="GOA:D3UWB4"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWB4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79623.1"
FT                   /translation="MKKWFYLLAAGMMAFSIGSVNAAAADDGKTLYFYNWTEYVPPGLL
FT                   NQFTNETGIKVIYSTYESNESMYTKLKTYKDGAYDLVVPSTYFVSKMSKEGMLQKIDTS
FT                   KLSNFKNLDPNLLHKSFDQNNEYSIPYIWGATVIGVNSDNIDPKTISSWADFWKPQYQS
FT                   GLVLTDDAREVFQMALLKLGYSGNTTNPKEIEAAYQELQKLMPNVLAFNSDNPANPFME
FT                   GEVDLGMVWTGSAYVARQSGTPVDIIWPKEGGIFWMDSLAIPANAKNVDGAMKLINFLL
FT                   RPEIAAQVAQKIGYPTPNLAAKKLLPAEITGDPSLYPDEAIIQKGEWQSDVGNANILYE
FT                   NYFQKLKAGQ"
FT   CDS_pept        complement(474026..474511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0475"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79624"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWB5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79624.1"
FT                   /translation="MPFWRLRGDGFWELQNTERCTPQKGNKEPPKRELIEYGVIGGFDM
FT                   GSIGLDDSMKLIVSKGINGGQMVEQLFWNFADQPILLPQQKEYYPLEEFVIWHRSQVFK
FT                   QQSAQIKKGSHPLLCYSDCCRLLTRFQFLEIVFVQDIGVANIALPFPFLDNGFIRIQ"
FT   regulatory      474160..474188
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(474745..474897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0476"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79625"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWB6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79625.1"
FT                   /translation="MVLIPEQDDDAWVLIKPYLPPAHSERAGRLHVEHLALSPFCEHDR
FT                   NTFTR"
FT   regulatory      complement(474759..474818)
FT                   /locus_tag="XBJ1_0476"
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(474920..476344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0477"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0477"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79626"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWB7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79626.1"
FT                   /translation="MKRFFLVFVLTLFLSGCGDADEGYYLIKNIDVIFDEDEGLEDFKE
FT                   LIAKKIKGEKDYMYFFLTPDEASYFTGVKPEKTAIKDNRLEIGHDMLTLKNTFSGVKLV
FT                   GDKKRICGFYNCIITFELDKVKQNDKRLLDIQNKFKESEIKKQKLYAAQKEKLAELVFK
FT                   DFFGQLTYLDDFSIKLEPIESGSLNEINSGIYFRNMGGLRIDLESEDNTIYNFKNQNSQ
FT                   LIGELFIIKSLKDKFDYSSWLEIQDEILYQDKQGAIYYNMHGELEAVYYQYDEKSQHYF
FT                   IGLANAPKLETIKKSYIMLRTMDEQYRGEIANIQDVSLSQTDFENKYGIKISDSFDSQE
FT                   IHKVLIKKMNDKLAETKDFSKDKDWFNSILVRFPSESFSSKIYFYFHPKPMKKVISEFK
FT                   NKYPRGKWIENVFVYNISPSSESGYSYFINHNGMVYEIFVATDIHSTVERMAFLSVLRH
FT                   LDPTKLQGYSPSKLRP"
FT   regulatory      complement(476419..476478)
FT                   /regulatory_class="promoter"
FT   regulatory      476516..476575
FT                   /regulatory_class="promoter"
FT   CDS_pept        476766..478166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0478"
FT                   /product="putative PLP-dependent transferase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0478"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79627"
FT                   /db_xref="GOA:D3UWB8"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWB8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79627.1"
FT                   /translation="MSTFTRLQKRLSRQGIETQYENNIYRFNKEQIEAEVLLPESLPLE
FT                   EKAVQQLLDLASVHVPGSDAKVCRTRATPDFHPGAVAPVGCIVATTEDLVIPAAIGTDI
FT                   NCGMRLLTTGLSYAEANSQKEALIQQLKNTLLMDQRDVPVTPTSFSALFDEGLAAWLQE
FT                   LPQQGVWQQADFKRMHTELNAILSTQAVQAHSRYAPEAFFEHREIIRPASLGTVGSGNH
FT                   FVELQIVDTILDRHAAYAAGLHEGEVLMMIHTGSRDVGFYIGQRWVDKARALWPVTAKY
FT                   PSSGLFGLTDEHAQEYFLAMGCAARYAWANRIVLTELVRAAWKQIFGQDKSKLIVDLSH
FT                   NIIFPEQGMNLHRKGATPARAGELALIPGSMGDYSYLVLGKGNEDWLWSCSHGAGRSIR
FT                   RQAMRNKVPDLQKNSRLPWQCITLKSDRLREEAPEAYKPITPVIEIQEQAGLIQPVARV
FT                   RPWITFKA"
FT   regulatory      478187..478216
FT                   /regulatory_class="terminator"
FT   operon          complement(478612..479429)
FT                   /operon="XBJ1_operon0092"
FT   CDS_pept        complement(478612..479013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0092"
FT                   /locus_tag="XBJ1_0479"
FT                   /product="transposase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0479"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79628"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWB9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79628.1"
FT                   /translation="MLTDGQGLPLAIAVAPANIHDIRLVIATLDGLQTGRRGYGTKLHR
FT                   DKAYEAEWLEKELKTRGYVPCIQSRKEEQDALAEQEDFKVNRWVVERTHSWLNRFRRIL
FT                   VRWEKRVENYEAMLHLACSLIVWNIILLG"
FT   CDS_pept        complement(479022..479429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0092"
FT                   /locus_tag="XBJ1_0480"
FT                   /product="transposase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0480"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79629"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWC0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79629.1"
FT                   /translation="MNKKSIAQWFISDELWQKIEPLLPPHKTHHPLGCHRRRVDNRAAM
FT                   NAIFFVLRTGCQWNALNATGICSSSSAHRRFQEWVAGGVFERLWQNGLLASEKIGAIDW
FT                   GKLALDGCLTKAPLAGSKKQAATQQTGENKA"
FT   regulatory      479418..479477
FT                   /regulatory_class="promoter"
FT   regulatory      complement(479459..479518)
FT                   /regulatory_class="promoter"
FT   CDS_pept        479503..479964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0481"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0481"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79630"
FT                   /db_xref="GOA:D3UWC1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWC1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79630.1"
FT                   /translation="MSGVSKAALSQLESGNSNPRIDTLDAIAIALRLPLGDLFGSNNER
FT                   YPYLEKKIPMKDTYSQVMKFRIGLGSVAEIWHLQMNPGVIISSPAHTVGTHEHIMIHDG
FT                   VLMLRLSNDESVILNPGDFYAFSGDVIHSYICIDVAVSATVVMSYSIQS"
FT   regulatory      complement(479956..479993)
FT                   /regulatory_class="terminator"
FT   operon          complement(480039..481629)
FT                   /operon="XBJ1_operon0093"
FT   CDS_pept        complement(480039..480956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0093"
FT                   /locus_tag="XBJ1_0482"
FT                   /product="putative Drug/metabolite exporter family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0482"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79631"
FT                   /db_xref="GOA:D3UWC2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWC2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79631.1"
FT                   /translation="MSHDALPLSRRRLYLLDLGLLAVALSWGASYSLMQLIIQAGVTIP
FT                   LFLMLRFALAVPFMFFGTRIRLHNIKPGEIINGLIFGCLLYAILTFETLGVKYTTASNA
FT                   GFLIALSVVIVPFFERILGKRKQSKFIYFTCFISLVGGGILSFSNTDNFGFNNGDWLIL
FT                   LAALIRGFQIFMFGKQTSGKSYSLVNITLIELVTVSVLGLAFVLMTDSASLLLIPTITF
FT                   NVWGYILFLSLLATAFAFLMQLYAANITSPTRVGLILSLEPGFAALFAVTIMGETIGIL
FT                   QGFGGAIIVCAALLGRIVEGKRYE"
FT   CDS_pept        complement(480946..481629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0093"
FT                   /locus_tag="XBJ1_0483"
FT                   /product="putative Predicted metal-dependent hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0483"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79632"
FT                   /db_xref="GOA:D3UWC3"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWC3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79632.1"
FT                   /translation="MTQIQCYLNNTYCFLSTGEVIANGSDEWGQWIALNNNIFHPQGGG
FT                   QPADIGWVNNIPVKVRKQATGQVVVYPESALHAPPGAQLNSKLSEEARICHAALHTAGH
FT                   LLNWEMRQYGWMAIKGHHFPGESRVEFSPMGSSAIPSDQLSLQNIETTINTRLRDGGQV
FT                   TTWYEADTRLCLIEGTEPMPCAGTHVDNLNKINEFTIKSVKFKKETLRISYDASHIILR
FT                   TDNVS"
FT   regulatory      complement(481861..481920)
FT                   /regulatory_class="promoter"
FT   regulatory      482141..482200
FT                   /regulatory_class="promoter"
FT   CDS_pept        482261..483235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0484"
FT                   /product="Catabolic threonine dehydratase"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0484"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79633"
FT                   /db_xref="GOA:D3UWC4"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWC4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79633.1"
FT                   /translation="MNFIPDYHDVVEAHSRIKKYINKTPVFTSRTVNQLFNAEVYFKCE
FT                   NYQRMGAFKFRGAMNALYQFSDEQKKAGVVTFSSGNHAQAISLAANLLNIPATIVMPQD
FT                   APKAKIAATKGYGGKVVIYDRYTEDCEEITRNLANQYGLTFIPPYDHPHIIAGQGTSTK
FT                   ELFEEVGELDALFIPLGGGGLLSGSALSAVHFSPKCRIFGVEPVAGNDGQQSFKKGEIV
FT                   HIATPKTIADGAQTQHLGKYTFPIIRHLVEDILVTSDDELIDAMYFLAERMKTVVEPTG
FT                   CLGFSAARKMREELKGQRIGIILSGGNIDMERYSNFLSNIGKI"
FT   regulatory      483256..483299
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(483318..484592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metY"
FT                   /locus_tag="XBJ1_0485"
FT                   /product="homocysteine synthase"
FT                   /EC_number="2.5.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0485"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79634"
FT                   /db_xref="GOA:D3UWC5"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWC5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79634.1"
FT                   /translation="MKLETLSIHAGYSPDPATKAVAVPIYQTTSYAFDDTQHGADLFDL
FT                   KVEGNIYSRMMNPTNDVLEKRIAALEGGIGALSVASGMAAVTYAIQAIAQAGDNIISVA
FT                   KLYGGTYNVMAHTFPSIGIETRFVDHNDIAAIEALIDEKTKAVYCESITNPGGHIIDIQ
FT                   AMADVAHKYGIPLIVDNTVATPYLCRPFEHGADIVIHSLTKYIGGHGTTIGGIIVDSGK
FT                   FPWAEHQDRFAILSTPDASYHGIIYTEHFGAAAYIARCRVGPLRSTGATLSAFSAFLIL
FT                   QGLETLALRMERHTENTLKVAQYLNEHPQVSWVKYAGLPEHPEHELAVRYMGGKPSSVL
FT                   SFGIKGEEEAGTRFIDALELIVRLVNIGDAKSLACHPASTTHRQLNDAEMVKAGVSRDL
FT                   IRLSIGIEHSDDIIADLSQALDAAK"
FT   regulatory      complement(484818..484877)
FT                   /regulatory_class="promoter"
FT   CDS_pept        485086..485673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pagC"
FT                   /locus_tag="XBJ1_0486"
FT                   /product="Virulence membrane protein pagC precursor"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0486"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79635"
FT                   /db_xref="GOA:D3UWC6"
FT                   /db_xref="InterPro:IPR000758"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWC6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79635.1"
FT                   /translation="MVIKKALLATLAVSGVMYGSLAYADSHTVTVGYAQSKVQNFKDIR
FT                   GVNLHYRYEWDSPVSIIGSFTHMKGDRDYKFSFKHNGKNYTGEDSLDMKYYSLMAGPAY
FT                   RINDYLSVYGLLGFAHSKADATEGAYHLRNTVEVEASKMNRKSTNFAYGAGVEVNPIQS
FT                   LSLYAGYEGASVKYNDNREEINGFNLGVGYRF"
FT   regulatory      485707..485766
FT                   /regulatory_class="terminator"
FT   regulatory      complement(486088..486125)
FT                   /regulatory_class="terminator"
FT   operon          complement(486148..490673)
FT                   /operon="XBJ1_operon0094"
FT   CDS_pept        complement(486148..487530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0094"
FT                   /locus_tag="XBJ1_0487"
FT                   /product="Alkaline protease secretion protein aprF"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0487"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79636"
FT                   /db_xref="GOA:D3UWC7"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWC7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79636.1"
FT                   /translation="MFRSYSVTGRVLFLPLFLLMLFSGTVQALSLTEAYALALQHDPTF
FT                   QAAIKAQEAGQEEKNLGRAELLPKLAFNYQYVPQNWQKMESSSSASGQRGNMITESRNR
FT                   QYHSYSGSLVLTQPLVDFEAWARYKTRQAYVLMSDARFRVDTQQLAVRVVNSYVDVAYA
FT                   QDRQAQVAQQRRAYEEQLERNQKLFASGEGTRTDVAETQAHYSQVVADELTVKDELDAA
FT                   IRDLQLLVGIPLPDDLPVNRLSPVQNFKIIKLAFAHYADWEQIALSQNPQLAEARQKVA
FT                   VAAQDIERNRAGYLPKLELYASHTENKSSSDNIVDQKYRTDSIGLRVSMNLYNGGGTSA
FT                   AVRQSAANYSKAKYEMDAEAGETLNALRRNYNACMNGEKRIRAYESAVEAAELQVKATQ
FT                   KSVALGQRVNVDILNAEQQLYIARRDLSQAKYQYMKSWIGLLSEAGQLNGEHIQLASGY
FT                   FE"
FT   CDS_pept        complement(487536..488873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0094"
FT                   /locus_tag="XBJ1_0488"
FT                   /product="Alkaline protease secretion protein aprE"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0488"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79637"
FT                   /db_xref="GOA:D3UWC8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWC8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79637.1"
FT                   /translation="MSYQTNAKSAKNDESGLLPLDANRYLRLGWLVIGIGLLGFFVWAA
FT                   FAPLDKGVASSGIVVVDGNRKTVQSPANGIIRQILASEGEQVKAGQVLVQLSQVQVNAQ
FT                   IDSLKQQLHTTLATEARLLAEQQGLEVISFPATLWDQQSEPRIKDILVLQKQLFLSRRE
FT                   MLRSDLAGMQQAEEGLSFQLKGLRNALTNKQQQQVSLKEQVTNLRPLTEEGYFPRNRYL
FT                   ELQRSQSELSGSMAEMAGRIGQLEKQCQETRQRIIQRQADYQREVRSQLSDVQVQANEL
FT                   KNKLETTQFDLSHTSITAPVSGSVMGLTVFTQGGVVASGEKLMEILPAQSALEVEARLM
FT                   VHLIDKVAMGQDVDLMFTAFNQNQTPKVTGKVTVISADRLVDGVTREPYYQMRVRVTPE
FT                   GMAQLAGLHIKPGMPVEVFVKTGSRSLLSYLFKPLMDRASTSLIEE"
FT   CDS_pept        complement(488946..490673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0094"
FT                   /locus_tag="XBJ1_0489"
FT                   /product="Alkaline protease secretion ATP-binding protein
FT                   aprD"
FT                   /EC_number="3.6.3.43"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0489"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79638"
FT                   /db_xref="GOA:D3UWC9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWC9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79638.1"
FT                   /translation="MKLRFPKDEITDVIRARSKVFWTIGLFTAFINLLMLVPSIYMLQV
FT                   YDRVLPSSNEMTLLMLTLITLGMFAIMGGLEYIRSMVVIRIGSQFDMCLNQRVYTASYE
FT                   SNLKNGSTDAGQMLNDLATIRQFLTGNALFAFFDVPWFPIYLWVIFLFSPYLGLLALVG
FT                   AIILITLAVLNQWLSQSPLSEASHLSLRSANLASTNLRNAEVIEALGMLPALRQRWFSL
FT                   HERFLNFQRIASERAASITALTKTVRMALQSLILGLGGWLAIEGNITPGMMITGSILMG
FT                   RALSPIEQLIQAWKSWSAARLSWQRLDKLLKAQPERKSGMSLPAPKGILLLEKVAAIPP
FT                   SKTQARQTAGNHKQVLQDISFSLNAGDVLGVIGPSASGKSTLARLLVGIWPSQEGVVRL
FT                   DDADIYQWNKDELGASIGYLPQDIELFGGTIAENIARFNDVDPEKVIEAAKKAGVHELV
FT                   LNLEQGYDTVIGTGGMGLSGGQKQRIGLARALYGNPSLLVLDEPNSNLDDIGEKALSQA
FT                   ITQLREQGKTVVVITHRPSLLSQTNKILLLVQGKMKMFGPSQQVMAALSQSKTVERAS"
FT   regulatory      complement(490693..490752)
FT                   /regulatory_class="promoter"
FT   operon          complement(490757..492688)
FT                   /operon="XBJ1_operon0095"
FT   CDS_pept        complement(490757..491086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0095"
FT                   /locus_tag="XBJ1_0490"
FT                   /product="Alkaline proteinase inhibitor precursor
FT                   (PrtA-specific inhibitor) (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0490"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79639"
FT                   /db_xref="GOA:D3UWD0"
FT                   /db_xref="InterPro:IPR016085"
FT                   /db_xref="InterPro:IPR021140"
FT                   /db_xref="InterPro:IPR022815"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWD0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79639.1"
FT                   /translation="MASSLRLPEPAELKGLWQLSDGNQVCSIELTDTRLPEGSIWALKG
FT                   DSCLTELMGNPVEGWRPTPDGITLTDDDGNSLAFFGHESEQWVAYLVDGRELVMTFSGT
FT                   HSVTK"
FT   regulatory      complement(491108..491167)
FT                   /operon="XBJ1_operon0095"
FT                   /regulatory_class="promoter"
FT   regulatory      complement(491210..491250)
FT                   /operon="XBJ1_operon0095"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(491258..492688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0095"
FT                   /locus_tag="XBJ1_0491"
FT                   /product="Secreted alkaline metalloproteinase"
FT                   /EC_number="3.4.24.40"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0491"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79640"
FT                   /db_xref="GOA:D3UWD1"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013858"
FT                   /db_xref="InterPro:IPR016294"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR034033"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWD1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79640.1"
FT                   /translation="MTSKNKYTYVGLSDSKSVQDVNALLTAYVPNSDPGIRVAHTPLGN
FT                   KAPDELVRTNYHWTNKVGSSGAVELSYHFLESAPSVMPRFGIAGFSSFNDEQKEAALLS
FT                   LQSWSDVANVKFNEVSSLSKANITFGFFDYSITDDYAFATLPKGQNTTYSWYSAESRTF
FT                   IDNDIGVNGYGRQTFTHEIGHTLGLDHPAEYDASDAVRPTYISVGEYFEDSRAYTVMSY
FT                   FSEKYTGQDYKGAFSSAPLLNDISAIQQLYGANTETRTGDTVYGFNSNTDRDFMTATNA
FT                   KSKLVFSVWDADGNDTFDFSGFTQNQRINLNEGAFSDVGGLKGNVSIARGVTIENAIGG
FT                   SGDDILVGNSADNVLKGGDGDDIIYGGLGGDDLWGGAGKDTFVYLNGKESLKGNPDWIH
FT                   DFISGEDKIDLSDFNFGGKGDIKFVDSFSGRAGEVLLTYDKVTDITDMSISLGGDLASH
FT                   DFLVKIIGQPVAEADFIV"
FT   regulatory      complement(492781..492823)
FT                   /regulatory_class="terminator"
FT   regulatory      complement(492886..492945)
FT                   /regulatory_class="promoter"
FT   operon          complement(493006..495467)
FT                   /operon="XBJ1_operon0096"
FT   CDS_pept        complement(493006..494103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0096"
FT                   /gene="ygdE"
FT                   /locus_tag="XBJ1_0492"
FT                   /product="putative RNA 2'-O-ribose methyltransferase,
FT                   SAM-dependent domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0492"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79641"
FT                   /db_xref="GOA:D3UWD2"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR011224"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040739"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79641.1"
FT                   /translation="MNKVALYCRPGFEKECAAEITDKAGKKGIYGFARVKENSGYVLFE
FT                   CYQHDDADRLIREIPFGELIFARQMVVVGELLKNLPQEDRITPILGMLTGVIERAGELR
FT                   VEVPDNDESKELMTFCRKFTVPLRHAMRQEKFLLAKESANRPVIHVLFIAPGCCYVGYS
FT                   YSNNNSRFYMGIPRLKFPSDAPSRSTLKLEEAFHVFIPHDEWEERLGSGLYAVDLGACP
FT                   GGWTYQLVKRGMIVHAVDNGLMADSLMDTGQVKHHRVDGFKFEPTVKNVYWLVCDMVEQ
FT                   PAKVAHLMTDWLVKSWCREAIFNLKLPMKKRYEEVAQILQKIEQQLKENGVNAQIQAKH
FT                   LYHDREEVTVHVRRIWSAYAMTRDF"
FT   CDS_pept        complement(494096..494491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0096"
FT                   /locus_tag="XBJ1_0493"
FT                   /product="Inner membrane protein ygdD"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0493"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79642"
FT                   /db_xref="GOA:D3UZ60"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ60"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79642.1"
FT                   /translation="MSSRFMLIFVGISGFLYVALGAMGAHMLAPVLTSRQMEWIHTGLQ
FT                   YQGLHTLVMMVLAALLMRQPTKPFGWAGIFFAAGIVLFSGSLYCLAFLPLKFLVYLTPI
