(data stored in ACNUC1104 zone)

EMBL: FN667742

ID   FN667742; SV 1; circular; genomic DNA; STD; PRO; 4432590 BP.
XX
AC   FN667742;
XX
PR   Project:PRJNA13400;
XX
DT   19-FEB-2010 (Rel. 103, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 4)
XX
DE   Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
XX
KW   complete genome.
XX
OS   Xenorhabdus nematophila ATCC 19061
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Morganellaceae; Xenorhabdus.
XX
RN   [1]
RP   1-4432590
RA   Gaudriault S.;
RT   ;
RL   Submitted (05-FEB-2010) to the INSDC.
RL   Gaudriault S., Laboratoire EMIP, UMR 1133, INRA, Universite Montpellier2,
RL   CC 54, Universite Montpellier 2, Place Eugene Bataillon, 34095 Montpellier
RL   CEDEX 05, FRANCE.
XX
RN   [2]
RX   PUBMED; 22125637.
RA   Chaston J.M., Suen G., Tucker S.L., Andersen A.W., Bhasin A., Bode E.,
RA   Bode H.B., Brachmann A.O., Cowles C.E., Cowles K.N., Darby C., de Leon L.,
RA   Drace K., Du Z., Givaudan A., Herbert Tran E.E., Jewell K.A., Knack J.J.,
RA   Krasomil-Osterfeld K.C., Kukor R., Lanois A., Latreille P.,
RA   Leimgruber N.K., Lipke C.M., Liu R., Lu X., Martens E.C., Marri P.R.,
RA   Medigue C., Menard M.L., Miller N.M., Morales-Soto N., Norton S.,
RA   Ogier J.C., Orchard S.S., Park D., Park Y., Qurollo B.A., Sugar D.R.,
RA   Richards G.R., Rouy Z., Slominski B., Slominski K., Snyder H., Tjaden B.C.,
RA   van der Hoeven R., Welch R.D., Wheeler C., Xiang B., Barbazuk B.,
RA   Gaudriault S., Goodner B., Slater S.C., Forst S., Goldman B.S.,
RA   Goodrich-Blair H.;
RT   "The entomopathogenic bacterial endosymbionts xenorhabdus and photorhabdus:
RT   convergent lifestyles from divergent genomes";
RL   PLoS One 6(11):e27909-e27909(2011).
XX
DR   MD5; 50d5bfe9670e4fdcf1f0648813dad561.
DR   BioSample; SAMEA3138407.
DR   EnsemblGenomes-Gn; EBG00001092183.
DR   EnsemblGenomes-Gn; EBG00001092184.
DR   EnsemblGenomes-Gn; EBG00001092185.
DR   EnsemblGenomes-Gn; EBG00001092186.
DR   EnsemblGenomes-Gn; EBG00001092187.
DR   EnsemblGenomes-Gn; EBG00001092188.
DR   EnsemblGenomes-Gn; EBG00001092189.
DR   EnsemblGenomes-Gn; EBG00001092190.
DR   EnsemblGenomes-Gn; EBG00001092191.
DR   EnsemblGenomes-Gn; EBG00001092192.
DR   EnsemblGenomes-Gn; EBG00001092193.
DR   EnsemblGenomes-Gn; EBG00001092194.
DR   EnsemblGenomes-Gn; EBG00001092195.
DR   EnsemblGenomes-Gn; EBG00001092196.
DR   EnsemblGenomes-Gn; EBG00001092197.
DR   EnsemblGenomes-Gn; EBG00001092198.
DR   EnsemblGenomes-Gn; EBG00001092199.
DR   EnsemblGenomes-Gn; EBG00001092200.
DR   EnsemblGenomes-Gn; EBG00001092201.
DR   EnsemblGenomes-Gn; EBG00001092202.
DR   EnsemblGenomes-Gn; EBG00001092203.
DR   EnsemblGenomes-Gn; EBG00001092204.
DR   EnsemblGenomes-Gn; EBG00001092205.
DR   EnsemblGenomes-Gn; EBG00001092206.
DR   EnsemblGenomes-Gn; EBG00001092207.
DR   EnsemblGenomes-Gn; EBG00001092208.
DR   EnsemblGenomes-Gn; EBG00001092209.
DR   EnsemblGenomes-Gn; EBG00001092210.
DR   EnsemblGenomes-Gn; EBG00001092211.
DR   EnsemblGenomes-Gn; EBG00001092212.
DR   EnsemblGenomes-Gn; EBG00001092213.
DR   EnsemblGenomes-Gn; EBG00001092214.
DR   EnsemblGenomes-Gn; EBG00001092215.
DR   EnsemblGenomes-Gn; EBG00001092216.
DR   EnsemblGenomes-Gn; EBG00001092217.
DR   EnsemblGenomes-Gn; EBG00001092218.
DR   EnsemblGenomes-Gn; EBG00001092219.
DR   EnsemblGenomes-Gn; EBG00001092220.
DR   EnsemblGenomes-Gn; EBG00001092221.
DR   EnsemblGenomes-Gn; EBG00001092222.
DR   EnsemblGenomes-Gn; EBG00001092223.
DR   EnsemblGenomes-Gn; EBG00001092224.
DR   EnsemblGenomes-Gn; EBG00001092225.
DR   EnsemblGenomes-Gn; EBG00001092226.
DR   EnsemblGenomes-Gn; EBG00001092227.
DR   EnsemblGenomes-Gn; EBG00001092228.
DR   EnsemblGenomes-Gn; EBG00001092229.
DR   EnsemblGenomes-Gn; EBG00001092230.
DR   EnsemblGenomes-Gn; EBG00001092231.
DR   EnsemblGenomes-Gn; EBG00001092232.
DR   EnsemblGenomes-Gn; EBG00001092233.
DR   EnsemblGenomes-Gn; EBG00001092234.
DR   EnsemblGenomes-Gn; EBG00001092235.
DR   EnsemblGenomes-Gn; EBG00001092236.
DR   EnsemblGenomes-Gn; EBG00001092237.
DR   EnsemblGenomes-Gn; EBG00001092238.
DR   EnsemblGenomes-Gn; EBG00001092239.
DR   EnsemblGenomes-Gn; EBG00001092240.
DR   EnsemblGenomes-Gn; EBG00001092241.
DR   EnsemblGenomes-Gn; EBG00001092242.
DR   EnsemblGenomes-Gn; EBG00001092243.
DR   EnsemblGenomes-Gn; EBG00001092244.
DR   EnsemblGenomes-Gn; EBG00001092245.
DR   EnsemblGenomes-Gn; EBG00001092246.
DR   EnsemblGenomes-Gn; EBG00001092247.
DR   EnsemblGenomes-Gn; EBG00001092248.
DR   EnsemblGenomes-Gn; EBG00001092249.
DR   EnsemblGenomes-Gn; EBG00001092250.
DR   EnsemblGenomes-Gn; EBG00001092251.
DR   EnsemblGenomes-Gn; EBG00001092252.
DR   EnsemblGenomes-Gn; EBG00001092253.
DR   EnsemblGenomes-Gn; EBG00001092254.
DR   EnsemblGenomes-Gn; EBG00001092255.
DR   EnsemblGenomes-Gn; EBG00001092256.
DR   EnsemblGenomes-Gn; EBG00001092257.
DR   EnsemblGenomes-Gn; EBG00001092258.
DR   EnsemblGenomes-Gn; EBG00001092259.
DR   EnsemblGenomes-Gn; EBG00001092260.
DR   EnsemblGenomes-Gn; EBG00001092261.
DR   EnsemblGenomes-Gn; EBG00001092262.
DR   EnsemblGenomes-Gn; EBG00001092263.
DR   EnsemblGenomes-Gn; EBG00001092264.
DR   EnsemblGenomes-Gn; EBG00001092265.
DR   EnsemblGenomes-Gn; EBG00001092266.
DR   EnsemblGenomes-Gn; EBG00001092267.
DR   EnsemblGenomes-Gn; EBG00001092268.
DR   EnsemblGenomes-Gn; EBG00001092269.
DR   EnsemblGenomes-Gn; EBG00001092270.
DR   EnsemblGenomes-Gn; EBG00001092271.
DR   EnsemblGenomes-Gn; EBG00001092272.
DR   EnsemblGenomes-Gn; EBG00001092273.
DR   EnsemblGenomes-Gn; EBG00001092274.
DR   EnsemblGenomes-Gn; EBG00001092275.
DR   EnsemblGenomes-Gn; EBG00001092276.
DR   EnsemblGenomes-Gn; EBG00001092277.
DR   EnsemblGenomes-Gn; EBG00001092278.
DR   EnsemblGenomes-Gn; EBG00001092279.
DR   EnsemblGenomes-Gn; EBG00001092280.
DR   EnsemblGenomes-Gn; EBG00001092281.
DR   EnsemblGenomes-Gn; EBG00001092282.
DR   EnsemblGenomes-Gn; EBG00001092283.
DR   EnsemblGenomes-Gn; EBG00001092284.
DR   EnsemblGenomes-Gn; EBG00001092285.
DR   EnsemblGenomes-Gn; EBG00001092286.
DR   EnsemblGenomes-Gn; EBG00001092287.
DR   EnsemblGenomes-Gn; EBG00001092288.
DR   EnsemblGenomes-Gn; EBG00001092289.
DR   EnsemblGenomes-Gn; EBG00001092290.
DR   EnsemblGenomes-Gn; EBG00001092291.
DR   EnsemblGenomes-Gn; EBG00001092292.
DR   EnsemblGenomes-Gn; EBG00001092293.
DR   EnsemblGenomes-Gn; EBG00001092294.
DR   EnsemblGenomes-Gn; EBG00001092295.
DR   EnsemblGenomes-Gn; EBG00001092296.
DR   EnsemblGenomes-Gn; EBG00001092297.
DR   EnsemblGenomes-Gn; EBG00001092298.
DR   EnsemblGenomes-Gn; EBG00001092299.
DR   EnsemblGenomes-Gn; EBG00001092300.
DR   EnsemblGenomes-Gn; EBG00001092301.
DR   EnsemblGenomes-Gn; EBG00001092302.
DR   EnsemblGenomes-Gn; EBG00001092303.
DR   EnsemblGenomes-Gn; EBG00001092304.
DR   EnsemblGenomes-Gn; EBG00001092305.
DR   EnsemblGenomes-Gn; EBG00001092306.
DR   EnsemblGenomes-Gn; EBG00001092307.
DR   EnsemblGenomes-Gn; EBG00001092308.
DR   EnsemblGenomes-Gn; EBG00001092309.
DR   EnsemblGenomes-Gn; EBG00001092310.
DR   EnsemblGenomes-Gn; EBG00001092311.
DR   EnsemblGenomes-Gn; EBG00001092312.
DR   EnsemblGenomes-Gn; EBG00001092313.
DR   EnsemblGenomes-Gn; EBG00001092314.
DR   EnsemblGenomes-Gn; EBG00001092315.
DR   EnsemblGenomes-Gn; EBG00001092316.
DR   EnsemblGenomes-Gn; EBG00001092317.
DR   EnsemblGenomes-Gn; EBG00001092318.
DR   EnsemblGenomes-Gn; EBG00001092319.
DR   EnsemblGenomes-Gn; EBG00001092320.
DR   EnsemblGenomes-Gn; EBG00001092321.
DR   EnsemblGenomes-Gn; EBG00001092322.
DR   EnsemblGenomes-Gn; EBG00001092323.
DR   EnsemblGenomes-Gn; EBG00001092324.
DR   EnsemblGenomes-Gn; EBG00001092325.
DR   EnsemblGenomes-Gn; EBG00001092326.
DR   EnsemblGenomes-Gn; EBG00001092327.
DR   EnsemblGenomes-Gn; EBG00001092328.
DR   EnsemblGenomes-Gn; EBG00001092329.
DR   EnsemblGenomes-Gn; EBG00001092330.
DR   EnsemblGenomes-Gn; EBG00001092331.
DR   EnsemblGenomes-Gn; EBG00001092332.
DR   EnsemblGenomes-Gn; EBG00001092333.
DR   EnsemblGenomes-Gn; EBG00001092334.
DR   EnsemblGenomes-Gn; EBG00001092335.
DR   EnsemblGenomes-Gn; EBG00001092336.
DR   EnsemblGenomes-Gn; EBG00001092337.
DR   EnsemblGenomes-Gn; EBG00001092338.
DR   EnsemblGenomes-Gn; EBG00001092339.
DR   EnsemblGenomes-Gn; EBG00001092340.
DR   EnsemblGenomes-Gn; EBG00001092341.
DR   EnsemblGenomes-Gn; EBG00001092342.
DR   EnsemblGenomes-Gn; EBG00001092343.
DR   EnsemblGenomes-Gn; EBG00001092344.
DR   EnsemblGenomes-Gn; EBG00001092345.
DR   EnsemblGenomes-Gn; XNC1_0040.
DR   EnsemblGenomes-Gn; XNC1_0041.
DR   EnsemblGenomes-Gn; XNC1_0097.
DR   EnsemblGenomes-Gn; XNC1_0098.
DR   EnsemblGenomes-Gn; XNC1_0126.
DR   EnsemblGenomes-Gn; XNC1_0127.
DR   EnsemblGenomes-Gn; XNC1_0128.
DR   EnsemblGenomes-Gn; XNC1_0197.
DR   EnsemblGenomes-Gn; XNC1_0198.
DR   EnsemblGenomes-Gn; XNC1_0199.
DR   EnsemblGenomes-Gn; XNC1_0204.
DR   EnsemblGenomes-Gn; XNC1_0205.
DR   EnsemblGenomes-Gn; XNC1_0253.
DR   EnsemblGenomes-Gn; XNC1_0254.
DR   EnsemblGenomes-Gn; XNC1_0274.
DR   EnsemblGenomes-Gn; XNC1_0275.
DR   EnsemblGenomes-Gn; XNC1_0290.
DR   EnsemblGenomes-Gn; XNC1_0291.
DR   EnsemblGenomes-Gn; XNC1_0292.
DR   EnsemblGenomes-Gn; XNC1_0294.
DR   EnsemblGenomes-Gn; XNC1_0301.
DR   EnsemblGenomes-Gn; XNC1_0302.
DR   EnsemblGenomes-Gn; XNC1_0303.
DR   EnsemblGenomes-Gn; XNC1_0304.
DR   EnsemblGenomes-Gn; XNC1_0305.
DR   EnsemblGenomes-Gn; XNC1_0311.
DR   EnsemblGenomes-Gn; XNC1_0312.
DR   EnsemblGenomes-Gn; XNC1_0421.
DR   EnsemblGenomes-Gn; XNC1_0422.
DR   EnsemblGenomes-Gn; XNC1_0423.
DR   EnsemblGenomes-Gn; XNC1_0538.
DR   EnsemblGenomes-Gn; XNC1_0539.
DR   EnsemblGenomes-Gn; XNC1_0640.
DR   EnsemblGenomes-Gn; XNC1_0641.
DR   EnsemblGenomes-Gn; XNC1_0649.
DR   EnsemblGenomes-Gn; XNC1_0650.
DR   EnsemblGenomes-Gn; XNC1_0719.
DR   EnsemblGenomes-Gn; XNC1_0720.
DR   EnsemblGenomes-Gn; XNC1_0725.
DR   EnsemblGenomes-Gn; XNC1_0726.
DR   EnsemblGenomes-Gn; XNC1_0757.
DR   EnsemblGenomes-Gn; XNC1_0758.
DR   EnsemblGenomes-Gn; XNC1_0837.
DR   EnsemblGenomes-Gn; XNC1_0838.
DR   EnsemblGenomes-Gn; XNC1_0850.
DR   EnsemblGenomes-Gn; XNC1_0851.
DR   EnsemblGenomes-Gn; XNC1_0980.
DR   EnsemblGenomes-Gn; XNC1_0981.
DR   EnsemblGenomes-Gn; XNC1_1019.
DR   EnsemblGenomes-Gn; XNC1_1020.
DR   EnsemblGenomes-Gn; XNC1_1023.
DR   EnsemblGenomes-Gn; XNC1_1033.
DR   EnsemblGenomes-Gn; XNC1_1034.
DR   EnsemblGenomes-Gn; XNC1_1062.
DR   EnsemblGenomes-Gn; XNC1_1063.
DR   EnsemblGenomes-Gn; XNC1_1121.
DR   EnsemblGenomes-Gn; XNC1_1122.
DR   EnsemblGenomes-Gn; XNC1_1123.
DR   EnsemblGenomes-Gn; XNC1_1124.
DR   EnsemblGenomes-Gn; XNC1_1363.
DR   EnsemblGenomes-Gn; XNC1_1364.
DR   EnsemblGenomes-Gn; XNC1_1369.
DR   EnsemblGenomes-Gn; XNC1_1370.
DR   EnsemblGenomes-Gn; XNC1_1371.
DR   EnsemblGenomes-Gn; XNC1_1465.
DR   EnsemblGenomes-Gn; XNC1_1466.
DR   EnsemblGenomes-Gn; XNC1_1638.
DR   EnsemblGenomes-Gn; XNC1_1639.
DR   EnsemblGenomes-Gn; XNC1_1640.
DR   EnsemblGenomes-Gn; XNC1_1652.
DR   EnsemblGenomes-Gn; XNC1_1653.
DR   EnsemblGenomes-Gn; XNC1_1660.
DR   EnsemblGenomes-Gn; XNC1_1661.
DR   EnsemblGenomes-Gn; XNC1_1662.
DR   EnsemblGenomes-Gn; XNC1_1663.
DR   EnsemblGenomes-Gn; XNC1_1665.
DR   EnsemblGenomes-Gn; XNC1_1670.
DR   EnsemblGenomes-Gn; XNC1_1732.
DR   EnsemblGenomes-Gn; XNC1_1786.
DR   EnsemblGenomes-Gn; XNC1_1787.
DR   EnsemblGenomes-Gn; XNC1_1891.
DR   EnsemblGenomes-Gn; XNC1_1892.
DR   EnsemblGenomes-Gn; XNC1_2010.
DR   EnsemblGenomes-Gn; XNC1_2011.
DR   EnsemblGenomes-Gn; XNC1_2212.
DR   EnsemblGenomes-Gn; XNC1_2213.
DR   EnsemblGenomes-Gn; XNC1_2214.
DR   EnsemblGenomes-Gn; XNC1_2296.
DR   EnsemblGenomes-Gn; XNC1_2297.
DR   EnsemblGenomes-Gn; XNC1_2351.
DR   EnsemblGenomes-Gn; XNC1_2353.
DR   EnsemblGenomes-Gn; XNC1_2361.
DR   EnsemblGenomes-Gn; XNC1_2362.
DR   EnsemblGenomes-Gn; XNC1_2367.
DR   EnsemblGenomes-Gn; XNC1_2368.
DR   EnsemblGenomes-Gn; XNC1_2383.
DR   EnsemblGenomes-Gn; XNC1_2384.
DR   EnsemblGenomes-Gn; XNC1_2421.
DR   EnsemblGenomes-Gn; XNC1_2422.
DR   EnsemblGenomes-Gn; XNC1_2447.
DR   EnsemblGenomes-Gn; XNC1_2448.
DR   EnsemblGenomes-Gn; XNC1_2536.
DR   EnsemblGenomes-Gn; XNC1_2538.
DR   EnsemblGenomes-Gn; XNC1_2541.
DR   EnsemblGenomes-Gn; XNC1_2542.
DR   EnsemblGenomes-Gn; XNC1_2543.
DR   EnsemblGenomes-Gn; XNC1_2552.
DR   EnsemblGenomes-Gn; XNC1_2553.
DR   EnsemblGenomes-Gn; XNC1_2555.
DR   EnsemblGenomes-Gn; XNC1_2556.
DR   EnsemblGenomes-Gn; XNC1_2572.
DR   EnsemblGenomes-Gn; XNC1_2573.
DR   EnsemblGenomes-Gn; XNC1_2577.
DR   EnsemblGenomes-Gn; XNC1_2578.
DR   EnsemblGenomes-Gn; XNC1_2579.
DR   EnsemblGenomes-Gn; XNC1_2580.
DR   EnsemblGenomes-Gn; XNC1_2639.
DR   EnsemblGenomes-Gn; XNC1_2640.
DR   EnsemblGenomes-Gn; XNC1_2772.
DR   EnsemblGenomes-Gn; XNC1_2773.
DR   EnsemblGenomes-Gn; XNC1_2774.
DR   EnsemblGenomes-Gn; XNC1_2775.
DR   EnsemblGenomes-Gn; XNC1_2776.
DR   EnsemblGenomes-Gn; XNC1_2777.
DR   EnsemblGenomes-Gn; XNC1_2778.
DR   EnsemblGenomes-Gn; XNC1_2786.
DR   EnsemblGenomes-Gn; XNC1_2787.
DR   EnsemblGenomes-Gn; XNC1_2788.
DR   EnsemblGenomes-Gn; XNC1_2791.
DR   EnsemblGenomes-Gn; XNC1_2797.
DR   EnsemblGenomes-Gn; XNC1_2798.
DR   EnsemblGenomes-Gn; XNC1_2799.
DR   EnsemblGenomes-Gn; XNC1_2890.
DR   EnsemblGenomes-Gn; XNC1_2891.
DR   EnsemblGenomes-Gn; XNC1_2892.
DR   EnsemblGenomes-Gn; XNC1_2907.
DR   EnsemblGenomes-Gn; XNC1_2908.
DR   EnsemblGenomes-Gn; XNC1_2948.
DR   EnsemblGenomes-Gn; XNC1_2949.
DR   EnsemblGenomes-Gn; XNC1_2958.
DR   EnsemblGenomes-Gn; XNC1_2959.
DR   EnsemblGenomes-Gn; XNC1_3020.
DR   EnsemblGenomes-Gn; XNC1_3021.
DR   EnsemblGenomes-Gn; XNC1_3022.
DR   EnsemblGenomes-Gn; XNC1_3023.
DR   EnsemblGenomes-Gn; XNC1_3024.
DR   EnsemblGenomes-Gn; XNC1_3356.
DR   EnsemblGenomes-Gn; XNC1_3357.
DR   EnsemblGenomes-Gn; XNC1_3379.
DR   EnsemblGenomes-Gn; XNC1_3380.
DR   EnsemblGenomes-Gn; XNC1_3466.
DR   EnsemblGenomes-Gn; XNC1_3467.
DR   EnsemblGenomes-Gn; XNC1_3503.
DR   EnsemblGenomes-Gn; XNC1_3504.
DR   EnsemblGenomes-Gn; XNC1_3514.
DR   EnsemblGenomes-Gn; XNC1_3516.
DR   EnsemblGenomes-Gn; XNC1_3519.
DR   EnsemblGenomes-Gn; XNC1_3520.
DR   EnsemblGenomes-Gn; XNC1_3605.
DR   EnsemblGenomes-Gn; XNC1_3606.
DR   EnsemblGenomes-Gn; XNC1_3607.
DR   EnsemblGenomes-Gn; XNC1_3634.
DR   EnsemblGenomes-Gn; XNC1_3635.
DR   EnsemblGenomes-Gn; XNC1_3654.
DR   EnsemblGenomes-Gn; XNC1_3655.
DR   EnsemblGenomes-Gn; XNC1_3685.
DR   EnsemblGenomes-Gn; XNC1_3688.
DR   EnsemblGenomes-Gn; XNC1_3752.
DR   EnsemblGenomes-Gn; XNC1_3753.
DR   EnsemblGenomes-Gn; XNC1_3768.
DR   EnsemblGenomes-Gn; XNC1_3791.
DR   EnsemblGenomes-Gn; XNC1_3792.
DR   EnsemblGenomes-Gn; XNC1_3821.
DR   EnsemblGenomes-Gn; XNC1_3822.
DR   EnsemblGenomes-Gn; XNC1_3844.
DR   EnsemblGenomes-Gn; XNC1_3845.
DR   EnsemblGenomes-Gn; XNC1_4056.
DR   EnsemblGenomes-Gn; XNC1_4057.
DR   EnsemblGenomes-Gn; XNC1_4119.
DR   EnsemblGenomes-Gn; XNC1_4120.
DR   EnsemblGenomes-Gn; XNC1_4121.
DR   EnsemblGenomes-Gn; XNC1_4122.
DR   EnsemblGenomes-Gn; XNC1_4124.
DR   EnsemblGenomes-Gn; XNC1_4125.
DR   EnsemblGenomes-Gn; XNC1_4127.
DR   EnsemblGenomes-Gn; XNC1_4128.
DR   EnsemblGenomes-Gn; XNC1_4131.
DR   EnsemblGenomes-Gn; XNC1_4132.
DR   EnsemblGenomes-Gn; XNC1_4246.
DR   EnsemblGenomes-Gn; XNC1_4247.
DR   EnsemblGenomes-Gn; XNC1_4305.
DR   EnsemblGenomes-Gn; XNC1_4306.
DR   EnsemblGenomes-Gn; XNC1_4308.
DR   EnsemblGenomes-Gn; XNC1_4309.
DR   EnsemblGenomes-Gn; XNC1_4396.
DR   EnsemblGenomes-Gn; XNC1_4397.
DR   EnsemblGenomes-Gn; XNC1_4399.
DR   EnsemblGenomes-Gn; XNC1_4400.
DR   EnsemblGenomes-Gn; XNC1_4403.
DR   EnsemblGenomes-Gn; XNC1_4404.
DR   EnsemblGenomes-Gn; XNC1_4486.
DR   EnsemblGenomes-Gn; XNC1_4487.
DR   EnsemblGenomes-Gn; XNC1_4565.
DR   EnsemblGenomes-Gn; XNC1_4567.
DR   EnsemblGenomes-Gn; XNC1_4637.
DR   EnsemblGenomes-Gn; XNC1_4638.
DR   EnsemblGenomes-Gn; XNC1_rRNA0001.
DR   EnsemblGenomes-Gn; XNC1_rRNA0002.
DR   EnsemblGenomes-Gn; XNC1_rRNA0003.
DR   EnsemblGenomes-Gn; XNC1_rRNA0004.
DR   EnsemblGenomes-Gn; XNC1_rRNA0005.
DR   EnsemblGenomes-Gn; XNC1_rRNA0006.
DR   EnsemblGenomes-Gn; XNC1_rRNA0007.
DR   EnsemblGenomes-Gn; XNC1_rRNA0008.
DR   EnsemblGenomes-Gn; XNC1_rRNA0009.
DR   EnsemblGenomes-Gn; XNC1_rRNA0010.
DR   EnsemblGenomes-Gn; XNC1_rRNA0011.
DR   EnsemblGenomes-Gn; XNC1_rRNA0012.
DR   EnsemblGenomes-Gn; XNC1_rRNA0013.
DR   EnsemblGenomes-Gn; XNC1_rRNA0014.
DR   EnsemblGenomes-Gn; XNC1_rRNA0015.
DR   EnsemblGenomes-Gn; XNC1_rRNA0016.
DR   EnsemblGenomes-Gn; XNC1_rRNA0017.
DR   EnsemblGenomes-Gn; XNC1_rRNA0018.
DR   EnsemblGenomes-Gn; XNC1_rRNA0019.
DR   EnsemblGenomes-Gn; XNC1_rRNA0020.
DR   EnsemblGenomes-Gn; XNC1_rRNA0021.
DR   EnsemblGenomes-Gn; XNC1_rRNA0022.
DR   EnsemblGenomes-Gn; XNC1_rRNA0023.
DR   EnsemblGenomes-Gn; XNC1_rRNA0024.
DR   EnsemblGenomes-Gn; XNC1_rRNA0025.
DR   EnsemblGenomes-Gn; XNC1_rRNA0026.
DR   EnsemblGenomes-Gn; XNC1_rRNA0027.
DR   EnsemblGenomes-Gn; XNC1_rRNA0028.
DR   EnsemblGenomes-Gn; XNC1_rRNA0029.
DR   EnsemblGenomes-Gn; XNC1_tRNA0001.
DR   EnsemblGenomes-Gn; XNC1_tRNA0002.
DR   EnsemblGenomes-Gn; XNC1_tRNA0003.
DR   EnsemblGenomes-Gn; XNC1_tRNA0004.
DR   EnsemblGenomes-Gn; XNC1_tRNA0005.
DR   EnsemblGenomes-Gn; XNC1_tRNA0006.
DR   EnsemblGenomes-Gn; XNC1_tRNA0007.
DR   EnsemblGenomes-Gn; XNC1_tRNA0008.
DR   EnsemblGenomes-Gn; XNC1_tRNA0009.
DR   EnsemblGenomes-Gn; XNC1_tRNA0010.
DR   EnsemblGenomes-Gn; XNC1_tRNA0011.
DR   EnsemblGenomes-Gn; XNC1_tRNA0012.
DR   EnsemblGenomes-Gn; XNC1_tRNA0013.
DR   EnsemblGenomes-Gn; XNC1_tRNA0014.
DR   EnsemblGenomes-Gn; XNC1_tRNA0015.
DR   EnsemblGenomes-Gn; XNC1_tRNA0016.
DR   EnsemblGenomes-Gn; XNC1_tRNA0017.
DR   EnsemblGenomes-Gn; XNC1_tRNA0018.
DR   EnsemblGenomes-Gn; XNC1_tRNA0019.
DR   EnsemblGenomes-Gn; XNC1_tRNA0020.
DR   EnsemblGenomes-Gn; XNC1_tRNA0021.
DR   EnsemblGenomes-Gn; XNC1_tRNA0022.
DR   EnsemblGenomes-Gn; XNC1_tRNA0023.
DR   EnsemblGenomes-Gn; XNC1_tRNA0024.
DR   EnsemblGenomes-Gn; XNC1_tRNA0025.
DR   EnsemblGenomes-Gn; XNC1_tRNA0026.
DR   EnsemblGenomes-Gn; XNC1_tRNA0027.
DR   EnsemblGenomes-Gn; XNC1_tRNA0028.
DR   EnsemblGenomes-Gn; XNC1_tRNA0029.
DR   EnsemblGenomes-Gn; XNC1_tRNA0030.