FT                   GGFSFLIGWLCILIGALRLRKSAPSHE"
FT   CDS_pept        complement(494547..495467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0096"
FT                   /gene="gcvA"
FT                   /locus_tag="XBJ1_0494"
FT                   /product="transcriptional regulator (postitive) of cleavage
FT                   of glycine (LysR family)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0494"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79643"
FT                   /db_xref="GOA:D3UZ61"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ61"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79643.1"
FT                   /translation="MSKRLPPLNALRVFDAAARHLSFTKAAEELFVTQAAVSHQMKSLE
FT                   DFLGLKLFRRRNRSLLLTEDGQSYYLDIKEIFTAINDATRKLQARSAKGALTVSLSPSF
FT                   AIQWLVPRLSGFNQSFPGIDVRIQAVDREEDKLADDVDVAIFYGRGNWPGMRTDRLYPE
FT                   YLLPVCSPSLLMGERPLKIPADLAKHTLLHDSSRRDWQAYIRQLDMQQQINVQQGPIFS
FT                   HSSMVIQAAVHGQGVALANNVMAQNEIDAGRLVCPFNDVLVSKNAFYLVCHDNQAELGK
FT                   IAAFRKWILMQAASEQARLGFITNE"
FT   regulatory      complement(495534..495593)
FT                   /regulatory_class="promoter"
FT   regulatory      496056..496115
FT                   /regulatory_class="promoter"
FT   CDS_pept        496254..497600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjcD"
FT                   /locus_tag="XBJ1_0495"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0495"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79644"
FT                   /db_xref="GOA:D3UZ62"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ62"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79644.1"
FT                   /translation="MSGMQAPTQCKLDKYFKITERGTTVRQEILAGLTTFLAMVYSVIV
FT                   VPGMLGQAGFPHTAVFISVCLVTGIGSLLMGLWVNLPMAIGCAISLTAFTAFSLVLGQQ
FT                   VSIPVALGAVFLMGCLFTVISVTGIRSWILRNMPMGIAHGTGIGIGLFLLLIAANGVGM
FT                   VIKNPHAGLPVAFGSLTAFPVIMTLLGLAGIIGLERKKVPGGILLVIIVISIIGLIFDP
FT                   AVKYQGFFKLPTLGEDGLSLMFSMDIVGALQPVVLPSVLALVMTAIFDATGTIRAVAGQ
FT                   ANLLDKGGQIINGGKALTADSVSSIFAGAMGSSPAAVYIESAAGTAAGGKTGLTAAVVG
FT                   ILFLLILFLSPLSYLVPAYATAPALMYVGLLMLSNVRKLNFDDSVEAMSGLLCAVFIVL
FT                   TCNIVTGIMLGFSALVVGRVFSGEWRKLNIGTVIIAIVLVIFYAGNWAI"
FT   regulatory      497726..497785
FT                   /regulatory_class="promoter"
FT   regulatory      497761..497805
FT                   /regulatory_class="terminator"
FT   operon          497929..500415
FT                   /operon="XBJ1_operon0097"
FT   CDS_pept        497929..499512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0097"
FT                   /gene="yjcE"
FT                   /locus_tag="XBJ1_0496"
FT                   /product="putative sodium:hydrogen antiporter (CPA1
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0496"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79645"
FT                   /db_xref="GOA:D3UZ63"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ63"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79645.1"
FT                   /translation="MIPFRIPLPIVQIAMGALLAWPHFGLHVTFDPELFLVLLIPPLLF
FT                   VDGWKTPTREFFQHGREIVILVLFLVLVTVVGIGYLIYWLLPGIPLIAAFALAAVLSPT
FT                   DAVALSSIVGKGRIPKNMMSVLEGEALMNDASGLVALKFAVAIAMGTMVFTVTGATIEF
FT                   FKVAIGGLLSGIAITWLYSKSLRLMSRWSGDDPATQIMFMMLLPFASYMIAEHIGVSGI
FT                   LAAVAAGMTISKSGVIRNAPLAMRLRADNVWGMLAFVFNGLVFVMLGLQLPGIWETSVE
FT                   QAELDPQVETWMLFAAVGIIYVALVLLRFCWLWLMKNASKVLMKKKPLEFASYTMRELC
FT                   LASLAGVRGAITLAGALSVPLFLPDGDPFPARYQLIFIAAGVILFSLFVGVVVLPLLLR
FT                   GMKVGDKQADINEIRMAKAAMAEVAIVSMNKMEERLSASTEEKLDAEVVSEIASRVTGY
FT                   LRRRTVGKDEIEHNLLVEELERRFRLTALRAERGELYHLRATRKISNETLQTLLHDLDL
FT                   LEALLVVKDQ"
FT   CDS_pept        499516..500415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0097"
FT                   /gene="yigM"
FT                   /locus_tag="XBJ1_0497"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0497"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79646"
FT                   /db_xref="GOA:D3UZ64"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004779"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ64"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79646.1"
FT                   /translation="MWLLTITTFLWAASFSLIGAYLAGQVDSWFSVFIRVVLAALVFLP
FT                   FLRWRGLSLKVISLYMVVGACQLGVMYLFVFHAYHYLTVAEFLLFTVMTPLYVTLIYDV
FT                   MGRQRLRWGYAMSSLLAVAGAAIIRYDRLSESFWIGLILVQLANIFFAIGQVGYKRLME
FT                   VYPIPQRVAFSWFYLGACVVATIGWLLFGDPYKLPTTQLQWGVLIWLGAGASGIGYFMW
FT                   NYGATQVDTGTLAIMNNMLVPAGLLVNFLIWQQHPDWLGFTIGSSLIVASLWVHHRWIL
FT                   KPVLQTANCPPRAGAQNE"
FT   CDS_pept        complement(500300..501256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metR"
FT                   /locus_tag="XBJ1_0498"
FT                   /product="transcriptional regulator of methionine
FT                   biosynthesis (LysR family)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0498"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79647"
FT                   /db_xref="GOA:D3UZ65"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037406"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ65"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79647.1"
FT                   /translation="MIEIKHLKTLQALSHCGSLAAAANHLHQTQSALSHQFSELEHRLG
FT                   FKLFIRKSQPLRLTPQGEVLLKLAGKVLPLVTASLRECSEPEEINLRIAIECHSCIQWL
FT                   TPALKRFSESWPQVSVDFKSGVTFDPQPALQQRELDIVLTSDIIADSKLNYTSLFDYEV
FT                   KLVLAPDHPLANKRDIYPQDLAPETLLIYPVQRQRFDIWRRFLQPAGVTPTLKSVDNTL
FT                   LLIQMVAARLGIAALPHWAVETFERQGLVVTKTLGEGLWSRLYAACREGEQHQPAINTF
FT                   IRSARQHAVDNLPFVKRVSISNGDAPKEMQQSGCFLW"
FT   regulatory      501268..501327
FT                   /regulatory_class="promoter"
FT   regulatory      complement(501309..501368)
FT                   /regulatory_class="promoter"
FT   CDS_pept        501364..503658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metE"
FT                   /locus_tag="XBJ1_0499"
FT                   /product="5-methyltetrahydropteroyltriglutamate-homocysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0499"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79648"
FT                   /db_xref="GOA:D3UZ66"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ66"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79648.1"
FT                   /translation="MTVLNHTLGFPRIGLKRELKKAQENYWAGKISQQELLETGRELRA
FT                   RHWQQQKEAGVDLVPVGDFAWYDQVLTTNLLLGNVPPRHQNEDGSIDLDTLFRIGRGRA
FT                   PTGTPAAASEMTKWFNTNYHYIVPEFQQGQEFKLTWTQLLDEVDEALALGHKVKPVLLG
FT                   PVTYLWLGKVKGKAFDRLSLLTDILPVYQQVLAELAKRGIEWVQIDEPALVLELPKEWL
FT                   EAFSTAYQALQGQAKLLLTTYFDSISHNLATIKSLPVQGLHVDLVAGKDSLDELNKSLP
FT                   ETWLLSLGVINGRNVWRADLSAKYQLVASLAGKRDIWIGTSCSLLHSPIDLNDETGLDE
FT                   EVKSWFAFALQKCAELSLLAQALNAPEGSKQAELDAYSAPIRARRSSTRVNNPTVTERI
FT                   TAIKPQDSERNLVYPERAKLQRERYNLPLWPTTTIGSFPQTTEIRSLRLDFKKGRVDNT
FT                   HYRTNISEHIKQAINEQENLGLDVLVHGEAERNDMVEYFGEHFDGYVFTQNGWVQSYGS
FT                   RCVKPPVIIGDISRPEAITVNWATYAQSLTDKPVKGMLTGPVTILCWSFPREDISRETI
FT                   AKQIALALRDEVDDLQKAGIGIIQIDEPALREGLPLRREEWQEYLEWAVDAFKLSAAIA
FT                   EDDTQIHTHMCYCEFNDIMLSIAALDADVITIETSRSDMELLDSFEDFSYPNEIGPGVY
FT                   DIHSPNVPSVEWIEALLRKAADRIPVERLWVNPDCGLKTRGWTETRQALANMVEAAKRL
FT                   RASVNNTSVNN"
FT   CDS_pept        503690..503827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0500"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79649"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ67"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79649.1"
FT                   /translation="MAGEKIISPISPEPIHEWIVLPTQHIDDLIKKAHRNSLLVDDLLV
FT                   "
FT   regulatory      504017..504076
FT                   /regulatory_class="promoter"
FT   CDS_pept        504032..504172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0501"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79650"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ68"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79650.1"
FT                   /translation="MALFESYTQSVILDYECDFYHKIMYVFLYLYQLKMIFITKKCQIR
FT                   H"
FT   CDS_pept        504219..504974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="udp"
FT                   /locus_tag="XBJ1_0502"
FT                   /product="uridine phosphorylase"
FT                   /EC_number="2.4.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0502"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79651"
FT                   /db_xref="GOA:D3UZ69"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010058"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ69"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79651.1"
FT                   /translation="MSDVFHLGITKSDLQGATLAIVPGDPNRVEKIAKLMDNPVHLASH
FT                   REFTTWRAEIDGKPVVVCSTGIGGPSTSIAVEELAQLGVSTFLRIGTTGAIQPHINVGD
FT                   VLVTTAAVRLDGASLHFAPMEFPAVADFECTNALYAAAKASGSATHVGITASSDTFYPG
FT                   QERYDTYSGRVVRRFQGSMQEWQQMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRT
FT                   QQEIPDVELLKKTESNALGIVVDAARRLL"
FT   regulatory      504988..505020
FT                   /regulatory_class="terminator"
FT   regulatory      504989..505048
FT                   /regulatory_class="promoter"
FT   operon          505103..506493
FT                   /operon="XBJ1_operon0098"
FT   CDS_pept        505103..505885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0098"
FT                   /locus_tag="XBJ1_0503"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0503"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79652"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ70"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79652.1"
FT                   /translation="MTTTLLSHPSLLPLHGGINFRDFGNKTLHNGAKIKSGLLFRSGSL
FT                   DMLTENDQTFLMSKNLFQIIDYRDSSEIEDKPDRVWRGANYHHAPANPLSKEVDANLEK
FT                   LGQERLEQFDERAFMLRLYELLPISNPAYKKLANLLVQPEKGGILQHCAVGKDRTGVGS
FT                   ALVLFALGADLDTVMEDYLVTNVTLAPYREYLLNEHAKVMSDRVIEKFAYVYSVQEEFL
FT                   LTALNSINQHYGSVDIWLEKDIGLDMTAREKLQSYFLE"
FT   CDS_pept        505963..506493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0098"
FT                   /locus_tag="XBJ1_0504"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0504"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79653"
FT                   /db_xref="GOA:D3UZ71"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ71"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79653.1"
FT                   /translation="MSLHEIIELVTDFVKAHEYWAIPIVFLLAFGESLAFISLLLPATI
FT                   ILLGLGALIGESGLNFWPIWIAAAAGAFFGDWVSYLFGAHYKDNVGKMWPLSRHPQMLV
FT                   RGHRFFERWGVWGVFIGRFFGPLRAVIPLVAGICAMPKRHFQLANFASALIWAFGILAP
FT                   GAFGLRWLAEWMG"
FT   regulatory      506513..506572
FT                   /regulatory_class="promoter"
FT   operon          506613..511069
FT                   /operon="XBJ1_operon0099"
FT   CDS_pept        506613..507968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0099"
FT                   /locus_tag="XBJ1_0505"
FT                   /product="DNA recombination protein RmuC"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0505"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79654"
FT                   /db_xref="GOA:D3UZ72"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ72"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79654.1"
FT                   /translation="MDIQWLYMLIGSLSGLLGGGIFVWLSVHQRIQQKELELRELHSQL
FT                   AISHEKLEQSHYWRTECDQLNQELLAQREINSVQEVELRELSTRLEESRLAAEEKQRLL
FT                   INSEQRLNTQFENLANRIFEQNRRRTDEYSRQSLNDLLMPFREQLDGFRSQVQDSFGQE
FT                   ARERHTLTHEIRNLQQLNAQMAKEAINLTKALKGDNKMQGDWGEMVLARVLESSGLREG
FT                   YEFHTQVNIKTENGERFQPDVIVHLPQEKDVIIDAKMSLIAYERYFNSDDDTQQAQALQ
FT                   EHINSIKGHIRGLSRKDYQQLPGLRSLDYVLMFIPIEPAYLVALNQAPELLDEALKHNI
FT                   MLVSPSTLLVAVRTINNLWRYEYQSQNARLIADKATRMYDKMRLFVDDMQGLGHSLNKA
FT                   QESYHLAMKKLAEGRGNLISQAEGFRDLGVDVKRPIDSQLIDKSFQSLQVNE"
FT   CDS_pept        508044..508799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0099"
FT                   /gene="ubiE"
FT                   /locus_tag="XBJ1_0506"
FT                   /product="bifunctional:
FT                   2-octaprenyl-6-methoxy-1,4-benzoquinone methylase;
FT                   S-adenosylmethionine:2-DMK methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0506"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79655"
FT                   /db_xref="GOA:D3UZ73"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ73"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79655.1"
FT                   /translation="MADQSKKTTDFGFRTVEKDEKQNMVAEVFHSVASKYDLMNDLMSF
FT                   GIHRIWKRFTIDASGIRRGHKVLDLAGGTGDLTAKFSRIVGEKGEVVLADINESMLKVG
FT                   REKLRDIGIVGNVNYVQANAEELPFSDNYFDCITISFGLRNVTDKEKALRSMCRVLKPG
FT                   GRLLVLEFSKPMLAPLSKVYDAYSFHVLPRIGQMIVKDADSYRYLTESIRMHPDQETLK
FT                   SLMEEAGFDQVSYTNMTGGIVALHKGFKF"
FT   CDS_pept        508801..509451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0099"
FT                   /locus_tag="XBJ1_0507"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0507"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79656"
FT                   /db_xref="GOA:D3UZ74"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ74"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79656.1"
FT                   /translation="METPELSDNLNSTVLFPVLTAFLETTLNHLLYRETVLKSSRMRLA
FT                   GKVLSIELKEIKTPLVLIFSEKQVDVLSQWSESADCSMKTTFTALLKLRDRHCLSSLIN
FT                   SGEIVIEGDMQVMQQWSALLDMSEWDPAHYLSPYVGDIVAEGLSRVMKGSIKLASNAIT
FT                   RQKTYLTESLTEEWRVAPNPLEVAYFSEEVNAVANDMSHMEKRLAALEGKYDS"
FT   CDS_pept        509441..511069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0099"
FT                   /gene="ubiB"
FT                   /locus_tag="XBJ1_0508"
FT                   /product="2-octaprenylphenol hydroxylase of ubiquinone
FT                   biosynthetic pathway"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0508"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79657"
FT                   /db_xref="GOA:D3UZ75"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ75"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79657.1"
FT                   /translation="MTPSEIKRLYFIVRVFLSYGLDELIPNIRLTWPLRFGRYFLFWLP
FT                   NRHKDKPLGERLRLALQELGPVWIKFGQMLSTRRDLFPPAIADQLSMLQDRVVSFDGAV
FT                   ARKSIEIALGGPLETWFDDFDSQPLASASIAQVHTARLKENGKEVVLKVIRPDILPVIK
FT                   ADVRLMYRMAHLVPLLPDGYRLRPREVVREYEKTLLDELNLLREAANAIQLRRNFEDSS
FT                   MLYVPEIYPDYCRENVLVMERIYGIPVSDIAMLEARNTDMKLLAERGVQVFFTQVFRDS
FT                   FFHADMHPGNIFVSYERPEDPTYIGIDYGIVGSLNKDDKRYLAENFIAFFNRDYRRVAE
FT                   LHVDSGWVPADINVEDFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMAVQPQ
FT                   LVLLQKTLLYIEGLGRQLYPQLDLWKTAKPFLEDWLHDQVGIPAIVRAFKEKAPYWAEK
FT                   LPEFPELVYGALQQHKRLQTSIDQISQQLQKQQVSQKKSLYLLGIGATLFICGSLFFMT
FT                   DKIHLSWWLMGAAVISWIFGWRRLK"
FT   regulatory      511079..511120
FT                   /regulatory_class="terminator"
FT   operon          511157..512620
FT                   /operon="XBJ1_operon0100"
FT   CDS_pept        511157..511405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0100"
FT                   /gene="tatA"
FT                   /locus_tag="XBJ1_0509"
FT                   /product="twin-arginine translocase subunit,
FT                   sec-independent protein export"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0509"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79658"
FT                   /db_xref="GOA:D3UZ76"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ76"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79658.1"
FT                   /translation="MISIPQLLIIAVIVVLLFGTNKLRSLGSDLGASIKGFKKAISDDE
FT                   KSDQAEKNSHDADFDTKSIAEKSTVAEKSESKNKEQV"
FT   CDS_pept        511409..511837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0100"
FT                   /gene="tatB"
FT                   /locus_tag="XBJ1_0510"
FT                   /product="Involved in membrane translocation of periplasmic
FT                   proteins that preserves folded structures and bound
FT                   ligands"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0510"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79659"
FT                   /db_xref="GOA:D3UZ77"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ77"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79659.1"
FT                   /translation="MFDIGFSELLLVMVIGLVVLGPERLPIAVKTVAGWIRVLRSLAAN
FT                   VQNELAQELKVQELQDSLKKMEEKVDLQSLSPELKASMDELREAAESLKKSYQLTPEEA
FT                   KALEEDETHFHSSVSHSVPESASKQNKNQSPEKANSEH"
FT   CDS_pept        511841..512620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0100"
FT                   /gene="tatC"
FT                   /locus_tag="XBJ1_0511"
FT                   /product="twin-arginine translocase subunit,
FT                   sec-independent protein export"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0511"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79660"
FT                   /db_xref="GOA:D3UZ78"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ78"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79660.1"
FT                   /translation="MSVDDTQPLIGHLIELRKRILNSLITVLVIFLALVYFSNDIYRLI
FT                   AAPLMEQLPKGANMIATDVASPFFTPIKLTIMVSIVVSAPMILYQVWAFIAPALYKHER
FT                   RLIMPLLFSSSVLFYLGMAFAYFVVFPIAFGFFVKTVPAGVVISTDISNYLSFVMALFM
FT                   AFGVSFEVPVAIILLCWSGVVTPESLKRKRPYILVGAFVVGMLLTPPDVFSQTLLAIPM
FT                   YLLFEVGILLSQFYVGGRKSGRAENESEYDEGNNPEK"
FT   regulatory      512658..512717
FT                   /regulatory_class="promoter"
FT   regulatory      512698..512729
FT                   /regulatory_class="terminator"
FT   CDS_pept        512739..513755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="XBJ1_0512"
FT                   /product="5-aminolevulinate dehydratase (porphobilinogen
FT                   synthase)"
FT                   /EC_number="4.2.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0512"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79661"
FT                   /db_xref="GOA:D3UZ79"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ79"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79661.1"
FT                   /translation="MSYVFPGTFPGRRMRRVRRHDFSRRLVAENQLTVNDLIYPVFVME
FT                   GINQRQEVSSMPGVYRLTIDLLLKEAEEIARLGIPVLSLFPAIEADKKSLDAQESYNPD
FT                   GLIQRSIRALKNEVPELGLLTDVALDPFTTHGQDGVIDQDGYVINDITKEILVKQALSH
FT                   AEAGAEIVAPSDMMDGRIGAIRDQLEVDGYINTQIMAYSAKYASCYYGPFRDAIGSSGN
FT                   LKGGNKMTYQMDPANSDEALQEIAQDLQEGADSVMVKPGMPYLDVIRRVKDTFGVPTFA
FT                   YQVSGEYAMHVAAIQNGWLKEQPAIMESLLCFKRAGADGVLTYFAKRVAQWLNEQKY"
FT   regulatory      complement(513776..513817)
FT                   /regulatory_class="terminator"
FT   regulatory      513795..513822
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(513821..514309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaH"
FT                   /locus_tag="XBJ1_0513"
FT                   /product="transcriptional activator affecting biosynthesis,
FT                   assembly and export of lipopolysaccharide core, F pilin,
FT                   and haemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0513"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79662"
FT                   /db_xref="GOA:D3UZ80"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR010215"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ80"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79662.1"
FT                   /translation="MGSWYLLYCKRGQISRAIGHLERQDVICLTPTAKIEKIVRGKRTT
FT                   VTEPLFPNYLFVNFDPEIIHTTTINSTRGVNHFIRFSTYPAVVPQTLIDELMSATEQEY
FT                   IAPETPITGDTVLITEGIFEGIQAIYNEPDGETRSILLLNILNKEVSKILDNKQFIKI"
FT   regulatory      complement(514333..514392)
FT                   /regulatory_class="promoter"
FT   regulatory      514532..514591
FT                   /regulatory_class="promoter"
FT   operon          514694..516878
FT                   /operon="XBJ1_operon0101"
FT   CDS_pept        514694..516166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0101"
FT                   /gene="ubiD"
FT                   /locus_tag="XBJ1_0514"
FT                   /product="3-octaprenyl-4-hydroxybenzoate decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0514"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79663"
FT                   /db_xref="GOA:D3UZ81"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ81"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79663.1"
FT                   /translation="MKYRDLRDFLSLLEQSGELKRIRMEVDPYLEMTEIADRTLRAGGP
FT                   ALLFENPKGYSMPVLCNLFGTPKRVAMGMGQDDVKALHDVGKLLAFLKEPEPPKGFRDL
FT                   VDKLPKFKQVLNMPTKRLNSAPCQEQVWTGDEVDLTRIPVMHCWPEDAAPLITWGLTVT
FT                   RGPNKERQNLGIYRQQVLGKNKLIMRWLSHRGGALDFQEWCQAHPGERFPVSVALGADP
FT                   ATILGAVTPIPDTLSEYAFAGLLRGHKTEVVKCLSNDLEVPASAEIILEGYIEPDEMAP
FT                   EGPYGDHTGYYNEVDMFPVFTITHITQRRDAIYHSTYTGRPPDEPAVLGVALNEVLVPI
FT                   LQKQFPEIVDFYLPPEGCSYRLAVVTMKKQYAGHAKRVMMGVWSYLRQFMYTKFIIVCD
FT                   DDINARDWNDVIWAITTRMDPQRDTVLMENTPIDYLDFASPVSGLGSKMGLDATNKWPG
FT                   ETQREWGRPIVMSDEIRARVDEIWDKLEILKR"
FT   CDS_pept        516177..516878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0101"
FT                   /gene="fre"
FT                   /locus_tag="XBJ1_0515"
FT                   /product="flavin reductase, FAD = preferred substrate"
FT                   /EC_number="1.5.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0515"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79664"
FT                   /db_xref="GOA:D3UZ82"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ82"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79664.1"
FT                   /translation="MTTLSCKVTSVDSITDTVYRVHLLPDSPFSFRAGQYLMVVMDERD
FT                   KRPFSMASPPSEKQTIELHIGASELNLYAMAVMDRILDQRVIDIDIPHGQAWFREDSEN
FT                   PMLLIAGGTGFSYTRSILLSALEKNPNRDISIYWGGRELHHLYDLGELQGLSECYPNLA
FT                   VVPVVEQVDEYWQGRTGTVLSAVLEDFGSLANHDIYIAGRFEMAKIARERFCSERDASI
FT                   DRMYGDAFEFI"
FT   regulatory      complement(516907..516939)
FT                   /regulatory_class="terminator"
FT   operon          complement(517031..520392)
FT                   /operon="XBJ1_operon0102"
FT   CDS_pept        complement(517031..518194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0102"
FT                   /gene="fadA"
FT                   /locus_tag="XBJ1_0516"
FT                   /product="3-ketoacyl-CoA thiolase; (thiolase I, acetyl-CoA
FT                   transferase), in complex with FadB catalyzes"
FT                   /EC_number="2.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0516"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79665"
FT                   /db_xref="GOA:D3UZ83"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ83"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79665.1"
FT                   /translation="MENVVIIDGIRTPMGRSKGGVFRQVRAEDLSAHLMKSILKRNPSV
FT                   QPEHIDDISWGCVQQTLEQGFNIARNSALLAGIPHSVPAVTVNRLCGSSMQSLHDGARM
FT                   IMTGDASIAMIGGVEHMGHIPMTHGVDFHSKLNRNVAKAAGVMGLTAEMLAKMHGISRE
FT                   MQDEFALRSHLRAAQATESKAFSNEIAPIHGHDADGNLKFIDFDEVIRPDTNLKNLAGL
FT                   RPVFDPVTGSVTAGNSSALSDGASAMLIMSESKAKELGLKARARIRSMAVVGCDPSIMG
FT                   YGPVPATQMALKKAGLSLADIGLIELNEAFAAQSLACMKGLNLLDSMDDRINLNGGAIA
FT                   LGHPLGCSGARITTTLLNLMERKDVQFGLATMCIGLGQGIATIIERV"
FT   CDS_pept        complement(518206..520392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0102"
FT                   /gene="fadB"
FT                   /locus_tag="XBJ1_0517"
FT                   /product="multifunctional: 3-hydroxybutyryl-CoA epimerase,
FT                   delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase, enoyl-CoA
FT                   hydratase (N-terminal); 3-hydroxyacyl-CoA dehydrogenase
FT                   (C-terminal)"
FT                   /EC_number="4.2.1.17"
FT                   /EC_number="5.3.3.8"
FT                   /EC_number="1.1.1.35"
FT                   /EC_number="5.1.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0517"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79666"
FT                   /db_xref="GOA:D3UZ84"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ84"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79666.1"
FT                   /translation="MLYLSDTIQVNWLKDGIAELIFNAPAAINKLDTKTVASLDKAVAV
FT                   LEQQTKLKGLLLRSEKQAFIVGADITEFLSLFDAPKEKLQEWLKFANDIFSRIEDLPVP
FT                   TISAINGYALGGGCEVVLSTDFRVASPDLRIGLPETKLGIIPGFGGSVRLPRLIGPDNA
FT                   LEIITAGKDIGAEEALKNGLIDAVVPTEKLVDAAVSILELAIKGDLDWQAARQPKLSPL
FT                   NLNDVERTMSFTVAKGMVMKVAGPHYPAPITAVKTIEKAATLGRDEALKLEAESFVPLA
FT                   HTTVARALVGIFLNDQYVKGLAKKHLKEVTVPQHATILGAGIMGGGIAYQSARKGVPVL
FT                   MKDINQKALDLGVNEAAKLLHKQFERGRLDAMKMAKILSSIQPTLSYAGIEQSQIVVEA
FT                   VVENPKIKAAVLAETESHINDDCILASNTSTIPITELAKSLKRPENFCGMHFFNPVHRM
FT                   PLVEIIRGEKTSDKTISTVVAYASKMGKTPIVVNDCPGFFVNRVLFPYLAGFGMLLRDG
FT                   GDFRQIDKIMEKEFGWPMGPAYLIDVVGIDTAHHAQAVMAQGFPERMTRDYHDAIDVLF
FT                   ENQRYGQKNDVGFYKYTQDKKGKPKKEQDETVDQLLAGISHPKQIFSGEDIIARTMIPM
FT                   INEVVRCLEEGVIASPAEADMALVYGLGFPPFHGGVFRYLDTMGTAAYVKLAERYAHLG
FT                   AMYHVPAGLKAKSESNESYYPAAAKIAVNPGEKA"
FT   regulatory      520489..520548
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(520513..520653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0518"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0518"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79667"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ85"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79667.1"
FT                   /translation="MIIWQEYKSYHNSLFLVSPWGNLTLVRLTDNIYIFHNYNKKYCHP
FT                   S"
FT   regulatory      complement(520530..520589)
FT                   /locus_tag="XBJ1_0518"
FT                   /regulatory_class="promoter"
FT   operon          520667..524686
FT                   /operon="XBJ1_operon0103"
FT   CDS_pept        520667..522001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0103"
FT                   /gene="pepQ"
FT                   /locus_tag="XBJ1_0519"
FT                   /product="proline dipeptidase"
FT                   /EC_number="3.4.13.9"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0519"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79668"
FT                   /db_xref="GOA:D3UZ86"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ86"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79668.1"
FT                   /translation="MEKLASLYHEHIKILQRRAREILARNQLDALLIHSGESLRVFLDD
FT                   CDYPFKVNAHFKAWVPVTKVPNCWLWVDGVNKPKLWFYSPVDYWHSVEALPNSHWTEEV
FT                   ELIHLAKADDIKAELSGLSKQNTAYIGEQTERAKNLGILEHNINPKMVLDYLSYHRSYK
FT                   TDYELVCMREAQKTAVNGHLAAYDAFTSGVSEFEINMFYLMATGHRDTDVPYNNIIALN
FT                   ENAAVLHYTKLQQTLPSEIRSFLIDAGAEYNGYVADITRTYAAKHNNDFASLIKDLNGE
FT                   QQAIIGSIKAGIRYTDYHINMHRRIAKLLKKHGIINGITEETMVEKGLTTPFFPHGLGH
FT                   SLGLQVHDAAGFMQDDTGTHLAAPTLHPYLRCTRILEPRMVLTIEPGIYFIETLLAPWR
FT                   ENEYSKHFDWKKIDMFKLYGGIRIEDNIVIHDGKIENMTRDLQLS"
FT   CDS_pept        522001..522612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0103"
FT                   /gene="yigZ"
FT                   /locus_tag="XBJ1_0520"
FT                   /product="putative elongation factor, with GTP-binding EF-G
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0520"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79669"
FT                   /db_xref="GOA:D3UZ87"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ87"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79669.1"
FT                   /translation="MKPYLIPAASVNFTEEIKKSRFITLLEHTSGVNEAKLFIQSIKEQ
FT                   YPDARHHCWAFVAGAPDDSQQLGFSDDGEPTGTAGKPMIAQLIGSGMGEITAVSVRYFG
FT                   GIKLGTGGLVKAYGNGVQQALKLLETEYKVPQKLYQLQCEYAYISMVEQLLQKFSGQVI
FT                   ASEYAENVTLQVSLPATLAGEIGDKLRDLSRGALFLTPKS"
FT   CDS_pept        522650..524101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0103"
FT                   /gene="trkH"
FT                   /locus_tag="XBJ1_0521"
FT                   /product="potassium transport protein, requires TrkE (Trk
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0521"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79670"
FT                   /db_xref="GOA:D3UZ88"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ88"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79670.1"
FT                   /translation="MHFRAITRIVGLLVILFSVTMIIPGLVALIYRDGAGRAFSQTFIF
FT                   ALVIGLMLWVPNRNQKHDLKPKEGFLIVVLFWTVLGSVGALPFIFSEKPNLSVTDAFFE
FT                   SFSGLTTTGATTLIGLDSLPKAILFYRQMLQWLGGMGIIVLAVAILPLLGVGGMQLYRA
FT                   EMPGPLKDNKMRPRIAETAKTLWLIYVLLTIACAIALWAAGMSIFDAISHSFSTIAIGG
FT                   FSTHDASIGFFNSPAINTIIAIFLLISGCNFGLHFAVLSGRSLKVYWRDPEFRMFITIQ
FT                   LALLVICVLILWQQSIYESGLDALNHAFFQVVSMATTAGFTTVSFADWPLFLPFLLLCS
FT                   AFIGGCAGSTGGGLKVIRILLLFLQGSRELKRLVHPNAVYTIKLGQRALPERIIEAVWG
FT                   FFSAYVLVFLISMLLLIATGVDEFSAFSAIAATLNNLGPGLGAVSDNFTTMNPAAKWIL
FT                   VVTMLFGRLEVFTLLVLFTPTFWRE"
FT   CDS_pept        524138..524686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0103"
FT                   /gene="hemG"
FT                   /locus_tag="XBJ1_0522"
FT                   /product="protoporphyrin flavoprotein oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0522"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79671"
FT                   /db_xref="GOA:D3UZ89"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ89"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79671.1"
FT                   /translation="MNCLLLYSTQDGQTKKIITYIAENLRRAGAECDLRDLATIKHINL
FT                   KPYHKVMIGASIRYGHFNSVLHKFAIRHQKQLNQMPTAFFGVNLTARKLEKRTPETNAY
FT                   LRKFLMKSPWKPNLCDVFAGALLYPRYRWLDRIMIQFIMRMTGGETDTTKEIEYTDWEQ
FT                   VDLFSGRFLQISCEKVPQK"
FT   regulatory      524891..524937
FT                   /regulatory_class="terminator"
FT   rRNA            525105..526601
FT                   /locus_tag="XBJ1_rRNA0005"
FT                   /product="16S ribosomal RNA"
FT   tRNA            526688..526764
FT                   /gene="IleGAT"
FT                   /locus_tag="XBJ1_tRNA0008"
FT                   /product="tRNA-Ile"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   tRNA            526890..526965
FT                   /gene="AlaTGC"
FT                   /locus_tag="XBJ1_tRNA0009"
FT                   /product="tRNA-Ala"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   rRNA            527302..527667
FT                   /gene="LSU_RRNA"
FT                   /locus_tag="XBJ1_rRNA0006"
FT                   /product="23S ribosomal RNA"
FT   rRNA            527682..529688
FT                   /gene="LSU_RRNA"
FT                   /locus_tag="XBJ1_rRNA0007"
FT                   /product="23S ribosomal RNA"
FT   operon          complement(530047..530960)
FT                   /operon="XBJ1_operon0104"
FT   rRNA            530125..530237
FT                   /locus_tag="XBJ1_0527"
FT                   /product="5S ribosomal RNA protein"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT   regulatory      complement(530246..530274)
FT                   /operon="XBJ1_operon0104"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(530295..530960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0104"
FT                   /locus_tag="XBJ1_0528"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0528"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79672"
FT                   /db_xref="GOA:D3UZ90"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ90"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79672.1"
FT                   /translation="MTMKKENSPQILSKKIAETIRNKLVIGELLPGQRLSEAILSEQLE
FT                   ISRNTLREVFRVLTQEGLLKHQPNRGVFVAIPDIASIIDIYQVRRLIECQALTQAYSMH
FT                   PSVAKMKEAVTSAQLYRNNQNWVGVGTANMHFHTAIVELTDSKRLITFYRNISAELRLA
FT                   FGLLNDPELLYAPYIDKNAHILELLDSGQTELAAKKMKDYLELSERTVLAAYTRKNNE"
FT   regulatory      531221..531280
FT                   /regulatory_class="promoter"
FT   operon          531307..537034
FT                   /operon="XBJ1_operon0105"
FT   CDS_pept        531307..532557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0105"
FT                   /locus_tag="XBJ1_0529"
FT                   /product="putative Membrane protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0529"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79673"
FT                   /db_xref="GOA:D3UZ91"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ91"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79673.1"
FT                   /translation="MAIQETVKQETVNFVVNRRSSLMAAVFLMATSAIGPGFITQTATF
FT                   TATMGAAFAFGILASILIDFVVQQNIWRIVTLTKMQSADIANAAIPGSGYLLAALVMFG
FT                   GLVFNVGNIAGAGLGLNALIGLEPKWGGLLSALMAIYIFASRRAGVAIDRIIVVLGVVM
FT                   IGLTLFVAIVSNPPVGEALRQTVLPDDINFATITTIVGGTVGGYICYAGAHRLLDKGMT
FT                   GVENIDAVSSAATKGILAVGLMRYFLFLAILGVVASGVTLDIASETANPASQAFQVVAG
FT                   EFGLRIFGLILWSAAITSVIGAAYTSISFARVFKKQLTDRHLNIITLCFITLSLAVYLL
FT                   IGTPPAALLVFAGGFNGLILPLGLTIFVYVGWKRADLMGGYHYPRWLLWSGVVTCVLTW
FT                   YMGAMSISSIFAFLKAA"
FT   CDS_pept        532568..533335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0105"
FT                   /gene="ybgL"
FT                   /locus_tag="XBJ1_0530"
FT                   /product="putative lactam utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0530"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79674"
FT                   /db_xref="GOA:D3UZ92"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ92"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79674.1"
FT                   /translation="MIKAIDLNSDLGESFGQWKMGNDAKMLGIVSSANVACGFHAGDPV
FT                   GILQTLKSAKENQVAIGAHISYPDLVGFGRRNMDIASHELTADVIYQIGALQGLALAAG
FT                   TSVRYVKPHGALYNTIANNERQALAVIEGILVIDPNLALVGLAGSNILRLAQEKGLKTI
FT                   AEAFADRAYTAEGELVSRREAGAVLHDVNLVAQRMLQLVTEGGVDSIDGKFTPIKADSI
FT                   CVHGDSPGALDMAKQVKKVLQQAGITIQSFIHA"
FT   CDS_pept        533367..534965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0105"
FT                   /locus_tag="XBJ1_0531"
FT                   /product="putative allophanate hydrolase subunit 1 and 2"
FT                   /EC_number="3.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0531"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79675"
FT                   /db_xref="GOA:D3UZ93"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ93"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79675.1"
FT                   /translation="MRFLLVNFNTILVELSGLPETLALFDSLSIVPVLGIEEIIPAART
FT                   LMIRFRPTKISIHQLVAEIGHRDLHECSHPQGKQIEIPVHYNGDDLAEVAEILGCTAQD
FT                   VIRQHTENEYTVAFSGFAPGFAYMVSDMAQWNIPRRQTPRTRIPAGAVALAGEFSGIYP
FT                   QASPGGWQIIGITTERMWDLSRPDPALLQPGYRVNFRDAGRATVTVSLSETSRTNPVFQ
FT                   SETSRYLEIRSVGLQTLFQDLGRFGKSGLGISESGAMDKSALRSANRIVGNSSEQACLE
FT                   IVQGGFKAVACGQMMVAVTGALCPIEIKTPQGELIHVSAYKPIDLSDGDEIILGRPDAG
FT                   TRSYLAVRGGFTIPSVLSSRSFDTLSHIGPEPLKAEDKLVVGTTSHCAAVSFSETLAFV
FT                   MPNKNEIVVLDVLLGPRTDWFTQESIDLLRNQIWQVTPQSNRIGLRLNGECSLSRIKCQ
FT                   ELPSEGTCAGAIQIPASGQPVLFLSDHPLTGGYPVIASVAHYHLDLAGQIPVNAKIRFN
FT                   PIIQFHELSGSEDLR"
FT   CDS_pept        534962..536740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0105"
FT                   /gene="accA"
FT                   /locus_tag="XBJ1_0532"
FT                   /product="bifunctional protein [Includes: biotin
FT                   carboxylase; biotin carboxyl carrier protein]"
FT                   /EC_number="6.3.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0532"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79676"
FT                   /db_xref="GOA:D3UZ94"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ94"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79676.1"
FT                   /translation="MNTIVNNVNKNPNKVLIANRGEIAVRIIRACRDYGVQTIAVYADA
FT                   DINAQHVQLADEAYGLSGNSPAATYLNIPRLLAIAKQSGATMVHPGYGFLSERAEFARA
FT                   VMDAGLIWIGPNPETIDELGDKVNARKIAHKVGAPLVVGTSEPVKDAQEVVAFAEEHGL
FT                   PIAIKAAFGGGGRGLKVAWRLDEVAELYHSAVREATAAFGRGECFIEQFLDKPRHIEAQ
FT                   IIADKQGHVVVVGTRDCSLQRRNQKLVEEAPAPFLTQQQRERIHQAAKAICAEANYVGA
FT                   GTVEFLLSADGTLSFLEVNTRLQVEHPVTEETAGIDLVIEQLRIAEGHPLSIQETPVPR
FT                   GHSFEFRINAEDAGKGFLPMSGVISEFTPPSGPGIRLDSGVISGSTIPATLDSLMAKLI
FT                   VTGTTREQAISRARRALREFRIRGVASVLPFHQAVMEHPDFVSDEIFNVHTRWIETDFA
FT                   NEIEALPRQIVTEDNSITRTYIEIDGRRHELGLSADLFAGFSHLAPVREQQSSQSAIKE
FT                   KMPADSRQVKAPISGILHSWIVKEGEQVNEGELIAVMEAMKMEVQINAHRAGKITFCVQ
FT                   AGDYQDAESTLAHIEY"
FT   CDS_pept        536801..537034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0105"
FT                   /locus_tag="XBJ1_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0533"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79677"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ95"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79677.1"
FT                   /translation="MVKTISQKVARESLGFPEFFEGGVYVTKNGVSELFVQTANERDAE
FT                   LQERVLERQVHALLKLINTEALYRHQILHSLQ"
FT   regulatory      complement(537025..537055)
FT                   /regulatory_class="terminator"
FT   operon          complement(537071..540374)
FT                   /operon="XBJ1_operon0106"
FT   CDS_pept        complement(537071..537424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0106"
FT                   /gene="frdD"
FT                   /locus_tag="XBJ1_0534"
FT                   /product="fumarate reductase, anaerobic, membrane anchor
FT                   polypeptide"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0534"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79678"
FT                   /db_xref="GOA:D3UZ96"
FT                   /db_xref="InterPro:IPR003418"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ96"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79678.1"
FT                   /translation="MNQRPKRSDEPIFWGLFGAGGMWSAIVGPAMVLLLGFLIPLGLAP
FT                   EALSYDRVLTFCQSFIGRIFLLLMISLPLWCGMHRLHHGMHDLQIHIPASKGVFYGTAA
FT                   ILSVVALIGVFTL"
FT   CDS_pept        complement(537441..537836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0106"
FT                   /gene="frdC"
FT                   /locus_tag="XBJ1_0535"
FT                   /product="fumarate reductase, anaerobic, membrane anchor
FT                   polypeptide"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0535"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79679"
FT                   /db_xref="GOA:D3UZ97"
FT                   /db_xref="InterPro:IPR003510"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ97"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79679.1"
FT                   /translation="MTTKRKPYVRGMESHWWHKLSFYRFYMIREGTAIPAIWFSLLVLY
FT                   GLFALKDGPESWAGFVSFLQHPAVLVINIITLLATLLHTKTWFELAPKALNIIVKNEKM
FT                   SPEPIIKLLWAITIIATAVILGVALFY"
FT   CDS_pept        complement(537851..538585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0106"
FT                   /gene="frdB"
FT                   /locus_tag="XBJ1_0536"