DR   EnsemblGenomes-Gn; XNC1_tRNA0031.
DR   EnsemblGenomes-Gn; XNC1_tRNA0032.
DR   EnsemblGenomes-Gn; XNC1_tRNA0033.
DR   EnsemblGenomes-Gn; XNC1_tRNA0034.
DR   EnsemblGenomes-Gn; XNC1_tRNA0035.
DR   EnsemblGenomes-Gn; XNC1_tRNA0036.
DR   EnsemblGenomes-Gn; XNC1_tRNA0037.
DR   EnsemblGenomes-Gn; XNC1_tRNA0038.
DR   EnsemblGenomes-Gn; XNC1_tRNA0039.
DR   EnsemblGenomes-Gn; XNC1_tRNA0040.
DR   EnsemblGenomes-Gn; XNC1_tRNA0041.
DR   EnsemblGenomes-Gn; XNC1_tRNA0042.
DR   EnsemblGenomes-Gn; XNC1_tRNA0043.
DR   EnsemblGenomes-Gn; XNC1_tRNA0044.
DR   EnsemblGenomes-Gn; XNC1_tRNA0045.
DR   EnsemblGenomes-Gn; XNC1_tRNA0046.
DR   EnsemblGenomes-Gn; XNC1_tRNA0047.
DR   EnsemblGenomes-Gn; XNC1_tRNA0048.
DR   EnsemblGenomes-Gn; XNC1_tRNA0049.
DR   EnsemblGenomes-Gn; XNC1_tRNA0050.
DR   EnsemblGenomes-Gn; XNC1_tRNA0051.
DR   EnsemblGenomes-Gn; XNC1_tRNA0052.
DR   EnsemblGenomes-Gn; XNC1_tRNA0053.
DR   EnsemblGenomes-Gn; XNC1_tRNA0054.
DR   EnsemblGenomes-Gn; XNC1_tRNA0055.
DR   EnsemblGenomes-Gn; XNC1_tRNA0056.
DR   EnsemblGenomes-Gn; XNC1_tRNA0057.
DR   EnsemblGenomes-Gn; XNC1_tRNA0058.
DR   EnsemblGenomes-Gn; XNC1_tRNA0059.
DR   EnsemblGenomes-Gn; XNC1_tRNA0060.
DR   EnsemblGenomes-Gn; XNC1_tRNA0061.
DR   EnsemblGenomes-Gn; XNC1_tRNA0062.
DR   EnsemblGenomes-Gn; XNC1_tRNA0063.
DR   EnsemblGenomes-Gn; XNC1_tRNA0064.
DR   EnsemblGenomes-Gn; XNC1_tRNA0065.
DR   EnsemblGenomes-Gn; XNC1_tRNA0066.
DR   EnsemblGenomes-Gn; XNC1_tRNA0067.
DR   EnsemblGenomes-Gn; XNC1_tRNA0068.
DR   EnsemblGenomes-Gn; XNC1_tRNA0069.
DR   EnsemblGenomes-Gn; XNC1_tRNA0070.
DR   EnsemblGenomes-Gn; XNC1_tRNA0071.
DR   EnsemblGenomes-Gn; XNC1_tRNA0072.
DR   EnsemblGenomes-Gn; XNC1_tRNA0073.
DR   EnsemblGenomes-Gn; XNC1_tRNA0074.
DR   EnsemblGenomes-Gn; XNC1_tRNA0075.
DR   EnsemblGenomes-Gn; XNC1_tRNA0076.
DR   EnsemblGenomes-Gn; XNC1_tRNA0077.
DR   EnsemblGenomes-Gn; XNC1_tRNA0078.
DR   EnsemblGenomes-Gn; XNC1_tRNA0079.
DR   EnsemblGenomes-Tr; EBT00001546375.
DR   EnsemblGenomes-Tr; EBT00001546376.
DR   EnsemblGenomes-Tr; EBT00001546379.
DR   EnsemblGenomes-Tr; EBT00001546381.
DR   EnsemblGenomes-Tr; EBT00001546384.
DR   EnsemblGenomes-Tr; EBT00001546387.
DR   EnsemblGenomes-Tr; EBT00001546390.
DR   EnsemblGenomes-Tr; EBT00001546392.
DR   EnsemblGenomes-Tr; EBT00001546394.
DR   EnsemblGenomes-Tr; EBT00001546397.
DR   EnsemblGenomes-Tr; EBT00001546399.
DR   EnsemblGenomes-Tr; EBT00001546401.
DR   EnsemblGenomes-Tr; EBT00001546404.
DR   EnsemblGenomes-Tr; EBT00001546406.
DR   EnsemblGenomes-Tr; EBT00001546409.
DR   EnsemblGenomes-Tr; EBT00001546411.
DR   EnsemblGenomes-Tr; EBT00001546413.
DR   EnsemblGenomes-Tr; EBT00001546415.
DR   EnsemblGenomes-Tr; EBT00001546417.
DR   EnsemblGenomes-Tr; EBT00001546419.
DR   EnsemblGenomes-Tr; EBT00001546421.
DR   EnsemblGenomes-Tr; EBT00001546424.
DR   EnsemblGenomes-Tr; EBT00001546425.
DR   EnsemblGenomes-Tr; EBT00001546427.
DR   EnsemblGenomes-Tr; EBT00001546430.
DR   EnsemblGenomes-Tr; EBT00001546433.
DR   EnsemblGenomes-Tr; EBT00001546435.
DR   EnsemblGenomes-Tr; EBT00001546438.
DR   EnsemblGenomes-Tr; EBT00001546440.
DR   EnsemblGenomes-Tr; EBT00001546442.
DR   EnsemblGenomes-Tr; EBT00001546445.
DR   EnsemblGenomes-Tr; EBT00001546447.
DR   EnsemblGenomes-Tr; EBT00001546449.
DR   EnsemblGenomes-Tr; EBT00001546452.
DR   EnsemblGenomes-Tr; EBT00001546454.
DR   EnsemblGenomes-Tr; EBT00001546456.
DR   EnsemblGenomes-Tr; EBT00001546459.
DR   EnsemblGenomes-Tr; EBT00001546461.
DR   EnsemblGenomes-Tr; EBT00001546463.
DR   EnsemblGenomes-Tr; EBT00001546465.
DR   EnsemblGenomes-Tr; EBT00001546468.
DR   EnsemblGenomes-Tr; EBT00001546469.
DR   EnsemblGenomes-Tr; EBT00001546470.
DR   EnsemblGenomes-Tr; EBT00001546471.
DR   EnsemblGenomes-Tr; EBT00001546472.
DR   EnsemblGenomes-Tr; EBT00001546473.
DR   EnsemblGenomes-Tr; EBT00001546474.
DR   EnsemblGenomes-Tr; EBT00001546475.
DR   EnsemblGenomes-Tr; EBT00001546476.
DR   EnsemblGenomes-Tr; EBT00001546477.
DR   EnsemblGenomes-Tr; EBT00001546478.
DR   EnsemblGenomes-Tr; EBT00001546479.
DR   EnsemblGenomes-Tr; EBT00001546480.
DR   EnsemblGenomes-Tr; EBT00001546481.
DR   EnsemblGenomes-Tr; EBT00001546482.
DR   EnsemblGenomes-Tr; EBT00001546483.
DR   EnsemblGenomes-Tr; EBT00001546484.
DR   EnsemblGenomes-Tr; EBT00001546485.
DR   EnsemblGenomes-Tr; EBT00001546486.
DR   EnsemblGenomes-Tr; EBT00001546487.
DR   EnsemblGenomes-Tr; EBT00001546488.
DR   EnsemblGenomes-Tr; EBT00001546489.
DR   EnsemblGenomes-Tr; EBT00001546490.
DR   EnsemblGenomes-Tr; EBT00001546491.
DR   EnsemblGenomes-Tr; EBT00001546492.
DR   EnsemblGenomes-Tr; EBT00001546493.
DR   EnsemblGenomes-Tr; EBT00001546494.
DR   EnsemblGenomes-Tr; EBT00001546495.
DR   EnsemblGenomes-Tr; EBT00001546496.
DR   EnsemblGenomes-Tr; EBT00001546497.
DR   EnsemblGenomes-Tr; EBT00001546498.
DR   EnsemblGenomes-Tr; EBT00001546499.
DR   EnsemblGenomes-Tr; EBT00001546500.
DR   EnsemblGenomes-Tr; EBT00001546501.
DR   EnsemblGenomes-Tr; EBT00001546502.
DR   EnsemblGenomes-Tr; EBT00001546503.
DR   EnsemblGenomes-Tr; EBT00001546504.
DR   EnsemblGenomes-Tr; EBT00001546505.
DR   EnsemblGenomes-Tr; EBT00001546506.
DR   EnsemblGenomes-Tr; EBT00001546507.
DR   EnsemblGenomes-Tr; EBT00001546508.
DR   EnsemblGenomes-Tr; EBT00001546509.
DR   EnsemblGenomes-Tr; EBT00001546510.
DR   EnsemblGenomes-Tr; EBT00001546511.
DR   EnsemblGenomes-Tr; EBT00001546512.
DR   EnsemblGenomes-Tr; EBT00001546513.
DR   EnsemblGenomes-Tr; EBT00001546514.
DR   EnsemblGenomes-Tr; EBT00001546515.
DR   EnsemblGenomes-Tr; EBT00001546516.
DR   EnsemblGenomes-Tr; EBT00001546517.
DR   EnsemblGenomes-Tr; EBT00001546518.
DR   EnsemblGenomes-Tr; EBT00001546519.
DR   EnsemblGenomes-Tr; EBT00001546520.
DR   EnsemblGenomes-Tr; EBT00001546521.
DR   EnsemblGenomes-Tr; EBT00001546522.
DR   EnsemblGenomes-Tr; EBT00001546523.
DR   EnsemblGenomes-Tr; EBT00001546524.
DR   EnsemblGenomes-Tr; EBT00001546525.
DR   EnsemblGenomes-Tr; EBT00001546526.
DR   EnsemblGenomes-Tr; EBT00001546527.
DR   EnsemblGenomes-Tr; EBT00001546528.
DR   EnsemblGenomes-Tr; EBT00001546529.
DR   EnsemblGenomes-Tr; EBT00001546530.
DR   EnsemblGenomes-Tr; EBT00001546531.
DR   EnsemblGenomes-Tr; EBT00001546532.
DR   EnsemblGenomes-Tr; EBT00001546533.
DR   EnsemblGenomes-Tr; EBT00001546534.
DR   EnsemblGenomes-Tr; EBT00001546535.
DR   EnsemblGenomes-Tr; EBT00001546536.
DR   EnsemblGenomes-Tr; EBT00001546537.
DR   EnsemblGenomes-Tr; EBT00001546538.
DR   EnsemblGenomes-Tr; EBT00001546539.
DR   EnsemblGenomes-Tr; EBT00001546540.
DR   EnsemblGenomes-Tr; EBT00001546541.
DR   EnsemblGenomes-Tr; EBT00001546542.
DR   EnsemblGenomes-Tr; EBT00001546543.
DR   EnsemblGenomes-Tr; EBT00001546544.
DR   EnsemblGenomes-Tr; EBT00001546545.
DR   EnsemblGenomes-Tr; EBT00001546546.
DR   EnsemblGenomes-Tr; EBT00001546547.
DR   EnsemblGenomes-Tr; EBT00001546548.
DR   EnsemblGenomes-Tr; EBT00001546549.
DR   EnsemblGenomes-Tr; EBT00001546550.
DR   EnsemblGenomes-Tr; EBT00001546551.
DR   EnsemblGenomes-Tr; EBT00001546552.
DR   EnsemblGenomes-Tr; EBT00001546553.
DR   EnsemblGenomes-Tr; EBT00001546554.
DR   EnsemblGenomes-Tr; EBT00001546555.
DR   EnsemblGenomes-Tr; EBT00001546556.
DR   EnsemblGenomes-Tr; EBT00001546557.
DR   EnsemblGenomes-Tr; EBT00001546558.
DR   EnsemblGenomes-Tr; EBT00001546559.
DR   EnsemblGenomes-Tr; EBT00001546560.
DR   EnsemblGenomes-Tr; EBT00001546561.
DR   EnsemblGenomes-Tr; EBT00001546562.
DR   EnsemblGenomes-Tr; EBT00001546563.
DR   EnsemblGenomes-Tr; EBT00001546565.
DR   EnsemblGenomes-Tr; EBT00001546567.
DR   EnsemblGenomes-Tr; EBT00001546568.
DR   EnsemblGenomes-Tr; EBT00001546569.
DR   EnsemblGenomes-Tr; EBT00001546570.
DR   EnsemblGenomes-Tr; EBT00001546571.
DR   EnsemblGenomes-Tr; EBT00001546573.
DR   EnsemblGenomes-Tr; EBT00001546575.
DR   EnsemblGenomes-Tr; EBT00001546576.
DR   EnsemblGenomes-Tr; EBT00001546578.
DR   EnsemblGenomes-Tr; EBT00001546580.
DR   EnsemblGenomes-Tr; EBT00001546582.
DR   EnsemblGenomes-Tr; EBT00001546584.
DR   EnsemblGenomes-Tr; EBT00001546585.
DR   EnsemblGenomes-Tr; EBT00001546586.
DR   EnsemblGenomes-Tr; EBT00001546587.
DR   EnsemblGenomes-Tr; EBT00001546589.
DR   EnsemblGenomes-Tr; EBT00001546590.
DR   EnsemblGenomes-Tr; EBT00001546591.
DR   EnsemblGenomes-Tr; EBT00001546592.
DR   EnsemblGenomes-Tr; EBT00001546593.
DR   EnsemblGenomes-Tr; EBT00001546594.
DR   EnsemblGenomes-Tr; EBT00001546595.
DR   EnsemblGenomes-Tr; EBT00001546597.
DR   EnsemblGenomes-Tr; EBT00001546599.
DR   EnsemblGenomes-Tr; EBT00001546601.
DR   EnsemblGenomes-Tr; EBT00001546602.
DR   EnsemblGenomes-Tr; XNC1_0040.
DR   EnsemblGenomes-Tr; XNC1_0041.
DR   EnsemblGenomes-Tr; XNC1_0097.
DR   EnsemblGenomes-Tr; XNC1_0098.
DR   EnsemblGenomes-Tr; XNC1_0126.
DR   EnsemblGenomes-Tr; XNC1_0127.
DR   EnsemblGenomes-Tr; XNC1_0128.
DR   EnsemblGenomes-Tr; XNC1_0197.
DR   EnsemblGenomes-Tr; XNC1_0198.
DR   EnsemblGenomes-Tr; XNC1_0199.
DR   EnsemblGenomes-Tr; XNC1_0204.
DR   EnsemblGenomes-Tr; XNC1_0205.
DR   EnsemblGenomes-Tr; XNC1_0253.
DR   EnsemblGenomes-Tr; XNC1_0254.
DR   EnsemblGenomes-Tr; XNC1_0274.
DR   EnsemblGenomes-Tr; XNC1_0275.
DR   EnsemblGenomes-Tr; XNC1_0290.
DR   EnsemblGenomes-Tr; XNC1_0291.
DR   EnsemblGenomes-Tr; XNC1_0292.
DR   EnsemblGenomes-Tr; XNC1_0294.
DR   EnsemblGenomes-Tr; XNC1_0301.
DR   EnsemblGenomes-Tr; XNC1_0302.
DR   EnsemblGenomes-Tr; XNC1_0303.
DR   EnsemblGenomes-Tr; XNC1_0304.
DR   EnsemblGenomes-Tr; XNC1_0305.
DR   EnsemblGenomes-Tr; XNC1_0311.
DR   EnsemblGenomes-Tr; XNC1_0312.
DR   EnsemblGenomes-Tr; XNC1_0421.
DR   EnsemblGenomes-Tr; XNC1_0422.
DR   EnsemblGenomes-Tr; XNC1_0423.
DR   EnsemblGenomes-Tr; XNC1_0538.
DR   EnsemblGenomes-Tr; XNC1_0539.
DR   EnsemblGenomes-Tr; XNC1_0640.
DR   EnsemblGenomes-Tr; XNC1_0641.
DR   EnsemblGenomes-Tr; XNC1_0649.
DR   EnsemblGenomes-Tr; XNC1_0650.
DR   EnsemblGenomes-Tr; XNC1_0719.
DR   EnsemblGenomes-Tr; XNC1_0720.
DR   EnsemblGenomes-Tr; XNC1_0725.
DR   EnsemblGenomes-Tr; XNC1_0726.
DR   EnsemblGenomes-Tr; XNC1_0757.
DR   EnsemblGenomes-Tr; XNC1_0758.
DR   EnsemblGenomes-Tr; XNC1_0837.
DR   EnsemblGenomes-Tr; XNC1_0838.
DR   EnsemblGenomes-Tr; XNC1_0850.
DR   EnsemblGenomes-Tr; XNC1_0851.
DR   EnsemblGenomes-Tr; XNC1_0980.
DR   EnsemblGenomes-Tr; XNC1_0981.
DR   EnsemblGenomes-Tr; XNC1_1019.
DR   EnsemblGenomes-Tr; XNC1_1020.
DR   EnsemblGenomes-Tr; XNC1_1023.
DR   EnsemblGenomes-Tr; XNC1_1033.
DR   EnsemblGenomes-Tr; XNC1_1034.
DR   EnsemblGenomes-Tr; XNC1_1062.
DR   EnsemblGenomes-Tr; XNC1_1063.
DR   EnsemblGenomes-Tr; XNC1_1121.
DR   EnsemblGenomes-Tr; XNC1_1122.
DR   EnsemblGenomes-Tr; XNC1_1123.
DR   EnsemblGenomes-Tr; XNC1_1124.
DR   EnsemblGenomes-Tr; XNC1_1363.
DR   EnsemblGenomes-Tr; XNC1_1364.
DR   EnsemblGenomes-Tr; XNC1_1369.
DR   EnsemblGenomes-Tr; XNC1_1370.
DR   EnsemblGenomes-Tr; XNC1_1371.
DR   EnsemblGenomes-Tr; XNC1_1465.
DR   EnsemblGenomes-Tr; XNC1_1466.
DR   EnsemblGenomes-Tr; XNC1_1638.
DR   EnsemblGenomes-Tr; XNC1_1639.
DR   EnsemblGenomes-Tr; XNC1_1640.
DR   EnsemblGenomes-Tr; XNC1_1652.
DR   EnsemblGenomes-Tr; XNC1_1653.
DR   EnsemblGenomes-Tr; XNC1_1660.
DR   EnsemblGenomes-Tr; XNC1_1661.
DR   EnsemblGenomes-Tr; XNC1_1662.
DR   EnsemblGenomes-Tr; XNC1_1663.
DR   EnsemblGenomes-Tr; XNC1_1665.
DR   EnsemblGenomes-Tr; XNC1_1670.
DR   EnsemblGenomes-Tr; XNC1_1732.
DR   EnsemblGenomes-Tr; XNC1_1786.
DR   EnsemblGenomes-Tr; XNC1_1787.
DR   EnsemblGenomes-Tr; XNC1_1891.
DR   EnsemblGenomes-Tr; XNC1_1892.
DR   EnsemblGenomes-Tr; XNC1_2010.
DR   EnsemblGenomes-Tr; XNC1_2011.
DR   EnsemblGenomes-Tr; XNC1_2212.
DR   EnsemblGenomes-Tr; XNC1_2213.
DR   EnsemblGenomes-Tr; XNC1_2214.
DR   EnsemblGenomes-Tr; XNC1_2296.
DR   EnsemblGenomes-Tr; XNC1_2297.
DR   EnsemblGenomes-Tr; XNC1_2351.
DR   EnsemblGenomes-Tr; XNC1_2353.
DR   EnsemblGenomes-Tr; XNC1_2361.
DR   EnsemblGenomes-Tr; XNC1_2362.
DR   EnsemblGenomes-Tr; XNC1_2367.
DR   EnsemblGenomes-Tr; XNC1_2368.
DR   EnsemblGenomes-Tr; XNC1_2383.
DR   EnsemblGenomes-Tr; XNC1_2384.
DR   EnsemblGenomes-Tr; XNC1_2421.
DR   EnsemblGenomes-Tr; XNC1_2422.
DR   EnsemblGenomes-Tr; XNC1_2447.
DR   EnsemblGenomes-Tr; XNC1_2448.
DR   EnsemblGenomes-Tr; XNC1_2536.
DR   EnsemblGenomes-Tr; XNC1_2538.
DR   EnsemblGenomes-Tr; XNC1_2541.
DR   EnsemblGenomes-Tr; XNC1_2542.
DR   EnsemblGenomes-Tr; XNC1_2543.
DR   EnsemblGenomes-Tr; XNC1_2552.
DR   EnsemblGenomes-Tr; XNC1_2553.
DR   EnsemblGenomes-Tr; XNC1_2555.
DR   EnsemblGenomes-Tr; XNC1_2556.
DR   EnsemblGenomes-Tr; XNC1_2572.
DR   EnsemblGenomes-Tr; XNC1_2573.
DR   EnsemblGenomes-Tr; XNC1_2577.
DR   EnsemblGenomes-Tr; XNC1_2578.
DR   EnsemblGenomes-Tr; XNC1_2579.
DR   EnsemblGenomes-Tr; XNC1_2580.
DR   EnsemblGenomes-Tr; XNC1_2639.
DR   EnsemblGenomes-Tr; XNC1_2640.
DR   EnsemblGenomes-Tr; XNC1_2772.
DR   EnsemblGenomes-Tr; XNC1_2773.
DR   EnsemblGenomes-Tr; XNC1_2774.
DR   EnsemblGenomes-Tr; XNC1_2775.
DR   EnsemblGenomes-Tr; XNC1_2776.
DR   EnsemblGenomes-Tr; XNC1_2777.
DR   EnsemblGenomes-Tr; XNC1_2778.
DR   EnsemblGenomes-Tr; XNC1_2786.
DR   EnsemblGenomes-Tr; XNC1_2787.
DR   EnsemblGenomes-Tr; XNC1_2788.
DR   EnsemblGenomes-Tr; XNC1_2791.
DR   EnsemblGenomes-Tr; XNC1_2797.
DR   EnsemblGenomes-Tr; XNC1_2798.
DR   EnsemblGenomes-Tr; XNC1_2799.
DR   EnsemblGenomes-Tr; XNC1_2890.
DR   EnsemblGenomes-Tr; XNC1_2891.
DR   EnsemblGenomes-Tr; XNC1_2892.
DR   EnsemblGenomes-Tr; XNC1_2907.
DR   EnsemblGenomes-Tr; XNC1_2908.
DR   EnsemblGenomes-Tr; XNC1_2948.
DR   EnsemblGenomes-Tr; XNC1_2949.
DR   EnsemblGenomes-Tr; XNC1_2958.
DR   EnsemblGenomes-Tr; XNC1_2959.
DR   EnsemblGenomes-Tr; XNC1_3020.
DR   EnsemblGenomes-Tr; XNC1_3021.
DR   EnsemblGenomes-Tr; XNC1_3022.
DR   EnsemblGenomes-Tr; XNC1_3023.
DR   EnsemblGenomes-Tr; XNC1_3024.
DR   EnsemblGenomes-Tr; XNC1_3356.
DR   EnsemblGenomes-Tr; XNC1_3357.
DR   EnsemblGenomes-Tr; XNC1_3379.
DR   EnsemblGenomes-Tr; XNC1_3380.
DR   EnsemblGenomes-Tr; XNC1_3466.
DR   EnsemblGenomes-Tr; XNC1_3467.
DR   EnsemblGenomes-Tr; XNC1_3503.
DR   EnsemblGenomes-Tr; XNC1_3504.
DR   EnsemblGenomes-Tr; XNC1_3514.
DR   EnsemblGenomes-Tr; XNC1_3516.
DR   EnsemblGenomes-Tr; XNC1_3519.
DR   EnsemblGenomes-Tr; XNC1_3520.
DR   EnsemblGenomes-Tr; XNC1_3605.
DR   EnsemblGenomes-Tr; XNC1_3606.
DR   EnsemblGenomes-Tr; XNC1_3607.
DR   EnsemblGenomes-Tr; XNC1_3634.
DR   EnsemblGenomes-Tr; XNC1_3635.
DR   EnsemblGenomes-Tr; XNC1_3654.
DR   EnsemblGenomes-Tr; XNC1_3655.
DR   EnsemblGenomes-Tr; XNC1_3685.
DR   EnsemblGenomes-Tr; XNC1_3688.
DR   EnsemblGenomes-Tr; XNC1_3752.
DR   EnsemblGenomes-Tr; XNC1_3753.
DR   EnsemblGenomes-Tr; XNC1_3768.
DR   EnsemblGenomes-Tr; XNC1_3791.
DR   EnsemblGenomes-Tr; XNC1_3792.
DR   EnsemblGenomes-Tr; XNC1_3821.
DR   EnsemblGenomes-Tr; XNC1_3822.
DR   EnsemblGenomes-Tr; XNC1_3844.
DR   EnsemblGenomes-Tr; XNC1_3845.
DR   EnsemblGenomes-Tr; XNC1_4056.
DR   EnsemblGenomes-Tr; XNC1_4057.
DR   EnsemblGenomes-Tr; XNC1_4119.
DR   EnsemblGenomes-Tr; XNC1_4120.
DR   EnsemblGenomes-Tr; XNC1_4121.
DR   EnsemblGenomes-Tr; XNC1_4122.
DR   EnsemblGenomes-Tr; XNC1_4124.
DR   EnsemblGenomes-Tr; XNC1_4125.
DR   EnsemblGenomes-Tr; XNC1_4127.
DR   EnsemblGenomes-Tr; XNC1_4128.
DR   EnsemblGenomes-Tr; XNC1_4131.
DR   EnsemblGenomes-Tr; XNC1_4132.
DR   EnsemblGenomes-Tr; XNC1_4246.
DR   EnsemblGenomes-Tr; XNC1_4247.
DR   EnsemblGenomes-Tr; XNC1_4305.
DR   EnsemblGenomes-Tr; XNC1_4306.
DR   EnsemblGenomes-Tr; XNC1_4308.
DR   EnsemblGenomes-Tr; XNC1_4309.
DR   EnsemblGenomes-Tr; XNC1_4396.
DR   EnsemblGenomes-Tr; XNC1_4397.
DR   EnsemblGenomes-Tr; XNC1_4399.
DR   EnsemblGenomes-Tr; XNC1_4400.
DR   EnsemblGenomes-Tr; XNC1_4403.
DR   EnsemblGenomes-Tr; XNC1_4404.
DR   EnsemblGenomes-Tr; XNC1_4486.
DR   EnsemblGenomes-Tr; XNC1_4487.
DR   EnsemblGenomes-Tr; XNC1_4565.
DR   EnsemblGenomes-Tr; XNC1_4567.
DR   EnsemblGenomes-Tr; XNC1_4637.
DR   EnsemblGenomes-Tr; XNC1_4638.
DR   EnsemblGenomes-Tr; XNC1_rRNA0001-1.
DR   EnsemblGenomes-Tr; XNC1_rRNA0002-1.
DR   EnsemblGenomes-Tr; XNC1_rRNA0003-1.
DR   EnsemblGenomes-Tr; XNC1_rRNA0004-1.
DR   EnsemblGenomes-Tr; XNC1_rRNA0005-1.
DR   EnsemblGenomes-Tr; XNC1_rRNA0006-1.
DR   EnsemblGenomes-Tr; XNC1_rRNA0007-1.
DR   EnsemblGenomes-Tr; XNC1_rRNA0008-1.
DR   EnsemblGenomes-Tr; XNC1_rRNA0009-1.
DR   EnsemblGenomes-Tr; XNC1_rRNA0010-1.
DR   EnsemblGenomes-Tr; XNC1_rRNA0011-1.
DR   EnsemblGenomes-Tr; XNC1_rRNA0012-1.
DR   EnsemblGenomes-Tr; XNC1_rRNA0013-1.
DR   EnsemblGenomes-Tr; XNC1_rRNA0014-1.
DR   EnsemblGenomes-Tr; XNC1_rRNA0015-1.
DR   EnsemblGenomes-Tr; XNC1_rRNA0016-1.
DR   EnsemblGenomes-Tr; XNC1_rRNA0017-1.
DR   EnsemblGenomes-Tr; XNC1_rRNA0018-1.
DR   EnsemblGenomes-Tr; XNC1_rRNA0019-1.
DR   EnsemblGenomes-Tr; XNC1_rRNA0020-1.
DR   EnsemblGenomes-Tr; XNC1_rRNA0021-1.
DR   EnsemblGenomes-Tr; XNC1_rRNA0022-1.
DR   EnsemblGenomes-Tr; XNC1_rRNA0023-1.
DR   EnsemblGenomes-Tr; XNC1_rRNA0024-1.
DR   EnsemblGenomes-Tr; XNC1_rRNA0025-1.
DR   EnsemblGenomes-Tr; XNC1_rRNA0026-1.
DR   EnsemblGenomes-Tr; XNC1_rRNA0027-1.
DR   EnsemblGenomes-Tr; XNC1_rRNA0028-1.
DR   EnsemblGenomes-Tr; XNC1_rRNA0029-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0001-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0002-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0003-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0004-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0005-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0006-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0007-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0008-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0009-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0010-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0011-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0012-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0013-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0014-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0015-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0016-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0017-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0018-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0019-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0020-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0021-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0022-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0023-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0024-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0025-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0026-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0027-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0028-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0029-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0030-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0031-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0032-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0033-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0034-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0035-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0036-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0037-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0038-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0039-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0040-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0041-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0042-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0043-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0044-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0045-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0046-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0047-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0048-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0049-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0050-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0051-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0052-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0053-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0054-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0055-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0056-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0057-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0058-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0059-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0060-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0061-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0062-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0063-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0064-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0065-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0066-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0067-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0068-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0069-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0070-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0071-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0072-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0073-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0074-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0075-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0076-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0077-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0078-1.
DR   EnsemblGenomes-Tr; XNC1_tRNA0079-1.
DR   EuropePMC; PMC2953030; 20802071.
DR   EuropePMC; PMC3091717; 20950463.
DR   EuropePMC; PMC3220699; 22125637.
DR   EuropePMC; PMC3318424; 22252871.
DR   EuropePMC; PMC4079199; 24904010.
DR   EuropePMC; PMC6086661; 30010541.
DR   EuropePMC; PMC6251167; 30466389.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00170; msr.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01728; STAXI.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF01999; group-II-D1D4-2.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02003; group-II-D1D4-4.
DR   RFAM; RF02005; group-II-D1D4-6.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; FN667742.
DR   SILVA-SSU; FN667742.
DR   StrainInfo; 27453; 1.
XX
CC   Annotation results relative to BLAST similarities, COG assignations,
CC   enzymatic function prediction (PRIAM software), TMHMM and SignalP
CC   predictions, and synteny conservation (Syntonizer software)
CC   are available in the MaGe annotation system
CC   http://www.genoscope.cns.fr/agc/mage.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4432590
FT                   /organism="Xenorhabdus nematophila ATCC 19061"
FT                   /strain="ATCC 19061"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:406817"
FT   operon          158..6209
FT                   /operon="XNC1_operon0001"
FT   CDS_pept        158..1546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0001"
FT                   /gene="dnaA"
FT                   /locus_tag="XNC1_0001"
FT                   /product="DNA replication initiator protein,
FT                   transcriptional regulator of replication and housekeeping
FT                   genes"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0001"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88094"
FT                   /db_xref="GOA:D3VG04"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG04"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88094.1"
FT                   /translation="MSLSLWQQCLARLQDELPATEFSMWIRPLQAELSDNTLALYAPNR
FT                   FVLDWVREKYINNINLLLNDFCGPEVPLLRFEVGNKPVSPNQSASQKIIADMPVATAPS
FT                   SSSVRPSWDNVKTQPELSYRSNVNPKHTFDNFVEGKSNQLARAAARQVADNPGGAYNPL
FT                   FLYGGTGLGKTHLLHAVGNSIMARKANAKVVYMHSERFVQDMVKALQNNAIEEFKRYYR
FT                   SVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRF
FT                   GWGLTVAIEPPELETRVAILMKKADENQIQLPGEVAFFIAKRLRSNVRELEGALNRVIA
FT                   NANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVA
FT                   RPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIR
FT                   TLSS"
FT   CDS_pept        1551..2651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0001"
FT                   /gene="dnaN"
FT                   /locus_tag="XNC1_0002"
FT                   /product="DNA polymerase III, beta-subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0002"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88095"
FT                   /db_xref="GOA:D3VG05"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG05"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88095.1"
FT                   /translation="MKFIIEREQLLKPLQQVSSPLSGRPTLPILGNLLLQVTEGSLLLT
FT                   GTDLETEMKARVTLTQPHEQGATTIPARKFFDIWRGLPDGAEISVELDGDRILVRSGRS
FT                   RFSLSTLPASDFPNLDDWQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETE
FT                   GEELRTVATDGHRLAVCSMNIGQNLPSHSVIVPRKGVIELMRLLDGGDNPLQLQIGSNN
FT                   IRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKTLEANCDMLKQAFSRAAILSNEKFRGV
FT                   RIYLSENQLRITANNPEQEEAEEIVDVSYQGTEMEIGFNVSYVLDVLNALKCEQVSLLL
FT                   TDATSSVKIENSASQAATYVVMPMRL"
FT   CDS_pept        2685..3776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0001"
FT                   /gene="recF"
FT                   /locus_tag="XNC1_0003"
FT                   /product="gap repair protein with nucleoside triP hydrolase
FT                   domain, part of RecFOR complex that targets RecA to
FT                   ssDNA-dsDNA junction"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0003"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88096"
FT                   /db_xref="GOA:D3VG06"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG06"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88096.1"
FT                   /translation="MILSRLLIRDFRNIANADLPLATGFNFLVGPNGSGKTSILEAIYT
FT                   LGHGRAFRSIQAGRVIRHDCEEFILHGRLDQQFHERSLSVGLSKNRQGGSQVRIDGSDG
FT                   HKIAELAKMLPMQLITPEGFTLLNGGPKYRRAFIDWGCFHNEPRFFMAWGNLKRLLKQR
FT                   NAALRQVTRYNQIQHWDRELAPLATEISQWRAEYIAGISEDIERTCKQFLPEFTLSISF
FT                   QQGWDKESEYAELLARQFERDRSLTYTASGPHKADLRIRADGTPVEDMLSRGQLKLLMC
FT                   ALRLAQGEYFTRQSGQKCLYLLDDFASELDAGRRQLLAERLKSTQAQVFVSAITSGQVT
FT                   DMIDVNSRMFRVEDGKIEVQPQD"
FT   CDS_pept        3795..6209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0001"
FT                   /gene="gyrB"
FT                   /locus_tag="XNC1_0004"
FT                   /product="DNA gyrase, subunit B (type II topoisomerase)"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0004"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88097"
FT                   /db_xref="GOA:D3VG07"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG07"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88097.1"
FT                   /translation="MSNTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVD
FT                   NAIDEALAGHCDKIVVTIHADNSVSVQDDGRGIPTGIHEEEGVSAAEVIMTVLHAGGKF
FT                   DDNSYKVSGGLHGVGVSVVNALSEKLELTIRRDGKVHEQTYHHGVPQSPLNIVGDTEQT
FT                   GTTVRFWPSMDTFKINTEFEYDILAKRLRELSFLNSGVSIRLVDKRTNAEDLFHYKGGI
FT                   KAFVEFLSRNKNPIHPNVFYFSTEKDGIGVEISMQWNDGFQENIYCFTNNIPQRDGGTH
FT                   LVGFRTAMTRTLNSYMDKEGYNKKSKVSATGDDAREGLIAVISVKVPDPKFSSQTKDKL
FT                   VSSEVKTAVETLMNEKLVEYLLENPNDAKTVVGKIIDAARAREAARKAREMTRRKGALD
FT                   LAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARF
FT                   DKMLSSQEVATLITALGCGIGRDEYNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFYRQ
FT                   MPEIIERGYVYIAQPPLYKVKKGKQEQYIKDDDAMEAYQMSIALDGAALYTNPHAPGLK
FT                   GEALENLVTEFNTTQKLIHRMERLYPLALLNSLIYHPKLTEDALNDQTKVEEWVSALTI
FT                   RLNDKEQHGSTYSYHIHENRERQVFEPVLCIRTHGVDTNYSLDFDFIHGGEYRRITKLG
FT                   DLIGNLIDEDAYIERGERRQAISSFEHALEWLSKESRRGLSIQRYKGLGEMNPEQLWET
FT                   TMNPETRRMMRVTVKDAIATDLLFTTLMGDAVEPRRAFIEENALKAANIDI"
FT   regulatory      complement(6213..6269)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(6274..6897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0005"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0005"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88098"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG08"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88098.1"
FT                   /translation="MKLNKSHFFLIPVLLGVSHFSIADKAIEDVITKNGLKDTKVMSLY
FT                   KNGTLSVEANTPNKVTLINKKAAKDNKEANQAMYWYRGMGLNEYKKFDANKYRKVPCVT
FT                   EKNNFCGIAPEFNYSKGYLSNNNPGVVIEFSTIEPKWLYHDFTELHKCQIKAEGGGTYG
FT                   LGPTGTSASCDASYKQKGLGNVFNKWLEKPEKIDVIISYVLLTK"
FT   regulatory      complement(6917..6976)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(7218..7487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0006"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0006"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88099"
FT                   /db_xref="GOA:D3VG09"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG09"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88099.1"
FT                   /translation="MSTLVMSAHNAIKALKESGLNETQAEKIVEIIADLQNTSAVTKED
FT                   LKQAEMNLRTDLTSIKNDMDWLKKLIVTVGIAVVIAAIKYIFVG"
FT   regulatory      complement(7658..7717)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(7662..7721)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(7758..8876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="XNC1_0007"
FT                   /product="aspartate-semialdehyde dehydrogenase,
FT                   NAD(P)-binding"
FT                   /EC_number="1.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0007"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88100"
FT                   /db_xref="GOA:D3VG10"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR011534"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG10"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88100.1"
FT                   /translation="MKSVGFIGWRGMVGSVLMQRMLEERDFDEINPVFFTTSQHGLSAP
FT                   QFAINSAGKSGVLQDAFDIEVLGALDIIISCQGGDYTNEIYPKLKATGWQGYWIDAASA
FT                   LRMNDDAVIILDPVNYQHIQNSLNKGIKTFVGGNCTVSLMLMSLGGLFANDLIEWASVS
FT                   SYQAASGGGARHMRELLVQMGMLHNQVAGEVQDPASAILDIEKSVTDFTRSGALPTDQF
FT                   GVPLAGSLIPWIDKQLENGQSREEWKGQAETNKILNTGNNVIPIDGLCVRIGALRCHSQ
FT                   AFTLKLKKDIPIHEIETLLASHNDWVRVIPNDRELTMRELTPAAVTGTLNTPVGRLRKL
FT                   NMGPEYLSAFTVGDQLLWGAAEPLRRMLRILL"
FT   regulatory      complement(8975..9034)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(9093..9123)
FT                   /regulatory_class="terminator"
FT   operon          complement(9131..9493)
FT                   /operon="XNC1_operon0002"
FT   CDS_pept        complement(9131..9271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0002"
FT                   /locus_tag="XNC1_0008"
FT                   /product="50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0008"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88101"
FT                   /db_xref="GOA:D3VG11"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG11"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88101.1"
FT                   /translation="MQVLSSLKTAKQRHPDCKVVRRRGRLYVICKSNPRFKAVQGKKKK
FT                   R"
FT   CDS_pept        complement(9284..9493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0002"
FT                   /locus_tag="XNC1_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0009"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88102"
FT                   /db_xref="GOA:D3VG12"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG12"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88102.1"
FT                   /translation="MTPVRVAISRLVQRFILRTITLEGNEYPYITIEVSSESHPFYTGR
FT                   QKVLSQEGNTARFQKRFGHFLGKK"
FT   CDS_pept        complement(9396..9569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0010"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88103"
FT                   /db_xref="GOA:D3VG13"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG13"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88103.1"
FT                   /translation="MLYYNNIARGFMKSGIHPYYRTVVFHDTSTGSYFKVGSTIHTENH
FT                   YVGRERVPLYHD"
FT   regulatory      complement(9564..9623)
FT                   /regulatory_class="promoter"
FT   CDS_pept        9947..10060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0011"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88104"
FT                   /db_xref="GOA:D3VG14"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG14"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88104.1"
FT                   /translation="MAHSIRYYLLASLFILFVEGILVWLFGRPPSTNLNSP"
FT   regulatory      complement(10117..10156)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(10181..11629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0012"
FT                   /product="putative monooxygenase, flavin-binding family"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0012"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88105"
FT                   /db_xref="GOA:D3VG15"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG15"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88105.1"
FT                   /translation="MSHHCDILIMGAGVAGIGMACHLKRECPDKQMIILERRQAIGGTW
FT                   DLFRYPGIRSDSDMMTFGYKFRPWSETSVFADGPSIKNYVNETAKEYGIDKKIQFGLKI
FT                   THTDWSNITNQWTITAVEEASGEVRTFTCNYLVAATGYYNYDKAYMPEYPGVEDFKGPV
FT                   IHPQHWPEKLDYKGKRVIVIGSGATAATLVPTMANDTKHITMLQRSPSYYLSPPANDYI
FT                   AAFLNKFLPKRWVYTFSRNRNLFIHRLLYKSSRHVPTLLKSFLLSSARRRVGDKFNMNH
FT                   LMPKYMPWDERLCVIPNGNLLRALKEGKASVVTDQIERFTENGILLQSGQELPADIIVS
FT                   STGLNLLPLGGIEISIDEKKLQGNERMLYKGTLIQDIPNFAYLFGYINSSWTLKIDLSA
FT                   DYICRLLKEMDRRGAKSVTPYAQPDEMLKHENIFGELQAGYVKRGDGGLPRQGRSPNWH
FT                   VSHDYKKDKEVLGQPVDDTALRWK"
FT   CDS_pept        complement(12161..12286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0013"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88106"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG16"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88106.1"
FT                   /translation="MDLGIFAQQSNNAISFVQPLGCTSNHFHGLLFLKRLVLMVC"
FT   regulatory      complement(12235..12278)
FT                   /locus_tag="XNC1_0013"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(12288..12545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0014"
FT                   /product="putative Drug resistance transporter(fragment)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0014"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88107"
FT                   /db_xref="GOA:D3VG17"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG17"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88107.1"
FT                   /translation="MWLIAVGMVLVVSVTANGALRDFGDASGTAVALYYSIESLIVGGL
FT                   GTLMTLVLDGNSAWPLVAYCFGMSAVSLIVFMVLKQKRRK"
FT   regulatory      complement(12703..12762)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(12877..14025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0015"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0015"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88108"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG18"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88108.1"
FT                   /translation="MSEYQYYHFKRLDGVLSAKQKSELRTISSRAEISSNHFTVHYNYS
FT                   DLKAEPAELMAQYFDVGFYYADWGQVICYLKVPPDTIPLAFMSIEDGDSVICEKGKNYL
FT                   LFIFSVEENDYYMDDDDAKDYLDHLVELRSELMEGDYRLLYLPWLKSAFDGDETLDELP
FT                   LINFNFKQLSEAQSAFAELFGIPPEAYNALDKLLKSSQAHTAKVTHLTAEEQINRLSAS
FT                   DKDLLLKSLFEQGQLIANQARSLIDKPLTHNDYKYWLSPSSLNAYWQTANEEIARERLL
FT                   AEEQRREQEWLAEIKRLNVVFSSREVHWENVKKYSEQGHASAYDKAAREMKDLYDAYRV
FT                   NNALAEFIPRYQIFARHIERRKTLVKRLECLNQEIGKYQDSI"
FT   regulatory      complement(14077..14136)
FT                   /regulatory_class="promoter"
FT   operon          complement(14214..24366)
FT                   /operon="XNC1_operon0003"
FT   CDS_pept        complement(14214..15254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0003"
FT                   /locus_tag="XNC1_0016"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0016"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88109"
FT                   /db_xref="GOA:D3VA56"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:D3VA56"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88109.1"
FT                   /translation="MLYTSNPIIKHKAGLLNLAEELSNVSRACKVMGVSRDTFYRYQEL
FT                   VETGGIDALINQSRKTPNLKNRVDAETEHAVINSAIEFPAYGQARTSNELRKAGIFVSA
FT                   SGVRSIWLRHHLENFKKRLAALEKKVADEGIILTDEQVAALERKQHDDEACGEIETAHP
FT                   GYLGSQDTFYVGNLKGVGRLYQQTFVDTYSKVAFAKLYTSKTPITAADLLNDRVLPFFS
FT                   AHRLPMLRILTDRGTEYCGRVEHHDYQLYLAVNDIDHTRTKAMSPQTNGICERFHKTIL
FT                   NEFYQVTFRKKLYGSLDELQKDLDKWMDNYNNHRTHQGKMCCGRTPIETLQDGKSIWAE
FT                   KNLTQI"
FT   CDS_pept        complement(15323..16057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0003"
FT                   /locus_tag="XNC1_0017"
FT                   /product="Zinc metalloprotease"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 12125824; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0017"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88110"
FT                   /db_xref="GOA:D3VG20"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG20"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88110.1"
FT                   /translation="MAQLKIGEIDMQLNRKAIKNLHISVLPPDGIVRISAPMHMSDTAI
FT                   RMAVISRIPWIKKQQQDFARQPRQSEREMVNGECHYLWGRRHRLNIVEHVGKQQVKTSG
FT                   GKIYLYVPYGAPFEKKAQVLSDYYRAALKERIEKLLMHWQPIIGVMPSSWGIKKMKTKW
FT                   GSCNTVSGSIWLNLELAKKPLECLEFILVHELVHLLERKHNERFMTYMDGYLPDWRERK
FT                   RLLSILPLSNDVLVQTRSDTSV"
FT   CDS_pept        complement(16057..19146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0003"
FT                   /gene="hsdR"
FT                   /locus_tag="XNC1_0018"
FT                   /product="Type I site-specific deoxyribonuclease HsdR"
FT                   /EC_number="3.1.21.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 8566812; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0018"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88111"
FT                   /db_xref="GOA:D3VG21"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG21"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88111.1"
FT                   /translation="MSTVGQRERVTQDRIVKFFQTELGYRYLGNLQDRDNKNIDVDILT
FT                   AWLKKQGISGTLIGRVLRQLINTAALGDGNKLYYANKDVYNLLRYGIKEKEDVGEQHQT
FT                   IWLINWHNPEANDFAIAEEVSIKGENKKRPDIVLYVNGIALGIIELKRSSVSVSEGIRQ
FT                   NLDNQKKEFIRDFFSTMQLVMAGNDTQGLRYGTIGTPEKYYLEWKEGIDNPYPYRLDFH
FT                   LSRICSKPRFLQLIHDFIVFDAGVKKACRHNQFFGVEAAKKRIFQREGGIIWHTQGSGK
FT                   SLTMVWLAKWIRENVPNSRVLIVTDRTELDAQIEKVFTGVEENIYRTKSGADLIFNLNR
FT                   PNPWLICSLVHKFGHRSEAEDDAATDEYIKELKKSLPSDFRAKGDLFVFVDECHRTQSG
FT                   KLHDAMKSILPEAVFIGFTGTPLMKKDKKKSIEVFGSFIHTYKFDEAVSDGVILDLRYE
FT                   ARDIDQYLTSQKRIDEWFEANTQGLSRLGKTQLKQKWGTMQKVLSSKSRLEMIVMDIRL
FT                   DMMKRPRLMDGRGNAMLVCSSIHQACTVYDLFSQTDLAGKVAIITSYKPDSASIKGEET
FT                   GEGLTEQLAKYKTYRKMLADYFEQPEDKVANRVEEFETKVKQQFIDEPGQMRLLIVVDK
FT                   LLTGFDAPSATYLYIDKHMSDHNLFQAICRVNRLDGDDKEYGYIIDYKDLFRSLNKAIS
FT                   DYTKEVFDGYDKKDIDGLLKNRLEQARLNLDAALEMVRALCEPVKAPRNTVDYIHYFCC
FT                   ESGADPELLSEKEALRLALYQCVAKLLRAFANIANEMTIAGYSPAQMEKIRAEVAHYEK
FT                   VRDEIKLASKDKVEMKRYEPAMRSLIDMYIRADDSEVLMDFEEIGLLELIIQKGAAAGE
FT                   DLPEGIRKDPEAMAETIENNVRKTIVDENPVNPRYYEHMSVLLDELIALRRQNALNYQE
FT                   YLEKIRDLAKKVVRPNQNTAAYPPDIDTPPKRAFYDNFDQNTDLAICIDKTIRDTKKAD
FT                   WVNDRFKEREIANALRDETAEYKVDIDKIMELAKTQRDYR"
FT   CDS_pept        complement(19192..20550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0003"
FT                   /gene="hsdS"
FT                   /locus_tag="XNC1_0019"
FT                   /product="Type I restriction-modification enzyme subunit S"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 8566812; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0019"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88112"
FT                   /db_xref="GOA:D3VG22"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG22"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88112.1"
FT                   /translation="MDVVTVEQVLEIRDKDITEIADTIIPVGYKKTEVGVIPEDWDAVF
FT                   FGDLFEDKLPRKALKSNDDVIFIGMQDLSENAQLLSQHKVKYGSLKGGLTYFEKGDVLV
FT                   AKITPCFENGKGCHTKNLLTEIGIGSTEFHVLRATKHTNADFIYFWTTKKYFRKTLESE
FT                   MVGSAGHKRVPLQAIQNFLLPCPRNNIEQIAIANTLSDIDVLISELETLLAKKQAIKTA
FT                   TMQQLLTGRTRLPQFALCENGSKKGYKQSELGEIPEDWEIICIKDVGFVDPENLGSTTS
FT                   LDYKFDYISLEQIDAGVLLGTVKCTFNTAPLRARRVLQQGDVLISTVRPNLMSHYFVRE
FT                   DVRDLVCSTGFSVVRCLKDKLRPGYLYQHFFSAVINNQIDMLISGSNYPAINSSDVKNL
FT                   KIQLGSVNEQTAIATILSDMDTEIQALEQKLDKTRQIKQGMMQELLTGKTRLI"
FT   CDS_pept        complement(20538..22997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0003"
FT                   /gene="hsdM"
FT                   /locus_tag="XNC1_0020"
FT                   /product="Type I restriction-modification enzyme subunit M"
FT                   /EC_number="2.1.1.72"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 8566812; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0020"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88113"
FT                   /db_xref="GOA:D3VG23"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR004546"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG23"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88113.1"
FT                   /translation="MAIKKNELYSSLWASCDELRGGMDASQYKDYVLTMLFMKYVSDKY
FT                   KNDRYGIIVIPEGASFDDMVALKGKKEIGDKINKIIRKLADENRLGTMFDVANFNDEEK
FT                   LGKGKEMIDRLSKLVGIFEGLDLSNNYAGGDDLMGDAYEYLMRHFATESGKSKGQFYTP
FT                   AEVSLVLAKIIGINDKTPRDASVYDPTCGSGSLLLKASDEAPRGLSIFGQEMDVTTSSL
FT                   AKMNMILHGHESDVHSIQQGNTIASPVFKDDKGQLKTFDFAVANPPFSNKNWTSGINPR
FT                   EDEFGRFGWGIPPEKNGDYAFLLHILKSLKSTGKGAVILPHGVLFRGNAESLIRENLIK
FT                   QGYIKGIIGLPANLFYGTGIPACIIVLDKQDAISADFDAEGKVTRGRDIFMIDASRGFI
FT                   KDGNKNRLRSQDIYKIVEVFTQQKTLPRFSRVVEFKEIVENDYNLNIPRYIDSSEPEDL
FT                   HDLSAHLQGGIPNRDIDALDKYWNIFPDIRSTLFAPEREGYSRSLVDANQVKNTILSHA
FT                   EFKTFAEQSLKPFATWCQSAALKEIRLKDKPKELIHEISEALLIRYESLPLLSKYDVYQ
FT                   ILMDYWAETMQDDVYVLVQDDWKAGKKVRELVVKQAEKLKETPDFVIKKTKYKAEIIPP
FT                   ALIIQNYFAGQQVKIDQLQIDADNATQALENYIEENSGDDGLLNDALNDKDKVTKASIA
FT                   ARLKLATDNEEKTVLKQAKELFDAEIDAKKALKKYQEALDLSVLKQYSKLTDDEIKTLV
FT                   VDKKWLATLEANIQAEIERVTQQLTNRVRELEERYAEPLPKINESVEEISKKVAEHLKD
FT                   MGLEWTL"
FT   regulatory      complement(23040..23099)
FT                   /operon="XNC1_operon0003"
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(23125..24366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0003"
FT                   /locus_tag="XNC1_0021"
FT                   /product="ATPase, AAA+ superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0021"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88114"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG24"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88114.1"
FT                   /translation="MDNKQYPRLIAPKLKEALTDTPVVCLLGPRQVGKTTLAKELEPGR
FT                   AYITFDDSTLLNAVKSDPLGFVQGLPERVTLDEVQRVPEILPALKAVVDTNRTSGRFIL
FT                   TGSANLLLLPGVQESLAGRVEVTYLQPLSEQEKQYSSVTLLEKLLSNRISPSIKGEQAQ
FT                   LEGIADAIVQGGYPEPNTRTEERARQWHKQYINAIIQRDVKDIAAIRDEEELLRLIKIL
FT                   ALRTGNLLNISGLSKDLGLQRDTVDKYITILERLFLVRRLPAWHKNHAKRLLKTPKIHI
FT                   IDSGLACALTKLRTNDWYDFSSDFGAVLESFVVQQLICQSGWSEHELFFSHYRDKEQVE
FT                   VDLVIEDGRKVWGVEVKKSASIQPKDGAGLAKLASLSGDDWQGGILFYTGNNCLPISQV
FT                   PNTYAVPMNALWKE"
FT   regulatory      complement(24544..24603)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(24638..24697)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(24700..26529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="XNC1_0022"
FT                   /product="L-glutamine:D-fructose-6-phosphate
FT                   aminotransferase"
FT                   /EC_number="2.6.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0022"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88115"
FT                   /db_xref="GOA:D3VG25"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG25"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88115.1"
FT                   /translation="MCGIVGACAQRDIAEILIEGLRRLEYRGYDSAGMAVVDSENRMTR
FT                   LREVGKVQMLADEADKQPVIGGTGIAHTRWATHGEPNERNAHPHVSEHIAVVHNGIIEN
FT                   HEELREELKARGYIFSSDTDTETIAHLVHWEQQQGGTLLEVVQRVIPQLRGAYGTVIMD
FT                   SRNPDVLVAARSGSPLVIGLGVGENFLASDQLALLPVTRRFIYLEEGDIAEITRRTVRI
FT                   FDINGEAIEREQIESNVQYDAGDKGVYRHYMQKEIYEQPMAIKSTLEGRLSNGQVNLSE
FT                   LGTNAAELLSQVEHIQIVACGTSYNAGMVSRYWFESLAGIPCDVEIASEFRYRKPARRK
FT                   NSLLITLSQSGETADTLAALRLSKELGYLTSLTICNVVGSSLVRESAFALMTKAGAEIG
FT                   VASTKAFTTQLTVLLMLVAYIGRLKDAEAGLEHDIVHALHALPSRIESMLYKDKLIEAL
FT                   AEDFSEKHHALFLGRGDQYPIAVEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPV
FT                   IIIAPNNELLEKLKSNIEEVRARGGLLYVFADQDAGFTNSENMKIISLPHVEELIAPIF
FT                   YTVPLQLLSYHVALIKGTDVDQPRNLAKSVTVE"
FT   regulatory      complement(26549..26608)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(26646..28034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="XNC1_0023"
FT                   /product="bifunctional: N-acetyl glucosamine-1-phosphate
FT                   uridyltransferase (N-terminal); glucosamine-1-phosphate
FT                   acetyl transferase (C-terminal)"
FT                   /EC_number="2.7.7.23"
FT                   /EC_number="2.3.1.57"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0023"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88116"
FT                   /db_xref="GOA:D3VG26"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG26"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88116.1"
FT                   /translation="MSIISNGVNTKSVVILAAGKGTRMYSDLPKVLHLLAGKPMVQHVI
FT                   DTAMELGTQNVHLVYGHGGDLMKQTLSNQNLNWVLQAEQLGTGHAMQQAAPHFADDEDI
FT                   LILYGDVPLIAKDTLARLIEAKPEGGIGLLTAILDNPTGYGRIIRENGDVTGIIEQKDA
FT                   TEEQRKINEINTGILVANGGDLKRWLAKLENNNAQGEYYLTDVIALAYKEGCQIKAVHP
FT                   SRLSEMEGVNNRLQLSALERIYQSEQAEKLLLAGVMLLDPARFDLRGTLVHGRDIVIDT
FT                   NVIIEGHVTLGNHVHIGSGCILKNCVIGDGAVISPYTVIEDSELSTECTVGPFARLRLG
FT                   TKLAEQAHVGNFVEMKKASLGKGSKAGHLTYLGDAVIGDNVNIGAGTITCNYDGANKFK
FT                   TIIGDDVFVGSDTQFVAPVTIEKGATIGAGTTVTKNVAENELVISRVKQTHIKNWQRPV
FT                   KKNK"
FT   regulatory      complement(28106..28141)
FT                   /regulatory_class="terminator"
FT   regulatory      complement(28140..28199)
FT                   /regulatory_class="promoter"
FT   operon          complement(28218..35159)
FT                   /operon="XNC1_operon0004"
FT   CDS_pept        complement(28218..28640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0004"
FT                   /gene="atpC"
FT                   /locus_tag="XNC1_0024"
FT                   /product="membrane-bound ATP synthase, F1 sector,
FT                   epsilon-subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0024"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88117"
FT                   /db_xref="GOA:D3VG27"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG27"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88117.1"
FT                   /translation="MAAMTFSLNVVSAEKLMFEGLVQKIQVTGSEGELGIYPQHTPLLT
FT                   AIKPGMIRIVKQFGEEEFIYLSGGILEVQPNGVIVLADTAIRGKDLDEAKVLEAKRKAE
FT                   ENIRNSHGDVDYAQASAELSKAIAKLRVIELTKKLM"
FT   CDS_pept        complement(28662..30044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0004"
FT                   /gene="atpD"
FT                   /locus_tag="XNC1_0025"
FT                   /product="membrane-bound ATP synthase, F1 sector,
FT                   beta-subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0025"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88118"
FT                   /db_xref="GOA:D3VG28"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG28"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88118.1"
FT                   /translation="MATGKIIQVIGAVVDVEFPQDSVPKVYDALEVKNGEEKLVLEVQQ
FT                   QLGGGIVRCIAMGTSDGLRRHLEVTDLGHPIEVPVGKATLGRIMNVLGDPIDMKGEIGE
FT                   EERWSIHRTAPTYEELSNSQELLETGIKVMDLICPFAKGGKVGLFGGAGVGKTVNMMEL
FT                   IRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVLDKVSLVYGQMNEPPGNRLRVAL
FT                   TGLTMAEKFRDEGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQE
FT                   RITSTQTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDS
FT                   TSRQLDPLVVGQEHYDVARGVQSILQRYQELKDIIAILGMDELSEDDKLVVARARKIQR
FT                   FLSQPFFVAEVFTGSPGKFVPLKDTIRGFKGILNGDYDHLPEQAFYMVGTIEEAVEKAK
FT                   KL"
FT   CDS_pept        complement(30079..30942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0004"
FT                   /gene="atpG"
FT                   /locus_tag="XNC1_0026"
FT                   /product="membrane-bound ATP synthase, F1 sector,
FT                   gamma-subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0026"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88119"
FT                   /db_xref="GOA:D3VG29"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG29"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88119.1"
FT                   /translation="MAGAKEIRTKIASVQNTQKITKAMEMVAASKMRKTQDRMAASRPY
FT                   AETIRSVIGHLALGNLEYKHPYLEEREVKRVGYVVVSTDRGLCGGLNINLFKKLLIEMK
FT                   DWSDKNVQVDLALVGSKGVSFFSSVGGNIVAQVTGMGDNPSLSELIGPVHVMMQAYDEG
FT                   RLDKLYIVTNKFMNTMSQVPTITQLLPLPAGDDETLKKKSWDYLYEPDPKALLDTLLRR
FT                   YIESQVYQGVVENLASEQAARMVAMKAATDNGGNLIKELQLVYNKARQASITQELTEIV
FT                   SGASAV"
FT   CDS_pept        complement(31006..32547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0004"
FT                   /gene="atpA"
FT                   /locus_tag="XNC1_0027"
FT                   /product="membrane-bound ATP synthase, F1 sector,
FT                   alpha-subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0027"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88120"