FT                   /product="fumarate reductase, anaerobic, Fe-S subunit"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0536"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79680"
FT                   /db_xref="GOA:D3UZ98"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ98"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79680.1"
FT                   /translation="MAEMKNLKMEVMRYNPEIDSEPHFVTYEVPYDEQTSLLDALGYIK
FT                   DNLAPDLSYRWSCRMAICGSCGMMVNRVPKLACKIFLRDYPQGMKIEALGNFPIERDLV
FT                   VDMTHFIESLEAIKPYIIGNDRKPADGPNVQTPAQMAKYHQFSGCINCGLCYAACPQFG
FT                   LNPEFIGPAAVTLAHRYNLDNRDHGKKERMPQINSDNGVWSCTFVGYCSEVCPKHVDPA
FT                   GAIQQSKAESAKDFLISMLKPQ"
FT   CDS_pept        complement(538578..540374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0106"
FT                   /gene="frdA"
FT                   /locus_tag="XBJ1_0537"
FT                   /product="fumarate reductase, anaerobic, catalytic and
FT                   NAD/flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0537"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79681"
FT                   /db_xref="GOA:D3UZ99"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005884"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ99"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79681.1"
FT                   /translation="MQTFNADLAIIGAGGAGLRAAIAAAEANPQLKIALISKVYPMRSH
FT                   TVAAEGGSAAVTQSHDSYDFHFNDTVSGGDWLCEQDVVEYFVKHCPTEMIQLEQWGCPW
FT                   SRKEDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLKYPQIQRFDEHFVLDILV
FT                   DEGQVRGLVALNMMEGTKVQIRANAVIMATGGAGRVYRYNTNGGIVTGDGMGMAFRHGI
FT                   PLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKDGYRYLQDYGMGPETPLGQPENK
FT                   YMELGPRDKVSQAFWHEWQAGRTIATPRGDVVHLDLRHLGEKKLLERLPFICELAKAYV
FT                   GVDPVKEPIPVRPTAHYTMGGIETNPQCETRIKGLFAIGECASVGLHGANRLGSNSLAE
FT                   LVVFGRLAGEEAVRHIQQTTPANENALDAQARDIENKLNKLLNQKGIESWAKIRDELGI
FT                   SMEEGCGIYRTPELMQKTMDKITELKERFRHIEITDRSSVFNTDLLYTIELGFGLDVAE
FT                   CMAHSAMNRKESRGAHQRLDAGCTERDDENFLKHTLAFYNPEGAPRLEYSDVKITISKP
FT                   AKRVYGGEAAAQDKQQKEQANG"
FT   CDS_pept        541036..541182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0538"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79682"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZA0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79682.1"
FT                   /translation="MFTKKLFFMSRCFPHEGQGYSVHFYSGEWQVKMIFTNLMLKICLV
FT                   DLI"
FT   regulatory      541137..541196
FT                   /regulatory_class="promoter"
FT   CDS_pept        541223..542200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="poxA"
FT                   /locus_tag="XBJ1_0539"
FT                   /product="putative lysyl-tRNA synthetase with Class II aaRS
FT                   and biotin synthetase domains"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0539"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79683"
FT                   /db_xref="GOA:D3UZA1"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZA1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79683.1"
FT                   /translation="MNEVTDWQPSAPIANLLKRAKILAEIRRFFADRGVLEVETPTMGQ
FT                   ATITDIHLVPFQTRFVGPGAADGLTLYLMTSPEYHMKRLLTAGSGSIYQMGRSFRNEEA
FT                   GRHHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQILECESAESLSYQQVFIRYLEIDPLT
FT                   ASKEKLREVAAKLDLSNIADQEEDRDTLLQLLFTMGVETHIGLEKPTFIYHFPASQASL
FT                   AEISKEDHRVAERFEVYFKGMELANGFRELTDSHEQRLRFVQDNRKREAMGLPVMPIDE
FT                   RLLKALEHGMPECAGVALGVDRLIMLALGAERISEVIAFPAGIS"
FT   CDS_pept        542175..542318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0540"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79684"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZA2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79684.1"
FT                   /translation="MPFLLGFPDATISVRGFLSNDFIAEGAASGCTFIALHLSNCSAVA
FT                   AI"
FT   regulatory      542250..542284
FT                   /locus_tag="XBJ1_0540"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(542341..543417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpQ"
FT                   /locus_tag="XBJ1_0541"
FT                   /product="glycerophosphodiester phosphodiesterase,
FT                   periplasmic"
FT                   /EC_number="3.1.4.46"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0541"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79685"
FT                   /db_xref="GOA:D3UZA3"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZA3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79685.1"
FT                   /translation="MQTPIKAIMAGLLLASSMSGIAHAADKIVIAHRGASGYLPEHTLP
FT                   AKAMAYAQGADYLEQDLVMTQDNELIVLHDHYLDRVTDVAERFPNRARADGRYYAIDFT
FT                   LPEIKSLRFTEGFDIEGGKKVQSYPGRFPMGKSDFSIHTFQEEIEFIQGMNKSTGKNIG
FT                   IYPEIKAPWFHHQEGKDITAKVLEVLKQYGYTKKSDKVYLQCFDANELKRIKNELEPKM
FT                   GMDLKLIQLIAYTDWKETYEQKQDGSWVNYSYDWMFKPGAMKEVAKYADGIGPDYHMLI
FT                   ANDSTPNNIKLTGLVQEAHASHLAVHPYTIRVDQLPKYATSGNQLFDIVFDKANVDGAF
FT                   TDFPDLAVKFLEKRHEHK"
FT   regulatory      complement(543466..543525)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(543877..543914)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(543953..545308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpT"
FT                   /locus_tag="XBJ1_0542"
FT                   /product="sn-glycerol-3-phosphate transport protein (MFS
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0542"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79686"
FT                   /db_xref="GOA:D3UZA4"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZA4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79686.1"
FT                   /translation="MLSIFRPAPHKARLPAQEIDPLYRRFRWQIFMGIFFGYAAYYLVR
FT                   KNFGLAMPHLAEQGFSKGDLGFALSGISIAYGISKFIMGSVSDRSNPRIFLPAGLILAA
FT                   AVMLFMGFVPWATSSIAVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSIWNC
FT                   AHNVGGGLPPLLFMLGMAWFQDWKAAFYMPAFAAILVAIIVFSLMRDTPQSCGLPPIEE
FT                   YKNDYPPDYTDKNEKELTAKEIFLQYILPNKLLWMIAIANVFVYLLRYGILDWSPTYLK
FT                   EVKHFAMDKSSWAYFLYEYAGIPGTLLCGWMSDKVFRGNRGATGVFFMTLVTIATIVFW
FT                   LNPAGNPNIDMICMLVIGFLIYGPVMLIGLHALELAPKKAAGTAAGFTGLFGYLGGSVA
FT                   ASIIVGYTVDFFGWDGGFMVMIGGSALSVVLLLFVMLSENKHKQEIARIASQ"
FT   regulatory      545988..546047
FT                   /regulatory_class="promoter"
FT   CDS_pept        546239..549475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0543"
FT                   /product="Putative non-ribosomal peptide synthetase
FT                   (fragment)"
FT                   /EC_number="5.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0543"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79687"
FT                   /db_xref="GOA:D3UZA5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZA5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79687.1"
FT                   /translation="MNTHTHKAILHTAFTEQTFSPDDNINSSNISHRIAALEPWFDNVP
FT                   SRLAKLAKTIPNDIAVSDPYETLVFGELQQRVENAANILHQYGVKMGSNVAIAAERGIP
FT                   WFVTMLAVWRIGAVYIPLNTMMPEKRLNDILASLSESVLVSDDTVSAGLKASTLIPLHA
FT                   LLNNTREIINDEITENIDMPALGDHPAYVMFTSGSTGLPKAVQVQHDNLAACLCAFGKL
FT                   LSVNQHDCMLTLTTFSFDISLMELLLTVVHGGSIYITSIDTQRDAMALSQILSDPQFTF
FT                   AQATPVTWLMALNAGWKPRSELSMLCGGEALSQDLADQLTASGGTLWNLYGPTETTIWS
FT                   TAFRMRKGDKVQLGGPIPGTTITIVDKYLRPVPKGTVGEILIGGLGVTAGYRNNPTETA
FT                   KRYVPDMTQRGKRAYLTGDMARMLEDGSLIYMGRQDDQVKVRGYRIELGEIETALRKQN
FT                   GVQDAIIRVIGSGDLAKIQAFVLFDPNRVVSEDWVHETQISLREVLHEAWIPAEYYRIP
FT                   YIPLTSSGKRDRKRLDEVAERLNASYDVVLPQTETEKQVYAIWRDLLATDVLGVTDNFF
FT                   QVGGHSILVARMVERIEKAFSLRIPISGIYVEPTVARISSILDEMIEAYQANPANAGGV
FT                   YHSEALIQQHAETLRKDVYLKESVCPDGLPHANWYQPDTVLLTGATGYLGLHLLEQLLK
FT                   QTAARIICLCRDSDEEHARDRIKAGFDKYQIDVVNGLERVDVIIGDLGQPRFGLLPETW
FT                   AQLAENVDVIYHNGALVNFIYPYSALKSINVDGTRTALEFACTARLKHFHYVSSVNALF
FT                   ATESPRPFMEDDRTMSESVRDPSGYSGSKWVSEGIINIARKRGVPVSIYRPGLILGHTL
FT                   TGAAQGNDYLVASLKGYLAMGFYPEHGLLLDIVPVDYVAASLVHISSQPESDGKFFNLF
FT                   NPVQVSIRQFFDWVQEFGYVLNPIPFNEGKEKILALDDTHPLYPLIPLIRDMTEKPYRA
FT                   LDPAYVHEIHPELELKQTLALLANTDIKCPVITAGYVHQVLQYLIDTGFLPAALPENFK
FT                   PEAYLGTANRKRSHELDSRREQQKKVFGLA"
FT   regulatory      complement(549611..549648)
FT                   /regulatory_class="terminator"
FT   regulatory      549625..549662
FT                   /regulatory_class="terminator"
FT   operon          complement(549841..551833)
FT                   /operon="XBJ1_operon0107"
FT   CDS_pept        complement(549841..550941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0107"
FT                   /gene="gldA"
FT                   /locus_tag="XBJ1_0544"
FT                   /product="glycerol dehydrogenase, NAD"
FT                   /EC_number="1.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0544"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79688"
FT                   /db_xref="GOA:D3UZA6"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZA6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79688.1"
FT                   /translation="MLKVIQSPSKYIQGPGALSHIGQYTKILADHVFVIADNFVMSLIG
FT                   DAVSKSLEAHAVTSHFEIFNGECSRGEIKRLSDISASHQCQAVIGIGGGKTLDTAKAIA
FT                   HACRLPVIISPTIASTDAPTSALSVLYTELGEFDGYLLYPQNPNIVLMDTRIIAKAPVR
FT                   LLVAGMGDALATYFEARANSAAHKPTMAGGATSNTGLALAKLCYDTLLAEGYKAKLAVE
FT                   AGVSTPAVENIIEANTYLSGIGFESAGLAAAHAIHNGFTVLEECHHLYHGEKVAFGTLA
FT                   QLMLENSPNEELETVLDFCVQVGLPVTLEQLGLRDSEKLHQKIMEVAKASCAEGETIHN
FT                   MPFKVTPEQVYAAIMAADRMGMDWLY"
FT   CDS_pept        550568..550687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0545"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79689"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZA7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79689.1"
FT                   /translation="MVGASVEAMVGEIITGSLHACAIALAVSRVLPPPIPITA"
FT   CDS_pept        550762..550890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0546"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79690"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZA8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79690.1"
FT                   /translation="MAGDCVCFQTFANGISNEAHYEIIGNHKNVISKYFGVLADVR"
FT   regulatory      complement(551044..551103)
FT                   /operon="XBJ1_operon0107"
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(551165..551833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0107"
FT                   /gene="yhhQ"
FT                   /locus_tag="XBJ1_0547"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0547"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79691"
FT                   /db_xref="GOA:D3UZA9"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZA9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79691.1"
FT                   /translation="MFHLTTQQKATALIWLSLFHILIITSSNYLVQLPVSIFGFHTTWG
FT                   AFTFPFIFLATDLTVRIYGAPLARKIILTVMLPALLISYFISALFFQGTWQGFGTLGTF
FT                   NLFVARIAAASFMGYVLGQILDVGVFNRLRQKRRWWIAPTAAMFFGNLLDTLAFFFIAF
FT                   YRSSDAFMATHWVEIALVDYAFKLFICMLFFLPAYGVLLNLILKFSFSHSTDKTLVKNH
FT                   "
FT   regulatory      551863..551922
FT                   /regulatory_class="promoter"
FT   regulatory      complement(551904..551963)
FT                   /regulatory_class="promoter"
FT   CDS_pept        551986..552264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sirA"
FT                   /locus_tag="XBJ1_0548"
FT                   /product="small ubiquitous RNA-binding protein required for
FT                   normal growth, cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0548"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79692"
FT                   /db_xref="GOA:D3UZB0"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZB0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79692.1"
FT                   /translation="MFEPTEIVMSNVFANPDKTLDTQGLRCPEPVMMIRKIVRHMDAGQ
FT                   TLLIIADDPATTRDIPGFCRFMEHALIAQETGQTPYRYLIKKNENVA"
FT   regulatory      552303..552356
FT                   /regulatory_class="terminator"
FT   regulatory      complement(552379..552408)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(552478..554766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zntA"
FT                   /locus_tag="XBJ1_0549"
FT                   /product="Pb/Cd/Zn/Hg transporting ATPase (P-type ATPase
FT                   family)"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0549"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79693"
FT                   /db_xref="GOA:D3UZB1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZB1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79693.1"
FT                   /translation="MFSIFKKHKQSQHGSLSHKNKDHKHSHGVHGKEDKSSHNAHEHDR
FT                   GHCSHDHAPTIQDTTPLELTANQRFNWIIHGMDCPSCAGKIENAVKKLPEAKQVRVLFT
FT                   TEKLVVDADSDIRAAVEQAVKQAGFEIKQTDSTIRLPPAANHWKTFSPILILIALMVIS
FT                   WGITKINPPAGQIAFIVTTLIGLYPVATKAIKLIRSGTPFAIETLMSVAAIGALFIDAT
FT                   AEAAMVILLFKVGEVLESYAAGRARRGVSALMALVPEQALRVTGGEKKTVPAADLRPGD
FT                   IIEIAPGARLPTDAELLSPFASFDESALTGESIPVERQQGEKVAAGCLSVDSAVQMRVF
FT                   SEPGHNAIDRILQLIEEAEERRAPIERFIDRFSRIYTPLIILFSVLVVVIPPLLLAEPW
FT                   ETWIYRGLTLLLIGCPCALVISTPAAITSALAAATRRGALIKGGAALEQLGSVTTIALD
FT                   KTGTLTEGKPRVTEIEPVENISVETLLALAGAVESGSHHPLAKAILNAAENKGVTVVEA
FT                   EHRKALAGIGVEGRLSGQKILVAAPGRLPENTLSTAWKQRVTELESNGKTAVAVVQGEQ
FT                   FVGLIAMQDTLRQDAIDAIRALKKQGVNAVMLTGDNPRAAAAIAAQLGIDYRAGLLPED
FT                   KVKAVTELNEKHHTMMVGDGINDAPAMKAASIGVAMGSGTDVALETADAALTHNRLTGL
FT                   PEMIALSRTTHYNIRQNITIALGLKAIFLITSLLGITGLWMAVLADSGATALVTANAIR
FT                   LLRVKSQKR"
FT   regulatory      complement(554906..554965)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(554940..554979)
FT                   /regulatory_class="terminator"
FT   operon          complement(555009..555898)
FT                   /operon="XBJ1_operon0108"
FT   CDS_pept        complement(555009..555278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0108"
FT                   /locus_tag="XBJ1_0550"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0550"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79694"
FT                   /db_xref="GOA:D3UZB2"
FT                   /db_xref="InterPro:IPR009525"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZB2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79694.1"
FT                   /translation="MFIQLGKVIMVLVWGIMIFNLIHPFPKPLRYFMDIAMVFTVIMHA
FT                   FQLLLLKNSQPKDQKFSVFLQTKIFFFGVFELLTWQKKQRQDKK"
FT   CDS_pept        complement(555299..555898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0108"
FT                   /gene="yhhF"
FT                   /locus_tag="XBJ1_0551"
FT                   /product="putative methyltransferase with SAM-dependent
FT                   methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0551"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79695"
FT                   /db_xref="GOA:D3UZB3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZB3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79695.1"
FT                   /translation="MTKKSQSASLGQIRIIGGKWRGRKLPVPDSEGLRPTTDRVRETLF
FT                   NWLMPIIQEARCLDCFSGSGALGIEALSRNASHATLLEYDRHVAKQLSANLALLKAENA
FT                   NVVQGNTLQYLNQTGTPFDVVFLDPPFRKGMLVETINLLEANGWLAEESWIYVEAESES
FT                   TATEAPANWQLHREKIAGQVAYRLYIRRQQSGDRSA"
FT   CDS_pept        555982..556143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0552"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79696"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZB4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79696.1"
FT                   /translation="MINLPRNPHIDMCCDVMKMLDWILSPLEPIAAGVVVEKQSVCGDR
FT                   FLAYPNKY"
FT   regulatory      complement(556120..556179)
FT                   /regulatory_class="promoter"
FT   operon          556228..559270
FT                   /operon="XBJ1_operon0109"
FT   CDS_pept        556228..557625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0109"
FT                   /gene="ftsY"
FT                   /locus_tag="XBJ1_0553"
FT                   /product="cell division protein: membrane binding
FT                   (N-terminal); GTPase domain (C-terminal)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0553"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79697"
FT                   /db_xref="GOA:D3UZB5"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZB5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79697.1"
FT                   /translation="MAEEQKKGFFSWFGRGRQEKKQQEEQLEQDKSAAEEAEQQRLAEE
FT                   AARRAAEEAEQQRLAEEAARRAAEEAEQQRLAEEAARRAAEEAEQQRLAEEAARRAAEE
FT                   AEQQRLAEEAAHHAAEEAEQQRLAEEAARRAAEEAEQQRLIEESSILPKEQDRPSKEGF
FT                   FARLKRSLVKTRQNLGSGFLGLFSGKKIDDDLFEELEEQLLVADVGVETTRKIINNLTA
FT                   HASRKELKDAEALYTKLKEEMSDILAKVDKPLDIEGKSPYVILMVGVNGVGKTTTIGKL
FT                   ARQYQSQGKSVMLAAGDTFRAAAVEQLQVWGERNKIPVIAQHTGADPASVIFDAIQSAK
FT                   AKGVDILIADTAGRLQNKSHLMEELKKIVRVMRKLDEETPHEIMLTLDACTGQNAVSQA
FT                   KLFHEAVGLTGISLTKLDGTAKGGVIFAIADQFDIPIRYIGVGEGIEDLRPFKADDFIE
FT                   ALFARED"
FT   CDS_pept        557632..558297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0109"
FT                   /gene="ftsE"
FT                   /locus_tag="XBJ1_0554"
FT                   /product="putative transport protein (ABC superfamily,
FT                   atp_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0554"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79698"
FT                   /db_xref="GOA:D3UZB6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZB6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79698.1"
FT                   /translation="MIRFEQVSKAYLGGRQALQGVDFHLLPGEMAFLTGHSGAGKSTLL
FT                   KLICGIERPSAGHIWFGGHDISRLKTRETPFLRRQIGMIFQDHHLLLDRTVYENVAMPL
FT                   IISGASAEDIRRRVSAALDKVGLLDKAKNFPIQLSGGEQQRVGIARAVVNKPTVLLADE
FT                   PTGNLDGELSEGIMRLFEEFNRVGVTVLMATHDVALIERRNYRILTLNQGRMQGGHHG"
FT   CDS_pept        558290..559270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0109"
FT                   /gene="ftsX"
FT                   /locus_tag="XBJ1_0555"
FT                   /product="integral membrane cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0555"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79699"
FT                   /db_xref="GOA:D3UZB7"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZB7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79699.1"
FT                   /translation="MVKNVRHSAKKMTPPKPKSKSLKGGWRVQQRYAWKSTLSDMLRQP
FT                   LATLLTIMVIAISLTLPSVFYIVWKNVNQAVEQWYPVPQLTVYLDKSLNDGGARQVIEQ
FT                   LKVIDGVKSVNYLSREEAENEFRAWSGFAGALNLLEENPLPAVAIISPQMDFQDSTVLT
FT                   TLRDRVSQIKGIEEVRMDESWFTRLTALANLIGQIAAVIGILMVVALLLVIGNSVRLSI
FT                   FSRRETINVMKLIGATDGFILRPFLNGGVLLGGLGAIFSLILSSLLVWKLSNVVTDVAG
FT                   VFGTTFKLYGLGWDESLLLVLISGMIGWLAAWFATIQHLRRFRPE"
FT   regulatory      559356..559415
FT                   /regulatory_class="promoter"
FT   CDS_pept        559498..560355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="XBJ1_0556"
FT                   /product="sigma H (sigma 32) factor of RNA polymerase;
FT                   transcription of heat shock and stress proteins"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0556"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79700"
FT                   /db_xref="GOA:D3UZB8"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZB8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79700.1"