FT                   /db_xref="GOA:D3VG30"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG30"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88120.1"
FT                   /translation="MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVNDGIIRVHGLA
FT                   DVMQGEMISLPGNRYAIALNLERDSVGAVVMGPYADLAEGMKVKCTGRILEVPVGRGLL
FT                   GRVVNTLGEPIDGKGAVEHDGFSPVEVIAPGVIDRQSVDQPVQTGYKSVDAMIPIGRGQ
FT                   RELVIGDRQTGKTALAIDAIINQRNSGIKCIYVAIGQKASTISNVVRKLEEHGALENTI
FT                   VVVASASESAALQYLAPYSGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPP
FT                   GREAFPGDVFYLHSRLLERAARVNAEYVEKFTNGEVKGQTGSLTALPIIETQAGDVSAF
FT                   VPTNVISITDGQIFLESSLFNAGIRPAVNPGISVSRVGGAAQTKIIKKLSGGIRTALAQ
FT                   YRELAAFSQFASDLDDATRKQLDHGQKVTELLKQKQYLPMSIAQQALSLFAAERGYLED
FT                   VEIAKVVSFEAALLAYASREHSDFLKEIDQSGDYNGEIEAKLKALLESFKATQSW"
FT   CDS_pept        complement(32562..33095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0004"
FT                   /gene="atpH"
FT                   /locus_tag="XNC1_0028"
FT                   /product="membrane-bound ATP synthase, F1 sector,
FT                   delta-subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0028"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88121"
FT                   /db_xref="GOA:D3VG31"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG31"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88121.1"
FT                   /translation="MSEFATVARPYAKAAFDFAVEHQSIEHWQNMLAFIAEVTRNEQVG
FT                   ELLSGSLAPETLAKTFITLCGEQVDAHAQNFIRVMAENGRLLVLPEVFQQFIQLRASLE
FT                   STIDVEVISVSELNEQQQAKISAAMEKRLSRKVKLNCKIDKSVIAGVVIRAGDMVIDGS
FT                   IRGRLDRLTDDLQS"
FT   CDS_pept        complement(33108..33578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0004"
FT                   /gene="atpF"
FT                   /locus_tag="XNC1_0029"
FT                   /product="membrane-bound ATP synthase, F0 sector, subunit
FT                   b"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0029"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88122"
FT                   /db_xref="GOA:D3VG32"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG32"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88122.1"
FT                   /translation="MNINATILGQAFAFVLFVLFCMKYVWPPIMAAIEKRQKEITDGLA
FT                   SAERAKKNLDLAQANATDQLKKAKADAQVIIEQANKQKAQIIDDAKAEAELERNKILVQ
FT                   ANAEIEAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL"
FT   CDS_pept        complement(33638..33874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0004"
FT                   /gene="atpE"
FT                   /locus_tag="XNC1_0030"
FT                   /product="membrane-bound ATP synthase, F0 sector, subunit
FT                   c"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0030"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88123"
FT                   /db_xref="GOA:D3VG33"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG33"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88123.1"
FT                   /translation="MDINMDLLYIAAAILMGLAAIGAAIGIGILGGKFLEGAARQPDLI
FT                   PLLRTQFFIVMGLVDAIPMIAVGLGLFMMFAVA"
FT   CDS_pept        complement(33926..34750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0004"
FT                   /gene="atpB"
FT                   /locus_tag="XNC1_0031"
FT                   /product="membrane-bound ATP synthase, F0 sector, subunit
FT                   a, important for FO assembly"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0031"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88124"
FT                   /db_xref="GOA:D3VG34"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG34"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88124.1"
FT                   /translation="MSASGEVSTSEYISHHLRHLQLDLRTFELVNPHASGYEATFWTLN
FT                   IDSLFFSIVLGMLFLFVFRRVAVCATDGVPGKFQTAVEMIIGFVDNTVRDMYHGKSKVI
FT                   APLALTVFVWVLLMNALDLLPVDFIPYIGEHVFGLPALRIVPTADVSVTLSMALGVFVL
FT                   ILFYSIKMKGIGGFAKELTLQPFNHPLFIPINLILEGVSLLSKPISLGLRLFGNMYAGE
FT                   LIFILIAALLPVWSQWLLSLPWAIFHILIITLQAFIFMVLTIVYLSMASEEH"
FT   CDS_pept        complement(34782..35159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0004"
FT                   /gene="atpI"
FT                   /locus_tag="XNC1_0032"
FT                   /product="membrane-bound ATP synthase subunit, F1-F0-type
FT                   proton-ATPase"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0032"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88125"
FT                   /db_xref="GOA:D3VG35"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG35"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88125.1"
FT                   /translation="MSVPLYNGKMALKLLLLQLMTFVILSVAFCTKSIEWGASAFVGGL
FT                   ACWLPNAIFLLLSRFQKIKEEGVPVRIAWFFAISEGVKVIIAIAVLIVALGVFKAAFAP
FT                   LGVAYLAVLIVQIIAPAVMNG"
FT   regulatory      complement(35256..35315)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(35685..35740)
FT                   /regulatory_class="terminator"
FT   operon          complement(35772..38292)
FT                   /operon="XNC1_operon0005"
FT   CDS_pept        complement(35772..36392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0005"
FT                   /gene="gidB"
FT                   /locus_tag="XNC1_0033"
FT                   /product="glucose-inhibited division protein, contains
FT                   S-adenosyl-L-methionine-dependent methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0033"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88126"
FT                   /db_xref="GOA:D3VG36"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG36"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88126.1"
FT                   /translation="MLNKLESLLAKTDIALSQEQKQQLVAYVEMLNKWNKAYNLTSVRD
FT                   PEQMLVRHIMDSIVVNPFLHGTRFIDVGTGPGLPGVPLAIVRQDSHFTLLDSLGKRVRF
FT                   LRQVQHELGLTNIDPVQSRVEEFIPEPPFDGVISRAFASLQDMLSWCRHLPKPLEGRFY
FT                   ALKGGLPEDELANLPTGFILDTVIPLQVTELDEQRHLVILKSN"
FT   CDS_pept        complement(36436..38292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0005"
FT                   /gene="gidA"
FT                   /locus_tag="XNC1_0034"
FT                   /product="glucose-inhibited division protein,
FT                   oxidoreductase-like with FAD/NAD(P)-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0034"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88127"
FT                   /db_xref="GOA:D3VG37"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG37"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88127.1"
FT                   /translation="MFYPEHFDVIIIGGGHAGTEAAMAAARMGRQTLLLTHNIDTLGQM
FT                   SCNPAIGGIGKGHLVKEIDALGGLMAKATDQAGIQFRTLNASKGPAVRATRAQADRVLY
FT                   RQAVRTALENQPNLMIFQQPVEDLIVENNTVTGVVTRMSLKFKAKSVVLTVGTFLDGKI
FT                   HIGLENYSGGRAGDPPAISLSHRLRELPLRVARLKTGTPPRIDARSIDFSQLEQQLGDN
FT                   PTPVFSFMGNAAQHPQQILCYITHTNEKTHEVIRSNLDRSPMYAGIIEGIGPRYCPSIE
FT                   DKVMRFADRNAHQIFLEPEGLTSNEIYPNGISTSLPFDVQMQIVHSMKGMENARIIRPG
FT                   YAIEYDFFDPRGLKQTLESKFIHGLFFAGQINGTTGYEEAAAQGLLAGLNAARYATGEE
FT                   GWFPRRDQAYIGVLVDDLCTLGTKEPYRMFTSRAEYRLMLREDNADLRLTEQGRRLGLV
FT                   DDLRWKHYSRKVEMIEQERQRLRNIWVHPHSDNLGDINQMLKTPLSKEANGEDLLRRPE
FT                   MNYELLTSLSRFAPGLTEAQAADQVEIQVKYEGYIARQQEEIEKQLRNENTALPVDLDY
FT                   QQVSGLSNEVIAKLNDHKPSSIGQASRISGITPAAISILLVW"
FT   regulatory      complement(38334..38393)
FT                   /regulatory_class="promoter"
FT   operon          complement(38668..39691)
FT                   /operon="XNC1_operon0006"
FT   CDS_pept        complement(38668..39108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0006"
FT                   /gene="mioC"
FT                   /locus_tag="XNC1_0035"
FT                   /product="FMN-binding protein, required for biotin synthase
FT                   activity"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10913144; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0035"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88128"
FT                   /db_xref="GOA:D3VG38"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG38"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88128.1"
FT                   /translation="MSTITLISGSTMGSAEYVAEHIAEILEDDGFSTEVLHGPSLDDLP
FT                   LEGLWLVVTSTHGAGDLPENLQSLSDAIAQQQPDLSKITFGAVGIGSSEYDTFCGAIRS
FT                   LERLLEDLGAKRIGDRLEIDILKHEIPEDPAGEWAKEWAKLL"
FT   regulatory      complement(39131..39190)
FT                   /operon="XNC1_operon0006"
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(39200..39691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0006"
FT                   /gene="asnC"
FT                   /locus_tag="XNC1_0036"
FT                   /product="transcriptional regulator of asparagine
FT                   biosynthesis (AsnC family)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2836709, 2864330, 3909107; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0036"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88129"
FT                   /db_xref="GOA:D3VG39"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG39"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88129.1"
FT                   /translation="MNITQKQGLKMAEIYQIDNLDRDILHALMENARIPYAELAKKLAV
FT                   SPGTIHVRVEKMKQSGIITGTRVDISAKQLGFDVCCFIGIILKSAKDYPAALKKLDMLD
FT                   EVVEVYYTTGHYSIFIKVMCRSIEALQDVLINKIQTIDEIQSTETLISLQNPITRTIKP
FT                   "
FT   regulatory      39692..39751
FT                   /regulatory_class="promoter"
FT   regulatory      complement(39732..39791)
FT                   /regulatory_class="promoter"
FT   CDS_pept        39827..40819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnA"
FT                   /locus_tag="XNC1_0037"
FT                   /product="asparagine synthetase A"
FT                   /EC_number="6.3.1.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1369484, 6117826, 9437423; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0037"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88130"
FT                   /db_xref="GOA:D3VG40"
FT                   /db_xref="InterPro:IPR004618"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG40"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88130.1"
FT                   /translation="MKTSFIEKQQQISFVKSYFSRLLEKQLGLIEVQGPILSRLGDGTQ
FT                   DNLSGHEKAVQVKVKTLPDATFEVVHSLAKWKRKTLGRFGFQAEQGLYTHMKALRPDED
FT                   RLTPIHSVFVDQWDWEKTMGEGQRSLDYLKQTVGKIYEAIKETQQAVSKEFGLAPFLPD
FT                   QIHFIHSEELLKRYPDLDAKGREREAAKEFGAIFLMGIGGKLSDDQSHDVRAPDYDDWT
FT                   SPNSDGFFGLNGDIIVWNPVLQDAFEISSMGIRVDAEALQRQLELTGDEDRLQYDWHQA
FT                   LVKGDMPQSIGGGIGQSRLVMLMLQMPHIGQVQCGVWSPEIIESVEGVL"
FT   operon          complement(40823..43787)
FT                   /operon="XNC1_operon0007"
FT   CDS_pept        complement(40823..42280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0007"
FT                   /locus_tag="XNC1_0038"
FT                   /product="conserved hypothetical protein; putative von
FT                   Willebrand factor type A (vWA) domain"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0038"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88131"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR023481"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG41"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88131.1"
FT                   /translation="MLTLTTLDLLLSINEGELIEEITLTLLSTPQLLIFFEKFPRIKQA
FT                   LQKDLPAWQQILLQRIKEAQIPAPLAEEFQLYQQVQASNTEDFYQQLPIIVEKLQQIGS
FT                   PFANEANTLLKTISGHTHSEHILFLQHWRINLIRQVTIFNKMLLEQEKEQLLAEIQKRL
FT                   TLIDHLDPVFDHNDRAAGRLWDMSKSQLHLTSQHTQLITLYADFLTHQPELEKLAQLLG
FT                   RSQTAKSIPEESHALQPITRLERIPDTVPEQVSGIRQSNDILRLLPTEIAMLGIEELEY
FT                   EFYRRLAEKKLLSYRLQGDSWQLKTTLKRVTHHHNKEQPKGPFIVCVDTSGSMGGFNEL
FT                   CAKAFCLALMRIALEDNRHCHIMLFSTALIHYELTSPTGLTQAIHFLGQTFRGGTDLAY
FT                   CLSTTVEKMKENIWKDADTVVISDFIAQRLPDTLIHQIKNLQQHQQHRFHAVSLSHYGK
FT                   PGIMRIFDHIWHFDTGFISRLQRKRRN"
FT   regulatory      40831..40863
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(42282..43787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0007"
FT                   /gene="yieN"
FT                   /locus_tag="XNC1_0039"
FT                   /product="conserved hypothetical protein; putative
FT                   transcriptional regulator"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0039"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88132"
FT                   /db_xref="GOA:D3VG42"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR022547"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041538"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG42"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88132.1"
FT                   /translation="MQLVEKISQLSQYLESGLYERRQAIRLCLLAALCGESVFLLGPPG
FT                   IAKSLIARRLKFAFQNARAFEYLMTRFSTPEEIFGPLSIQALKDEGRYQRLTEGYLPEA
FT                   EIVFLDEIWKAGPAILNTLLTAINEKKFRNGNQEEQLPMRLLVTASNEFPDTDSGLEAL
FT                   YDRMLIRLCLDKIQEKRNFRALLTDRNHENNNPVPTYIQISDNEFYQWQEKINHVSLTD
FT                   HIFELIYQVRQQMNTSENIPDVSDRRWKKSIRLLQASAFFSGRNEISPLDIVLLKYCLW
FT                   HDLNALKNLSQLLHILLTEQAYRQNSLIQKIDGLYQQWVQSNQDGNGSSPLQLTTKTSL
FT                   LGRRNLHSLPTNIKDEKLILFLRPSLHLHNIEVNFIEIDKKTLENTLKNNETTLPARLN
FT                   GIGFPQTLTVEISEKHQLKVLDISRNSAVLCQAGDQPQLPEKTTTEWHEKRLSIHDEIQ
FT                   HQHQLFNQHQPCLFIEEHWLASIEQSFLRLTEKLEQLRTKIGG"
FT   regulatory      43948..44007
FT                   /regulatory_class="promoter"
FT   regulatory      complement(43990..44049)
FT                   /regulatory_class="promoter"
FT   operon          44042..46529
FT                   /operon="XNC1_operon0008"
FT   CDS_pept        44042..44242
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0008"
FT                   /locus_tag="XNC1_0040"
FT                   /product="Membrane-associated component of high-affinity
FT                   D-ribose transport system (N-terminal fragment)"
FT                   /note="Evidence 7 : Gene remnant; PubMedId : 3011793"
FT                   /db_xref="PSEUDO:CBJ88133.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        44345..44536
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0008"
FT                   /locus_tag="XNC1_0041"
FT                   /product="D-ribose transport protein (ABC superfamily,
FT                   peri_bind) (C-terminal fragment)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CBJ88134.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        44599..45543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0008"
FT                   /gene="rbsK"
FT                   /locus_tag="XNC1_0042"
FT                   /product="ribokinase"
FT                   /EC_number="2.7.1.15"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3011794, 9385653; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0042"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88135"
FT                   /db_xref="GOA:D3VG45"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG45"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88135.1"
FT                   /translation="MSMAKLVVMGSINVDHILNLESFPQPGETVKGRQYQVAFGGKGAN
FT                   QAVAAGRCGADITFIACVGQDGIGEQVRQQLAKDNINTSSIECIEGETTGVALIFVNQQ
FT                   GENVIGINAGANGALTPDYFRCYEQVVKDADALLLQLETPLETVQLAAETSKKHHTKVI
FT                   LNPAPAQKISAQLLSLVDIITPNETEAECLTGITVKDDAGAKEAALALHDQGIETVIIT
FT                   LGSRGVWLSEKGKEGKIVPGFKVKVIDTIAAGDTFNGALVTGLLEGKEMLSAIRFAHAA
FT                   AAIAVTRQGAQPAVPWRHEIDTFLSEQDSLWLP"
FT   CDS_pept        45540..46529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0008"
FT                   /gene="rbsR"
FT                   /locus_tag="XNC1_0043"
FT                   /product="transcriptional repressor for ribose metabolism
FT                   (GalR/LacI family)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1304369; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0043"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88136"
FT                   /db_xref="GOA:D3VG46"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG46"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88136.1"
FT                   /translation="MKDVARLAGVSTSTVSHVINNNRYVSEKIKKRVNAAIEELNYTPS
FT                   ALARSLKIKQTKTIGMLVTSSDNSFYSEVVRGVEQSCYERGYSLILHTEGNLTRMLRCM
FT                   ETLLQKRVDGLLIMCSEQQLISKDFFLRYPLAPIVTMDWSPFDVSSDVIKDNSLLGGEL
FT                   ATNYLISRGFRKIACIAGPQDKMPAQQRLFGYRKAMRDAGLEISEGYEIYSNFEFSGGF
FT                   LSMKQLLQLPEPPEAVFASNDAMAIGVYQALYQSGLSVPKDISVIGYDDIAIAPYLTPP
FT                   LTTIHQSKGELGKLAIDTLLYRMDNPESEPKELILTPALVERSSVARR"
FT   CDS_pept        complement(46536..47918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsrA"
FT                   /locus_tag="XNC1_0044"
FT                   /product="putative permease of the major facilitator
FT                   superfamily; putative transmenmbrane domain"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0044"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88137"
FT                   /db_xref="GOA:D3VG47"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG47"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88137.1"
FT                   /translation="MVKSARNMSGLPWIAAMAFFMQSLDATILNTALPAIAKSLHHSPL
FT                   AMQPAIVSYTLTVAMLIPVSGWLADRFGTQRIFIYAVSLFSLGSLACALSHNLSFLVIS
FT                   RVIQGIGGAMMMPVARLALLRTYPRSELLPILNFVTMPGLLGPILGPMLGGLLVTYATW
FT                   HWIFIINIPIGLLGIIYARKNMPNLTMPKCPFDFLGFMLFGMGLVMISVSFDLFGDNSL
FT                   SSYIPLVLLPGGITMLLIYIFHAKRHKNPLIDLQLFQTHTFSIGIASNIATRLSTGSLS
FT                   FIIPLMLQVGFGYSAVIAGIMMAPNAIGSILAKSFVTKILTRFGYKNTLFWVTVIIGVM
FT                   ISQFSLQTPEMSVVLLIIPLFILGMAMSTQFTAMNTITLADLNDNNASAGNSLLAVTQQ
FT                   LSISFGVTVSAAVLRFYESMEYGSTVSHFHYTLITMGAITLISSTVFLFLNKEDGNNLI
FT                   NK"
FT   regulatory      complement(48049..48108)
FT                   /regulatory_class="promoter"
FT   rRNA            48453..49949
FT                   /locus_tag="XNC1_rRNA0001"
FT                   /product="16S ribosomal RNA"
FT   tRNA            50054..50129
FT                   /gene="GluTTC"
FT                   /locus_tag="XNC1_tRNA0001"
FT                   /product="tRNA-Glu"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   rRNA            50316..50855
FT                   /locus_tag="XNC1_rRNA0002"
FT                   /product="23S ribosomal RNA"
FT   rRNA            50870..52877
FT                   /gene="LSU_RRNA"
FT                   /locus_tag="XNC1_rRNA0003"
FT                   /product="23S ribosomal RNA"
FT   rRNA            53326..53438
FT                   /locus_tag="XNC1_rRNA0004"
FT                   /product="5S ribosomal RNA protein"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT   operon          complement(53574..55537)
FT                   /operon="XNC1_operon0009"
FT   CDS_pept        complement(53574..55229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0009"
FT                   /gene="yjcG"
FT                   /locus_tag="XNC1_0050"
FT                   /product="putative transporter of the sodium symport
FT                   superfamily (SSS family); putative transmembrane protein"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0050"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88138"
FT                   /db_xref="GOA:D3VG48"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR014083"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG48"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88138.1"
FT                   /translation="MKKIVLPTIPLCFSLLAQADAISGNNVEKQPLNIQAIVMFLLFVG
FT                   LTLCITYWASKRTISRSDYYTAGGRITGFQNGMAIAGDYMSAASFLGISALVYTSGYDG
FT                   LIYSIGFLVGWPIILFLIAERLRNLGRYTFADVASYRLKQSPIRTLSAIGSLVVVALYL
FT                   IAQMVGAGKLIELLFGLNYYIAVVLVGILMVLYVLFGGMLATTWVQIIKAILLLAGATF
FT                   MAVMVMKAVNFNFNTLFKEAIAVHTLGPAIMSPGGLVSDPISALSLGLALMFGTAGLPH
FT                   IIMRFFTVNDAKEARKSVFYATGFIGYFYILTFIIGFGAILLVSANPSFKDATGTLIGG
FT                   TNMAAVHLASAVGGDFFLGFISAVAFATILAVVAGLTLAGASAVSHDLYANVIKKGQAN
FT                   ERDELRVSKITVVILGIVAIGLGILFEKQNIAFMVGLAFSIAASCNFPIILLSMYWHKL
FT                   TTRGALIGGGLGLLTAVVLMILGPTIWVSILGHEKPIYPYEYPALFSMSVAFIGAWLFS
FT                   ITDTSIQGQQEREKFRSQFIRSQTGIGIEQGKAH"
FT   CDS_pept        complement(55226..55537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0009"
FT                   /locus_tag="XNC1_0051"
FT                   /product="Inner membrane protein yjcH"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0051"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88139"
FT                   /db_xref="GOA:D3VG49"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG49"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88139.1"
FT                   /translation="MNADIYQDIENNPRFKELVKKRGRFAWLLSIIMLVLYVGFIFLIA
FT                   FAPEWLGTQLHENTSITRGIPVGVGIIFSSFILTGIYVVKANGEFDRLVSTILDEVRK"
FT   regulatory      complement(55613..55642)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(55744..57699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acs"
FT                   /locus_tag="XNC1_0052"
FT                   /product="acetyl-CoA synthetase, has propionyl-CoA
FT                   synthetase activity"
FT                   /EC_number="6.2.1.1"
FT                   /EC_number="6.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0052"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88140"
FT                   /db_xref="GOA:D3VG50"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG50"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88140.1"
FT                   /translation="MTQIIKHLIPADIADSALISKQQYLQDYQWSLQDPEGFWGEKGKI
FT                   VDWITPYTKVKNTSFDPGHISIRWFEDGTLNLSANCLDRHLQERGDQTAIIWEGDNPAE
FT                   SRHVTYRELHHDVCQFANVLKKLGIQKGDVVAIYMPMVPEAAVAMLACARIGAIHSVIF
FT                   GGFSPDAIAGRVIDSNAKLIVTADEGLRAGRTIPLKKNVDEALNNSAVTSVTNVVIFKR
FT                   TGNTKNWYDGRDLWWHELINSVSTDCPAEEMNAEDPLFILYTSGSTGKPKGVLHTSGGY
FT                   LVYASLTFKYTFDYRPGEIYWCTADIGWVTGHSYLLYGPLSCGATTLMFEGVPNYPDVN
FT                   RLCQVIDKHQVNILYTAPTAIRALMAEGDKAIEETKRTSLRILGSVGEPINPEAWEWYY
FT                   KKIGNSKCPIVDTWWQTETGGFMITPLPGATDLKAGSATLPFFGVSPALVDNSGEILEG
FT                   ENEGNLVITDSWPAQARTLYGDHERFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVD
FT                   DVLNISGHRLGTAEIESALVSHPKIAEAAVVGIPHHIKGQAIYAYVTLIHGEEPSPALY
FT                   SEVRSWVRKEIGPIATPDILHWTDSLPKTRSGKIMRRILRKIASGDTSNLGDTSTLADP
FT                   GVVDKLLEEKQSIKIS"
FT   regulatory      57847..57906
FT                   /regulatory_class="promoter"
FT   regulatory      complement(57849..57908)
FT                   /regulatory_class="promoter"
FT   CDS_pept        58071..58697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodA"
FT                   /locus_tag="XNC1_0053"
FT                   /product="superoxide dismutase, manganese"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0053"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88141"
FT                   /db_xref="GOA:D3VG51"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG51"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88141.1"
FT                   /translation="MSYSLPSLPYSYDALEPHFDKQTMEIHHSKHHQTYVNNTNTALEA
FT                   FPECNTLDIDDLIQQLDKIPADKLTFVRNNAGGHSNHSLFWKGLKLGTELSGALKMAIE
FT                   RDFGSIDNFKEKFEQAAATRFGSGWAWLVLKEDGKLAVVSTANQDSPLMGEEIAGASGY
FT                   PIVGLDVWEHAYYLQYQNRRPDYIKAFWHVVNWDEATKRYEEKIK"
FT   CDS_pept        58728..58910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0054"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88142"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG52"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88142.1"
FT                   /translation="MLIATVISILYRRLRRPALTLILNGPSVCYRPTLICLGGKFSFYD
FT                   GLKQRLSHLFGQSNI"
FT   regulatory      58729..58764
FT                   /locus_tag="XNC1_0054"
FT                   /regulatory_class="terminator"
FT   regulatory      58854..58913
FT                   /regulatory_class="promoter"
FT   CDS_pept        58936..59604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0055"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0055"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88143"
FT                   /db_xref="GOA:D3VG53"
FT                   /db_xref="InterPro:IPR005163"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG53"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88143.1"
FT                   /translation="MNGLQVYRGKIISSEKWGPSAVNKLLVNGRLQLTSLGLEGDEQAE
FT                   GFHGGPDRALCHYPREHYLFWKRQFPELMETFVSPLFGENLSTEGMTEDNVYIGDIFQW
FT                   GEALIQITQPRSPCYKLNLITGISDFSAMMQNNGCCGWLYRVISAGFVSTGEPIKLLSR
FT                   NSDVSVTEAISIAFHSPFDEEQYRRLMGVAGLSASWNLTMQKRITHGKIEDFNRRLFGH
FT                   "
FT   regulatory      59605..59647
FT                   /regulatory_class="terminator"
FT   operon          complement(59650..64022)
FT                   /operon="XNC1_operon0010"
FT   CDS_pept        complement(59650..60687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0010"
FT                   /gene="trpS"
FT                   /locus_tag="XNC1_0056"
FT                   /product="tryptophan tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0056"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88144"
FT                   /db_xref="GOA:D3VG54"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG54"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88144.1"
FT                   /translation="MNEPTEMKLNSQKPIVFSGAQPSGELTIGNYMGALRQWVNMQDDY
FT                   DCIYCIVNQHAITVRQDPSELKKRTLDTLALYLACGIDPKKSTIFVQSHVPQHSQLSWV
FT                   LNCYAYFGELSRMTQFKDKSARHAENINAGLFDYPVLMAADILLYQANQIPVGGDQKQH
FT                   LELSRDLALRFNALYGDIFTVPEPFIPQGGSARVMSLQDPTKKMSKSDDNRNNVIALLE
FT                   DPKSVAKKIKRAVTDSEEPPRVHYDLENKPGVSNLLDILAGVTGKTVPELEAEFEGKMY
FT                   GHLKGAVADAVSEMLTDLQERYHHFRNDEALLNQIMTEGAAKAQARAQATLDKVYDAVG
FT                   LLAHP"
FT   CDS_pept        complement(60692..61414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0010"
FT                   /gene="gph"
FT                   /locus_tag="XNC1_0057"
FT                   /product="phosphoglycolate phosphatase, contains a
FT                   phosphatase-like domain"
FT                   /EC_number="3.1.3.18"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0057"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88145"
FT                   /db_xref="GOA:D3VG55"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG55"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88145.1"
FT                   /translation="MLNNVVKKIRAIAFDLDGTLVDSADGLADALDQALIAKGLPAAGK
FT                   DQVAVWIGNGADIMVERALKWAGAEPSPELHRETRKLFDTFYETSITTGSKLFPQVKET
FT                   LAELAKHRLPMAIITNKPTPFIAPLLESLGISEYFSVVLGGDDVKEKKPHPAPLYLTMG
FT                   MFGLHKEELLFVGDSRNDILAAQSAGCPCVGLTYGYNYGESIALSHPTYVLDHFSDLFP
FT                   TIGLSTLNLLSTSKIQEA"
FT   CDS_pept        complement(61414..62088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0010"
FT                   /gene="rpe"
FT                   /locus_tag="XNC1_0058"
FT                   /product="D-ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0058"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88146"
FT                   /db_xref="GOA:D3VG56"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG56"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88146.1"
FT                   /translation="MKQDFLIAPSILSADFARLGEDTAKVLAAGADVVHFDVMDNHYVP
FT                   NLTIGPMVCQALRHYGITAPIDVHLMVKPVDRIIPDFAKAGATYITFHPEASEHIDRTL
FT                   QLIREHGCKAGLVFNPATPLRYLDYVLDKLDVILLMSVNPGFGGQSFIPETLKKLRQVR
FT                   KIIDDSGYDIRLEVDGGIKPSNIAEAAQAGADMFVAGSAIFSQPDYKAVIDEMRGELSK
FT                   VT"
FT   CDS_pept        complement(62147..62965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0010"
FT                   /gene="dam"
FT                   /locus_tag="XNC1_0059"
FT                   /product="DNA adenine methylase"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0059"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88147"
FT                   /db_xref="GOA:D3VG57"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG57"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88147.1"
FT                   /translation="MKKKRAFLKWAGGKYPLVDDIKRHLPEGDCLIEPFVGAGSVFLNT
FT                   DYDSYILSDINSDLINLYNTVKSRADEFINHARPLFFPEFNTSENFYRMREEFNKSSDP
FT                   FYRSILFLYLNRHCYNGLCRYNSRGQFNVPFGRYKKPYFPENELYWFAEKSQKATFICQ
FT                   HYEIALNNAPKGAVVYCDPPYAPLSATANFTAYHTNNFNLLDQENLAQIAYHLSSQRGI
FT                   PVLISNHDTPMTREWYHQASLYIVKARRTISRNILARSKVDELLALYCQK"
FT   regulatory      complement(62985..63044)
FT                   /operon="XNC1_operon0010"
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(63051..64022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0010"
FT                   /gene="damX"
FT                   /locus_tag="XNC1_0060"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0060"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88148"
FT                   /db_xref="GOA:D3VG58"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR032899"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG58"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88148.1"
FT                   /translation="MDELKSEKKQKTETEFKPDTSDRRPPRSKSQSNQPKLAVSRQQMM
FT                   IGVGILVLLLLIIAISSALKSPTEHEKQQSSNAAEKSIDLSGSSTLSGNEQDIGQETPS
FT                   VPATHGTDSKTHDISLPPPINSTSSQSLPPATNTGSYNQRIELPGDISDALNQQQSNIN
FT                   HSVQSNMAPLQANPTKPVLTPPIEQTKLEKVTPPKIENKGREENQPKAATKPLTNHHQT
FT                   NKKPETGASGDLLKAPANRFTLQLSSASRSDTLIAFAKKHNLSHYKVYETKRDHKTWFI
FT                   LIHGNYSSVYDAKSAISSLPAEVQAKKPWVRKLQQVQQDLKK"
FT   regulatory      complement(64049..64108)
FT                   /regulatory_class="promoter"
FT   operon          complement(64172..65836)
FT                   /operon="XNC1_operon0011"
FT   CDS_pept        complement(64172..65269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0011"
FT                   /gene="aroB"
FT                   /locus_tag="XNC1_0061"
FT                   /product="dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0061"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88149"
FT                   /db_xref="GOA:D3VG59"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG59"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88149.1"
FT                   /translation="MEQVTVTLGERSYPITIAEGLFSISEAFKPLQAGQQVMVVTNETL
FT                   APLYLEQVKSTLQEMGLRVDEVILPDGEQYKSLFVLNDIFSALLENNHGRDTTLIALGG
FT                   GVIGDMTGFAAASYQRGSRFIQVPTTLLSQVDSSVGGKTGVNHPLGKNMIGAFYQPVSV
FT                   VIDLNCLKTLPSQELYSGLAEVIKYGIALDGEFFSWLEDNIEKLLTLDNQAMAYCIRRC
FT                   CELKAMVVAADEQERSGMRALLNLGHTFGHAIEAEMGYGVWLHGQAVAAGMVMAATASE
FT                   LVGTFSQQDTQRIIHLLERANLPVNGPVKMSPDDYLPHMMRDKKVASGKLHLVLPTAIG
FT                   EATLRSGIGKDVISEAIRLCQPSTS"
FT   CDS_pept        complement(65315..65836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0011"
FT                   /gene="aroK"
FT                   /locus_tag="XNC1_0062"
FT                   /product="shikimate kinase I"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0062"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88150"
FT                   /db_xref="GOA:D3VG60"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG60"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88150.1"
FT                   /translation="MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIERRTGA
FT                   DVGWVFDVEGEEGFRDREEKIINELTEKQGIVLATGGGSVKSKETRNRLSARGVVVYLE
FT                   TTIEKQLARTQRDKKRPLLQVDTPAREVLENLADERNPLYEEIADVTIRTDEQSAKVVA
FT                   NQIIELLEKN"
FT   CDS_pept        66067..66204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0063"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88151"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG61"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88151.1"
FT                   /translation="MFDLLTQLGNPCMLNYSQRQIHKQVRPRKMVDDLIKKAQSLLPTN
FT                   "
FT   CDS_pept        complement(66230..67207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0064"
FT                   /product="putative transport protein, possibly in
FT                   biosynthesis of type IV pilin (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0064"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88152"
FT                   /db_xref="GOA:D3VG62"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG62"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88152.1"
FT                   /translation="MRNPFLPPQPPMGDETTFSSTEQDEQEQEIEYQTIALKYADAEQI
FT                   SERLQKNLPALLTKWGKVEHDPFTNSLILEDKFDAITRIKNWLKEVDTPQQQVQIIAHI
FT                   VTSSREALHELGIHWGVTADPVNRSLGLNRLNLHQPAGSQRHRLVLNTARIHANLLEME
FT                   LSALEQENQLDIIASPRLTASHQHPASIKQGSEIPYVVQDKDKTTIQFKEAVLGMEVTP
FT                   HILREGKIRLALKISQNAPGFPVSQGGNENLAIDKQEIMTQVTVRNGETLILGGIFQQK
FT                   KVASQQKVPYLSDIPLLGTLFNQNGEQHSRRELVIFITPQLTDI"
FT   operon          complement(67312..69345)
FT                   /operon="XNC1_operon0012"
FT   CDS_pept        complement(67312..67944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0012"
FT                   /locus_tag="XNC1_0065"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0065"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88153"
FT                   /db_xref="GOA:D3VG63"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG63"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88153.1"
FT                   /translation="MKSNDFEWFHRPAWQQLLWQQLVIILLLVGFYFGIWQENQHEIDA
FT                   LRSSITERQYHTAQSQQHIKERPSLSDIQQQIQHIKRELDQDSNISSKGISSKNAPPKN
FT                   TNVLKRLYFPLLHSGSQLIEWKNHRENNQVSWHIVLSLNYGQFLYFLSEIQQLQPPLLI
FT                   KHLTIKPMNDNLTVRIVLSDIVLSDIKQPDITLPDKIQSVSGYGDKS"
FT   CDS_pept        complement(67934..68482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0012"
FT                   /locus_tag="XNC1_0066"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0066"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88154"
FT                   /db_xref="GOA:D3VG64"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="InterPro:IPR016778"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG64"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88154.1"
FT                   /translation="MYQVNFLPWRQKRLKRRCQKWGLMLCLQIALWSAVLALISTQQTR
FT                   QIAQHRDKLTEIKHQLALFQHTIRETDQAVQQHEQLTQLLRKKQVFMEQNQRYLQLFRQ
FT                   LPHLLPQKSWLTAFSDANGQLIFTAHSQDYAEISDLLDNLTEDQALINVQLKKMTTGDD
FT                   QIKVFTIDADWLMGEAHEK"
FT   CDS_pept        complement(68482..69345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0012"
FT                   /locus_tag="XNC1_0067"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0067"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88155"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG65"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88155.1"
FT                   /translation="MYPSKWYIGLDIQDHDIRALAAIKRRDGWQLRHCWQYRLSGEIIS
FT                   GGRLQNPEKLRHILIQWRQILPKNISLRLALPVQQTLQRQFTLPDHASLQEPELGWFVY
FT                   ASAEKQFPVSDLALDYRIHDQQVCISAIRQKDLNLWLKLFADINLYPDAIDIAPCALRY
FT                   AARLSGIPDNSWLVHKRTMDWLWVSPVNPAFGYGLIASQAYPHLAQVIKQLPITPETGS
FT                   NAIYCSSEERDEEEQIISAKTAAELTESIHHWQLLSAFRHYHPPLPEQTNTFIIAAGLA
FT                   LRPDDK"
FT   regulatory      69422..69481
FT                   /regulatory_class="promoter"
FT   regulatory      complement(69474..69533)
FT                   /regulatory_class="promoter"
FT   CDS_pept        69562..72072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcA"
FT                   /locus_tag="XNC1_0068"
FT                   /product="bifunctional penicillin-binding protein 1a:
FT                   transglycosylase (N-terminal); transpeptidase (C-terminal)"
FT                   /EC_number="2.4.2.-"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0068"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88156"
FT                   /db_xref="GOA:D3VG66"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG66"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88156.1"
FT                   /translation="MILIVVCILLGTASIFGLYKYIEPQLPDVATLKDVRLQTPMQVFS
FT                   ADDELIAQYGEKRRLPLTLSEMPPLMVKAFIATEDSRFYEHHGVDPIGIIRAVSVVMTS
FT                   GHATQGASTITQQLARNFFLSPEKTLIRKAKEAFLAIKIEQLLTKDEILELYLNKIYLG
FT                   QRAYGIGAAAQVYFGKTVNELTLSEMAMIAGLPKAPSTFNPLYSYDRAMSRRNVVLGRM
FT                   LEEGYITQRQYNEAREEKLVARYHGPQIVFSAPYLTEMARQEIINRYGENAYTDGYKVY
FT                   TTITRKAQLAAVNAVRTNVIDYDIRHGYRGAQEVLWKASQPAWDQALIINKLKTLPKYG
FT                   PLVPAVVTGSSANQAEAMLVDGSKVELTMAGVRWARSFKTDSLQGPVPRRVNDVIHAGE
FT                   QIWVRKVNDIWWLAQLPQVNAALVSINPLNGAVEALVGGFNFELSKFNRVTQSLRQVGS
FT                   NIKPFLYTAAMDKGLTLASLLNDAPISRWDAGAGTDWRPKNSPPTYDGPVRLRQGLGQS
FT                   KNVVMVRAMRAMGVDYAADYLKRFGLPGENVVRTESLALGSPSFTPMQLVRGYAVMANG
FT                   GYLVDPYFIARIENEEGNVLFEAKPKLACPQCENIPVIYGETARSIELSEDSIENVAHS
FT                   DEPQDSALPPQPDLERVSANTDVDDQQYAPHVISTPLAFLIHDALNTNVFGEPGWMGTG
FT                   WRAARDLKRRDIGGKTGTTNSSKDAWFSGYGPDIVATAWIGFDEHSRSLGRTPALKGEG
FT                   GAKTAQPIWDDFMKVALEGVPEKIMEPPAGIVSVTIDRATGKLSSGGGNTRKEYFIEGT
FT                   QPTEYAVPDVGTTVTENGESHELF"
FT   regulatory      complement(72095..72150)
FT                   /regulatory_class="terminator"
FT   regulatory      72115..72153
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(72194..72604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0069"
FT                   /product="putative transposase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0069"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88157"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG67"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88157.1"
FT                   /translation="MALFMRKREPSIHTGRQFVTAQHLPVLERVLSLADYLRQMGKRSA
FT                   FIVADILDEQDWTPFERQSASTGRAPYSPHAMMGILLYGIMKGHCSLRELERLARFDLG
FT                   CIFVSQGITPDHASLGRFIIPLWMEASSLPKP"
FT   CDS_pept        complement(72746..73138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0070"
FT                   /product="transposase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0070"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88158"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG68"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88158.1"
FT                   /translation="MQSLKIRTGNRDAAAARRFFRKAIRHHGEPERVTIDKSSANTAAR
FT                   EALNRGKPEEEAIVVRQNKYLNNLIEQDHRNIKRRIRSRLGFKSFRRAQTLLAGIEIVS
FT                   MLRKGQYFQPTGKPLSPAAMFYHLVA"
FT   regulatory      complement(72751..72810)
FT                   /locus_tag="XNC1_0070"
FT                   /regulatory_class="promoter"
FT   regulatory      72885..72944
FT                   /regulatory_class="promoter"
FT   CDS_pept        73061..73534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0071"
FT                   /product="Putative NADPH-quinone reductase, YabF family
FT                   (fragment)"
FT                   /EC_number="1.10.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0071"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88159"
FT                   /db_xref="GOA:D3VG69"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG69"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88159.1"
FT                   /translation="MANGFAKKAPCCGSIAIASPDFEALHRGEVLPDVAKSLAMVKEAD
FT                   HLIFIYSVWWFGQPAILKGWIDRVFSNGFAYYEDEKGFTPYLTGKSATIFITLGTPEQV
FT                   LAQNDMELDHFMRGMTLGTLGLVGIYPTKIVPFYAIPKSSDEERRMMLESVTI"
FT   regulatory      73556..73594
FT                   /regulatory_class="terminator"
FT   operon          complement(73600..79763)
FT                   /operon="XNC1_operon0013"
FT   CDS_pept        complement(73600..74403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0013"
FT                   /locus_tag="XNC1_0072"
FT                   /product="putative Protein tonB"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0072"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88160"
FT                   /db_xref="GOA:D3VG70"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG70"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88160.1"
FT                   /translation="MTHTAIFDNPTLISQKGLLISILIAILLHINLIWLFNRHTSYPDD
FT                   AAHHINNNASAMTLSITMVAASSWNHEPEPVSPPPPLLTAPESPTKPEIALDKAVHPEN
FT                   RVEKPQGSHKPKKRQKPQKEKPQEIAAKKPIQSTPVQKEINAETHGSDQVNSQSSMSRA
FT                   STSQPLVGQGKSEWDNYHARLRQEIEHHKEYPRKAKRMKQQGIVIINFTLLNDGTLTAA
FT                   KVVNSSGNSTLDNAALNAIHRARSVGVKPADIPSDVTLRLDFKLD"
FT   CDS_pept        complement(74420..77398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0013"
FT                   /locus_tag="XNC1_0073"
FT                   /product="putative receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0073"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88161"
FT                   /db_xref="GOA:D3VG71"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG71"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88161.1"
FT                   /translation="MVYRVKTQLTPITIALSLAFSLAASPLFAESKSTATSPNNKTDLG
FT                   KISVTDTSDKDEAGYDAVYDRDISNIYIGKKEIERYKGTSPADLLKGAVGVYSGDARNS
FT                   GALDINIRGIQGQGRIPVTIDGTEQAITVGRGYNGANNRNYIDPNLISSIEIEKGPSLN
FT                   RNIKGSVGGAVAIKTLGIDDVVPKGETFGINTKLETSSNSVRERTPSLSLGQDYRDIPN
FT                   FARNGIETDPALQITPHSSKDNKLFGYKDNAFRFAVGTRQESFDLMLAYAYRRQGNYFA
FT                   GKGGAHRYDESITETDRELMKGARTTLDPYLPFAARIYRPGNEVPNTSSEMRSVLIKNT
FT                   WRFTDDQTLLLGFRNTHMDFGDIMPSRLGWVDPADNKVPQWPLANVHQQAANLHYKWQP
FT                   TDNPYADFDMNLWTTRTTSNTNTAGGYPRTPTDRDWNWENKKASRNNNIDGTLINSAVT
FT                   HSQNNRWGIDISNKFTLHSSLDLTLIGNFQRERLDSNDDYNSTNMYFFQSPSRRGQRQE
FT                   INLAFNFDWRPTSWLELKAGAKRVSYWSQDDVLNERRAAKDWRYEKQRETIGHQMSYWR
FT                   TPTEKEADMVRKREEFMRSNKISQMSRAERQVYLNKLGTEYPAIKTTNISSRNGQKRKM
FT                   VREEFVWRYDTGTGQLNKSDNPYFNGQLDMNEKVIDPISGKEGYKYEYGMAVDANGLSG
FT                   PEVNNPWEPTAKRKAHAWAPSFSATAYVTDDLRLYTRYVEAVRMPSLFEDTVGFSGSKT
FT                   NRVGQRFKPERAKTIETGFVYDFSQLVDAERHADIKFSYYNTVIENVFDRDNTYQLSQM
FT                   DKQKIAGLELQARYDNGGFFTDMGLTYNMKNKVCDHNSVMRMDSLNRHGIPECIDGGFP
FT                   GGYLRTSIQPQYSANLTIGGRLLDEKLELGSRMLYHSKAENKEEKWLMNALPDTYKGQS
FT                   NNPMRWNPVFTVDAYISYQITPDVSLELVGTNLTNRYYLDPLTRSMMPAPGRTFKLSLT
FT                   SQF"
FT   CDS_pept        complement(77459..78934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0013"
FT                   /locus_tag="XNC1_0074"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0074"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88162"
FT                   /db_xref="InterPro:IPR007655"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG72"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88162.1"
FT                   /translation="MSDNRTTPILAAALIALCLSLSVYADEDTSRNIWLDAQHNQQENE
FT                   TNLITPDPIFMGSNSSFIVINGQTFQVGNNINDLGQALFLAINHQQWPDVRRFLAAYQK
FT                   LPEHDAMLVNFAQGGLARLEGDLDLATYHYQQILHQQPDFPRIELELARIYFEDHQNRE
FT                   AKQLFTGLNEKQQLPAAVLKNINSYLEAIELRTGWRGSFSAGYAYNDNVNMSSNHGPIC
FT                   LSYSMGICTKKQQVPKAIKAWGMSYDATLSRRYQLSDHHGIFGRGLMYGENYRNYHDGN
FT                   ENTFLLVGGYNFKNRNHDFSFGPLFEYKQRTDDTTYRAIGAKTEWRWAFTNKTTLNIEL
FT                   EHKQLRHQEQRYRRKDGELSSTYLTLSHAINKNVVLFGGGDWLYRNNDHYREDSYQQWG
FT                   IRAGIAGELYSGITGSLFATLKERRFGAYTPMLNATRQDTEQIYTAVIKVPAAEILGMT
FT                   PSLTFRHRRNHSNVDWLYSYNKNEVLIRLEKYF"
FT   regulatory      complement(78962..79021)
FT                   /operon="XNC1_operon0013"
FT                   /regulatory_class="promoter"
FT   regulatory      complement(78965..79010)
FT                   /operon="XNC1_operon0013"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(79023..79763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0013"
FT                   /locus_tag="XNC1_0075"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0075"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88163"
FT                   /db_xref="InterPro:IPR001677"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG73"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88163.1"
FT                   /translation="MKKFNVLVAALGALGFMAQAQAAVGFGQSQDETTPHIKVGATQPG
FT                   SGPHGGKGGEPGIGVSSVYGGQITGFAGLTRMAPADSNGIHNISMAGAPGSHGGMGVFH
FT                   FSKVANADVYFGEWSQTGQASDSTHTVYYAGKDVTTNIPTDGTATYTVTGINQYSGDNA
FT                   LSGTFTADFGEKTLAGSLANTAMTIDIDASIGADAKFEGAAITDTLVGQTNGHFFGDSA
FT                   ASLAGYATFADDSTKDTAFGGSKQ"
FT   regulatory      complement(79927..79986)
FT                   /regulatory_class="promoter"
FT   regulatory      80183..80242
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(80195..80392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0076"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88164"
FT                   /db_xref="GOA:D3VG74"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG74"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88164.1"
FT                   /translation="MSPTELNDYIRRLSSCRFVGCILKSIGDIYISVRAIIFLFYFFTR
FT                   HKRKYEKKYTNEIYLVNFLY"
FT   CDS_pept        80396..81160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0077"
FT                   /product="putative transferase enzyme"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0077"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88165"
FT                   /db_xref="GOA:D3VG75"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG75"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88165.1"
FT                   /translation="MEAKIVIQSAEERTDLESAINEILDSNWPEFMNYGSVSEQYWDKL
FT                   YEPGFSRFQKVAIMQQGQQERVVGMLNSIPFPWEYHSLDQLPDEGWDAVLRAGVEAKGK
FT                   QKTNMLSALAVTVVPEFRGHNIPALLINSVKQTARDEGLEGLVVPVRPSLKSQYPLQDF
FT                   VEYCGWKNEQGEPFDPWIRTHCRLGAKIIKPALRSMDIYGSLAQWQAWTGMVFPQSGEY
FT                   IIPGGLVPLVVDAEKQMAYYIEPNLWMFHHLG"
FT   regulatory      complement(80520..80579)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(81166..81996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdhD"
FT                   /locus_tag="XNC1_0078"
FT                   /product="formate dehydrogenase formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0078"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88166"
FT                   /db_xref="GOA:D3VG76"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG76"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88166.1"
FT                   /translation="MDNTKSGNQLAIEGICGAFQINVKHKNNLNSSRPDWVAEEVPIAL
FT                   VYNGISHVVMMASPKDLAHFAIGFSLSEGIITSPQEIRGIDSVISCHGGIELHIELSNR
FT                   RFAALKERRRNMAGRTGCGICGTEQLADVFRPISPLPFTQTFSLSHLDAALSRLPDLQE
FT                   IGVLTGCTHAAGWISTEGNLLGGCEDVGRHVALDKLLGMRAKTGWQQGAVLVSSRASYE
FT                   MVQKSAHCGVEILFAVSAATSLAIEVAQKCHLTLIGFCKPGRATIYTHPQRVVD"
FT   regulatory      82005..82064
FT                   /regulatory_class="promoter"
FT   regulatory      complement(82018..82077)
FT                   /regulatory_class="promoter"
FT   operon          82145..83430
FT                   /operon="XNC1_operon0014"
FT   CDS_pept        82145..82399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0014"
FT                   /locus_tag="XNC1_0079"
FT                   /product="formate dehydrogenase-O, major subunit
FT                   (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0079"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88167"
FT                   /db_xref="GOA:D3VG77"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG77"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88167.1"
FT                   /translation="MQVSRRQFFKICAGGMAGTTAAALPTAAIAQTRNYKLLRARETRN
FT                   TCTYCSVGCGLLMYSLGDGAKNRGISVSTISAKRGSTGQ"
FT   CDS_pept        82396..82695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0014"
FT                   /locus_tag="XNC1_0080"
FT                   /product="formate dehydrogenase-O, cytochrome B556 (FDO)
FT                   subunit (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0080"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88168"
FT                   /db_xref="GOA:D3VG78"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG78"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88168.1"
FT                   /translation="MSVFLFLLLVSGIVIWRPYFAEYFPIPLIRIALLVHSLAAIGLIL
FT                   TIIVHTYAAFWVKGSVRAMVEGWVTRGWAKKHHPRWYREIVEQEQQNGQQKEKE"
FT   CDS_pept        82739..83017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0014"
FT                   /locus_tag="XNC1_0081"
FT                   /product="CcdA protein"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 15774890; Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0081"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88169"
FT                   /db_xref="InterPro:IPR009956"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG79"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88169.1"
FT                   /translation="MTRVLTRVICGDYMTALHSRTKKTVSVTVSPELYEQAKQIGLNFS
FT                   AILTQALIAELKSAAAEQWKRDNREGFEELNRITREHGLLSDQYRTF"
FT   CDS_pept        83019..83324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0014"
FT                   /locus_tag="XNC1_0082"
FT                   /product="Cytotoxic protein CcdB"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 15774890; Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0082"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88170"
FT                   /db_xref="GOA:D3VG80"
FT                   /db_xref="InterPro:IPR002712"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG80"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88170.1"
FT                   /translation="MQYTVYKNTGNPDYSYLLDVQSDIIDVLETRLVIPLFLKSNFHGR
FT                   IPTRLCPTLNIDGNEYLVMTHAMASIRVSMLGDEMTNVSSHRQLIKDAMDLLFDGF"
FT   CDS_pept        83293..83430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0014"
FT                   /locus_tag="XNC1_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0083"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88171"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG81"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88171.1"
FT                   /translation="MRWIYSLTGFEQAGPRSHPIELNREVENETGGGAFPPVLQDVMGF
FT                   "
FT   regulatory      complement(83364..83411)
FT                   /regulatory_class="terminator"
FT   operon          complement(83427..85704)
FT                   /operon="XNC1_operon0015"
FT   CDS_pept        complement(83427..85505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0015"
FT                   /locus_tag="XNC1_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0084"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88172"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG82"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88172.1"
FT                   /translation="MKLTPEKLFTAINEYAHQPEKKRYLTPKQVQWFADPENVFLLIAI
FT                   VLTIPEEVMDKIGDSISNWVEAAIAELALTATKLPVGVKRQFEGAIEETLNHAKENFAL
FT                   NSECVLLLLSILKKNQFNIQTDITQLLEISEHDDNAGVVSFPTQPIRLSQLLDQYDIQS
FT                   GIEFIEFFENGVSVVPHEALPHLLSELSKYSWGIDALLLLTQYFEEPVALASGQVLDSC
FT                   PSSAWANLSYQQLINLCARFNRHPSVKHSMKRWKKLAMKHCHARATAKIHELYVSHVDG
FT                   NDCASIMMKATLNGEDDQLSMMLDFKSGIRETFLDIDPNKSLTELIAQLDDSVDFTPVS
FT                   PEWLQQILPWILSVQHSKNTPLDLYSLYWLSQLPAEWTEPEEFEFENWNQKLSYQADFQ
FT                   RKERNRLSSIYMKHFSPLLMTWLAPEECLLEAKKPRDLLKNYYYANRDLFTERLTYSAA
FT                   VERYKLPPSAQRFANDYLDLAHSLHDPALNRKKFSLFDALSEMSFEFFAMMLDPVNAEL
FT                   PLQGLVIKVSLLDASPAVWRRISVSNQLTLCELHDVIQDAMGWENAHLYCFDIGGIEIP
FT                   EEHYDQVRIGIFLNDIGSTLNYQYDFGDDWSHQVTVEKLLPKDIIQPEVTAGNGMCPAE
FT                   DSGGIWHWNHLLKLRKKKILTEEEAEQLEWAGLSPDEQPEPFDKQLANKRLKALFNY"
FT   regulatory      85433..85492
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(85489..85704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0015"
FT                   /locus_tag="XNC1_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0085"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88173"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG83"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88173.1"
FT                   /translation="MDRYTTILPCQTEEWHGREVPANLLVAHLQVSVKLSVLYLSGKSG
FT                   IISINHEHSSLVHLSIIEELNHETHT"
FT   operon          85742..86987
FT                   /operon="XNC1_operon0016"
FT   CDS_pept        85742..86050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0016"
FT                   /locus_tag="XNC1_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0086"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88174"
FT                   /db_xref="GOA:D3VG84"
FT                   /db_xref="InterPro:IPR006452"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG84"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88174.1"
FT                   /translation="MSILKNLYQHRAERLKTLATENHPFSSYLNFAAEIVQAQQKALYD
FT                   NPLSHPVTGVTRLAIRSFVCHSRRHRRRYCTTQRIFTFYSSITADSPASSLFSKSTA"
FT   regulatory      complement(85823..85882)
FT                   /regulatory_class="promoter"
FT   CDS_pept        85902..86987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0016"
FT                   /locus_tag="XNC1_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0087"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88175"
FT                   /db_xref="GOA:D3VG85"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015190"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG85"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88175.1"
FT                   /translation="MSQGWQSVPLFVTAAVTGEGIAPLREYLRSIHQSQLTHQHHHSFQ
FT                   NPQPEKLSQRFRLAVDRVFTVKGAGIVVTGTALAGRVSVGDALWLTGSEQTIRVRGLHA
FT                   QNQPAFLDWLSQLAITRHHAGNLASHLPQGALSLSHFAWARQLTESQLSHLLAEMNVII
FT                   AGDWALSLHNAELAEQRLLQVLAEYHAKHPDQLGVGKARLRRMALPTLDETLVYTLINR
FT                   LLEQKALKQTHGLAFTDEQASLWLKAEPYFNTEVWWVRDLATEMGEDEAIIRHLLRTAA
FT                   QLGMIIAIVPDRYYHRQRIQQFADVIRQYDQDKGGITAVGFRDEFSIGRKLAIQILEFF
FT                   DRTGFTRRKADLHMLRDEEIF"
FT   regulatory      87009..87068
FT                   /regulatory_class="promoter"
FT   CDS_pept        87143..88792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0088"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0088"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88176"
FT                   /db_xref="GOA:D3VG86"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG86"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88176.1"
FT                   /translation="MKKKIISRVYLGLLLIASLILVLEKGGDIYPALVSVGVFGVIFGL
FT                   VFFVSARWLFSAVLAGTLFIILKFLNQIKVHYYKEQLMFSDLNVMLDPSNQETLRHYWL
FT                   AGIAIGAMIIWLIFNMVLSWKTALPVRRMKWRLASLVLMAAGVFGINLTVSAYHNQWIG
FT                   ELPKGRGTMTNMVMSAMDSKYHPPRFGTSADYFLQQAKKVTLPEVQSDVKPDVVVLLQE
FT                   STVNPHLYQLPADVKLPDLYMFQRDVNTSAQSPLRVQTFGGGTWLSEFSVLTGLNTDDF
FT                   GARKNAVFYFVVDHLQNSLFHAMKENGYYTVVLTPFNKSAYHAGHAYKTLGVDRIIQPQ
FT                   ELGYPASMDENLWTISTQDMLSYVKTILAKETDKPVFIFSLTMYEHGPYEESHHDDYGL
FT                   TGKIDRSATVGKFSHYMEKITASDSAIKDFSEFVAKRDKPTVFLSFGDHQPSIHVAHYN
FT                   SLLPDPAHITQFTLRDNLKQGASITTGKLTDISFLGGMILERARLFAPEFYQANMTMRH
FT                   LCDGALNDCQDTALVESYKHYIYQQLGVAGKE"
FT   regulatory      88815..88862
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(88926..89705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0089"
FT                   /product="GntR-family transcriptional regulator"
FT                   /EC_number="2.7.1.48"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0089"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88177"
FT                   /db_xref="GOA:D3VG87"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG87"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88177.1"
FT                   /translation="MRNHFVDWVREQLEKRSNSPRYIQLQQAIEAAIEKQLLKADEFLP
FT                   PERRLAESLNISRVTVSKAMQLLEEKGVIVRQQGIGTQVAKLADASLNQAVGFTAQIIK
FT                   EGGTVSNYWLSRNIIPAPADIAKKLSINTGEHIAELRRIRFANNTPVSLENTYIPQKYL
FT                   PHPELLEGSLYAHWEEHNIHLTNVNHKIKAISCPAELAISLHVTENSPLLQIHQISFNN
FT                   QNEIIEFSEILCRGDIYGLDFNSAQNIDINYNQKNNS"
FT   regulatory      89793..89852
FT                   /regulatory_class="promoter"
FT   regulatory      complement(89943..90002)
FT                   /regulatory_class="promoter"
FT   operon          89999..92675
FT                   /operon="XNC1_operon0017"
FT   CDS_pept        89999..90265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0017"
FT                   /locus_tag="XNC1_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0090"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88178"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG88"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88178.1"
FT                   /translation="MTPALARYGGLNVRLSCWFEETETLLALSWANQVGKLCSGHGVIF
FT                   YGTPKRVRFFCADPGKENRRSYDQSHFQDAIHYPHSLLSRGLS"
FT   CDS_pept        90355..91812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0017"
FT                   /locus_tag="XNC1_0091"
FT                   /product="Cytosine/purines, uracil, thiamine, allantoin
FT                   permease family protein (modular protein)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0091"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88179"
FT                   /db_xref="GOA:D3VG89"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG89"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88179.1"
FT                   /translation="MSTQQNRHRFWKVERTGIDLVPASERTGTPLDLFWVWSAANIGIL
FT                   GIVYGAIIVSFKLSFLQSVLAALIGLSSFALVGYVSFSGKRGRTTTLTLSRTIFGIKGN
FT                   TAPTVIFWFISMGWESINIVTGTLTLSALFQACGLAESTLLTVASMILFAGLSIGVTLL
FT                   GKEMVITLQRWVIQIFGIMTLVVVFYILMMTKWETVLSMPPGSWLTGFLPAVSVVAAGS