FT                   /translation="MTKEMQTLALVPQGSLEGYVRASNAYPMLSAEEEKELAERLHYQG
FT                   DLDAAKKLILSHLRFVVHVARSYSGYGLPQADLIQEGNIGLMKAVRRFNPEVGVRLVSF
FT                   AVHWIKAEIHEYVLRNWRIVKVATTKAQRKLFFNLRKAKQRLGWFNQDEVDLVAKELGV
FT                   TSKDVREMESRMSAQDMAFDMSSNDDSHDSQPVAPVLYLQDKASDFADGIEEDNWENHA
FT                   ADKLSMAIEGLDERSQDIIRARWLDDDNKSTLQELADKYGVSAERVRQLEKNAMKKLRL
FT                   AIEA"
FT   regulatory      560368..560417
FT                   /regulatory_class="terminator"
FT   CDS_pept        560517..561653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="garK"
FT                   /locus_tag="XBJ1_0557"
FT                   /product="glycerate kinase I"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0557"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79701"
FT                   /db_xref="GOA:D3UZB9"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZB9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79701.1"
FT                   /translation="MKIVIAPDSFKESLSALQVAEAIEQGFREIFPQAAYIKLPMADGG
FT                   EGTVESLVAATGGQIISCSVTDPLGQPVDAFFGLLGDGKTAVIEMAAASGLHLVPMEQR
FT                   NPLITTSYGTGELILAALEHGAQKLILGIGGSATNDGGAGMMQALGAQLWDGDCRILPL
FT                   GGAALTRLESIDLSGLDPRLSQLEITVACDVKNSLCGESGASAIFGPQKGATPEMVKAL
FT                   DSALHHYGMKIESLTDKKVIDVAGTGAAGGMGASLLGCLGAKLQSGIEIVINTLKLEEA
FT                   IQGADLVITGEGRMDSQTIQGKTPIGVARVAKKFGIPTIALVGGMSCDYHVVHQHGLDA
FT                   VFSIVPGACSLSDALANSTDNLRVTARNVASVWRMAYS"
FT   CDS_pept        complement(561644..562045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0558"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0558"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79702"
FT                   /db_xref="GOA:D3UZC0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032900"
FT                   /db_xref="InterPro:IPR040448"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZC0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79702.1"
FT                   /translation="MKLTIKPISVLSQQDKIDLKKIWPEQDTQEWEVLLAGDQKLFVAQ
FT                   FNGRLLAAVKVTLNSSTGILEDFCVREVTRRRGVGAYLLEQVKAAFPEINRWEWSLNHF
FT                   PDIHAPALRDFMDACDFRYDAQNNAYYYE"
FT   regulatory      complement(562117..562176)
FT                   /regulatory_class="promoter"
FT   operon          562585..570704
FT                   /operon="XBJ1_operon0110"
FT   CDS_pept        562585..564327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0110"
FT                   /locus_tag="XBJ1_0559"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0559"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79703"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZC1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79703.1"
FT                   /translation="MKSFEYYYQQEFDYLRQLAKIVSEEKPHLRDVLGGGDPDVERLFE
FT                   GASVLTARLKHNIEDGFPELTRPLLQKLRAQPLKGLPATSIIQFDSHGQGDSDFSIPAG
FT                   TEVYTEAGQPFVMCRPCPIAPLTLVSREIIHQIQATKIILKFRYTGKDAEWQTRPISLF
FT                   LSSDEPVADILMLGLMQYYTDTELHHNGQVYKAQGERFEARSGASRLTLSSAKDDNWAP
FT                   QLLIESLYLPHINQFVDLPLPVMAKQLKLAEHREFSVELTLNTLLPLSAEQIESAFQLH
FT                   CVPVVNMKRNCQVTLPFAAETARYPLPLALNQGILHIAGIELKNEPGSEEEHRGGEYLF
FT                   YPASLLTGMERYHSEYDNAGFYGLETAHDEWNGVRYQVVFYDSEGKLMHKPPEREFICH
FT                   FYGFEQNLPPLISGVISLGGENVPEILQLKNITPTSRTYPPITDSLRYWHFLSHYATGS
FT                   YALESVRSVRQLLQDFDLYPEGDRPVSRSIRRMIDGISNITAKWGDRLIRGRPVRCLLI
FT                   TLEMDESAYTSAGEMYRFANALYQFFPFCLAQGSWLRMRVISQPSGTQWYLSPSMLEGY
FT                   RSIM"
FT   CDS_pept        564340..566349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0110"
FT                   /locus_tag="XBJ1_0560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0560"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79704"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZC2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79704.1"
FT                   /translation="MDGLVFTCRIGRLPQTTFQVVDFSLQEGLSQLFHLTMTVVSSLNN
FT                   VALSEQLGTSASLTVIRDGVTERTVNGIVAGAEQGNTDGLRTYYTFIVRPEMWLMTLNQ
FT                   DSRIFHYQSVPDILARLLKEHRIKAESKFYKDHQQHAIREYTTQKRESAYDFWCRLAAE
FT                   EGIMFWFEEDKLFYSNSHLGMLAALTLTYNVQANTDNSDSTAWQWNYGEYLCPDETRHK
FT                   DNNFLRPSYPLQHTAALEKGMGHSVFESYGRFQKDAEGRPFTQLRLEQLQNQSKVGKAV
FT                   TNCIKLRPGRIFMLQSHPIGAMNDSWQIVTVSHQGHQPQASGEAGEGTTLTNQISFIPG
FT                   RQDWRPPFRYKPLADGDEVATVVGPEGEEIYVDKHGAIKVHFHWNRYDEADDRASCWVR
FT                   VAQGWNGDGYGFMAIPRIGQEVIVSYLNGDIDRPIVTGCTYNGRNRPPLDLPAEKTRTT
FT                   FKTRTHKGEGFNELRFEDAKGSEEIYIHAQKDQLIEINYDKTQRVGHDESHHVLNNRKH
FT                   EIGNDEFIRIMHEQHIQIDLNQFETITKDRKTRINNNWQENIFADHRQEVGRDKTAKIN
FT                   NNYTLNVVNNIQSLTKVHTLQASESVLIKGKAGSIKLDGSGVTITGKITLQGEVSVTGG
FT                   SPGTVPSLSGSANEGLVMAEDCREKARKQQESSE"
FT   CDS_pept        566349..567560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0110"
FT                   /locus_tag="XBJ1_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0561"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79705"
FT                   /db_xref="InterPro:IPR025391"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZC3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79705.1"
FT                   /translation="MSWIPDYAEHWVVDYAYTTPQGEPDSARAIVHAASQPQALSALAE
FT                   YVLQAGDSPGQYQSIQPLPEYLAASAEVELPLLRQFRQGVERNARVIPLNEHNNNPLLP
FT                   AARGVLQFAVTETLPASARGQYRYMVIDATVYRRVMGSFIVPDLMVSNLRWESLFQGET
FT                   QITLEDSAPYLVELTDDPTVHSAFQHKITRPITPEPGIFIDSDQPFPVIRNHLRKFTYL
FT                   RNEQHQSWVFYRFYVPQGLLPLLRSLPDEQLMHFMRPIMQIGYFDSQTGQYYALSVAEN
FT                   SLNQEKTAPVAINRSLVDILAGQTQARAVTQIVKFIAETQPELSAEQQEQLPAFVVQQA
FT                   NLACLAGFAHQRSILYLVAGRSLARGNEALWQRAWQHACAEAQAQEVRALACYEYCFKN
FT                   RALS"
FT   CDS_pept        567579..570704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0110"
FT                   /locus_tag="XBJ1_0562"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0562"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79706"
FT                   /db_xref="GOA:D3UZC4"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZC4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79706.1"
FT                   /translation="MEKSILTSAGDALETAAKKVAETFEKMVDEAKARIPHELDMDTVV
FT                   RPCDANIRPVYPVRYAYMNFFGDTWIDAQLPPPISTFIDPDDDSLSASVLGGYSIRMPR
FT                   PGWIYVKEEGAIKTRGSQQNGNLLIFKFSPEIVTLEGKRGMVTKYTKYEQKAGSSSWEE
FT                   IHPASGTAGLGYPFLAIDKDVTQISLIYSEVELAKSVLNKMDNDKNFRKNAMQFVDLDS
FT                   EVSDYAIDARQEHFDGLVEDFKDPEKQFQAYKNQLSDPLLHAADLGDITTEGSFFMDAD
FT                   MEMRYIDSLICPYYKDKAKIVVLHDPVGYQRDILMAYMLLNLWELSYSATNMYPLTIGN
FT                   FVEILAASKNKEVKKCVEECIHQENWKTWWPKLTTPIKSVKDRKKEILEFYKCFSESEM
FT                   IAGKLGGLTHYFKNFFSVSDKKDIYTEGDAKEFERFCILHAELMEPLKHSEEGLLAMES
FT                   IIAGPLAIDGNSAWEVALNGIVNSLGHDGVDKGSIARFLNRGIDIILSVVGNLLARLYV
FT                   FTTELSYKGVLHLHVLSVKQVTHKLVPKILDYFGLEIKQGHYLELTEKEYYTFLKKIEE
FT                   YENQGVSGEIKKGMAHAESGLKRFVGKKVFDWSNRLDNYNNNIKIKIPLIKFKRPELNP
FT                   QFKFFYNANKSAGYLLSSGLSGLDLLMKSYMLYKLTSMSRFDKNAPFNANRLPYYYVSS
FT                   YANTILGGLIAAKGVSAIGGDAIKVAASLAGKLNSPAAKALLDSASRRLLLESALITKW
FT                   VNSGLIATGFVSGVLSYYDAYNSFSFGNDKEAYSHISIGTGSIIMAVGWSMAVAASEVT
FT                   FGVSLLIALGASLMLGGTFAAIYFNWIDLETLLSNCFWGNGSKYAFWSTSEKRLSLENQ
FT                   FKRIKIIDKEIKDIYLVEFQEFLNIFIKPTLNIENNKQGKVIYKFILPNFKWGKSDIYH
FT                   EVIPSALSDGYSDPDASIIERGYSRHHYSVVKDNFDKAIDIARKNRENLIYDEESGLTT
FT                   LTVEVDEKYSVYMKVFWYYKPTEDTVSPLHYKLGKEPILENAVYGYEDEVLR"
FT   regulatory      570897..570956
FT                   /regulatory_class="promoter"
FT   CDS_pept        571110..571661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0563"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79707"
FT                   /db_xref="GOA:D3UWD3"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWD3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79707.1"
FT                   /translation="MEYLYISYSKDSIYGEERARRSLILDSSFGLFFLSANILIISIFL
FT                   RLRKPANFIIDHERQLFYTWKKGKVYVSRYKELGVAFANNILHFKCYGLNEKNELTYQF
FT                   FIPYLSLFNSDEDKIYILAFMSKYLLQGKEAVSSVDFKRQEQLPWFRKQIKPADWETQI
FT                   TAILAELDRFWPPKGATEPK"
FT   regulatory      571678..571737
FT                   /regulatory_class="promoter"
FT   regulatory      571711..571757
FT                   /regulatory_class="terminator"
FT   operon          571819..573464
FT                   /operon="XBJ1_operon0111"
FT   CDS_pept        571819..572499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0111"
FT                   /locus_tag="XBJ1_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0564"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79708"
FT                   /db_xref="GOA:D3UWD4"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWD4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79708.1"
FT                   /translation="MAKDNEIKLSRISTVCDPLLKENIGILDKEQLENEGVFELINDKN
FT                   CVIINEINNHRIHIIVPALIGFLLGFCFFVSDYINEWKCNEKGYLRTLKYAKKYYGENF
FT                   YLNSKIPEYMKAYEYISDAESVSLLQYFHIRYTDSGFYKKSTVRYDLLLEGGFFLFFLT
FT                   ANSFLLYLLFFSHKVAPLVIDREKKIFYTWGKEKLFLLFTINWEKSQHWKMRFMDMKMR
FT                   YYVK"
FT   CDS_pept        572496..573464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0111"
FT                   /locus_tag="XBJ1_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0565"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79709"
FT                   /db_xref="GOA:D3UWD5"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWD5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79709.1"
FT                   /translation="MSILIKKIFKKIFRVKAPPTEPLFTFGDPVLEQKLILLDNKTVKR
FT                   AGFLDAINSKECHFRHNLIRARKEVIVPLMIGFMLGLGFFINDFVKGWKANEEDLLWSV
FT                   QNAKKRYGEQFYLNPNAPAYTKSLRVISDDKKISLTEYLYISYSKDSYYGEEMARRYLI
FT                   IDASFGLFFLSANILIISIFLRLRKPANFIIDHERQLFYTWKKGKVYVSRYKELGVAFA
FT                   NNILHFKCYGLNEKNELTYQFFIPYLSIFNSDEDKVYILAFMSKYLLQGKEAVSSVDFK
FT                   RQERLPWFRKQIKPADWETQITAILAELDRLEPPKGATEPK"
FT   CDS_pept        573430..573618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0566"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79710"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWD6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79710.1"
FT                   /translation="MSHRKGRLNLNNRWKNINTVSYIFSRKNSTEKYYNYLGAILKDSN
FT                   VFDKNPINKIGMFNLIL"
FT   regulatory      573515..573557
FT                   /locus_tag="XBJ1_0566"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(573753..573795)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(574033..575910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0567"
FT                   /product="Putative chitinase"
FT                   /EC_number="3.2.1.14"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0567"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79711"
FT                   /db_xref="GOA:D3UWD7"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWD7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79711.1"
FT                   /translation="MANKYTYTSSKAMSDISDVIGDPLTAWNQQEGGRVYNVIFNSNVY
FT                   TNTYWVERWHVPGQSGQKSSPHNAWQYVRAATAEEINTHGNPTDGTINPTEEIPSPVLQ
FT                   SDRYTEETYEKVKYKPDGSGTNLSYTATRVCKPMYNQYERDPAKPKLSAYITDWCQYDA
FT                   RLDDKNENPEDRGRGFNLSTIDPTTYDKLIFSFLGICGDIGVKKEKVKEVWDGWNSQTD
FT                   QKITEGHIVPLDPYGDLGTARNVGLPESSKNTSINAGTFLPYYQQSKAAGLLGGLRELQ
FT                   KRARAAGHKLELAFSIGGWSLSSYFSKMAENEGQRTVFINSVVDFFERFPMFSCVDIDW
FT                   EYPGAEGDVHNIISENDGKNYALLVKELRTALDNRFGTGSKEISIACSGVKAKLAKSNI
FT                   AELVKNGLDNIFLMSYDFFGTGWANYIGHHTNLYSPNEPDPNGEYDLSAEAAINYLHQD
FT                   LGIPLSIINLGYANYGRSGKGAKLETRLYDKPGDALGTMEKGAPEFFDIVNNYMDSEHT
FT                   LSTGKNGFVLMTDTNADADFLFSEKQGHFISLDTPRTVKQKGEYVTGHQLGGIFSWSGD
FT                   QDCGLLANAAREGMGYIAKSNHETIDMGPLYNPGQPYYLKSLRELKSSR"
FT   regulatory      complement(575964..576001)
FT                   /regulatory_class="terminator"
FT   operon          complement(576005..585392)
FT                   /operon="XBJ1_operon0112"
FT   CDS_pept        complement(576005..580111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0112"
FT                   /gene="tccB2"
FT                   /locus_tag="XBJ1_0568"
FT                   /product="A component of insecticidal toxin complex (Tc)
FT                   (fragment)"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0568"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79712"
FT                   /db_xref="InterPro:IPR040840"
FT                   /db_xref="InterPro:IPR041079"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWD8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79712.1"
FT                   /translation="MSNSIEAKLQEDLRDALVDYYLGQIVPKGKDFQFYRDKIKNVDDL
FT                   YDFLLLDTQVSSKVITSRVSHVTQSIQQYINRIVLNLEPGLSMTQEETYDWQEFANRYG
FT                   YWSANQQLRLYPEIYVDPTLRLTKTEFFFQLESVLNQGKLTDNVAQKAVLGYLNNFEEV
FT                   SNLEIISGYEDGIDLANDKTYFIAKTRTQPYRYFWRTLDMKQRNTDSNELYPTAWSEWK
FT                   PISVPLENARNGVVRPVIMNNRLYISWFEVSKEEEKNKNDESKTIIRYRTKLNLAHLGF
FT                   DGTWSSGTTVREEVLDDAMDKMIAVLDRTGKEDRLVLVAFTRRHGIENKVPYDYDVVFS
FT                   YICDNMLMASTDLPPSSTKLSDQDDYGDKLVWFFFRDPQNGGMDEFKQLILYPVHINRQ
FT                   WPIEKERKFEGKLGDEQDFDLKADYVEDSLDMYLTAISTYKYDFSLSKNILYCIWLEDK
FT                   NKNRCWLNYQVLTKEDFERGEIKLSTRVKRCHSDDLSDITIVTGFSLPKANADDIGGRI
FT                   RVILSVGKLVREKFQIKQTKQTQYLQFPENPPTPVWYTDKQIRLNTLFAKELVSKASQK
FT                   LDLVLSWDTQNLPEESISGSGTEPIDLKGANGIYFWELFFHMPFMVAWRFNVEQRYEEA
FT                   NRWLKYIFDPYENEDQPALKQGKPRYWNSRPLIDEPKKNYSLMQPSDPDAIASGEPIHY
FT                   RKAIFYFLVRNLIDDGDMEYRKLQPTARTIARLSYATASSLLGRRPDVQLASFWQPLSL
FT                   EDALYRYDNSELRQLEMQSQPLPHIPVVHDNTIRALDNDLFMKPINNELTAIWDRMENR
FT                   IYNLRHNLTLDGKEINMALYDGKISPRDLMNLRYQRVVTARNASRMNFKTPNYRFEPML
FT                   ARARAGVETLIQFGGTLLSLLERKDSLSFEKFQMLQNSDLYRFSIDLQQQEININQASL
FT                   EVLQVSKKSAQERHEHFKGLYDENISSTEQQVIELQSQSASALLAAQTLRTGAAALDML
FT                   PNIYGLAVGGSRWGAALSAAAEMVMIKHQSDSIKADSLNVSESYRRRRQEWEMQYKQAE
FT                   WEVNSIDQQINVQNLQLTASMKRLAQVEAEQQKSLALLDYFSSRFTNESLYTWMISQLS
FT                   NLYLQAYDAVSSLCLSAEASLQYELDSEQTFIEGSSWNDLYQGLMSGETLKLALQRMER
FT                   AYVEQNSRLQEITKTISLKALRKTAWENDLATLRQHSPITFNLQESDFAKDYPNLANRR
FT                   IKSVSVSLPMLIGPYEDICAQLSLGVNTRMVKADIQTMEKLVKEGINADSPYLARSIHP
FT                   NQQISLSTGINDSGMFTLNFDDERFLPFEGAGVESSWTFGFTNNSQNLDSLTDVILHVR
FT                   YTAKIGSSAFGKAVQKLLVEQKITD"
FT   CDS_pept        complement(580104..583658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0112"
FT                   /gene="tccA2"
FT                   /locus_tag="XBJ1_0569"
FT                   /product="A component of insecticidal toxin complex (Tc)
FT                   (fragment)"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0569"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79713"
FT                   /db_xref="InterPro:IPR018003"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWD9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79713.1"
FT                   /translation="MDKNHDYSDEQQNMKKVSPLLAAVAEIPLPEIALPEKYSLTTVKQ
FT                   HNTPSSVSLVDSLRNLGYHSIFDIVRLSKQRFIKRHNESLAGHAEIIFDKAVSMANQLV
FT                   QHYRQNPLRQYDGQTAAFLSTATDNQNASEQTGKLPDYSGLFPEPWDDFCQPDAIESLD
FT                   SPANYLLDLYKFIQQIEVDGTNQATLLASRRSDISYLMLDSDALYKELRALTIVNDVLS
FT                   ESARIYIDQTGEANKPVNQVLGETRFPFTLPYNLPTQQINRGLAESKNELGTVIRQVDT
FT                   HFPWHTEISKYDQILLAYSQLSNEQISLLTEAAPFSENLLSRDQLIKAYYSSSTTELVP
FT                   DKDISRHAYIVAQDDSVEGPTKLVENSPSAYDRISITCKNQADKTISVKLRAENVLTYY
FT                   RVKARMEPFDNSPPFSRQLKLTYVESDNSDIGNLDDGPYFGNMTIYAATPKEIPSGENQ
FT                   PTGPIDGVIFQAMSYRLAIAKSGTSSSELSPQANDFFINNYGLSEEESAQLKKIAIFGD
FT                   QTGTQATHIENLFSSGNYQPIVSPNVHFSNPIFFNRQSTATFPAAYHYGGVYINAGQRD
FT                   TLEIIRADNGREIKAVSNFRYDRLNRFIRLQRWLGLPYHQLDLLLASGIKAEADNLDMR
FT                   ITDNVLKELGLFRHLNTQYQVTPEMFAGWLHQITPFSTSDSVPFFDQIFNQTKLFDQPL
FT                   TLDDEVFNYTATQGDDAKTVKQLCAGLGISTVTFQLIAPMVESALTPTQDTLTGQLRRN
FT                   LDVVSRLYRLVSIPRIFGLSTEDGVFLIDILTGNHRYLAQQPIFTADSTRQDDILIVIM
FT                   KMEAVSRWLAKTKITAAKLSLMLGQTVLPVVPTDSMVTFFKGIAVGLSDSVLLSSSDFT
FT                   RPELVTINWWELLTAEGGLLNAQGLVLDIPPEWDKTDEIQIREKVKALFKEGKTPQDNV
FT                   INIVTQLLIQAKNAQENLLSSAIAAEYGVEKSLVPLQLRWLGSNVYLVLEMILTGVPET
FT                   AAEISHQFTDLTYSLLIYTQIISTLKINKNLLLLRLTKPEWLGLSNSKTSNALSLDEIY
FT                   LLTRYQDLVNNANQNEDKIHDYFSYANKPQANGKAVKNNEDESEKCAEILADILGWHAD
FT                   EIHLACTLRGLTPPQAKNLLHIDWLRRLQQLAVTTSLSVKTLWDAGTLTLNTDFSLYQS
FT                   VGEAVMAALKAQGDNENV"
FT   CDS_pept        complement(583752..585392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0112"
FT                   /locus_tag="XBJ1_0570"
FT                   /product="Putative chitinase"
FT                   /EC_number="3.2.1.14"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0570"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79714"
FT                   /db_xref="GOA:D3UWE0"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWE0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79714.1"
FT                   /translation="MDNTEKDTESKLVYKTDPGYQHPSPVQGYGKEATQKTYQLNGYDP
FT                   ATSTDILTYTATRMAKTVFNTYHDDDEFSIACYFTDWAQYDGRAVEASPSDEVFRNQGG
FT                   RSADLTRIKGDSTNGSPFKKLIFSFAGIVGDEGPKGNIILKAAKDWGFGADEAETLKNY
FT                   TGWPIPIDPWGDVSTYFNCGFDSGASGAAKDVYNQEKATGLLGGFNSLKKADPNLEVSV
FT                   SIGGWSMSGAFYEICRSDAYRKQFIDGVKNLFCRFSMFNHIDIDWEYPGSAGMGNPFDK
FT                   DDYVYYKKLIEELTAAKIPNLQGISIAASADPQKIDDAHIPELMEAGVTGINLMTYDFF
FT                   TLGDGKLSHHTNLYRNKNDQHSKYSIDDAVQHLITQGVDKKKIFIGYAGYTRNAKGANI
FT                   TSKSPLQGTYNGQGNIVGTFESAVIEWTDIIYNYVDFENGIGRNGYEIIQDNVAKADYL
FT                   YNQDLKVFMSLDTPRSVREKARYVKEKGLGGLFIWSGDQDNGLLTNAAHEGLGRPVKKS
FT                   VIDMSPFYFDNDDLPSYDKPKEPQCKDCV"
FT   regulatory      complement(585420..585479)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(586376..586678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0571"
FT                   /product="Transcriptional regulator (MrfJ protein)"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0571"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79715"
FT                   /db_xref="GOA:D3UWE1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWE1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79715.1"
FT                   /translation="MVDANTLVGKRICTKRKELGITATALAKQIGISQQQLSRYERGTN
FT                   RININHLVVISKQLGTPISWFFEECFKDEKEDSTVNKLTDQYIPIAETVIGKNGR"
FT   regulatory      complement(586851..586910)
FT                   /regulatory_class="promoter"
FT   operon          complement(588227..594000)
FT                   /operon="XBJ1_operon0113"
FT   CDS_pept        complement(588227..589132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0113"
FT                   /locus_tag="XBJ1_0572"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0572"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79716"
FT                   /db_xref="GOA:D3UWE2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWE2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79716.1"
FT                   /translation="MPLIRLFREEDSTGVSALFRVVYGEDYVYPEVYLPTMLSRYNAAR
FT                   HWYSAVAIQNGQVLGHATLWRNGRCPSSAELSLIAVHPQARGQGIATALGRYLCDQAKE
FT                   MGLGMLTIKQVSSHNHSQRLAQNLGFHTTGLLPDYVISPFDQARPESIVLGCLPLQRWP
FT                   FPELHWPVNWQTWLTSVTQIFGQEPLKPAVPIDTGTRIASHGGRLEVWIETQTTERVKE
FT                   VTELPAHKLIYVKLPVGEETLHAVQILQQAGFACTGFVPGHHHRWEMLLVRGHSRKELT
FT                   LSCQFAHNLHQQSLFACAER"