FT                   GIAWAASSADYSRFQNENSSNAKIFTAVTAGGMIPLVLLLFAGILLSVQLPDLPNSDNP
FT                   IAHIGSILPDWMLIPYLMTALAGIVIMAVMSLYSASLNLLTLGIKVKRIHAVTIDSVIV
FT                   LTVAVYTLFVTGDFMGPFIAFLIFFGVFLAAWEAVFLLDYIVIRRKQGYCPDTLFNDSG
FT                   PNGGIKWVPISCWLLGALAGFMVTKNDFMSGPWAVGIFANSSFGLFLSFFVSLICYGLY
FT                   LMLNRDKRLKHLYCLSLSWDRRQGILF"
FT   CDS_pept        91782..92675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0017"
FT                   /gene="yegV"
FT                   /locus_tag="XNC1_0092"
FT                   /product="putative sugar kinase with ribokinase-like
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0092"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88180"
FT                   /db_xref="GOA:D3VG90"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG90"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88180.1"
FT                   /translation="MGSATGDIVLKLPELPDDGEYWEAEEVDRQVGGCALNVARALRRL
FT                   QVPVINGIFVGNGTWGASVAAEMENLGLKVTLRHPTKDNSWCFAMMKPDGKRIYVSVPG
FT                   CDDAWNTEVLATIPLPEQGFLYASGYELANPTAGDLREWLLASPVGLTLVLDFGPRLVD
FT                   IDPEFIRTLPVGRTILSLNEDEITVLCGDGDSMTQAGRYADEQGFTIIARVGAEGAWIC
FT                   QPNRSPEYVPAYKVRFEDRIGAGDAHCGGMLAGLSQGMSLRDAVDFGNRVAAIVVSLPG
FT                   ANGAPTKDELENFTVG"
FT   regulatory      92730..92789
FT                   /regulatory_class="promoter"
FT   CDS_pept        92814..93137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0093"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0093"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88181"
FT                   /db_xref="GOA:D3VG91"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG91"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88181.1"
FT                   /translation="MRKITSFSMGEQLDGFVQRMIESGRYGSTSEVMRSALRLLEQQEN
FT                   QDEAIRNAVIDGLNSGKSSLTLRDIAEQRKRQRISKPLTVLPISPDTNPDIFNIHLHQI
FT                   ASV"
FT   CDS_pept        complement(93176..93769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0094"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0094"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88182"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG92"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88182.1"
FT                   /translation="MLLKTRGALQASDAGKLLGTTGEAARQQFVKLAKEGLIEAKSETR
FT                   GVGRPVQLWHLTKKGHAQFPDTHAELTTQLITIIRNQLGETAMDVIIHSREKEALSNYK
FT                   KNMEGITHLQERVERLVAIRCREGYMANYSIEENGAFLFFENHCPICSAAKICQGFCRT
FT                   ELKIFREILQANVERTEYILSGDRRCAYRITPLV"
FT   regulatory      93813..93872
FT                   /regulatory_class="promoter"
FT   regulatory      complement(93869..93928)
FT                   /regulatory_class="promoter"
FT   CDS_pept        93927..95336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0095"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0095"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88183"
FT                   /db_xref="GOA:D3VG93"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG93"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88183.1"
FT                   /translation="MIMTEEGRWRDLFSGKNASSAIVLSLGVGLMAVNTLIAITILPSI
FT                   VRDIGGLNLYAWNTTLFVIASIIGSILSARLLSTSGARNAYLVASLIFFVGSLICTLAP
FT                   SMGIMLIGRTVQGFGGGFLFALSYSMIHLVFEQALWSRAMALISGVWGIATLIGPAIGG
FT                   IFAEMNAWRYAFGTMVPVLLLYALFSYLILPKRVQSTTKTALPIIQLILLSVAVLAVSS
FT                   GSLSQDVRVNIIGIFIAVVLVFILIIYERRTSARLMPKNTFSLHSPHLILFATIFLLTV
FT                   GLSGDVFIPYFLQMLHGQSPLISGYMVAIAALGWSAGEMLSAGWQGAKMRFAVVSGPVF
FT                   MLAGMLFLFVILPYPSAGEWQIVLPIMLGLGLFGFGVGLGWPHLLTRLLQVSSEADKSI
FT                   AGSSITTIQLFSTAFGSALGGMIVNIFGFYEPGGKEGAAVSSYWLFLIFAIAPVLAFLT
FT                   AYKSAKIKVEK"
FT   CDS_pept        complement(95343..96227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0096"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0096"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88184"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D3V9L2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88184.1"
FT                   /translation="MYNLEELYCCVDDFCQKFIPLWHQQLIENGLRKRHREASLSLSEV
FT                   MMILILFHMSHYRDFKTFYIEHVKQYFTADFPGLVSYTRILTLKKRALIPLCAFLSSRK
FT                   AQTQGIAFIDSTKIAVCHNLRIPRHRVFEGMAQRGKTSTGWFYGFKLHLVINDCGELLA
FT                   VKLTAGNQDDRQPVRALTKGLTGCLYGDKGYLSQALCDELEAEGVTLITNVRNNMKTKA
FT                   LSLWDRLMLRRRFLIETVVDQLKNISQIEHSRHRSQLGFLLEVAAGLIAYTFQPKKPSL
FT                   NLRDNEIAIFKRS"
FT   regulatory      96334..96393
FT                   /regulatory_class="promoter"
FT   operon          96629..96962
FT                   /operon="XNC1_operon0018"
FT   CDS_pept        96629..96766
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0018"
FT                   /locus_tag="XNC1_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CBJ88185.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        96756..96962
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0018"
FT                   /locus_tag="XNC1_0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CBJ88186.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        complement(97098..98177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbp"
FT                   /locus_tag="XNC1_0099"
FT                   /product="sulfate transport protein (ABC superfamily,
FT                   peri_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0099"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88187"
FT                   /db_xref="GOA:D3VG97"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG97"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88187.1"
FT                   /translation="MVKNHNGLGEHLIVVMNTEVIKLKVRKYAISVIFFLALTIVLAAN
FT                   NAWAKEIQLLNVSYDPTRELYQQYDQAFSEYWHQKTGDTVKIRQSHGGSGKQATSVING
FT                   LQADVVTLALAYDVDAIAESGRTGKNWIQRLPDNSAPYTSTIVFLVRKGNPKQIKDWSD
FT                   LIRPDVSVVTPNPKTSGGARWNYLAAWGYGLAHHHQDQDKAKAFVKALYKNVEVLDSGA
FT                   RGATNTFVERGIGDVLIAWENEALLAINALGKGKFDIVTPSISILAEPTVAVVDKVVDK
FT                   RGTREVATEYLKYLYSPIGQEIAAKNYYRPRDNAVAEKYRAFFPELKLFTIDEVFGGWG
FT                   QAQKAHFATGGVFDEIIRR"
FT   regulatory      complement(98204..98263)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(98305..98343)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(98387..99364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfkA"
FT                   /locus_tag="XNC1_0100"
FT                   /product="6-phosphofructokinase I"
FT                   /EC_number="2.7.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0100"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88188"
FT                   /db_xref="GOA:D3VG98"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012828"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG98"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88188.1"
FT                   /translation="MINKIKRIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVYGIYDGY
FT                   LGLYENRMKKLDRFSVSDMINRGGTFLGSARFPEFRDDKVREIAIENMRKNGIEALVVI
FT                   GGDGSYLGAKKLTEAGFPCIGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSTS
FT                   HKRISIVEVMGRYCGDLTLSAAIAGGCEFIVLPECETPFDREELLAEIKAGIEKGKRHA
FT                   IVAITEHVCDVGELAKYIEAETRHETRATVLGHIQRGGAPVAYDRILASRMGAYSVQLL
FT                   LEGCGGRCVGIQNEKLVHHDIIDAVQNMQRIFKKDWLETAKKLY"
FT   regulatory      complement(99514..99573)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(99600..100499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yiiP"
FT                   /locus_tag="XNC1_0101"
FT                   /product="putative transport protein (CDF family)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0101"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88189"
FT                   /db_xref="GOA:D3VG99"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG99"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88189.1"
FT                   /translation="MSINYGRWISTAALAATVLASVLLIVKIFSWWLTGSVSLLAALVD
FT                   SLVDLAASLTNFFAVRYSLQPADKEHTFGHGKAESLAALAQSMFISGSAIFLFLTGLQH
FT                   LLSPKPLEHAVIGIWVIIIALISTLCLVTFQKWVLNKTQSQAIRADMLHYKSDLLMNGA
FT                   ILVALILSVYGFKRADALFALGIGCYILYSALRMGYDAVQSLLDRALPDEERQEIIEII
FT                   RNYPGISGGHDLKTRQSGPTRFIQFHLEMDDHLPLVQAHALAEGIENKLRNRFPGADII
FT                   IHQDPCSVIPEEHKNRWD"
FT   CDS_pept        100551..100739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0102"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88190"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGA0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88190.1"
FT                   /translation="MEKYRGCEAKLSYVVRVYFGIRTMYEYNAFYRRARMCFMESYFLL
FT                   KPPYSVCLLVTSQIMSK"
FT   regulatory      100760..100819
FT                   /regulatory_class="promoter"
FT   operon          100845..101495
FT                   /operon="XNC1_operon0019"
FT   CDS_pept        100845..101153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0019"
FT                   /locus_tag="XNC1_0103"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0103"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88191"
FT                   /db_xref="GOA:D3VGA1"
FT                   /db_xref="InterPro:IPR009387"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGA1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88191.1"
FT                   /translation="MYKRQVFSRERAELLTDDEFRHLQEHLLKNHEQGSTISATGGCKK
FT                   IRLQREGMGKRGGVRIIYYTIIKTGMLYLLLIYPKNKKDDLTPKQKEVLKAISNKLQ"
FT   CDS_pept        101199..101495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0019"
FT                   /locus_tag="XNC1_0104"
FT                   /product="putative transcriptional regulator with
FT                   DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0104"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88192"
FT                   /db_xref="GOA:D3VGA2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGA2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88192.1"
FT                   /translation="MDKKLFDDLIESMNQMVAIDKGELSVPAENIHRHRLPDVKKLRET
FT                   FGLKQSEFAEAVGVSASLIQSWEQHRRTPSGSSLKLLKMLERNPALINELSAL"
FT   regulatory      complement(101774..101815)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(101830..102246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcQ"
FT                   /locus_tag="XNC1_0105"
FT                   /product="putative regulator with DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0105"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88193"
FT                   /db_xref="GOA:D3VGA3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGA3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88193.1"
FT                   /translation="MRYPVTLEPVEEGGYFVSFPDIPEALTQGETREEALEMALDALIT
FT                   SFEFYFEDNEKIPLPSPIGQDDDYVDVPLSITSKVLMLNAFIDSKLTQTELASRMGVKK
FT                   QEVTRIFDLRHSTKIDTVGKAAAVIGHQLTLSMQ"
FT   CDS_pept        complement(102317..102478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0106"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88194"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGA4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88194.1"
FT                   /translation="MVKQSEFRRWLEAQGVEVSNGTNHLKLKYKGETKHYAETPQPRDK
FT                   RTTEESNS"
FT   regulatory      complement(102495..102554)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(102559..102586)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(102607..103050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0107"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88195"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGA5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88195.1"
FT                   /translation="MIGAYYHPSRSLNNIHQDAPYTDKPIPHYTHNGTGYHVTLPMIPS
FT                   LRPGVVVNQQRLSKVNLTNENMTLTWIPKGQQEIVAPVVWVGSQQINVMTLMLDTLDVV
FT                   KELAELTAAHTHHNTDTPENASAIRNTAHKSDGLKQKYSPVIG"
FT   regulatory      complement(103191..103250)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(103322..103356)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(103423..103923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpxP"
FT                   /locus_tag="XNC1_0108"
FT                   /product="Periplasmic protein; Putative negative regulator
FT                   of cpxR."
FT                   /note="Evidence 1a : Function experimentally demonstrated
FT                   in the studied strain; PubMedId : 17951441; Product type pr
FT                   : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0108"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88196"
FT                   /db_xref="GOA:D3VGA6"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGA6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88196.1"
FT                   /translation="MRNIAILALASMVVLRSTLALADTADTDDTPEAANPSPYCLSYEH
FT                   KRDSGYYRSDEHNYNYSYVFGGITLTEQQRQQMWDLVKKQHLHEQSIIDMRVERQKMYH
FT                   LLIEREFDEAAVRLQLEKIAEKNIDLGVEIARIRNQMYQLLTPEQKERLYKRYEGQTAQ
FT                   EMH"
FT   regulatory      103865..103924
FT                   /regulatory_class="promoter"
FT   regulatory      complement(103965..104024)
FT                   /regulatory_class="promoter"
FT   operon          104076..106147
FT                   /operon="XNC1_operon0020"
FT   CDS_pept        104076..104768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0020"
FT                   /gene="cpxR"
FT                   /locus_tag="XNC1_0109"
FT                   /product="response regulator in two-component regulatory
FT                   system with CpxA, regulates genes involved in
FT                   folding/degrading periplasmic proteins (OmpR family)"
FT                   /function="16.15 : Symbiosis"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 1a : Function experimentally demonstrated
FT                   in the studied strain; PubMedId : 17951441; Product type r
FT                   : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0109"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88197"
FT                   /db_xref="GOA:D3VGA7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGA7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88197.1"
FT                   /translation="MHKILLVDDDRELTSLLKELLEMEGFNVVIAHDGEQALQYIDSSI
FT                   DLLLLDIMMPRKNGIETLKELRQYHQTPVIMLTARGSDLDRVLGLELGADDYLPKPFND
FT                   RELVARIRAILRRSNWSEQQADIGTPILEIDKLQLSPGRQEASFDGTILDLTGTEFTLL
FT                   YLLAQHLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPNRTDELPWFKTLRGR
FT                   GYLMVSVK"
FT   CDS_pept        104765..106147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0020"
FT                   /gene="cpxA"
FT                   /locus_tag="XNC1_0110"
FT                   /product="sensory histidine kinase in two-component
FT                   regulatory system with CpxR, regulates genes involved in
FT                   folding/degrading periplasmic proteins, senses changes in
FT                   the cell envelope"
FT                   /function="16.15 : Symbiosis"
FT                   /function="15.9 : Pathogenesis"
FT                   /EC_number="2.7.1.-"
FT                   /note="Evidence 1a : Function experimentally demonstrated
FT                   in the studied strain; PubMedId : 17951441; Product type r
FT                   : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0110"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88198"
FT                   /db_xref="GOA:D3VGA8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR032404"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038515"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGA8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88198.1"
FT                   /translation="MINSLTARIFAIFWLTLALVLMVALMAPKLDSRQLTPLLDSEYQQ
FT                   GNKLAKQLEEELTRYPANDLFWWLRLDRAIAQLTPPGQSLLLVTSAGNIIDINTPTRQK
FT                   QVVRNFIGQSDNADHPKKKKYGRSEILGPFSIRDGEDHYQLYFVRPAGSPQSDFINLMF
FT                   DRPFLLPAATMLISAPLLLWLAWSLAKPARKLKNAADDVAKGNLRQHPELESGPQEFLA
FT                   TGSSFNQMISALERMVTAQQRLISDISHELRTPLTRLQLATALLRRRHGESKELARIET
FT                   ETQRLDGMINDLLVLSRNQHKNELLRENIKAYDIWHDILENAKFEVEQMNKTLDIVSPP
FT                   GAWVIYCNPATLGSALENIVRNALRYSDSHIAVAFKADNQGVTITVDDDGPGVSPEDRE
FT                   QIFRPFYRTDEARDRESGGTGLGLAIVETAISQHRGWVKAEDSPLGGLRLVIWLPLHGH
FT                   GR"
FT   regulatory      106257..106316
FT                   /regulatory_class="promoter"
FT   operon          106515..110598
FT                   /operon="XNC1_operon0021"
FT   CDS_pept        106515..107825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0021"
FT                   /locus_tag="XNC1_0111"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11554764; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0111"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88199"
FT                   /db_xref="GOA:D3VGA9"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGA9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88199.1"
FT                   /translation="MSFLSELINKFDNKSASVAIVGLGYVGLPLMLRYSDIGFKVIGFD
FT                   IDQNKTDKLSQGLSYIEHISSSKIKKAIETGFEATTDFSRISECDAIILCVPTPLNKYR
FT                   EPDMSFVINTTDMVKPFLRQGQVLSLESTTYPGTTEEELLPRVEENDLTVGEDIFLVYS
FT                   PEREDPGNPDFETRTIPKVIGGHTENCLKAGIAVYQPAIDQVVPVSSTKAAEMTKLLEN
FT                   IHRAVNIGLVNEMKLVADKMGIDIHEVIRAAATKPFGFVPYYPGPGLGGHCIPIDPFYL
FT                   TWKAREYGINTRFIELSGEVNSSMPDYVVTKTVLALNKINKSINGSRVLVLGISYKKNV
FT                   DDMRESPSVHIMEKLRELGALVEYSDPHVPVFPKMREHHFDLISQSLTSNNLNKFDCIV
FT                   LATDHDKFDYELIINNAKLIVDTRGKYSPNHNNVIKA"
FT   CDS_pept        107839..108888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0021"
FT                   /locus_tag="XNC1_0112"
FT                   /product="Myo-inositol 2-dehydrogenase"
FT                   /EC_number="1.1.1.18"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0112"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88200"
FT                   /db_xref="GOA:D3VGB0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGB0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88200.1"
FT                   /translation="MFDVIKDRKIKFALVGCGRISKNHFDSLAVHKDNAELVAICDTDN
FT                   AALHAAVEKTGVQGFNNLHNMLDNISADIIILTTPSGLHPEQAIACLEKGFNVITEKPM
FT                   ATRLSDGERMVKAADKVGKRLFVVKQNRLNATLQLLKRAVEEKRFGQINMVHLNVFWTR
FT                   PQDYYDQAAWRGTWEFDGGAFMNQASHYVDLLEWLIGPVKDIQAMMSTHLDIEAEDTGV
FT                   LNIKWRNGALGSMAVTMCTYPKNLEGSITILGEKGSARVGGLAVNEIQEWNFADEKDYD
FT                   QQVKDANYETTSVYGFGHPLYYKNVIDVMRGEAEPMTDGREGLKSLELLIAAYLAARDN
FT                   KTVSLPLVY"
FT   CDS_pept        108905..109495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0021"
FT                   /locus_tag="XNC1_0113"
FT                   /product="Acetyltransferases"
FT                   /EC_number="2.3.1.30"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0113"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88201"
FT                   /db_xref="GOA:D3VGB1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGB1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88201.1"
FT                   /translation="MSIIEEVMVHTSAIVDDGAQIGKNSRIWHFTHVCSGARIGEGCSL
FT                   GQNVFIGNKVIIGSHCKIQNNVSIYDNVYLEDGVFCGPSMVFTNVYNPRSFIERKNDYK
FT                   DTLVKKGATLGANCTIVCGTTIGSYAFIGAGAVVNKDVPDYALMVGVPAKQIGWMSEFG
FT                   EQLDLPLHGKASTTCPYTGHVYQLDDNSVKRIK"
FT   CDS_pept        109513..110598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0021"
FT                   /locus_tag="XNC1_0114"
FT                   /product="aminotransferase"
FT                   /EC_number="3.1.13.1"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0114"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88202"
FT                   /db_xref="GOA:D3VGB2"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGB2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88202.1"
FT                   /translation="MQFTDLAAQQLRIKDKIDQNIQKVLTHGKYILGPEVSELEEKLVE
FT                   YTGAKYCITCANGTDALQIALMAIGIKPGDEVITPGFTYIATAETVALLGGIPVYVDVK
FT                   QTTYNLDPELLEAAITPKTKAIIPVSLYGQCADFDEINAIAEKYNITVIEDAAQSFGAS
FT                   YKGKRSCNLTTISCTSFFPSKPLGCYGDGGAIFTSDEELAKVIRQIARHGQDRRYHHIR
FT                   VGINSRLDTLQAAILLPKLEIFDEEMALRQIVAKNYDKVLNEIGIITTPYIELHNISAY
FT                   AQYTIRVQNRDELQNKLKEKGIPTAVHYPLPLNKQPAVASGVVLPVGDQIAQEVISIPM
FT                   HPYLTEIQVLNITNILINHLK"
FT   regulatory      110826..110857
FT                   /regulatory_class="terminator"
FT   regulatory      111450..111509
FT                   /regulatory_class="promoter"
FT   operon          111567..115014
FT                   /operon="XNC1_operon0022"
FT   CDS_pept        111567..111773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0022"
FT                   /locus_tag="XNC1_0115"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0115"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88203"
FT                   /db_xref="GOA:D3VGB3"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGB3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88203.1"
FT                   /translation="MIFNKLTNSSKIFSAFIILIYVVVSYKHGLSVNNNMINLYLPYKN
FT                   YFIGDTQAYKNVDELKKIIEGIK"
FT   CDS_pept        111780..112907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0022"
FT                   /gene="rffE"
FT                   /locus_tag="XNC1_0116"
FT                   /product="UDP-N-acetyl glucosamine-2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0116"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88204"
FT                   /db_xref="GOA:D3VGB4"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGB4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88204.1"
FT                   /translation="MKILLVFGTRPEAIKMASLIYELKKHSNFNVRVCVTGQHRDMLDQ
FT                   VLNLFNIIPDIDLNIMESSQDLTSITCNILTKLKHVIFEEKPDLVLVHGDTTTTFAASL
FT                   SAFYHKVKVGHIEAGLRTGNIDSPWPEEANRKLVSSLACLHFTPTATARNNLISENINS
FT                   DTIFVTGNTVIDSLLEMKSIIGKNINLQTRFDYEFSFINKYKKSILITGHRRENFGQGF
FT                   QNICHAIKLLAQKNQDVCFIYPVHLNPNVKNVVEKTLYGQNNIYLISPQTYDSFVYLMS
FT                   RAYIILTDSGGIQEEAPSLGKPVLVMRNSTERPEAISAGTVKLVGTSTDEIYSSVTKLL
FT                   NNANLYLEMSKSCNPYGDGKASKYIAKILLKNFIN"
FT   CDS_pept        112913..113935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0022"
FT                   /locus_tag="XNC1_0117"
FT                   /product="putative Glycosyltransferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0117"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88205"
FT                   /db_xref="GOA:D3VGB5"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGB5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88205.1"
FT                   /translation="MYTFMISFITRNNPLTHPVLIALATALKRINNENDIQIKNLTSFF
FT                   INFYISHDNYKNANWIVVDDPIAFLYCVYKLKINHKKIIFYSLEMYEHQLLNDNLKNKM
FT                   RNSLFSLAHKHAQKKSFKIIFPSQNRLDFYLNCRNENHIKNKSVVIYNYPESNSLSIEK
FT                   PNDTYINLIETLKSNNKKIIIYAGSIQKGRDLEKFMSQLATSENHHLILIGHNKNYSNE
FT                   YFKTINNVSFLGPLPRKQVNYFYEQADIGLLQYENEPLNTKLCAPVKLWEYLYFKLNII
FT                   SNSNYAMQTEWKSHVDYFYKTNEDLMKILSVSEHKNKYLTDIPFLEEEIVSFIRDKLIP
FT                   "
FT   CDS_pept        113932..115014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0022"
FT                   /locus_tag="XNC1_0118"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0118"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88206"
FT                   /db_xref="GOA:D3VGB6"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGB6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88206.1"
FT                   /translation="MKNFLYTYGSFFIAKAISVSVYSSALALWIPEKIINSQFQYLILI
FT                   EFFYGMLLFPLKISIIKNKEDIYTYLLWSFVFVILGYIYSFINFDTNLNLFVLLIGISL
FT                   FPIRLILTVHGEITNIDNFILKENLSSISSSIICAILFFTGDMTNAKFLLNIIYRELLT
FT                   TVFIIIFNANFISTAFKIKKTKFKWRETNILAGIDYLFALFLFKNILFKVISNGYYMSS
FT                   EFSDKTIKFFSILYDPMAAIFGIALRRNLAIKGYAEYLKNTKYFFIILAIINTGFYFLV
FT                   INISEFYFLATVFLFVFLAALLNSILLISTYIRYIIISLLCSITLSLHLDILPSFDLIF
FT                   FLPIFIFVFIYKFNLVKKRL"
FT   CDS_pept        115441..115656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0119"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88207"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGB7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88207.1"
FT                   /translation="MTMLPLYGNSIQFICEMDGALGKAALFFLRLAGESPVVEGKPDHY
FT                   VASLASPAVTKEMKRRQRNVRAETDG"
FT   CDS_pept        complement(115678..116052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0120"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88208"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGB8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88208.1"
FT                   /translation="MSQADFLPIRSSFVNHDSPSLLCTVIVALSRSICLPALRSAIITR
FT                   FITTMADSDFLIPVSEVLYFGTCTRNTYSLEKYQDLLGSALFSTGSPTPETPVCPSYFT
FT                   SGPSRSLLPAGSTIPSAQHN"
FT   regulatory      115801..115860
FT                   /regulatory_class="promoter"
FT   CDS_pept        115816..115965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0121"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88209"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGB9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88209.1"
FT                   /translation="MILLKGISISGTSTKIQDLRNGYQEVGVSHSSDETSNDRGAKGWQ
FT                   TDRT"
FT   CDS_pept        115976..116347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0122"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase) (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0122"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88210"
FT                   /db_xref="GOA:D3VGC0"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGC0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88210.1"
FT                   /translation="MTVHSNDGLSWLTKLERIGKKSACDKKQVFNNLGHLLNRDMLKGQ
FT                   FLRLDGNRAVGIDRMTKAAYGEHLDENIHNLIVRIRRGMYRPKAARITQIPKEDGSKRP
FT                   LAISCIEDKLVQLSPQPDL"
FT   CDS_pept        116607..116852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0123"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase) (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0123"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88211"
FT                   /db_xref="GOA:D3VGC1"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGC1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88211.1"
FT                   /translation="MRGCPQGSILSPVLANIYLHYVIDEWFDEISRSHIHGRAEMVRYA
FT                   DDMVFTFEFLSEAKRFYKVLPKRLNKYGLELHDDKS"
FT   regulatory      116894..116926
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(117273..117527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0124"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88212"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGC2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88212.1"
FT                   /translation="MRATRTTGARDTVRYTEDEWLLQNLSYWLMAKVAPVIRVLHYATI
FT                   LKANQTKHTSCSSEPDVQNYRIRLPTDPSRHTYSARIEH"
FT   regulatory      117343..117402
FT                   /regulatory_class="promoter"
FT   CDS_pept        117545..118513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0125"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0125"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88213"
FT                   /db_xref="GOA:D3VGC3"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGC3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88213.1"
FT                   /translation="MEQVYYCGIDIAKSKFDCAIRLNNGKYKDKVFKNESEGFSTFINW
FT                   LAHHGFSHVHICMEATGIYWEAFAEYLADKGLTVSVINPAQIKAFSISLLVRNKTDRED
FT                   ARVISDFCFERKPAAWLAPSASEQSLWTLVLRLESLQKMRTQENNRLHVARENVTKSLT
FT                   DHIAWLNNEIEILQGDMLLLINGNAEMKQKKTLLESIPGLGVQTAAVLLSFGIHPGRFV
FT                   NARQAAAYAGVDPRLNESGSSVKGRPRLSKTGHAFLRKPLYMPAMTTLFRTAWGKHFYA
FT                   RLTAAGKAPKLIIGAMMRKLIHVAFGVLKTEKSFDQSLHGV"
FT   regulatory      complement(117614..117673)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(118546..118674)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0126"
FT                   /product="Transposase (fragment)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="PSEUDO:CBJ88214.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        complement(118605..118931)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0127"
FT                   /product="Transposase (fragment)"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ88215.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   regulatory      complement(118621..118669)
FT                   /locus_tag="XNC1_0126"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(118804..119514)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0128"
FT                   /product="Transposase (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ88216.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        complement(119537..119725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0129"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88217"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGC7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88217.1"