FT   CDS_pept        complement(589147..590418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0113"
FT                   /locus_tag="XBJ1_0573"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0573"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79717"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWE3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79717.1"
FT                   /translation="MTLSLHDLVEYARHHAPFFRDLYSDLPQSGWALTDLPLIDPAAYW
FT                   QQSQPLENWPVLTGPINSGHIFKTGGSTSEGRLSVFSRSEWQAFVRSFGQGLAQQLQSG
FT                   DRVANLFFAGDLYTSLLFIHGALSHSPVPVVEYPFTCSVEDQALADAIVSLGINVLAGV
FT                   PVQLLRFASTLQRSGQFMPNIDRLLYGGESLFPEQLALLNIVFPNARISSIGCASVDAG
FT                   LIGAASPDCHHGEHRVFDEDSIVEIIDESNGQPITESGRNGMLVVTNLQRRLMPVIRYP
FT                   TGDLACWCEGSGRLNRKFALQGRAGSAHRIRVSTLSLFPDQIARLLQQQKGILAWQLLL
FT                   SRQDGIDKITLLLASDSPQMPSTTSIHQALVTAQPAMAELCSQGGLQVEVASCALENMV
FT                   THPRSGKLIRVVDHRCYNAEEKTA"
FT   CDS_pept        complement(590463..592868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0113"
FT                   /locus_tag="XBJ1_0574"
FT                   /product="putative Long-chain-fatty-acyl-CoA reductase"
FT                   /EC_number="1.2.1.50"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0574"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79718"
FT                   /db_xref="GOA:D3UWE4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR008670"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWE4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79718.1"
FT                   /translation="MYLVNGEVISNLEPAATLADLKNRLADALACPPTVQEVLDCAERF
FT                   ANNLDTLATDFALDSATISTLRHFCRRDALEEKLRHELGEQPFSLRRFDYTQPRFETWQ
FT                   PLGLVVHITPANAPLLPFMAVLESLLVGNINWLRPSSSDNGLNARILAEFLRHDLSGKL
FT                   ASYVSVMPLPSDQLSELLACADAVSAWGSNAALTAIRSQLRPGCRWIDWGHRISFAYLD
FT                   PMVASNADYDALADDVCRFDQQACSSPQCLLVDSTDENVLRKVADAVASALERRAPEWP
FT                   ALQPDIQEAAEISSQMAFLRLDHTFADVAGSVTEGAGWRVAWTQRRELAASPLYRTLQI
FT                   RPVPRAQLINVLLPWRPYLQSCGLIAGEHELPALSRQLLAAGVSRICQPGAMHEGYEGE
FT                   PHDGVYALTRLARRVSVSVKAEQLPNHVTLDKLSVRPPDLAGLPIMGKAQFQQSGTTPK
FT                   AQVFFRSGGSTGAPKLAGFSHRDYHIQMQAAADGLFSAGLDPAQDRVINLLYGGNLYGG
FT                   LLSFFTVLDKLSVPHYPMGGPIDDDFSQILQVIITQGVNTLVGMPSTIYQLFEREEAAL
FT                   RAYGGVRKIFAGGEHVSEERRQFLSSFGVQVIRSAIYGSVDAGPLGHACTCCNEGEFHL
FT                   LSDIQWLEILDLDSEQPVQSGETGRLVFTPLAREGQVVQRYEVGDLGHWLPETCTCGLP
FT                   TPRFRLKGRHGGLIRVGSIFVNPTALSADLAFPVQWLVGNLDKGGEYIHVLADGDINQV
FT                   RQHLLRHEMLNQVVSSELLQLEITSTPAGQFRRHSQSGKTPLVLDYRA"
FT   CDS_pept        complement(592870..594000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0113"
FT                   /locus_tag="XBJ1_0575"
FT                   /product="putative
FT                   Long-chain-fatty-acid--luciferin-component ligase"
FT                   /EC_number="6.2.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0575"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79719"
FT                   /db_xref="GOA:D3UWE5"
FT                   /db_xref="InterPro:IPR007534"
FT                   /db_xref="InterPro:IPR016671"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWE5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79719.1"
FT                   /translation="MTSLAYVDALCSLDHPYRADSDCDQLFDAAMRELTQYHCENSPGY
FT                   YQWLKANGLDAQKLEKLHDWSHLPPIFANYFKHQLLLSHTGIDALELTSSGTTGQKSRM
FT                   RYDTRSIQAAQRMVERIFEYYGWNTPQQPCNYILLSYEPAGAITLGTAYTDQYLCQYAP
FT                   VSQACYALRHNGKSNEFDPFGVIRALQEFAAQGLPVRFLGFPAFLWFTLERMREMNLPP
FT                   LQLHPESLVFLGGGWKTHADKAISRSELYRRLHEQLGIPDERCRDGYGSVEHPVPYVEC
FT                   QNHHFHVPSYARAYVRDTASMAVQPYGKPGFLHLISPYITSSPAHSIVVSDLAVLHPAA
FT                   ECGCGLATDWFELLGRAGISKNRSCAIAASELIKES"
FT   regulatory      complement(594216..594275)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(594834..594886)
FT                   /regulatory_class="terminator"
FT   operon          complement(594922..598275)
FT                   /operon="XBJ1_operon0114"
FT   CDS_pept        complement(594922..595677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0114"
FT                   /gene="xni"
FT                   /locus_tag="XBJ1_0576"
FT                   /product="exonuclease IX, 5'-3' exonuclease"
FT                   /EC_number="3.1.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0576"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79720"
FT                   /db_xref="GOA:D3UWE6"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR022895"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR038969"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWE6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79720.1"
FT                   /translation="MIHLLIVDALNLIRRIHAVQGSPCAPACEHALKQLITHSSPTHAV
FT                   AVFDEDDRGHSWRHQLLPDYKAGRSAMPDDLQQEMPLIKQAFNALGVACWHAEGHEADD
FT                   LAATLATKVTSTGHRVTIVSTDKGYCQLLSPTIQIRDYFQKRWLDLPFVEREFGVSPAQ
FT                   LPDYWGLSGISSSKIPGVQGIGPKTAAILLQQAGSLDNLFQYLEAQPDKWRNKLATHKE
FT                   MAYISREVASLRTDLSLNGNLQQLRLDHR"
FT   CDS_pept        complement(595747..597114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0114"
FT                   /locus_tag="XBJ1_0577"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0577"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79721"
FT                   /db_xref="InterPro:IPR021826"
FT                   /db_xref="InterPro:IPR027820"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="InterPro:IPR037153"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWE7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79721.1"
FT                   /translation="MITHVSPLGSMDLLSQLEVDTLKHTASSDLYRLFRNCSLAVLNSG
FT                   SQTDNSKELLSKHEDFDINVLRRERGVKLELVNPPKDAFVDGKIIRSLRANLFAVLRDI
FT                   LFVHAQIDHAQKVHHLNMENGMHITNTIFSILRNAKALHLSEDPNMIVCWGGHSINEKE
FT                   YLYGRKVGNELGLRELNICTGCGPGAMEAPMKGAAVGHAQQRYQKSRFIGITEPSIIAA
FT                   EPPNPLVNELIIMPDIEKRLEAFVRIAHGIIIFPGGVGTAEELLYLLGILMNPDNKDQV
FT                   LPLILTGPKESADYFHVLDQFIVNTLGEQARQYYRIIMDDPSEVARVMKKTMPQVKEHR
FT                   RSTGDAYSFNWSLKISHDLQHPFEPFHSNMANLNLHPNQPSEKLASALRCAFSGIVAGN
FT                   VKEAGIHAIEKDGAFKIHGDVDIMRCMDELLKDFVRQDRMKLPGGTAYEPCYEIIK"
FT   CDS_pept        complement(597153..597998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0114"
FT                   /locus_tag="XBJ1_0578"
FT                   /product="7-cyano-7-deazaguanine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0578"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79722"
FT                   /db_xref="GOA:D3UWE8"
FT                   /db_xref="InterPro:IPR016428"
FT                   /db_xref="InterPro:IPR029139"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWE8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79722.1"
FT                   /translation="MSLYQDNQALAQLTLGKPTPYRDHYDPTLLQAVPRSMNREPLGLF
FT                   PDNLPFHGADIWTLYELSWLNTRGVPQVAIGHVSLNAASVSLIESKSFKLYLNSFNQTR
FT                   FADWDTVQKTLQQDLSVCANGEVNVVLHPLHDFSQQPIAEFEGKCIDNQDIEIDDYQFS
FT                   RDYLNGAATGSVVDEILVSHLLKSNCLITHQPDWGSVQIRYKGPKIDQEKLLRYLVSFR
FT                   HHNEFHEQCVERIFNDLIALCAPEKLTVYARYTRRGGLDINPWRSNEAFIPETGRLARQ
FT                   "
FT   CDS_pept        complement(598072..598275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0114"
FT                   /locus_tag="XBJ1_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0579"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79723"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWE9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79723.1"
FT                   /translation="MNICLNCYPDKITNRINKLKNRKRSEYHIMTHIIDGKKQIHNSIE
FT                   NKRLSLAQKSYANSVSTVNNVQ"
FT   regulatory      598288..598347
FT                   /regulatory_class="promoter"
FT   regulatory      complement(598295..598354)
FT                   /regulatory_class="promoter"
FT   CDS_pept        598535..599086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="syd"
FT                   /locus_tag="XBJ1_0580"
FT                   /product="interacts with secY"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0580"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79724"
FT                   /db_xref="GOA:D3UWF0"
FT                   /db_xref="InterPro:IPR009948"
FT                   /db_xref="InterPro:IPR038228"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWF0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79724.1"
FT                   /translation="MISNVTEALSDFTRRYVELWQEETGLPPVSSDLYGVPSSCIERTG
FT                   DGVVYWLPKLFSVHEKLSKVETALDIRLQDSIHDYYVTQLAGDMTASFEGQNLSLIQVW
FT                   SDDDFIRLQENLIGHLVTQKRLKLSPTAFIATIDSDMGMISVCNLTGQVVLEQFGKPER
FT                   TILSADLASFLSVIKPATSL"
FT   regulatory      599115..599159
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(599238..599492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0581"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79725"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWF1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79725.1"
FT                   /translation="MIVIAIRLNWSLPAHSLTKYVPVSYSLQNHYIDSIGVPAYTSSSL
FT                   NPLPVGIFPGYFFTVVPNRTVKGSIIQRVETSHLNWLSK"
FT   regulatory      599525..599584
FT                   /regulatory_class="promoter"
FT   operon          599647..601214
FT                   /operon="XBJ1_operon0115"
FT   CDS_pept        599647..599973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0115"
FT                   /locus_tag="XBJ1_0582"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0582"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79726"
FT                   /db_xref="InterPro:IPR007384"
FT                   /db_xref="InterPro:IPR023376"
FT                   /db_xref="InterPro:IPR036814"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWF2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79726.1"
FT                   /translation="MNIEQQILLKLQLIEADMKAAGLWRSHPPKPEAFESTEPFSLDTM
FT                   SAEEWLQWVLIPRMRAMIEQNANLPTAFDITPYFEEVYKEEAERYLPLLEHLRELDSLF
FT                   TQDI"
FT   CDS_pept        599975..600727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0115"
FT                   /gene="truC"
FT                   /locus_tag="XBJ1_0583"
FT                   /product="pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0583"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79727"
FT                   /db_xref="GOA:D3UWF3"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWF3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79727.1"
FT                   /translation="MLDIIYQDDHIVAVNKPAGWLVHRSWLARHETVFVMQTLRDQIGQ
FT                   HVFPVHRLDKPTSGVLLMALSSEVARTLSQQFECHHIQKTYHAIVRGYVEGDGIIDYAL
FT                   MEELDKIADKFADTDREAQSAITHYRSLAKVECPVEIGRYPTSRFSLLELMPKTGRKHQ
FT                   LRRHMSHLRHPIIGDTTHGDLRQNRGVVKYYQTGRLMLHASQLQLAHPVTGEDLLLTAR
FT                   WEASWQHLLEQFGWQGIVPELECPTTHE"
FT   CDS_pept        600762..601214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0115"
FT                   /gene="yqcA"
FT                   /locus_tag="XBJ1_0584"
FT                   /product="putative flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0584"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79728"
FT                   /db_xref="GOA:D3UWF4"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWF4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79728.1"
FT                   /translation="MAKIGVFVGTVYGNALAVAEEAQQILQQQGHDVEVFEDATLTQWQ
FT                   EYQQQVVLVVTSTTGQGNLPDNIQPLYSDMNDKLGHQPDLRYGVIALGDSSYDFFCGGG
FT                   RTFDKLLQEQGAKRVGEVLLIDGIDVVEPEVFAQNWVEEWGALLTE"
FT   regulatory      complement(601205..601253)
FT                   /regulatory_class="terminator"
FT   operon          complement(601271..605256)
FT                   /operon="XBJ1_operon0116"
FT   CDS_pept        complement(601271..601657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0116"
FT                   /locus_tag="XBJ1_0585"
FT                   /product="putative structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0585"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79729"
FT                   /db_xref="InterPro:IPR020911"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWF5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79729.1"
FT                   /translation="MYDNLKSLGITHPEDIDRYSLRQEANNDILKIYFRKDKGEFFAKS
FT                   VKFKYPRQLKTISDDNSAQGYKEVKEINTNLRYVIEELDQICRHDQVEVDLKHKILDDL
FT                   RHLEHVVANKIAEIEADLEKLTRK"
FT   regulatory      complement(601694..601726)
FT                   /operon="XBJ1_operon0116"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(601736..602560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0116"
FT                   /gene="dapD"
FT                   /locus_tag="XBJ1_0586"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0586"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79730"
FT                   /db_xref="GOA:D3UWF6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWF6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79730.1"
FT                   /translation="MQQLQSIIDNAFENRTNITPGTVDEATRSAVNQVIQMLDSGKLRV
FT                   AEKIAGQWVTHQWLKKAVLLSFRINDNQVIEGAESRYFDKVPMKFADYDQARFEKEGFR
FT                   VVPPAAVRQGAYIARNSVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVG
FT                   IGGVLEPLQANPTIIEDNCFIGARSEIVEGVIVEEGAVISMGVYIGQSTKIYDRETGEI
FT                   HYGRVPAGSVVVSGNLPSKDGSYSLYCAVIVKKVDAKTRGKVGLNELLRNID"
FT   CDS_pept        complement(602602..605256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0116"
FT                   /gene="glnD"
FT                   /locus_tag="XBJ1_0587"
FT                   /product="uridylyltransferase"
FT                   /EC_number="2.7.7.59"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0587"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79731"
FT                   /db_xref="GOA:D3UWF7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR005105"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWF7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79731.1"
FT                   /translation="MSVDITFAHAPIPPLSPVEFSLDDLQCPVLKQHVDEFQLWLQQAF
FT                   KAGISPEALISARSDYIDRLLTRLWQAHGFDQNTSLSLIAVGGYGRRELHPLSDIDLLI
FT                   LSESQLTEDQAHNIGQFITLLWDIRLEVGHSVRTFEECLHEGLSDLTVATNLIESRLIC
FT                   GDLPLFLRLQKHIFSDDFWPSSTFFAAKLREQWERHQRYHSTSYNLEPDIKSSPGGLRD
FT                   IHTLLWVARRHFGAASLDEMVDFGFLTREERNELNECQNFLWRIRFALHLVVTRYDNRL
FT                   LFERQFNVAQLLGYEGERNQPVERMMKNFYRVTRRVSELNDMLLQLFDEAILTLQPDEK
FT                   PRPLNEAFQLRGDLIDLSDETLFIQDPTSILKMFYHMAEHREIKGIYSTTLRQLRYARR
FT                   NLKHPLCELPEARKLFMDILRHPRAVKNALIPMHRHSVLGAYMPLWSNIVGQMQFDLFH
FT                   AYTVDEHTLRVLQKLESFADENNRVIHPLCVELYPRIPQPELLRLAAFFHDIAKGRNGD
FT                   HSELGAKDAFTFARQHGLTTREAELVEWLVRDHLLMSVTAQRRDIQDPDVIQQFAGQVK
FT                   NKNRLNYLLCLTVADICATNSKLWNSWKQSLIRELYFATETQLRQGIQNTPDLRERVRH
FT                   NRLQALALLRQERADEEQLHNIWSRCHADYFLRHTPDQLAWHAGHLIQHQSAEPMVLIS
FT                   TAFSHGGTEIFIWCQDRPSLFAAVVGELDRRNLSVHDAQIFTNRDEMAMDTFIVLEPNG
FT                   HPLALDRHEPIRRALLKVVNDPHPKAPKARNLPAKLRHFDVPTKVSFLPTQNARRSYME
FT                   LVALDQPGLLARVGNIFAELGVSLHGARITTIGERVEDFFILADKDHQELDNKIKGELS
FT                   ERLTEALNTKDKV"
FT   regulatory      complement(605302..605348)
FT                   /regulatory_class="terminator"
FT   regulatory      complement(605322..605381)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(605414..606211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="XBJ1_0588"
FT                   /product="methionine aminopeptidase"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0588"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79732"
FT                   /db_xref="GOA:D3UWF8"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWF8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79732.1"
FT                   /translation="MAISIKTDEDIQKMRVAGRLAAEVLEMIEPYVKVGVTTGELDRIC
FT                   HDHITNKQQAISACLGYHGFPKSVCISVNDVICHGIPSDDKVLKEGDIVNIDVTVIKEE
FT                   FHGDTSKMFIVGKSTIQGERLCRVTQESLYLALKMVKPGIRLRSLGKAIQQYVEGQDYS
FT                   VVREYCGHGIGRVFHEEPHVLHYDADDGGVVLQKGMAFTIEPMVNTGDSRIRTMKDGWT
FT                   VKTKDHGWSAQYEHTIVVTENGCEIMTLRKEEEPHISAVLINE"
FT   regulatory      complement(606275..606334)
FT                   /regulatory_class="promoter"
FT   regulatory      606390..606449
FT                   /regulatory_class="promoter"
FT   operon          606594..608324
FT                   /operon="XBJ1_operon0117"
FT   CDS_pept        606594..607319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0117"
FT                   /gene="rpsB"
FT                   /locus_tag="XBJ1_0589"
FT                   /product="30S ribosomal subunit protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0589"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79733"
FT                   /db_xref="GOA:D3UWF9"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWF9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79733.1"
FT                   /translation="MATVSMRDMLQAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEK
FT                   TVPMFNSALAELNKIASRKGKILFVGTKRAACEAIKEEALGCDQYFVNHRWLGGMLTNW
FT                   KTVRQSIKRLKDLEVQSQDGTFDKLTKKEALMRTRELGKLENSLGGIKDMGGLPDALFV
FT                   IDAEHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFIIPGNDDAIRAVKLYLGAVATAVR
FT                   DGRSQDLAVQAEEGLVDAE"
FT   regulatory      607375..607406
FT                   /operon="XBJ1_operon0117"
FT                   /regulatory_class="terminator"
FT   regulatory      607382..607441
FT                   /operon="XBJ1_operon0117"
FT                   /regulatory_class="promoter"
FT   CDS_pept        607467..608324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0117"
FT                   /gene="tsf"
FT                   /locus_tag="XBJ1_0590"
FT                   /product="protein chain elongation factor EF-Ts"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0590"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79734"
FT                   /db_xref="GOA:D3UWG0"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWG0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79734.1"
FT                   /translation="MADITAALVKELRERTGAGMMECKKALVEANGDIELAIDNMRKSG
FT                   QAKAAKKAGRVAAEGVILVEVAADAKYAGIVELNCETDFVAKDSGFLAFGKEVIAAVMA
FT                   DKNADIDALKAQFEEQRANLVAKIGENINIRRVTILEGDAVGSYLHGARIGVLVSAEGA
FT                   SEELIKHVAMHVAASKPEYVNPTDVPADVVAREHQIQMDIAMQSGKPREIAEKMVSGRM
FT                   NKFTGEISLTGQNFVMDPSKTVGDLMKENNAKVINFIRFEVGEGIEKVEADFAAEVAAM
FT                   SKQS"
FT   regulatory      608331..608372
FT                   /regulatory_class="terminator"
FT   regulatory      608358..608417
FT                   /regulatory_class="promoter"
FT   operon          608455..609873
FT                   /operon="XBJ1_operon0118"
FT   CDS_pept        608455..609183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0118"
FT                   /gene="pyrH"
FT                   /locus_tag="XBJ1_0591"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0591"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79735"
FT                   /db_xref="GOA:D3UWG1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWG1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79735.1"
FT                   /translation="MATNAKPVYQRILLKLSGEALQGAEGFGIDASVLDRMAQEVKELV
FT                   ELGIQVGVVIGGGNLFRGAGLAEAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARL
FT                   MSAIPLNGVCDNYSWAEAISLLRHGRVVIFSAGTGNPFFTTDSAACLRGIEIEADVVLK
FT                   ATKVDGVYSSDPAKDTEAVLYSKLTYQEVLERELKVMDLAAFTLARDHSIPIRVFNMNK
FT                   PGALRRVVMGESEGTLISHG"
FT   CDS_pept        609256..609873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0118"