FT                   /translation="MLVSRPTQSPRQAPCILKFDYHKNDLAQCMQLASPEGFKPVEELL
FT                   THTLSHSSETRTVVRHP"
FT   regulatory      complement(119652..119711)
FT                   /locus_tag="XNC1_0129"
FT                   /regulatory_class="promoter"
FT   CDS_pept        119702..119896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0130"
FT                   /product="Insertion element IS1 1/5/6 protein insB
FT                   (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0130"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88218"
FT                   /db_xref="GOA:D3VGC8"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGC8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88218.1"
FT                   /translation="MGRSTHQQWSFVGDKKNQRWFWYTWKLRLKRIVAYVFGDRSRKTL
FT                   DKLLTLLSPFNIRFYCTDD"
FT   CDS_pept        120414..120983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0131"
FT                   /product="transposase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0131"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88219"
FT                   /db_xref="GOA:D3VGC9"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGC9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88219.1"
FT                   /translation="MRQKLVKFRTAQINALHGMLLEFGENLHKGRTPLAKEFPEGLERL
FT                   AARLPMYLISLLGGQYRCFADLDAYIDGIEKQLSVVAKQNEICQRLLEIPGIVSLIATA
FT                   AVATMGEASVFKSGREFAVFIGLVPKQTGSGGKAHLLGISKRGDTYLQTLFIHGINSAS
FT                   LVAKDPGLWITELKRRRPKVVANKLA"
FT   regulatory      121220..121279
FT                   /regulatory_class="promoter"
FT   operon          121308..125815
FT                   /operon="XNC1_operon0023"
FT   CDS_pept        121308..121946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0023"
FT                   /locus_tag="XNC1_0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0132"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88220"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGD0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88220.1"
FT                   /translation="MINNFNSVLVLAPHTDDGELGAGGTIAKLIENGKKITYVAFSTAE
FT                   ESVPKGMEKDILKTEVKAATKALGIKNDNLIIFNYQVRKLNYARQEILENLIEIRKKNK
FT                   FDLILMPSLKDIHQDHTTIAQEGLRAFKNATILGYELIWNNLSFDTTCFIKLDKHHIQK
FT                   KVSALHKYESQKNRDYMSEDFIFSLARTRGVQIGTKYAESFEVIRCVIN"
FT   CDS_pept        121931..122806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0023"
FT                   /locus_tag="XNC1_0133"
FT                   /product="Transferase hexapeptide repeat"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0133"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88221"
FT                   /db_xref="GOA:D3VGD1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGD1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88221.1"
FT                   /translation="MCYQLKFSVPIGKICKELNLFYRGNNSHITNISPINNIVNGSLSF
FT                   IKGDVKLLTPNVTLVCDESDMNFFNDKKTNFIISKNPRLDFIRILNFLEKESGFNHFSF
FT                   KSKISPTVSIGHNSIIEDGCIIHENVKIEHNVVIHSGTIIGAHTRIRANSSIGGDGFGF
FT                   ERTLDGIPIRFPHLGGVIIGENVEVGSNTCIARGTLSNTIIEDHVKIDNLVHIAHNCHI
FT                   GKGTFITACAEISGGVTIGNNSWIGPNSSIIQKKNIGDNSLIGIGAVLTKDMPESTVFA
FT                   GNPAKKIRDI"
FT   CDS_pept        122814..124049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0023"
FT                   /locus_tag="XNC1_0134"
FT                   /product="putative glycosyltransferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0134"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88222"
FT                   /db_xref="GOA:D3VGD2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88222.1"
FT                   /translation="MNILYINHYAGSPYHGMEFRPYYLAKEWLNNGHKITILASSFSHV
FT                   RSKQPNIKHKITEENIDGIHYIWYPTNKYKGNGILRVINIFSFLLQIILFNKKIIKKTK
FT                   PNIILASSTYPLDIWVAKYLAKKHKAKLIFEIHDLWPLSPIELGGMSPKHPFMTLCQYA
FT                   ENSAYKYSDAVISILPKVHQHVIKHGLDINKLHIIPNGIVYSDWEDGNYDKIPDNIRSK
FT                   INTLKNKGYTIVGYSGSHGIPNALRYLIEAADLLRDKPFHFILVGSGLEKNNLLEYKNS
FT                   LDLENITFFEPITKKQMPDLLTLFDISYIGAHKTPIYRFGISPNKLMDYMMAENVILSS
FT                   IEAGNDPVTDAACGITVEAESSKAIADALIKLSEYSLEEKQQMGKNGKNYVLKNHTYSV
FT                   LADKFLQVMKKL"
FT   CDS_pept        124046..125203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0023"
FT                   /gene="arnB"
FT                   /locus_tag="XNC1_0135"
FT                   /product="putative PLP-dependent aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0135"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88223"
FT                   /db_xref="GOA:D3VGD3"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGD3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88223.1"
FT                   /translation="MNNKFLPFALPEISEEEINEVVDSLKNGWITTGPKAKKFEQDFAN
FT                   YLGSDVEAIAVNSATAGLHLALEAIGIKPEDEVIVPTYTFTATAEVVRYLGADPVFVDS
FT                   LPDSLNIDPEAIRKAITTKTKAIIPVHFAGLSCDMDEIISIAKEFNLKIVEDAAHAFPT
FT                   IYNGKKIGTLDTDVTVFSFYANKTMTTAEGGMLVSRNPDIIKRAKVMRLHGISKDAFDR
FT                   YQSKTPAWYYEVMEPGFKYNMPDICAAIGIHQLRKIDSFQQKREEMAKFYDEELKNLPL
FT                   ILPTKPFSSDNQHAWHLYPIRLKNEVKISRDDFIIKMAEKNIGCSVHFIPLHKHPVWKN
FT                   TYSLSDKDFPVAENNFHKIISIPLYTKMTKDDQIRVINAIKEILK"
FT   CDS_pept        125204..125815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0023"
FT                   /locus_tag="XNC1_0136"
FT                   /product="Putative glycosyltransferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0136"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88224"
FT                   /db_xref="GOA:D3VGD4"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGD4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88224.1"
FT                   /translation="MKLTYDFFKRLFDFISSFMGMVILSPILIFIALWIKMDSKGPIFF
FT                   RQKRVGKYGKPFYIHKFRSMTLDAEEKGQLTIGNDSRITSSGKFIRKYKLDELAQLIDV
FT                   LLGTMSLVGPRPEVPKFIDKYPLDIRKKILSVKPGITDLASIEMINENEILSQYPDPHQ
FT                   AYIDIIMPIKAKYYLDYVKQKSFFLDVKIIFKTIYKIIFR"
FT   CDS_pept        complement(125808..125939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0137"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88225"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGD5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88225.1"
FT                   /translation="MSKRNHMLIQYEDAIMIISATININVFSNLSLSKKSVSFMNVT"
FT   regulatory      125959..126018
FT                   /regulatory_class="promoter"
FT   operon          126055..128288
FT                   /operon="XNC1_operon0024"
FT   CDS_pept        126055..127695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0024"
FT                   /locus_tag="XNC1_0138"
FT                   /product="putative dTDP-glucose-4,6-dehydratase/UDP-glucose
FT                   4-epimerase (WeeK) (WbpM)"
FT                   /EC_number="5.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0138"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88226"
FT                   /db_xref="GOA:D3VGD6"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGD6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88226.1"
FT                   /translation="MGILKWAIIGSFLSTLILIAFSLYQQAFLPRTVPIIYFSFLVILL
FT                   CGTRFFYRTLRNYTMSRGIPVIIYGAGESGRQLLPILREHREFEPVAFIDDNSKLKNLS
FT                   IHGVTVYSPNSIIDLIEKYNVKKILLSIPSASISERRYIIEKLQPTHCEILTIPNFNEL
FT                   VDGSAQIDTLRRVSVDDLLGREQVSPLPELLSKNILNKNVLVSGAGGSIGSELCRQIIQ
FT                   QKPNSLVLLELTEYALYSIERELQKINRDKKLNVNIIPILGDIKNSEKIDKILSKFHIN
FT                   TIYHAAAYKHVPLVELNTIEGIQNNIFGTLAIAQAALNQKVDKFVLISTDKAVRPTNIM
FT                   GATKRFAELILQALARQNKHTQFSMVRFGNVLGSSGSVVPLFEKQIANGGPITLTHKDI
FT                   TRYFMTIPEAAQLVIQAGAMGVNGDVFVLDMGESVRIYDLATKMIHLSGLTIKNENNLH
FT                   GDIEIKVTGLRPGEKLYEELLIGNNVSGTNHPRIMTANEIYLEWSELNKLIQELKSACY
FT                   ERNLDTIREILISAPLEFHPKDDICDLLK"
FT   regulatory      127702..127761
FT                   /operon="XNC1_operon0024"
FT                   /regulatory_class="promoter"
FT   CDS_pept        127785..128288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0024"
FT                   /gene="yibK"
FT                   /locus_tag="XNC1_0139"
FT                   /product="putative tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0139"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88227"
FT                   /db_xref="GOA:D3VGD7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGD7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88227.1"
FT                   /translation="MLNIVLFEPEIPPNTGNIIRLCANTGCQLHLIQPLGFTWDDKRLR
FT                   RAGLDYHEFANIKQHHDYNAFLESEGLSSVNSQSHSGARLFALTTKGTPAHSNVSYRDG
FT                   DYLMFGPETRGLPSYVLDNMPPEQKIRIPMLSDSRSMNLSNTVAVVVFEAWRQLGYPGA
FT                   LLRD"
FT   regulatory      complement(128283..128322)
FT                   /regulatory_class="terminator"
FT   regulatory      128293..128336
FT                   /regulatory_class="terminator"
FT   operon          complement(128356..131198)
FT                   /operon="XNC1_operon0025"
FT   CDS_pept        complement(128356..129177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0025"
FT                   /gene="cysE"
FT                   /locus_tag="XNC1_0140"
FT                   /product="serine acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0140"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88228"
FT                   /db_xref="GOA:D3VGD8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGD8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88228.1"
FT                   /translation="MSREELNEVWKNIKNEAKTLADCEPLLASFFHATLLKHANLGSAL
FT                   SYMLANKLASPIMPPIEVREVVESAYRSDPKMIESAARDIKAVRLRDPAVDKYSTPLLY
FT                   LKGFHALQAYRIAHWLWKQDRKALAIYLQNQISVSFGVDIHPAARIGCGIMLDHATGIV
FT                   IGETAVVENDVSILQSVTLGGTGKAGGDRHPKVREGVMIGAGSKILGNIEIGRGAKIGA
FT                   GSVVLRPVPPHTTVAGVPARIVGKPESDKPSLDMNQHFNGINNGFENGDGI"
FT   CDS_pept        complement(129197..130201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0025"
FT                   /gene="gpsA"
FT                   /locus_tag="XNC1_0141"
FT                   /product="glycerol-3-phosphate dehydrogenase (NAD+)"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0141"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88229"
FT                   /db_xref="GOA:D3VGU4"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGU4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88229.1"
FT                   /translation="MTVIGAGSYGTALAITLARNGYKVVLWGHNPEHIQTLQQTRCNQT
FT                   FLPDVSFPDSLRPETDLKNAVSASRDILIVVPSHVFNDVLQQIKPHLQHDSRIVWATKG
FT                   LEAETGRLLQDVAREILGNEIPLAVVSGPTFAKELAAGLPTAIAVSATTPEFGEELQQL
FT                   FHCGKSFRVYKNPDFIGVQLGGAIKNVIAIGAGISDGMGFGANARTALITRGLAEMSRL
FT                   GVALGADPSTFMGMAGLGDLVLTCTDNQSRNRRFGMMLGQGVNVDDAQHEIGQVVEGYR
FT                   NTKEVRALAERTGVEMPITEQIYQILYCNKNVIEAARALLGRATRDEGEVSQS"
FT   CDS_pept        complement(130216..130686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0025"
FT                   /gene="secB"
FT                   /locus_tag="XNC1_0142"
FT                   /product="molecular chaperone in protein export, enhances
FT                   activity of SecA (General Secretory Pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0142"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88230"
FT                   /db_xref="GOA:D3VGU5"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGU5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88230.1"
FT                   /translation="MSEQNNTEMAFQIQRIYTKDVSFEAPKAPQIFQQEWQPEVKLDLD
FT                   TASNELVQGVYEVVLRVTVTATLEEETAFLCEVQQAGIFSIDGIEGTQLAHCLGAYCPN
FT                   ILFPYARECITSLVGRGTFPQLNLAPVNFDALFMNYLQQQAEAQPNQAEQEA"
FT   CDS_pept        complement(130761..131198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0025"
FT                   /locus_tag="XNC1_0143"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0143"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88231"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGU6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88231.1"
FT                   /translation="MLQEIMQFISRNTILSLVWIALLVAVIVMTAKSAFSKCKEITRAQ
FT                   AIHLINKEDAVVVDLRSRDDFRKGHIIGSVNLIPSEIKDNNLGELEKHKKQPVIVVSAN
FT                   GMEARTPAENLVRFGFEQVYSLKEGVAGWSGENLPLARGKK"
FT   regulatory      131322..131381
FT                   /regulatory_class="promoter"
FT   regulatory      complement(131322..131381)
FT                   /regulatory_class="promoter"
FT   operon          131464..132095
FT                   /operon="XNC1_operon0026"
FT   CDS_pept        131464..131781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0026"
FT                   /locus_tag="XNC1_0144"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0144"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88232"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGU7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88232.1"
FT                   /translation="MNTIKHYLTSDDRDLYMEFLKGIRDPIAKSKISSRVSRMVTGNFG
FT                   DHKPCREGVWELRIDQGPGYRVYYGLVGREVVLLLIGGDKRTQDADIDQAIECLKDYLK
FT                   G"
FT   CDS_pept        131754..132095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0026"
FT                   /locus_tag="XNC1_0145"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0145"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88233"
FT                   /db_xref="GOA:D3VGU8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGU8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88233.1"
FT                   /translation="MSEGLFEGVIMAKARLHDDAMVQLLREDPEFAQYYLHQAFVDMDE
FT                   EGGQEAFLMALRHVVEARGGMAQIADKAGVSRETLYRTLSPKGNPTLKTLRNIIAATGF
FT                   PLSHLAAMI"
FT   regulatory      132210..132269
FT                   /regulatory_class="promoter"
FT   operon          132349..134736
FT                   /operon="XNC1_operon0027"
FT   CDS_pept        132349..133662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0027"
FT                   /gene="envC"
FT                   /locus_tag="XNC1_0146"
FT                   /product="periplasmic protease"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0146"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88234"
FT                   /db_xref="GOA:D3VGU9"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGU9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88234.1"
FT                   /translation="MAENKDLKSCNNRQKQNKKQKKIRVLYLFALLFTFFSFSANTFAN
FT                   QISENKNQLKDIQQDIVEKEKSVKQQQKQRTDLLNQLKEQESTISEVGRSLHGTQVRLN
FT                   KLESEVSVLNANIKRLQTRQKEQRQLLARQLDAAFRQGNHQGLELLLNGQEMQRKERIL
FT                   AYYSYLNQSRQEAITQLQKTTKALSQQKKSQLDKRSEQKEILIGQKQQKQKMEVARTAR
FT                   QKTLTVLESSLKKDQQSLTELRQNETSLRNKIAKAEREAKARAEREAREAARVRAQVAA
FT                   KQKQAQQKGSRYKPTEGERALMARTGGLGRPAGQAIWPVRGRVIHSFGEAIQGELRWKG
FT                   VVISAAEGTEVRAISDGRVLLADWLQGYGLVVVVEHGKGDMSLYGYNQSKLVRVGQQVR
FT                   AGQPIALAGSSGGQQQPSLYFEIRRQGRAVNPLPWLGK"
FT   CDS_pept        133687..134736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0027"
FT                   /locus_tag="XNC1_0147"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0147"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88235"
FT                   /db_xref="GOA:D3VGV0"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGV0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88235.1"
FT                   /translation="MMKMKYLLIKHVGLFTLLFWILSFFTSVSFTLNARAARLAIVIDD
FT                   VGYRIHEENKILQMPIAVSVAILPDSPHGREMAVKAYQQGREVLIHLPMAPLSQQPLEK
FT                   NTLHPAMSREEIGRIIQEAIQKVPHAVGMNNHMGSAMTSDLTGMEKVMQVLSRHHLYFL
FT                   DSVTIGNTQVTKAATGTSVPVIRRNIFLDNVQTEAETRHQFNRAITLARKKGSAIAIGH
FT                   PHPTTVRALQQALATLPDDIELVTPGILLGHEPSNKREQQITRQCTKPRQSEPVPETQL
FT                   DYLKEIGKALANNIIVNTLSQHFQKLLQSVPKQEAPNTLNKTIGGQVTVNQDAGKKKSH
FT                   QKEDQTRCP"
FT   regulatory      complement(134704..134756)
FT                   /regulatory_class="terminator"
FT   operon          complement(134773..137004)
FT                   /operon="XNC1_operon0028"
FT   CDS_pept        complement(134773..135798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0028"
FT                   /gene="tdh"
FT                   /locus_tag="XNC1_0148"
FT                   /product="threonine 3-dehydrogenase, NAD(P)-binding"
FT                   /EC_number="1.1.1.103"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0148"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88236"
FT                   /db_xref="GOA:D3VGV1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGV1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88236.1"
FT                   /translation="MKALSKLKPEAGIWMTDVPTPELGHNDVMIKIRKTAICGTDVHIY
FT                   NWDDWSQKTIPVPMVIGHEYVGEVVAIGQEVKGFNIGDRVSGEGHITCGHCRNCRGGRT
FT                   HLCRNTTGVGVNRAGAFAEYLVIPAFNTFKIPDNIPDELAAIFDPFGNAVHTALSFDLV
FT                   GEDVLVSGAGPIGIMAAAVCKHVGARHVVITDVNEYRLELARKIGVTRAVNVSKENLTD
FT                   VMAELGMTEGFDVGLEMSGAPPAFRTLLNTMNHGGRIALLGIPPSDMAIDWNQVIFKGL
FT                   FIKGIYGREMFETWYKMAALIQSGLDLTPIITHQFSIDDYQKGFDIMRSGQSGKVILNW
FT                   D"
FT   CDS_pept        complement(135808..137004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0028"
FT                   /gene="kbl"
FT                   /locus_tag="XNC1_0149"
FT                   /product="2-amino-3-ketobutyrate CoA ligase (glycine
FT                   acetyltransferase)"
FT                   /EC_number="2.3.1.29"
FT                   /note="Evidence 1a : Function experimentally demonstrated
FT                   in the studied strain; PubMedId : 16164547; Product type e
FT                   : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0149"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88237"
FT                   /db_xref="GOA:D3VGV2"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGV2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88237.1"
FT                   /translation="MSASFYQKMNEQLEQSRAEGLFKTERIITSAQNANIAVAEGSQVI
FT                   NFCANNYLGLANHPDLIAAAKAGMDSHGFGMASVRFICGTQDSHKELENKIAEFLGMED
FT                   AILYSSCFDANGGLFETLFGPEDAIISDALNHASIIDGIRLCKAKRYRYANNDMQELRA
FT                   QLEKATAEGAQNILIATDGVFSMDGVIADLKSICDLADEFGALVMVDDSHAVGFVGKQG
FT                   RGTHEYCDVMGRVDIITGTLGKALGGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAI
FT                   VSASIKVLDMLKNGDDLRERLWRNANLFREKMTAAGFTLAGADHAIIPVMLGDAKLAQA
FT                   FAAELLKEGIYVIGFFYPVVPKGQARIRTQISAAHTEEHIEHVVAAFIRIGKQLNVIA"
FT   regulatory      137143..137202
FT                   /regulatory_class="promoter"
FT   regulatory      complement(137185..137244)
FT                   /regulatory_class="promoter"
FT   operon          137235..140212
FT                   /operon="XNC1_operon0029"
FT   CDS_pept        137235..138173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0029"
FT                   /gene="rfaD"
FT                   /locus_tag="XNC1_0150"
FT                   /product="ADP-L-glycero-D-mannoheptose-6-epimerase,
FT                   NAD(P)-binding"
FT                   /EC_number="5.1.3.20"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0150"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88238"
FT                   /db_xref="GOA:D3VGV3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGV3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88238.1"
FT                   /translation="MIIVTGGAGFIGSNIVKALNDEGYKDILVVDNLKDGTKFVNLVDL
FT                   DITDYMDKEDFIASIVAGDDLGDIDAIFHEGACSSTTEWDGKYMMDNNYQYSKDILHYC
FT                   LDRQIPFLYASSAATYGGRSDNFIEERQYEKPLNIYGYSKFLFDQYVRDILPHADSQVC
FT                   GFRYFNVYGPREGHKGSMASVAYHLNHQIHQGQNPKLFAGSENFQRDFIYVGDVAAVNL
FT                   WFWKNSVSGIFNCGTGRAESFQAVADAVTEFHKEKSPVVEYIDFPEKLKGRYQSFTQAD
FT                   LTKLRAAGYEKPFKTVAEGVAEYMQWLNQDN"
FT   CDS_pept        138183..139235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0029"
FT                   /gene="rfaF"
FT                   /locus_tag="XNC1_0151"
FT                   /product="ADP-heptose; LPS heptosyltransferase II"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0151"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88239"
FT                   /db_xref="GOA:D3VGV4"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGV4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88239.1"
FT                   /translation="MKILVIGPSWVGDMMMSQSLYRTLKDLYPNAEIDVMAPAWCRPLL
FT                   AKMPEVNQALAMPLGHGVLALGDRRRLGIELRESQYDRAYVLPNSFKSALVPFFANIPL
FT                   RTGWRGEMRYGLLNDLRTLDKRAFPLMVQRYVALAYEGKKIHSADALPQPLLWPKLTVN
FT                   DEDIAESTAAFNIADHRPIIGFCPGAEFGPAKRWPHYHYAALAEQLITEKGYQILLFGS
FT                   AKDHEAGEEIRALLSDDARENCLNLAGKTSLEQAVNIIAACDAVITNDSGLMHVAAALD
FT                   CPLVALYGPSSPDFTPPLSNKAEVIRLMTGYHKIRKGDSDGGYHQSLIDIKPDRVLASL
FT                   EKLLQVEKQN"
FT   CDS_pept        139235..140212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0029"
FT                   /gene="rfaC"
FT                   /locus_tag="XNC1_0152"
FT                   /product="ADP-heptose; LPS heptosyl transferase I"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0152"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88240"
FT                   /db_xref="GOA:D3VGV5"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011908"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGV5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88240.1"
FT                   /translation="MRILLVKTSSMGDVLHSLPALTDARQRFPDIQFDWVVEEGFAQIP
FT                   TWHSAVANVIPVAIRRWRKNWFRKDICAERAQFRKQLQLHQYDAIIDAQGLLKSAFLVT
FT                   RLAQGPKHGYDRKSIREPLASFFYDRCYAVSKQQHAVERIRTLFAESLGYKKPLEQGDY
FT                   AIARHFLNQQAENQSHYLVFLHATTRDEKHWPENHWRQLIADIQTMGLRIKLPWGAEHE
FT                   YQRALRLAEGFSHVDVLPKLTLAEVAQILAGAKAVVSVDTGLSHLTAALDRPNITLFGP
FT                   TDPGLIGGYGKEQHSLKSVDGTMQGIVPSGVMSLLQEVLKKNFS"
FT   regulatory      140229..140288
FT                   /regulatory_class="promoter"
FT   CDS_pept        140407..141192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0153"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0153"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88241"
FT                   /db_xref="GOA:D3VGV6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGV6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88241.1"
FT                   /translation="MIFSDKSDVTIVITSCGRFELLENTIQSLDKHNTYPIGKVIITED
FT                   SGNKKIVEVIPEHWKPHCKIIINNPKLGQIKSIDLAYSKVETQYIFHCEDDWLFYRDGF
FT                   IEDSRLLLEENHDILQVWLRDFEKDIKINYPFHYPSNPQSVCGVDFSILESNDEVWKGF
FT                   SFNPGLRRKSDYLRIAPYYVGKDFGEAEAHISKLYYDMGMYAVLLKNSATEHIGWDQHI
FT                   INENDIFHNKDKIQKKIKYFSIGFLFGCILTFVFISLMK"
FT   regulatory      141212..141249
FT                   /regulatory_class="terminator"
FT   regulatory      complement(141460..141506)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(141654..142040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0154"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0154"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88242"
FT                   /db_xref="InterPro:IPR009977"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGV7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88242.1"
FT                   /translation="MDIYIDLYQKRWNYNHSEEQKKHLLEIYTELRDHIFGYVLLINSK
FT                   PCAYDFVLWAESPKWISFDAINGGYDPEYAHLSVGSILMWVNIQQAKVLCQQGDKTMRY
FT                   SLGNPTLEYKNRWCETFPLGKVLF"
FT   regulatory      complement(142230..142289)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(143012..143971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0155"
FT                   /product="putative WbfO protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0155"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88243"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGV8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88243.1"
FT                   /translation="MNLSPRLSVLMSVYNGEDYLAESIDSILSQTFGGYELIIIDDGST
FT                   DSTSSILSSYAKKDTRIRVITNENNIGLIRSLNKGLHIASSNLVARMDADDIAIPERFE
FT                   IQMDFMRDHPNVAVCGGFTTYLENPAKGDVHAINHEDIVAECFFHCPFAHPTVIMRKDK
FT                   ILELTDGYDPNDLYAEDYGLWSRLVISKKIKFANIDKSLLKYRTHPNNPRIEYKKKQKE
FT                   TANDIQRKMFLSLGINIPLKDIDLLNHSEGKISIGNIKKCESWLLKIERSTDNMEPLER
FT                   IAFLKEIKDKKMYLWRRIRKNSIPAILRYITARFYYRK"
FT   regulatory      complement(144047..144106)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(144167..145132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0156"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0156"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88244"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGV9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88244.1"
FT                   /translation="MITKTPDTHSACSKILSIIVAAHNLEKLILKCINSIKNTLSDLEP
FT                   SLYEVLLIDDSSSDSTSSILKQFSEENSSFIYIRKEFKSLGKVKKYAVEQSNGEYITFV
FT                   DGDDFLSNFSMKNIIDFLIEKRPDMLISPLQDVRKPEDIIHKSNFLSPILFDRNTAIKE
FT                   YLIHKKFQAHSCGKFFRRDLFDGSNFPEVSCYEDALSFSSILAKCDRIYYTRTKYYNYI
FT                   KREGSLSESINKAKINAMAEVVFIDDKVFGEKFRNLTACHAIEIAYKYHNFLSRNYFSS
FT                   LMNLINSISIFSFMLDNRVRFSFKVKYYKVMMNKKIINNK"
FT   regulatory      complement(145194..145253)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(145262..146215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0157"
FT                   /product="WalW protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0157"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88245"
FT                   /db_xref="GOA:D3VGW0"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGW0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88245.1"
FT                   /translation="MTKPAFIITIDTEGDNLWQDSVQISTENTQYLPRFQKLCEQFGFK
FT                   PVWLTNYEMAMDDSYIEFAKDVISRNTGEIGMHLHAWNSPPLTPLTDDDMHYKPYLIEY
FT                   PKEQMRAKIDFMTHLLEDKLQTKMLSHRAGRWAFNQDYAQLLAEYGYQVDCSVTPKVDW
FT                   RFTKGDPDGNGGTDYSHFPTHAYFMDLQDISKKGCSSLLQVPMSIQYKHSSIMNCIKQK
FT                   YDQLRGKKRSPSVNWLRPKGGNVALMKKVIQQTLASGSDYIEFMLHSSEFMPGGSPTFK
FT                   NEEQIEQLYQDLEELFAFIKPLAQGMTLAEYYQFKL"
FT   regulatory      complement(146238..146297)
FT                   /regulatory_class="promoter"
FT   operon          complement(146349..149640)
FT                   /operon="XNC1_operon0030"
FT   CDS_pept        complement(146349..147452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0030"
FT                   /locus_tag="XNC1_0158"
FT                   /product="WalW protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0158"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88246"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGW1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88246.1"
FT                   /translation="MKGHILFIIDGLPGGGAENVTIRLCDGLQRKGFDITLLSLSDKCE
FT                   YSIPSNIELIINADEYKGPFRRQTEITRRAKAMDKVLEKVFLQKGIPVLVISNLHKTDR
FT                   IVAKSKILADLNVWFCIHGVFSKSYLEHKTGLAHWIKKWKIQQVYQNRNLICVSDAVGA
FT                   DLKENLSLIPKEMITIYNPFNLAEIKSCSLENNPYSGENYFLHLGRFHHVKRHDRLLEA
FT                   FAKADLSCNLLIAGQGDEQATKAIKQKIVELGLQSKVHLIGFLVNPLPVIRGAKAVILS
FT                   SDSEGLGNVLIEALICHTPIVSTGCPGGVNEIMVGELEQYKSELTAESLAEKMRLVYQN
FT                   PPVITQDMYKRFDLDIVIGEYLSLINQ"
FT   CDS_pept        complement(147449..148579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0030"
FT                   /locus_tag="XNC1_0159"
FT                   /product="Lipopolysaccharide core biosynthesis protein RfaG
FT                   (Glucosyltransferase I)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0159"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88247"
FT                   /db_xref="GOA:D3VGW2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGW2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88247.1"
FT                   /translation="MKSIRLAIVRQKYRPDGGAERFISRALEALDNDSLDLNVITRSWQ
FT                   GDINPNWHVHLAAPFKWGRISREKRFADAAKAIWQKEHFDIVQSHERIAGCDIYRAGDG
FT                   VHQRWLQQRSRILPAWKSKLLFTSRYHRYVMNAEEEMYLAPELKKVICNSQMIKREVME
FT                   NFGLPDEKISVIYNAIDQSEFFPAGEDERLVLRQKYALPAQAKCFVYVGSGFERKGLKA
FT                   AIEAIGMTKDYLVVIGQDKEENKYKQLAHSLGCHDRIRFLGVQKETLPFYQMADGLLLP
FT                   TLYDPFPNVVLEAMACGLPVITSHTCGGSEFITSGENGFVCDALDISGLAESISSVPAD
FT                   HLTSRFSMLSKEKIVNYTPAYLSQQLTELYNKVLSL"
FT   CDS_pept        complement(148576..149640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0030"
FT                   /gene="rfaQ"
FT                   /locus_tag="XNC1_0160"
FT                   /product="lipopolysaccharide core biosynthesis;
FT                   modification of heptose region of core"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0160"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88248"
FT                   /db_xref="GOA:D3VGW3"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011916"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGW3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88248.1"