FT                   /gene="frr"
FT                   /locus_tag="XBJ1_0592"
FT                   /product="ribosome releasing factor"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0592"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79736"
FT                   /db_xref="GOA:D3UWG2"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWG2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79736.1"
FT                   /translation="MISYVDIRGLQNNQIPRVCNVINEIKKDAQDRMEKSVEALKNQIS
FT                   KIRTGRASPSLLDGISVDYYGSATPLRQIASVVAEDARTLAITVFDRSMTPAIEKAIMA
FT                   SDLGLNPSSAGTIIRVPLPALTEERRKDLIKVVRGDAEQGRVSVRNIRRDANDKVKALL
FT                   KDKEISEDEERRSQDEIQKLTDSFIKKIDEALASKETELMDF"
FT   regulatory      609891..609927
FT                   /regulatory_class="terminator"
FT   regulatory      609922..609981
FT                   /regulatory_class="promoter"
FT   CDS_pept        610014..611210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /locus_tag="XBJ1_0593"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0593"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79737"
FT                   /db_xref="GOA:D3UWG3"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWG3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79737.1"
FT                   /translation="MKRLTILGSTGSIGKSTLSVVRNNLDKFQVVALVAGKNIEIMAQQ
FT                   CLEFRPQYAAMADAHSATVLRQLLQEQGSQTEVLSGREAICDLAALDDVDQVMSAIVGV
FT                   AGLLPTLAAIRKGKQVLLANKEALITSGRLFMQAVNQYQAQLLPIDSEHNAIFQSLPES
FT                   VQHNLGNASLKQHGISSIILTGSGGPFRRTPLETLLDVTPDEACAHPVWSMGRKISVDS
FT                   ATMMNKGLEYIEARYLFNASADEIEVLLHPQSVIHSMVRYQDGSIIAQLGTQDMCTPIA
FT                   YAMAYPNRIVSGVKPLDFTELSTLTFEALDYRRYPCLKLAIDACHEGQAATTALNAANE
FT                   ETVSAFLKDGIRFTDIAMINRLVVEKLNLPEPESIEEVLEIDKVARELAKETIKACSK"
FT   regulatory      611212..611271
FT                   /regulatory_class="promoter"
FT   regulatory      611296..611353
FT                   /regulatory_class="terminator"
FT   operon          611519..626122
FT                   /operon="XBJ1_operon0119"
FT   CDS_pept        611519..612214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0119"
FT                   /gene="ispU"
FT                   /locus_tag="XBJ1_0594"
FT                   /product="undecaprenyl pyrophosphate synthetase
FT                   (di-trans,poly-cis-decaprenylcistransferase)"
FT                   /EC_number="2.5.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0594"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79738"
FT                   /db_xref="GOA:D3UWG4"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWG4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79738.1"
FT                   /translation="MDGNGRWAKQRGKLRVFGHRAGVKAVRVAVSFSVKHNIESLTLYA
FT                   FSSENWNRPQQEVSSLMELFVFALDNEVKSLHKHNVKLSVIGDISRFSSRLQERIRRSV
FT                   ELTAGNTGLQLNIAANYGGRWDLVQGVKQIAEKIRANELEPEEITEATVGSVINLSEQP
FT                   EVDLVIRTGGEHRISNFLLWQIAYAELYFTDILWPDFDETVFEGAINAFVKRERRFGGT
FT                   IPDDAEVGS"
FT   CDS_pept        612224..613087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0119"
FT                   /gene="cdsA"
FT                   /locus_tag="XBJ1_0595"
FT                   /product="CDP-diglyceride synthase"
FT                   /EC_number="2.7.7.41"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0595"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79739"
FT                   /db_xref="GOA:D3UWG5"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWG5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79739.1"
FT                   /translation="MLKYRLLTTLILIPIVIAALFLLPPSGFGLVVITVSVLAAWEWGQ
FT                   FAGLFTQAKRITLAVLFAVGLLALQYSLSDFSHLIEKPQIVYLLWAGMIWWAAAILLVT
FT                   TYPASASIWKSSTALRLLFGVLTIVPFYCGMMVLRTQGYENNTYHGAWWLLYAMLLVWG
FT                   ADSGAYVFGRTLGKHKMAPRVSPGKTLEGLVGGVLTAALISWLFGKFAPVPVMPENLLL
FT                   ISAVVVIASVFGDLTESMFKRESGIKDSSLLIPGHGGVMDRVDSLTAAVPVFAGLVLLI
FT                   SSGFGL"
FT   CDS_pept        613097..614449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0119"
FT                   /gene="ecfE"
FT                   /locus_tag="XBJ1_0596"
FT                   /product="membrane-associated protease"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0596"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79740"
FT                   /db_xref="GOA:D3UWG6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWG6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79740.1"
FT                   /translation="MDILWNLAAFIVALGILITVHEFGHFWVARRCGIYVERFSIGFGK
FT                   ALWRRTDKQGTEYVIALIPLGGYVKMLDERVESVSPERRHMAFNNKTIGQRAAVVSAGP
FT                   IANFILAVIAYWLVFVIGVPSVRPVVLDVKPDSIAAQANILPGMELKTVDGIETFDWNS
FT                   VRLALVSKVGESFVSMDVMPMDAAASMQKTLDLRDWAFDPSKQDVLLSLGIMPVVPRIS
FT                   SQVENVYPDSPAEKAGLQRGDRIVKVNGQNVDVWHTFVSFIRKNPNVPLKLDVARANSI
FT                   IPLSLTPEVRRLSNGREEGFAGAELHVIPLADEYKVIQQYGAFSAIYQAGDKTWQLMKL
FT                   TVNMIGKLIVGDVKLNNLSGPISIAKGAGVSADSGLVYYLMFLALISVNLGIINLFPLP
FT                   VLDGGHLLFLAIEKIKGGPVSERVQDFSYRIGTILLVLLMGLALFNDFSRF"
FT   CDS_pept        614430..616865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0119"
FT                   /gene="ecfK"
FT                   /locus_tag="XBJ1_0597"
FT                   /product="putative outer membrane antigen"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0597"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79741"
FT                   /db_xref="GOA:D3UWG7"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWG7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79741.1"
FT                   /translation="MISPASKVGDRLGKRITTMAMKKLLIASLLFGSATAYSSDGFVVR
FT                   DIHFEGLQRVTSGAALLNMPVRVGDTISDEDISRTIHTLFATGNFEDVRVLRDGNTLVV
FT                   QVKERPTIASITFSGNKSVKDDMLKKNLESSRVSVGEALDRTMLSNMEKGLEDFYYSVG
FT                   KYNATVKAVVTPLPRNRIDLKLIFSEGISAQIQQINIVGNKAFSTNELLNRFQLRDDIP
FT                   WWNFMADQKYQKQKLAGDLETLRSFYLDRGYARFNIDSTQVNLTPDKKGIYITVNINEG
FT                   AQYKIASVDLNGNLAGYQSEATKLTNIQPGSLYNGTEVTSMEKAIKNLLGRYGYAYPRV
FT                   ITQPEINDTDKTVKLHVNVDAGNRFYVRKIRFEGNDISRDSVLRREMRQMEGAWLGSDR
FT                   VEQGKERLDRLGFFETVNVDTERVSGSPDLVDVVYKVKERNTGSMNFGVGFGTESGMSF
FT                   QVGLQQENWLGTGNSVGISASKNDYSTSADLSFTDPYFTVDGVSLGGRVYYNDFRADDA
FT                   ELSGYTNKAYGTEGILGFPLNENNRLAMRLGYAHNSLSNMRPQAAMWRYLKKMGKEPPL
FT                   KGKASFDSNDFPLTFSWIYGNFDRGFFPTSGFKSSVDAKVALPGSDNQYYKLTWSATGY
FT                   YPIDDKNSWIMMGRTRMGYGGGLGGKEMPFYENFYAGGSNSVRGFRSNNIGPKAIYLGE
FT                   NKEPEKNSPSRDAVGGNALATASFELITPTPFLDAKYANTVRTSFFVDAGTVWDTNWNN
FT                   ISPGLPDYSKPNNIRVSAGIALQWLSPLGPLTFSYGKPIKEYEGDRAEQFQFNIGGTW"
FT   regulatory      616871..616930
FT                   /operon="XBJ1_operon0119"
FT                   /regulatory_class="promoter"
FT   regulatory      616890..616926
FT                   /operon="XBJ1_operon0119"
FT                   /regulatory_class="terminator"
FT   CDS_pept        616964..617461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0119"
FT                   /gene="skp"
FT                   /locus_tag="XBJ1_0598"
FT                   /product="periplasmic molecular chaperone for outer
FT                   membrane proteins"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0598"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79742"
FT                   /db_xref="GOA:D3UWG8"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWG8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79742.1"
FT                   /translation="MKKVLCAASFGIALAFSAGVQAADKIGVVNVGEIIQKLPAREAAV
FT                   KQLDSEFKGRISELQSMEADMQTKVQKLQRDGSTMKASERTKLEKEVMAQRNDYAQKAQ
FT                   SLDNDSRRRQMEEQNKLLTRIHDAVKVVAGKEGYDVVLDANTVLYSVSGKDITADVLKQ
FT                   VK"
FT   CDS_pept        617466..618494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0119"
FT                   /gene="lpxD"
FT                   /locus_tag="XBJ1_0599"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl)-glucosamine
FT                   N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0599"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79743"
FT                   /db_xref="GOA:D3UWG9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWG9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79743.1"
FT                   /translation="MVSIRLADLAQQLNAQLHGDGDIVITSIAPMYSANSEQITFLSDS
FT                   RYTDKLAECQAAAVVLRESDLTHCKVAALVVDNPYLAYARMAQIMDTTPQPAQDIHPSA
FT                   VIFSEVQLGKNVAVGANAVVESGVILGDNVIVGAGCFIGKNTRIGAGTRLWANVSVYHN
FT                   VEIGEQCLIQSGTVIGSDGFGYANDRGNWIKIPQLGSVVIGDRVEIGASTTIDRGALDN
FT                   TVIGNGVIIDNQCQIAHNVIIGDNTAVAGGVTMAGSLKIGRYCMIGGASVINGHIEICD
FT                   KVTVTGMGMVMRPITEPGVYSSGIPLQPNKVWRKTAALVMNINEMNKRLKSVERQREGE
FT                   NE"
FT   regulatory      618503..618562
FT                   /operon="XBJ1_operon0119"
FT                   /regulatory_class="promoter"
FT   CDS_pept        618619..619071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0119"
FT                   /gene="fabZ"
FT                   /locus_tag="XBJ1_0600"
FT                   /product="(3R)-hydroxymyristol acyl carrier protein
FT                   dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0600"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79744"
FT                   /db_xref="GOA:D3UWH0"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWH0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79744.1"
FT                   /translation="MSDNRTLQIEEILDLLPHRYPFLLVDRVLDFEEGKFLRAVKNVSF
FT                   NEPFFQGHFPGKPIFPGVLILEAMAQATGILAFKSVGSLAPGELYYFAAIDGARFKRPV
FT                   LPGDQMVLEVEFIKERRGVARFKGVAKVDGEVACEAEMMCARRREA"
FT   CDS_pept        619075..619872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0119"
FT                   /gene="lpxA"
FT                   /locus_tag="XBJ1_0601"
FT                   /product="UDP-N-acetylglucosamine acetyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0601"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79745"
FT                   /db_xref="GOA:D3UWH1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWH1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79745.1"
FT                   /translation="MIDQTAVIHPSSIVEEGAVIGGNVRIGPFCYIGSQVEIGEGTEVK
FT                   SHVVINGITKIGRDNQIYQFASIGEVNQDLKYQGEPTRVEIGDRNRIRESASIHRGTVQ
FT                   GGGLTKIGSDNLLMINTHIAHDCMIGDRCIIANNGTLGGHVILGDYVIIGGMTAVHQFC
FT                   QIGSHVMVGGCSGVAQDVPPYVIAQGNHATPFGLNIEGLKRRGFDKESLHAIRNAYKAL
FT                   YRSGRTLEEARIEIELQTANNPHVKAFSDFLENSAKSSRGIIR"
FT   CDS_pept        619892..621061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0119"
FT                   /gene="lpxB"
FT                   /locus_tag="XBJ1_0602"
FT                   /product="tetraacyldisaccharide-1-P synthase"
FT                   /EC_number="2.4.1.182"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0602"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79746"
FT                   /db_xref="GOA:D3UWH2"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWH2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79746.1"
FT                   /translation="MATFSSVNNQRPLTIALVAGETSGDILGAGLIRALKAQIPDAHFV
FT                   GVAGPLMQAEGCEAWYEMEELAVMGIVEVLGRLPRLLKIRKDLTARFTALKPDVFVGID
FT                   APDFNITLEGRLKQRGIRTIHYVSPSVWAWRQKRVFKIGRATDLVLAFLPFEKAFYDRF
FT                   SVPCKFIGHTMADSMPLQTDKMAAREALGVPLNAHCLAILPGSRHAEVEMLSADFLRTV
FT                   QLLRKILPDLHVLVPLVNAKRHQQFQRIKDEIAPDLSVHMLDGNAGKAMIASDATLLAS
FT                   GTAALECMLAKCPMVVGYRMKPFTFWLAKRLVKTPYVSLPNLLAGKELVKELLQDECEP
FT                   QALSEALLPLLQGGADVEALKQTFLHLHESIRCDADEQAAQAVLELARR"
FT   CDS_pept        621061..621651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0119"
FT                   /gene="rnhB"
FT                   /locus_tag="XBJ1_0603"
FT                   /product="RNAse HII"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0603"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79747"
FT                   /db_xref="GOA:D3UWH3"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWH3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79747.1"
FT                   /translation="MDFVYPQANLIAGVDEVGRGPLVGAVVTAAVILDPAKPITGLMDS
FT                   KKLTEKRREALYLEIKEKALCWSLGRAEPEEIDQLNILHATMLAMQRAVEGLAITPDYV
FT                   LIDGNRCPALPMSALAVIKGDSLVAEISAASILAKVTRDREMAELGKQFPDYGFAQHKG
FT                   YPTALHLEKLALLGATEHHRKSFAPVKRALGLG"
FT   CDS_pept        621716..625150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0119"
FT                   /gene="dnaE"
FT                   /locus_tag="XBJ1_0604"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0604"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79748"
FT                   /db_xref="GOA:D3UWH4"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWH4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79748.1"
FT                   /translation="MIDGLAKTGSLIKKVAKLDMPAFAITDFTNLCGLVKFYGSAHSAG
FT                   IKPIIGADFYVESDLLGDEYAHLTILARNNEGYQNLTFLISEAYQKGYGAIGPTIKQEW
FT                   LIKYKAGLILLSGGRMGDVGKFLLRGNRAMADQCLDFYQEHFPDSYYLELIRTGRQDEE
FT                   NYLHAAVEVAAEKNLPVVATNDVCFLESDDFEAHEIRVAIHDGYTMADPKRPKNYSPQQ
FT                   YLRSEQEMCELFSDIPEALQNSVEIAKRCNVTIRLGEYFLPQFPTGDMSTEDYLVEKSK
FT                   QGLEDRLNFLYPDPQIRAEKRSEYDERLDIELEVINQMGFPGYFLIVMEFIQWSKDNGV
FT                   PVGPGRGSGAGSLVAYALKITDIDPLAFDLLFERFLNPERISMPDFDVDFCMEKRDQVI
FT                   DHVADMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDRISKLVPPDPGMTLEKA
FT                   FAAEPQLPEIYEADEEVRVLIDMARKLEGVTRNAGKHAGGVVIAPTKITDFSPIYCDPE
FT                   GLNPVTQFDKNDVEYAGLVKFDFLGLRTLTIINWALDMVNARRTHKNLEPIDITAIPLD
FT                   DQISFDMLQRSETTAVFQLESRGMKDLIKRLRPDCFEDMIALVALFRPGPLQSGMVDNF
FT                   IDRKHGREELSYPDVEWQHESLKPVLEPTYGIILYQEQVMQIAQVLAGYTLGGADMLRR
FT                   AMGKKQPEEMAKQRSVFEEGAISQGINGELAIKIFDLVEKFAGYGFNKSHSAAYALVSY
FT                   QTLWLKAHYPAEFMAAVMTADMDNTEKVVGLVDECWRMGLKVLPPDINSGLYHFHVNDE
FT                   SEIVYGIGAIKGVGEGPIEAILEARQKEGHFKELFDLCARVDTKKLNRRVMEKLIMSGA
FT                   FDRLGPHRAALMSSLEDALKAADQHAKAEAIGQTDMFGVLAEKPEQVELSYASTPKWPE
FT                   QVVLDGERETLGLYLTGHPITSYLKEIERYTNGLRLKDVSPTPRGQVTTVVGLVLASKI
FT                   LTTKRGNRIGICTLDDRSGRLEIMLFSDALERYQHLLEQDKILIATGQVSFDDFSGGLK
FT                   MTVRELMDISEAREKFARGIAISLSDRQINKQLFNRLRGVLEPHRSGTIPVHLYYQRVD
FT                   ARARLRFGATWRVTPTDTLLTDLRTLLGNEQVELEFD"
FT   CDS_pept        625163..626122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0119"
FT                   /gene="accA"
FT                   /locus_tag="XBJ1_0605"
FT                   /product="acetylCoA carboxylase, carboxytransferase subunit
FT                   alpha"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0605"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79749"
FT                   /db_xref="GOA:D3UWH5"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWH5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79749.1"
FT                   /translation="MSLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINLDEEVQRLRE
FT                   KSLELTRKIFSDLGAWQISQLSRHPLRPYTLDYIQRVFTDFEELAGDRAYADDKAIVAG
FT                   LARLDGRPVMVIGHQKGRETKEKIRRNFGMPSPEGYRKALRLMELAERFKLPIITFIDT
FT                   PGAYPGVGAEERGQSEAIARNLREMSRLSVPVICTVIGEGGSGGALALSVGDKVNMLQY
FT                   STFSTISPEGCASILWKSAEKAPLAAEAMGNTAPRLKELKLIDSVIPEPLGGAHRNYDA
FT                   IAQALKAQLLADFADLDHLNSEELVNRRYERLMQYGYC"
FT   regulatory      626177..626236
FT                   /regulatory_class="terminator"
FT   regulatory      626271..626330
FT                   /regulatory_class="promoter"
FT   operon          626350..628649
FT                   /operon="XBJ1_operon0120"
FT   CDS_pept        626350..627267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0120"
FT                   /locus_tag="XBJ1_0606"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0606"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79750"
FT                   /db_xref="GOA:D3UWH6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWH6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79750.1"
FT                   /translation="MDKYKYIIYAFSCVLIWSFVPSISRLGQKGMDHFQYLFWSNILSV
FT                   LAVFFVAVLMGRNLKQLLFIPFPVMFKVLILGTLDCFFYLLLYYGYSIENGVAVLVVQY
FT                   SWPLMIIGLSFLLLKEKLSIRQMIGITLGFIAVVITFTQGNITRIAVEHPQALLLVFSG
FT                   AFCFALMSVLSKHFAIDPYINTFWVFACSTLVSAVFLLVFSSFNWPVGDSLMPTLLNGI
FT                   ILNGVSYIIWFKAMNSPDSPKIASILFLSPVLSMIWLILFFGDAFVPAYVVGLVLVIIS
FT                   GLLCISAKTEPATQNKLSDDLIED"
FT   CDS_pept        627300..628649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0120"
FT                   /gene="tilS"
FT                   /locus_tag="XBJ1_0607"
FT                   /product="TilS, tRNA(Ile)-lysidine synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15124629; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0607"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79751"
FT                   /db_xref="GOA:D3UWH7"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWH7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79751.1"
FT                   /translation="MINTHIPLLTMLIDQLGRHKKVLVGFSGGLDSTVLLHLLVQLRYQ
FT                   SHSGVIRDQIELRAIHIHHGLNPKADKWVEHCRQICADWKVDFRVEKVSLDIRQNGIEA
FT                   AARDARYQAFQHELQQGEILVTAQHLDDQAETFLLALKRGSGPAGLSSMPSSMPFSGTT
FT                   LIRPLLNASRAELETYAQTQRLQWIEDDSNQDDRYDRNFLRLHIMPLLNQRWPHFPQSA
FT                   SRSASLCGEQEQLLDELLNESLNELITPEGAIAISPLVDCSEAKRNALLRRWFNQHGVK
FT                   MPAREQLQKIWSEVALSRQDAEPRFRLGQHDVRRYRQQLWLVPQCQSLAGTLLEWDIAQ
FT                   ELRLPDGLGMLVLSEESGINVRMPDRNERVTIRFGVQGNISIVGRRHSRHSKKLWQELG
FT                   IAPWLRERTPLLYYDEKLVAALDVFVTKEGQPLAEKEILSIKWDRMPYSA"
FT   regulatory      628744..628793
FT                   /regulatory_class="terminator"
FT   regulatory      complement(628892..628926)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(628987..629244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rof"
FT                   /locus_tag="XBJ1_0608"
FT                   /product="modulator of Rho-dependent transcription
FT                   termination"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0608"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79752"
FT                   /db_xref="InterPro:IPR009778"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR038626"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWH8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79752.1"
FT                   /translation="MSIDTEYQPINCDDYDNLELACQHQLHLHIQLQGGGIFEGKASKL
FT                   ILRKKVEYILVESNEETRELRLDHIISFSNPEIGTIVIEH"
FT   CDS_pept        629571..630260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nlpE"
FT                   /locus_tag="XBJ1_0609"
FT                   /product="outer membrane lipoprotein, involved in copper
FT                   homeostasis and in adhesion"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0609"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79753"
FT                   /db_xref="InterPro:IPR007298"
FT                   /db_xref="InterPro:IPR033450"
FT                   /db_xref="InterPro:IPR038139"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWH9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79753.1"
FT                   /translation="MNKKILLAVGVLTAVGCQNKVASQDNATLQENTLQNKLQTAERVF
FT                   TGVVPCADCTGIETTLQLSSDGSYILGQIYLEAKNEENTFFETGHWIKSGKKIDLTHED
FT                   GKKSYYQMKGENLVMLDIDGEPIQSNFNYELGKVTPKKMAGEYSYIADSATFTECRTGK
FT                   HYDASENIDLERGYSATGVEGGEPVYVEVEGYYSLRPSMEDGMFDHALIQTGKIHFDKS
FT                   ASCQTRK"
FT   regulatory      complement(630271..630316)
FT                   /regulatory_class="terminator"
FT   regulatory      630289..630322
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(630346..632067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="XBJ1_0610"
FT                   /product="proline tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0610"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79754"
FT                   /db_xref="GOA:D3UWI0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWI0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79754.1"
FT                   /translation="MRTSQYLLSTLKETPADAEVVSHKLMLRAGMTRKLASGLYNWMPT
FT                   GVRVLKKVENIVREEMNNAGAIEVSMPVVQPADLWQESGRWEQYGPELLRFEDRGARPF
FT                   VLGPTHEEVITDLVRNEVTSYKQLPLNLFQIQTKFRDEVRPRFGVMRSREFIMKDAYSF
FT                   HTSQESLQETYDKMYDAYSKIFTRIGLDFRAVLADTGSIGGSASHEFQVLADSGEDDIA
FT                   FSTESNYAANIELAEAVMPSHERAVPSEDMHLVETPNAKTIAELVEQFNLPIEKTVKTL
FT                   IVHAAKESSHQLVALLVRGDHELNEIKAEKLPLVASPLSFATEEEIRAVVQAGPGSLGP
FT                   VNLPMPVIIDRSVSVMSDFGAGANVDDKHYFGINWERDLPLPEIADIRNVLEGDASPDG
FT                   QGTLLIKRGIEVGHIFQLGTKYSDALKATVQNEDGHNQVVSMGCYGIGVTRIVAAAIEQ
FT                   NHDDRGIIWPDAIAPFQVALLPMNMHKSYRVKEVAEKLYADLRANGIDVIFDDRKERPG
FT                   VMFADMELIGVPHTLVIGDRNLDNGEVEYKYRRNGDKQMLKLEGIIEYLKEQIKQH"
FT   regulatory      complement(632103..632162)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(632132..632159)
FT                   /regulatory_class="terminator"
FT   operon          complement(632183..633303)
FT                   /operon="XBJ1_operon0121"
FT   CDS_pept        complement(632183..632890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0121"
FT                   /locus_tag="XBJ1_0611"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0611"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79755"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWI1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79755.1"
FT                   /translation="MADFHFTQIGTIHSPYKEKFAIPRQPGLVEDGAGQLELLAPYNQI
FT                   DAIRGIEQFSHLWIIFVFHQTMNGGWNPLVRPPRLGGNAKMGVFATRSTFRPNPIGMSL
FT                   VELKGIQCQNNRVILELGSLDLVDGTPVIDIKPYLPFAESRPEARAGFAQKAPDTGMEV
FT                   SFLPIAEHQLSSHQANYPHLRRFISQILAQDPRPAYRKKEQENRIYAVHILDFNVRWQI
FT                   RDAMTEVVSIEHR"
FT   CDS_pept        complement(632911..633303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0121"
FT                   /gene="rcsF"
FT                   /locus_tag="XBJ1_0612"
FT                   /product="regulator in colanic acid synthesis;
FT                   overexpression confers mucoid phenotype, increases capsule
FT                   synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0612"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79756"
FT                   /db_xref="GOA:D3UWI2"
FT                   /db_xref="InterPro:IPR030852"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWI2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79756.1"
FT                   /translation="MRMLPICFITLFMVGCTSLSTQVEKPTQTGSKLKHQPAKKSKVSS
FT                   YVQLYTKTEELLGTPFKNLGIVFGESCRTTRQDPPASIAVARKNMLVKAASLKADAVLL
FT                   HQCAILSNHNCYQTAICEGSALLTTK"
FT   regulatory      complement(633390..633427)
FT                   /regulatory_class="terminator"
FT   regulatory      complement(633399..633458)
FT                   /regulatory_class="promoter"
FT   operon          complement(633461..635980)
FT                   /operon="XBJ1_operon0122"
FT   CDS_pept        complement(633461..634276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0122"
FT                   /gene="metQ"
FT                   /locus_tag="XBJ1_0613"
FT                   /product="D-methionine transport protein (ABC superfamily,
FT                   peri_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0613"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79757"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWI3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79757.1"
FT                   /translation="MSVKLKSIVAISALLGTLILAGCDQEPRDPDHIKVGVIVGPELEV
FT                   AEVAKKVAKEKYGLDVELITFNDYVLPNESLNKGDIDVNVFQHKPFLDQQVKERNYKLT
FT                   IVGNSFIYPIAAYSRKIKSLGELENGNQITIPNDPTNQGRALLLLQKQGLITLKEGVGL
FT                   LPTVLDIINNPKDLDIVELEAPQLPRSLDDQKIAFAIINNAYAGQVGLTPEQDGLFVED
FT                   KDSPYVNIIVSREDNKDAENVQKFVKAYQSEEVEQAAQRIFKGGALKGW"
FT   CDS_pept        complement(634303..634956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0122"
FT                   /gene="metI"
FT                   /locus_tag="XBJ1_0614"
FT                   /product="D-and L-methionine transport protein (ABC
FT                   superfamily, membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0614"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79758"
FT                   /db_xref="GOA:D3UWI4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWI4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79758.1"
FT                   /translation="MSDGMIFLLFKGVWETLVMTFVSGFFGFVIGLPIGVLLYVTRAGQ
FT                   IMENITLYRILSALVNIGRSIPFIILLVWMIPFTRLIVGTSIGLQAAIVPLTVGAAPFI
FT                   ARMVENALLEIPPGLIEAARAMGATPLQIVKKILLPEAQLSLINAATITLITLVGYSAM
FT                   GGAVGAGGLGQIGYQYGYIGYNAPVMNTVLALLIVLVFLIQLGGDRLIIAVNHK"
FT   CDS_pept        complement(634949..635980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0122"
FT                   /gene="metN"
FT                   /locus_tag="XBJ1_0615"
FT                   /product="D-and L-methionine transport protein (ABC
FT                   superfamily, atp_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0615"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79759"
FT                   /db_xref="GOA:D3UWI5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012692"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWI5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79759.1"
FT                   /translation="MIKLTQINKVFQLGTRSINALSNINLHVPQGQIYGVIGSSGAGKS
FT                   TLIRCVNMLERPTSGKVLVNGQDLTSMSNRELTHARRHIGMIFQHFNLLSSRTVFGNVA
FT                   LPLELDNTPKNEINKRVSELLELVGLSDKHDAYPANLSGGQKQRVAIARALANSPKILL
FT                   CDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDQVAVINAGLLIEQ
FT                   DVVSEIFSHPKTPVAQEFIKSTLHIDIPESYLKKLKPECTPDSLPLLKLEFTGKSVDAP
FT                   LISMAVRRFNIDVSILSSQMDYAGGVKFGVMLAELGGEYSSIESTIEFLKEHHVKVEVL
FT                   GYV"
FT   regulatory      complement(636052..636111)
FT                   /regulatory_class="promoter"
FT   operon          complement(636700..638110)
FT                   /operon="XBJ1_operon0123"
FT   CDS_pept        complement(636700..637338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0123"
FT                   /locus_tag="XBJ1_0616"
FT                   /product="putative amino acid efflux transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0616"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79760"
FT                   /db_xref="GOA:D3UWI6"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWI6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79760.1"
FT                   /translation="MLSNYWGEFLGLAMIHFLAVVAPGPDFAVTIQQSVKFGRLAGVCT
FT                   AIGIGAGISVHVVYTLVGISSLMHSTPWLMEMAKLVGSLYIIWLGIKFIKSKPVNPDTL
FT                   ESKNIIQTSQSKWQAFLMGFMTNALNPKATLFFLAVFTTVVSINTPILIQVFYGLWMCI
FT                   ANTVWFVLVSVIFSNVLIRNKFMEKGYWFERVMGIVLISFAIRLLFISV"
FT   CDS_pept        complement(637340..638110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0123"
FT                   /locus_tag="XBJ1_0617"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0617"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79761"
FT                   /db_xref="GOA:D3UWI7"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWI7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79761.1"
FT                   /translation="MIIETDRLNSACIEKLAKQEILAIRIKKFIPTSLAEKISEKILGK
FT                   GFDKYLNAPSIGRIGMAFYETENKALRVADYFENVLNNINELRQRCSPYLSPIDQLRCV
FT                   LDEVWPAGAQLETLYGKKMYVGLSRVVEPGVTFLAHHDIFAKDAPDSFRAKSLQAQFAA
FT                   NVYLSMPNEGGALQVWKNKLSPEEFDSMRRDSYGIEPSLLGKPALEVQPDAGELLIFNA
FT                   QCMHAVTAGIGSSRLSLSCFIGYRGEAAPLSFWS"
FT   regulatory      complement(638206..638265)
FT                   /regulatory_class="promoter"
FT   operon          complement(638893..639193)
FT                   /operon="XBJ1_operon0124"
FT   CDS_pept        complement(638893..638985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0124"
FT                   /locus_tag="XBJ1_0618"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0618"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79762"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWI8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79762.1"
FT                   /translation="MKYTPFGFDIAKHLMQVHFVDEYTSEVVDK"
FT   CDS_pept        complement(639029..639193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0124"
FT                   /locus_tag="XBJ1_0619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0619"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79763"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWI9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79763.1"
FT                   /translation="MKTQWRISVLCYYSNSLLLMYIHNDRECNERIPTTVLEVRDEAWL
FT                   LTDFQPYSA"
FT   regulatory      complement(639355..639414)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(639767..639973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0620"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79764"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWJ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79764.1"
FT                   /translation="MGDPTTFRSGREFSTYLGLVPRQTGTGGRVKPVNVNGSVKLGLLL
FT                   DSSGQVQTSLRRGHICSLRLRID"
FT   CDS_pept        640308..640454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0621"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79765"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWJ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79765.1"
FT                   /translation="MSILDEKGLIDWAEIFLDGSNIRASKDVLLKTRKIGHYYKGHFIF
FT                   HRC"
FT   regulatory      640462..640521
FT                   /regulatory_class="promoter"
FT   CDS_pept        640541..640720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0622"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0622"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79766"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWJ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79766.1"
FT                   /translation="MGFEELIMFQTAKETFDKSVIPTCPDIPLACSYVITAEQVPVLLA
FT                   CILAPSITMKNTAL"
FT   operon          complement(640749..642216)
FT                   /operon="XBJ1_operon0125"
FT   CDS_pept        complement(640749..641636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0125"
FT                   /locus_tag="XBJ1_0623"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0623"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79767"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWJ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79767.1"
FT                   /translation="MHNLVDLFCHVDDFCKLFMPQWQKYLIESGQCQRLRPTRMTTSEI
FT                   MTIIIAFHMSHQRDFKHFYIGFMTVYHKKDFPSLLSYTRFLEVMPTVLAPLSSFFTHLK
FT                   GQPTGLEFIDSTRIKVCHNLRIPRHQVFKGAAARGKGTMGWFYGFKLHIIVNHLGEIVA
FT                   TKLTSANVDDRTPVKALSKGLLDKLYADKGYISKALTEELEMEGITLVTGQRKNMKPKL
FT                   LAAWDRAMLAKRFIIETINDQLKNITQIEHSRHRSLHGFMLNLLGGLIAYCLKPKKPSL
FT                   NLSNTEKTGLQVMA"
FT   CDS_pept        complement(641734..642216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0125"
FT                   /locus_tag="XBJ1_0624"
FT                   /product="transposase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0624"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79768"
FT                   /db_xref="GOA:D3UZC5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZC5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79768.1"
FT                   /translation="MKVSRSTFYAWQAKPVRLLSDEQQALNRKATALFKESRESLGYRM
FT                   LAKKLRKEGLTISDYRTRELMNQRGLSVRQRQRYRAPRKDKAISTACNLLNRNFNPLAP
FT                   NEVWAGDITYLKTPEGWLSLAIVMDLYSRRTVGWQISTEIDTTLISQALMNAYYLT"
FT   regulatory      complement(642263..642322)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(642277..642507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0625"
FT                   /product="transposase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0625"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79769"
FT                   /db_xref="GOA:D3UZC6"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZC6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79769.1"
FT                   /translation="MVVEQSYTVPQAAETLGIPTKLLYTWRKHDVEQSKPSALTPDERQ
FT                   ELLQLRKENKQLKMEKEILKKASAFFAGELL"
FT   regulatory      642905..642964
FT                   /regulatory_class="promoter"
FT   CDS_pept        643036..643602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhB"
FT                   /locus_tag="XBJ1_0626"
FT                   /product="D,D-heptose 1,7-bisphosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0626"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79770"
FT                   /db_xref="GOA:D3UZC7"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZC7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79770.1"
FT                   /translation="MTQSIPAVFLDRDGTINIDHGYVHEIDNFQFIDGTIEAMLELKKM
FT                   GYALVLVTNQSGIAREMFTEDQFLQLTEWMDWSLADRGVDLDGIYYCPHYPEGSADAYK
FT                   KNCHCRKPQPGMLLDAQKELSIDMSASYMVGDKIEDMLAANAANVGTKVLVRTGKAVTE
FT                   AVEQAADLVINSLIDLPNAIKNRQK"
FT   regulatory      643787..643833
FT                   /regulatory_class="terminator"
FT   rRNA            644001..645497
FT                   /locus_tag="XBJ1_rRNA0009"
FT                   /product="16S ribosomal RNA"
FT   tRNA            645602..645677
FT                   /gene="GluTTC"
FT                   /locus_tag="XBJ1_tRNA0010"
FT                   /product="tRNA-Glu"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   rRNA            646038..646403
FT                   /gene="LSU_RRNA"
FT                   /locus_tag="XBJ1_rRNA0010"
FT                   /product="23S ribosomal RNA"
FT   rRNA            646418..648424
FT                   /gene="LSU_RRNA"
FT                   /locus_tag="XBJ1_rRNA0011"
FT                   /product="23S ribosomal RNA"
FT   rRNA            648861..648973
FT                   /locus_tag="XBJ1_0629"
FT                   /product="5S ribosomal RNA protein"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT   tRNA            649049..649125
FT                   /gene="AspGTC"
FT                   /locus_tag="XBJ1_tRNA0011"
FT                   /product="tRNA-Asp"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   regulatory      complement(649066..649125)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(649742..649882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0630"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79771"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWL9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79771.1"
FT                   /translation="MKPCGFLGLSGAELIEARASLPIVTPDRFKQANINQKSVLQKRWG
FT                   P"
FT   CDS_pept        complement(650014..651018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0631"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0631"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79772"
FT                   /db_xref="GOA:D3UWM0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWM0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79772.1"
FT                   /translation="MQNVTLIGIDLGKHSFHVHCQDKSGKALLRKKFTRARLMEFLAGS
FT                   PSATVVMEACAGAHFMARRIAAFGHEAKLISPQFVRPFVKSNKNDFVDAEAICEAASRP
FT                   SMRFVQPRTEAQQAMRALHRVRESLVRDRVKTTNQMHAFLLEFGISMPIGTAVIKRLST
FT                   VLAENELPPYLAQLLMRLHAHYLYLVEQLTELETALEQELRRDETGQRLQTIPGVGPIT
FT                   ASVLSSQLGDGKQYGCSRDFAASTGLVPRQYSTGGKNTLLGISKRGDKNLRRLLVQCAR
FT                   VFIQRIDYQSGRLAEWVKAQLERKHSNVVACALANKLARIAWAITTRQTVFER"
FT   regulatory      complement(651029..651069)
FT                   /regulatory_class="terminator"
FT   regulatory      complement(651151..651210)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(651234..652238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0632"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0632"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79773"
FT                   /db_xref="GOA:D3UWM0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWM0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79773.1"
FT                   /translation="MQNVTLIGIDLGKHSFHVHCQDKSGKALLRKKFTRARLMEFLAGS
FT                   PSATVVMEACAGAHFMARRIAAFGHEAKLISPQFVRPFVKSNKNDFVDAEAICEAASRP
FT                   SMRFVQPRTEAQQAMRALHRVRESLVRDRVKTTNQMHAFLLEFGISMPIGTAVIKRLST
FT                   VLAENELPPYLAQLLMRLHAHYLYLVEQLTELETALEQELRRDETGQRLQTIPGVGPIT
FT                   ASVLSSQLGDGKQYGCSRDFAASTGLVPRQYSTGGKNTLLGISKRGDKNLRRLLVQCAR
FT                   VFIQRIDYQSGRLAEWVKAQLERKHSNVVACALANKLARIAWAITTRQTVFER"
FT   regulatory      complement(652249..652289)
FT                   /regulatory_class="terminator"
FT   regulatory      complement(652328..652387)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(652443..652829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0633"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79774"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZD1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79774.1"
FT                   /translation="MGGSQALALDFSYKSEMPADNKPSEEYLKKRAGLESKSWNVDTLT
FT                   QDNVLAEKREEEMGQYNKKFENKNGIGLSYDWESKHLKSLQHMQQTSHFSNRRCYRATR
FT                   QKLEKDFGNGYSYSDIADTCGSFH"
FT   regulatory      652786..652845
FT                   /regulatory_class="promoter"
FT   regulatory      complement(652956..653015)
FT                   /regulatory_class="promoter"
FT   CDS_pept        653042..653830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0634"
FT                   /product="Phenazine biosynthesis PhzC/PhzF protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0634"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79775"
FT                   /db_xref="GOA:D3UZD2"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79775.1"
FT                   /translation="MHSYPIYHVDAFTEKSFSGNPAAVVLLDKWLTDEALIAIAAEINL
FT                   SETAFLVGNQLRWFTPKVEVNLCGHGTLATAFVLIEHQSCQDNPITFTSLSGELRVSHQ
FT                   EGIFTLDFAAADCHEEKTLVSIMQDALGQNINEVFASHDRYICVMDSADQVLNTQPDFN
FT                   KIAALPLAGLTITAPGESPVDFVSRYFAPAKGVNEDPVTGSTHCVLTPFWGKRLNKSTL
FT                   HARQLSERGGDILCKTDGNRVYLTGKAKLFSHGQILLEDQ"
FT   CDS_pept        653873..654061
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0635"
FT                   /product="transposase (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ79776.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        654012..654140
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0636"
FT                   /product="transposase (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ79777.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   regulatory      654349..654408
FT                   /regulatory_class="promoter"
FT   CDS_pept        654591..654755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0637"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0637"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79778"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZD5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79778.1"
FT                   /translation="MKKYILSCLLAGVTLLSSMQSYALACNFFPPDSQAWKACTEVCKL
FT                   VFSPSICLK"
FT   regulatory      complement(654742..654796)
FT                   /regulatory_class="terminator"
FT   regulatory      654847..654885
FT                   /regulatory_class="terminator"
FT   operon          complement(654897..656335)
FT                   /operon="XBJ1_operon0126"
FT   CDS_pept        complement(654897..655103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0126"
FT                   /locus_tag="XBJ1_0638"
FT                   /product=