FT                   /translation="MGKTTRRFEKILIIKLRHHGDTLLITPVVNTLKENFPDSEIDVLL
FT                   YKETEPMLVNFGLVSHIFSIDRQWKKAGTKAYIIHHWRLINQLKNRRYNLIINLADQWY
FT                   SALVSKISGAPTRIAFDFPKRQNLLWKSCFSHLVSTEGEESLHVVEQNLSALKPLNLSN
FT                   TNSDVTMSYSEGDWQKVSELLHTNGINNQYIVIHPASRWFFKCWNERKISETINALQSD
FT                   GHSIVVTSGTEPREKEMIEQILSSCDKENIVSLAGQITLPQLGALIANARLFIGVDSVP
FT                   MHMASALKTPCIALFGPSKLVFWHPWNVNGEVIWAGNYGKLPDPDDIDTKTETRYLDLI
FT                   PTDVVIAAARRYLS"
FT   regulatory      149323..149382
FT                   /regulatory_class="promoter"
FT   CDS_pept        149584..149757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0161"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88249"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGW4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88249.1"
FT                   /translation="MMPEFYDENLFKSTSCFTHCVFNVRCLRKKNLITLYSKDRILPFL
FT                   SLDIKYIALKNE"
FT   regulatory      complement(149683..149742)
FT                   /regulatory_class="promoter"
FT   regulatory      149783..149842
FT                   /regulatory_class="promoter"
FT   operon          149867..152401
FT                   /operon="XNC1_operon0031"
FT   CDS_pept        149867..151144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0031"
FT                   /gene="waaA"
FT                   /locus_tag="XNC1_0162"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase (KDO
FT                   transferase)"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0162"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88250"
FT                   /db_xref="GOA:D3VGW5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGW5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88250.1"
FT                   /translation="MLLRLYQVLLYLIQPIIWLRLLLRSRKSPAYRKRWGERYGFCAKK
FT                   VTPGGILLHSVSVGETLAAIPLVRILRHHYPLLPITITTMTPTGSERVLSALGSDVNHV
FT                   YLPYDLPGSMSRFFDHVNPKLVIIMETELWPNLITQLHQREIPLVIANARLSARSAAGY
FT                   QKISSFIKTILNKITLIAAQNQEDGERFIELGLRRSQLSVTGSLKFDISVTPELAAKAI
FT                   TLRRQWAPHRPVWIATSTHDGEESILLEAHCKLLKQFPDLLLILVPRHPERFNKAAELT
FT                   QKAGLSAILRSAGTIPEADVQVVIGDTMGELMLLYGIADMAFVGGSLIERGGHNPLEAA
FT                   AHAIPVIMGPHTFNFKDICAKLEKADGLITVTDSQSLSSAIHSLLADEDYRRYYGHHAA
FT                   EVLHENQGALQRLLKLLEPYLPPRSH"
FT   CDS_pept        151144..151953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0031"
FT                   /locus_tag="XNC1_0163"
FT                   /product="Lipopolysaccharide core biosynthesis glycosyl
FT                   transferase kdtX"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0163"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88251"
FT                   /db_xref="GOA:D3VGW6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGW6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88251.1"
FT                   /translation="MSDKKRLSVVMIAKNAADVITDCLLSVNWADEIIVLDSGSTDATC
FT                   QIASEMGAKVYTNTQWPGFGRQRQLAQSYASGDYIFMIDADERVTPELKASIEHVITSP
FT                   DDDNKVYSCARLNLFMGRFMKHSGWYPDKVIRLYRRERYQYNDNQVHESLDTQGASIVT
FT                   LKGDLRHLTCRNLMEFQQKQLNYAEAWAKHRYEQGKKTRYFSVWSHMLGAFFKTWLFRA
FT                   GFLDGKQGLMLAVVNAQYTFNKYAALWELTQTKSNYDEKKSNLSRHL"
FT   CDS_pept        151919..152401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0031"
FT                   /gene="coaD"
FT                   /locus_tag="XNC1_0164"
FT                   /product="CMP-deoxy-D-manno-octulosonate-lipid A
FT                   transferase (phosphopantetheine adenylyltransferase)"
FT                   /EC_number="2.7.7.3"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0164"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88252"
FT                   /db_xref="GOA:D3VGW7"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGW7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88252.1"
FT                   /translation="MKRKAIYPGTFDPVTYGHLDIVTRAANMFDHILLAIANSDRKNPM
FT                   FSLEERVTLAKEVTAHLENVEVVGFSELMVNFAKKQQATILIRGVRSVADFEYECQLAN
FT                   MNRHFMQELESVFLLPSQNLSFVSSSLIKDVARHDGDISSFLPEPVARAMLQKLGK"
FT   regulatory      complement(152390..152438)
FT                   /regulatory_class="terminator"
FT   regulatory      152403..152452
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(152444..153253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="XNC1_0165"
FT                   /product="formamidopyrimidine DNA glycosylase, also acts on
FT                   5-formyluracil and 5-hydroxymethyluracil"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0165"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88253"
FT                   /db_xref="GOA:D3VGW8"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGW8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88253.1"
FT                   /translation="MPELPEVETSRRGIEPHLVGNIIQYAEVRNSRLRWPVSEQIMKLS
FT                   DRPVLSVQRRAKYLLLELPEGWIIIHLGMSGSLRILLEERPPEKHDHVDLIMADGKTLR
FT                   YTDPRRFGAWLWSDDLNKCSVLSHLGPEPLFDQFDGEYLYSLSRNKKTAIKPWLMDNKV
FT                   VVGVGNIYANEALFVAHILPERPVHSLTQQEAHLLADIIKQILHRSIEQGGTTLKDFLQ
FT                   SDGKPGYFAQELFVYGKKGELCSKCGEKIECIKLGQRSTFFCRQCQH"
FT   regulatory      153264..153323
FT                   /regulatory_class="promoter"
FT   operon          153371..155604
FT                   /operon="XNC1_operon0032"
FT   CDS_pept        153371..153823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0032"
FT                   /locus_tag="XNC1_0166"
FT                   /product="O-antigen ligase RfaL (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0166"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88254"
FT                   /db_xref="GOA:D3VGW9"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGW9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88254.1"
FT                   /translation="MLNVKNKFNLNNNKKSLWNLSIVGLYVILVYLPDITRYKNLVMIL
FT                   ICTTALYYLVKDFRQVTNALRSHLVLSVLLFVLAMFYSVGISIDPALSFKEMNKPILNG
FT                   LLLFSLTFPIVLYQESKEDIARMILVAFIIGMAAISLTDIAKYIIN"
FT   regulatory      complement(153395..153454)
FT                   /regulatory_class="promoter"
FT   CDS_pept        153915..154799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0032"
FT                   /locus_tag="XNC1_0167"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0167"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88255"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D3V9L2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88255.1"
FT                   /translation="MYNLEELYCCVDDFCQKFIPLWHQQLIENGLRKRHREASLSLSEV
FT                   MMILILFHMSHYRDFKTFYIEHVKQYFTADFPGLVSYTRILTLKKRALIPLCAFLSSRK
FT                   AQTQGIAFIDSTKIAVCHNLRIPRHRVFEGMAQRGKTSTGWFYGFKLHLVINDCGELLA
FT                   VKLTAGNQDDRQPVRALTKGLTGCLYGDKGYLSQALCDELEAEGVTLITNVRNNMKTKA
FT                   LSLWDRLMLRRRFLIETVVDQLKNISQIEHSRHRSQLGFLLEVAAGLIAYTFQPKKPSL
FT                   NLRDNEIAIFKRS"
FT   CDS_pept        154816..155604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0032"
FT                   /locus_tag="XNC1_0168"
FT                   /product="O-antigen ligase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0168"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88256"
FT                   /db_xref="GOA:D3VGX1"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGX1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88256.1"
FT                   /translation="MGEMPFSNFNHREFSYGFIFYFPVLLCTWALWKKHALLSWLLLII
FT                   ASAISLFLLLGTLARGAWVAILVATVFIIAINREWKLTVAAAICLGLLAGVTHWSAGSN
FT                   PDTRLLIHKLTQTDSSHRYSNGTQGSAWSLIMENPVKGYGFGNKVYHQVYNSRVADYPD
FT                   WTYRTSIGPHNIFLSLWFSAGILGLVTTLLMTFSVLLTGSRIIRQHSGIIRQSGIILLA
FT                   AFIGVFIVRGAFENAYINEIGILLGLLIALYKKTTSKAIN"
FT   regulatory      complement(155601..155648)
FT                   /regulatory_class="terminator"
FT   regulatory      155616..155660
FT                   /regulatory_class="terminator"
FT   operon          complement(155680..158967)
FT                   /operon="XNC1_operon0033"
FT   CDS_pept        complement(155680..156858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0033"
FT                   /locus_tag="XNC1_0169"
FT                   /product="WalM protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0169"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88257"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGX2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88257.1"
FT                   /translation="MKIAYIDPYPVPDYRVASLQILQNVDAFARQGHHVCLITPKGQSQ
FT                   AEEIMGRSLPPSAEQITLHDIRRKWYFPLNTQKLFYFQVSRWLKEHPVDAIFTRNIKMA
FT                   NYLLCKHPEIPHFFESHEVFSQSFKESHDLVKHKNQHKYQKLRKIEQQVYERSQVVFVL
FT                   TSLLGEDIYKEYGVKTPIVIAPDGVDMLAVNATNLTPSGKEYKDGLPTQVLYLGSLHRW
FT                   KGIPTVMKAMSFLDNAMLNIAGGTPEQITRLRQTAKQIGVADRVNFLGFVQPKHRFQVI
FT                   ADHDICVLPLTKTSIGSRYTSPLKLFEYMAMGKPVVISDFPSIRDAVDEKAVNFANSEN
FT                   AESFAEQIQWLINHPAEVMKKVDYARQLVAERFNWDQRAKLITNVIAEKLSE"
FT   CDS_pept        complement(156858..157961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0033"
FT                   /locus_tag="XNC1_0170"
FT                   /product="WalN protein"
FT                   /EC_number="2.4.1.56"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0170"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88258"
FT                   /db_xref="GOA:D3VGX3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGX3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88258.1"
FT                   /translation="MKIGFIDVTVTMSYGGIQTAVWELAKALTDAGHEIHIFGGTGDIR
FT                   PELAGRNIHIHTFPFIPRERVLNIGRRFQRIVERYSFARHAREAVMAENFDWLILTKPF
FT                   DFFWPRMIPKTSHTKFCYMSGGTSFFKGDRILGKKISAWVACSHFNAWQIQHHFKQFPS
FT                   VIYNGVNTDKFKPIDSDIRTRLGINEDTFLLTFAGRLVGWKGMKVAIEAMTLLRDKDVK
FT                   LLIIGAGEELKQLEKRVSALKLKESVIFHPPVSHDQLPEFYAAGDAGLFPSIGDEAFGI
FT                   TIAEAMACGRPVIASYIGGIPEVVGNENQAGILVTPGDAPAIAASVNHLLSLEDRGKGM
FT                   GKCARQRIEAMYTWEHSANRLLNAIKK"
FT   CDS_pept        complement(157963..158967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0033"
FT                   /locus_tag="XNC1_0171"
FT                   /product="WalO protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0171"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88259"
FT                   /db_xref="GOA:D3VGX4"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGX4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88259.1"
FT                   /translation="MQPKNILIINIARFGDTLLATPVIRALKAKWPEANIDVFAHKKTK
FT                   EILYNIELIYELKAFSKGKAKWCGWLSRRHYDFALVYGDDKSLLQYAKRQSNLTIYFSD
FT                   TSEEKVNEYTVEKPRDPMPAQQERALLIRALGVEVNDWRLHYCVSQSEEEYARDFLQRQ
FT                   ELEHQLKIGFQLQSFPAKAYRDWPVEHFYELAQRIYRDYPHAHILLLGSKEGEKCAQML
FT                   AEKLGANRCTSLAGKTTMRQNAAIMSRLDLYIGVDTGTTHLAGALGIPMVALYHSFHPG
FT                   RFLAPQQHPKLAVIEHPVDSRQATRQDSMSAISVDKVWHSVQNLLENERKDNE"
FT   regulatory      complement(159065..159124)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(159165..160283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0172"
FT                   /product="WalR protein"
FT                   /EC_number="2.4.1.57"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0172"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88260"
FT                   /db_xref="GOA:D3VGX5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGX5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88260.1"
FT                   /translation="MAKKTLNILHTESSCGWGGQEIRILTESQGMIQRGHHVVIVCCPT
FT                   STLYREAHHYGVPVVALPIEKKRLSCLRAMRRWLKTEGRQFDVINTHSSTDSWLAAAAC
FT                   AVLKGMPPIIRTRHVSTHVSKSMATRWLYLHACQHIVTTGGKLRQYLHTHNTYPLSHMT
FT                   SVPTGIDLTRFHPEDKLQSRQRIGIENKPTLGIVATMRTWKGHRYLLDSWKILHQHYPD
FT                   WQLLFVGDGPQRKNLEPHVQQAGLTGSVIFLGNRQDVPDCLNAMDIFALPSFGNEGVPQ
FT                   GIMQAMACGLPVVSTSVGAITEAVIDGDTGYIIEPKNAEQLTEKLDFLMKDAELRSQMG
FT                   NASLQRATHLFGMDNMLEKMESIFYRSINSKR"
FT   regulatory      complement(160313..160372)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(160389..160419)
FT                   /regulatory_class="terminator"
FT   operon          complement(160440..160855)
FT                   /operon="XNC1_operon0034"
FT   CDS_pept        complement(160440..160607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0034"
FT                   /gene="rpmG"
FT                   /locus_tag="XNC1_0173"
FT                   /product="50S ribosomal subunit protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0173"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88261"
FT                   /db_xref="GOA:D3VGX6"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGX6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88261.1"
FT                   /translation="MAKGIRDKIKLVSSAGTGHFYTTTKNKRTMPEKLEMKKFDPVVRQ
FT                   HVMYKEAKIK"
FT   CDS_pept        complement(160619..160855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0034"
FT                   /gene="rpmB"
FT                   /locus_tag="XNC1_0174"
FT                   /product="50S ribosomal subunit protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0174"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88262"
FT                   /db_xref="GOA:D3VGX7"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGX7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88262.1"
FT                   /translation="MSRVCQVTGKRPVSGNNRSHALNATKRRFLPNLHSHRFWVESEKR
FT                   FVTLRVSVKGMRVIDKKGIDTVLAELRARGEKY"
FT   CDS_pept        160796..161095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0175"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88263"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGX8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88263.1"
FT                   /translation="MGAVVTTHRALAGNLADSGHVYISKNQISSSFVLGMAASSGLGAH
FT                   LSTFSLLKKRYGKDTHFLSKKLTEIGSSRQAQDPQRWRSIRPHSLMLKSRTTKI"
FT   regulatory      complement(161038..161097)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(161117..161809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yicR"
FT                   /locus_tag="XNC1_0176"
FT                   /product="putative associated with replication fork, DNA
FT                   repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0176"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88264"
FT                   /db_xref="GOA:D3VGX9"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR022820"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGX9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88264.1"
FT                   /translation="MDTQAMEKHDELHLSLAPREKLLAYGAVSLTDAELLAIFLRTGTR
FT                   GIPVVQMAEYLLKSFGSLYHLLSADYADFCSHKGMGQCKYVQLQAVSELAKRFFSSQFI
FT                   HEDIMSSPTMTQSYLQDLLSWQDREVFVVLCLTNQNKVICHDEMFKGTINKVEIHPREI
FT                   VKLAVKVNAASIILAHNHPSGNPEPSLADKVVTEKIIEACDLVGVKVLDHIVIGKQYCV
FT                   SFMERGWI"
FT   regulatory      162006..162065
FT                   /regulatory_class="promoter"
FT   operon          162152..163817
FT                   /operon="XNC1_operon0035"
FT   CDS_pept        162152..163381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0035"
FT                   /gene="dfp"
FT                   /locus_tag="XNC1_0177"
FT                   /product="bifunctional: 4'-phosphopantothenoylcysteine
FT                   decarboxylase; phosphopantothenoylcysteine synthetase,
FT                   FMN-binding"
FT                   /EC_number="6.3.2.5"
FT                   /EC_number="4.1.1.36"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0177"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88265"
FT                   /db_xref="GOA:D3VGY0"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGY0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88265.1"
FT                   /translation="MTGFSGQQLSGRQIVLGISGGIAAYKTAELVRRLRDRGAQVRVVM
FT                   TPAAEAFITPLTLQAVSGYPVSDDLLDPAAEAAMGHIELAKWANLIILAPATADLLARL
FT                   AAGMANDLVTTICLASAAPIAVVPAMNQQMYRAQATQHNLKVLEERNVLIWGPDEGSQA
FT                   CGDVGPGRMLEPMSIVELATQHFNTKQDLAGLSIAITAGPTREALDPVRFISNHSSGKM
FT                   GFSIAQAAAERGAEVTLITGPVNLPTPQGVKRIDVTSALEMNEQVQATATSQNIFIGCA
FT                   AVSDYRSKQIAAEKIKKQGDEITFTLVKNPDIVASVAALEENRPFVVGFAAETQNVEEY
FT                   ARGKLKQKHLDLICANNVSLAGHGFNSDTNALHLFWHDGRVHLPHSGKLQLSHRLLDEI
FT                   LKRYDEKNRC"
FT   CDS_pept        163359..163817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0035"
FT                   /gene="dut"
FT                   /locus_tag="XNC1_0178"
FT                   /product="deoxyuridinetriphosphatase"
FT                   /EC_number="3.6.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0178"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88266"
FT                   /db_xref="GOA:D3VGY1"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGY1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88266.1"
FT                   /translation="MMKKIDVKILDPRIGQEFPLPTYATPGSAGLDLRACLDNAVELAP
FT                   GQTELLPTGIAIHIADEQLAAVILPRSGLGHKHGVVLGNLVGLIDSDYQGQLMVSVWNR
FT                   GDKMFTVEPGERIAQMVFVPVVQAEFNLVEDFETSERGSGGFGHSGRQ"
FT   regulatory      163835..163894
FT                   /regulatory_class="promoter"
FT   regulatory      163912..163948
FT                   /regulatory_class="terminator"
FT   CDS_pept        163962..164561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttk"
FT                   /locus_tag="XNC1_0179"
FT                   /product="putative transcriptional regulator of dUTPase
FT                   subunit with homeodomain-like DNA binding domain (TetR/AcrR
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0179"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88267"
FT                   /db_xref="GOA:D3VGY2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGY2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88267.1"
FT                   /translation="MVEKERKKKKNRREEILQALAHMLETSDGSQRITTAKLAANVGVS
FT                   EAALYRHFPSKTRMFDSLIEFIEDALISRINLILQDEKDTVTRLRLIFVLILGFAEKNP
FT                   GLTRIMTGHALMFEQDRLQNRINQLFERIEVQLRQILKEKKMRDGQGFDYDETVLASQL
FT                   LAFCEGMLSRFVRSEFRYRPTTEFEVRWPLILTQLQ"
FT   regulatory      complement(164668..164715)
FT                   /regulatory_class="terminator"
FT   regulatory      164752..164786
FT                   /regulatory_class="terminator"
FT   operon          complement(164816..166277)
FT                   /operon="XNC1_operon0036"
FT   CDS_pept        complement(164816..165457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0036"
FT                   /gene="pyrE"
FT                   /locus_tag="XNC1_0180"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0180"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88268"
FT                   /db_xref="GOA:D3VGY3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGY3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88268.1"
FT                   /translation="MKAYQREFIELALKKQVLKFGEFTLKSGRKSPYFFNAGLFNTGRD
FT                   LALIGRFYAAALLDSGIKCDLLFGPAYKGIPIATTAAVALAEHHDIDMPYCFNRKEAKD
FT                   HGEGGSLVGSPLQGNVVVVDDVITAGTAIRESMEIIKQHGATLSGVILCLDRQERGRET
FT                   LSAIQEVERDYHCQVFSIITLNDLVSYLRENPEMQSHLEAVETYRKEYGI"
FT   regulatory      complement(165493..165522)
FT                   /operon="XNC1_operon0036"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(165534..166277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0036"
FT                   /gene="rph"
FT                   /locus_tag="XNC1_0181"
FT                   /product="RNase PH"
FT                   /EC_number="2.7.7.56"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0181"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88269"
FT                   /db_xref="GOA:D3VGY4"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGY4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88269.1"
FT                   /translation="MSLVGKRPAGRTAGQVRPIKMTRHYTKHAEGSVLVEFGDTKVLCN
FT                   ASVEEGIPRFLKGQGQGWITAEYGMLPRATNSRNAREAARGKQTGRTMEIQRLIARSLR
FT                   AAVDLKKLGEFTITLDCDVIQADGGTRTAAISGACVALVDALNKLVADGKLKESPLKSM
FT                   VAAVSVGIVGGEGLCDLEYVEDSAAETDMNVVMIDDGRMIEVQGTAEGEPFSHDELLSL
FT                   LSLAKEGLETIFEAQRDALKQDSSK"
FT   regulatory      166267..166326
FT                   /regulatory_class="promoter"
FT   regulatory      complement(166308..166367)
FT                   /regulatory_class="promoter"
FT   CDS_pept        166403..167266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0182"
FT                   /product="Protein yicC"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0182"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88270"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGY5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88270.1"
FT                   /translation="MIRSMTAFARRDIKADWGNAAWELRSVNQRYLETYIRLPEQFRSL
FT                   EAVIRERIRSRLTRGKVECNLRFELDARAQGSLMLNEPLAKQLVEAASWVKQQSGEGDI
FT                   NPVDILRWPGVMSAEEQDLDAISAQLLNELDLALDAFIQSRETEGQALKSLIEQRLDAV
FT                   TVEVVKVRAQMPAILQWQRERLQAKLEDAQIQLENNRLEQELILLAQRVDVAEELDRLD
FT                   AHVKETRNILKKKEAVGRRLDFMMQEFNRESNTLASKSINADVTNSAIELKVLIEQMRE
FT                   QIQNIE"
FT   regulatory      167284..167343
FT                   /regulatory_class="promoter"
FT   regulatory      167298..167337
FT                   /regulatory_class="terminator"
FT   operon          167366..168873
FT                   /operon="XNC1_operon0037"
FT   CDS_pept        167366..168130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0037"
FT                   /locus_tag="XNC1_0183"
FT                   /product="Putative integrase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0183"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88271"
FT                   /db_xref="GOA:D3VGY6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGY6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88271.1"
FT                   /translation="MATDVLRWLRRMFDYAIKRQMIEINPCSAFEVADAGGKEVSRDRW
FT                   LTREELIIVLRTFRASSISRQNEISFKILLALCLRKMELCAARWEEFNFKKAVWHFPAE
FT                   RSKNGDAIDIPLCPQVIEWFMELKAMACGSQYVLPARKMQHRMIPHIQESTLPVALAKV
FT                   RRELPVDMPNFTIHDFRRTARTHLAALGVDPFVAERCLNHRIKGVEGIYNRHDYFDERK
FT                   AALAQWCDLLVALEKGEDYNVTPIKQIKRKFL"
FT   CDS_pept        168127..168873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0037"
FT                   /locus_tag="XNC1_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0184"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88272"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGY7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88272.1"
FT                   /translation="MKNKPPEIDVFKLFSSQGLATPNAVALSLLGINPYTAVKDIPEEY
FT                   SDHVNQLRSAIVNNVNAVNPLQDTKTNSAVDSDIVFGAAYPCMCLLEGFIPEVITSRIK
FT                   QALNNTYTEHRKNDEWKTYIKAFGGQELVQKIAMQNKKGQGQYRKNDEQKGTYKLIGLL
FT                   VLLLQEKTINGCQPSNNYGSIGKPNKKGIYADIKVLVDVMNEDLLANNKMSKNFLGGVG
FT                   SSTFYDKLRDADYYLNESDEQLVHKQ"
FT   regulatory      169052..169111
FT                   /regulatory_class="promoter"
FT   CDS_pept        169267..169509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0185"
FT                   /product="Putative cytoplasmic protein (modular protein)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0185"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88273"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGY8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88273.1"
FT                   /translation="MAKQKNPRMKNTSPYPEVGNARKRHTADFLGISDSTLHRWVKDKK
FT                   IPQPFELEGGFFVFDAAEIRKWVENKKSRRESIVI"
FT   regulatory      169562..169621
FT                   /regulatory_class="promoter"
FT   operon          169643..175561
FT                   /operon="XNC1_operon0038"
FT   CDS_pept        169643..170482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0038"
FT                   /locus_tag="XNC1_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0186"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88274"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGY9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88274.1"
FT                   /translation="MNEVSFYKDENLSYIFNYKLIPFEENGKDTGFMIRTIELYKLAKM
FT                   KDSIKKFTEITGFNFDNLIPSVEEIKFLIKRGRSVVSNYSKFPEKQEAELKSLVDILNN
FT                   AQNGKISKPTGYHLSTRVWITDMHHAVERKEDSIKRERGKLEKMNGLYGLLYPVIEWLF
FT                   SEKITGFKKELLESIPRETVNLNALLSEMDWEHSRACKLIISAMDELERCVNKVISQCV
FT                   TPKDKYTLNHTPVYQSDYYKLYYRKESHHLKHVLTADEYVNAMVNAKNRTQDKLSYM"
FT   CDS_pept        170505..171524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0038"
FT                   /locus_tag="XNC1_0187"
FT                   /product="putative phage gene"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0187"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88275"
FT                   /db_xref="InterPro:IPR006441"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGZ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88275.1"
FT                   /translation="MYITAIPDAARTFHANFTRGANYSSSNSDTFYISSPSENLLRVAI
FT                   SDSSWFLNKLTLADVNQENGDTVNLGDNTLHTGRVIDGRFHKRVNMEGAPYALEETDTC
FT                   AAISYEQMSLIANSGSGDDEHFTKVMSDLFSKTVSLDMIRIGFNGEFCAYPTQPDVYKR
FT                   GQDVNRGWHAIAKEFNQGSQVITDKIALGKNGDFPNLDAIANYLIIKKIPEEFREDPRL
FT                   VVLVGSELAALYREKLFSASDKAADIQASQMALSTIAGRFALIPPFMPGRRLVVTTLDN
FT                   LHIYTQKNTRRFRAEFVDERQVYEHSYLRNEGYGLGDGNLYAAVDENAIHIEEGVFSL"
FT   CDS_pept        171521..172042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0038"
FT                   /locus_tag="XNC1_0188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0188"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88276"
FT                   /db_xref="GOA:D3VGZ1"
FT                   /db_xref="InterPro:IPR009228"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGZ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88276.1"
FT                   /translation="MSESHLMTTWICVATEGQTIDRRTIEAQWLSEIAETYDPHYYTAL
FT                   IWEEHNRNLDNLGEVLAARTDVIDGKARLYLRLRPNLKLMEYNRQGQKLFCSIEVQEDF
FT                   QGEGIFYLGGLAVTDSPASVGTDRLKFSINRSHFSRKKSKFSISSPAVFNLSDGLKNTK
FT                   NRWFTAISAG"
FT   regulatory      172051..172078
FT                   /operon="XNC1_operon0038"
FT                   /regulatory_class="terminator"
FT   CDS_pept        172114..172626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0038"
FT                   /locus_tag="XNC1_0189"
FT                   /product="putative bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0189"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88277"
FT                   /db_xref="InterPro:IPR018880"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGZ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88277.1"
FT                   /translation="MKIKRLHPSNRLGYIEKTLAKSNVGRGNLRIVKATVDATCVFFCV
FT                   VNNAYLMAAYAYLNSMVALSEHPKGWLVSFTTSISTSDNVTAPIERGNSGGDPFDKVKE
FT                   IIFMMAIPAQTQFKFLFLCVKRSDITATPCRIEATAADEHNARMLLVHDFVLLFAGRLP
FT                   VQPKREG"
FT   CDS_pept        172629..172847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0038"
FT                   /locus_tag="XNC1_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0190"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88278"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGZ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88278.1"
FT                   /translation="MTNTTHKNAVISATGEKQLLRVAQMTAFFAELLNNSEGKPISSEG
FT                   MAVVMECLSEQVELIIDESSLMNRDIK"
FT   CDS_pept        172847..175561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0038"
FT                   /locus_tag="XNC1_0191"
FT                   /product="Putative prophage primase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0191"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88279"
FT                   /db_xref="GOA:D3VGZ4"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR009270"
FT                   /db_xref="InterPro:IPR013237"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGZ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88279.1"
FT                   /translation="MNNQNYPNASTIPTSIPSVTDIVKAANGRWYYILSNLGVSVPENN
FT                   KHGACPKCGGKDRFRFDDKNGKGTWFCNHCGSGDGLDLLKLVTGQDTKTACSEINKILL
FT                   LPEFKKITPTRVKKVGAQKGIELFEKLKTLCFSGESQYLSNKGLTHHNYLITQQQYTQS
FT                   NIIFPIGSLLLPLVDNQRSLKGGQLISPKGEKSLLAGSALSASFIVVVDEADKNIEQVV
FT                   ITEGFATGLSLSKVIDAFIVAAVAATNLVKVAQQLRERWPQAKIIIAGDNDLIDGKENT
FT                   GRSWAEKAAKAVDGWVTLPPTHYKSDWDDYRQENNADKVKEAFFEEMTYCGKDKTYLPQ
FT                   GFRLTQEYLWYDKLVNKSDGDTEVRNIKISSPIKVTAITCDADSSNYGRLLEWEDTYGN
FT                   CRKWAMPMEMLSGSGEELRRVLLVNGLSYINISGQARAHLMEYISLCRPERKVTCVNKT
FT                   GWHGNVYVLQDEVVGAGADSVILQTSSVQGKDFRVSGSSEEWREHIGKYCVGNARLAFS
FT                   VSLAFASSLLKLVGVGGGGYHLKGESTDGKTTTMKVAASVCGGTDYWYTWRATGNALEG
FT                   TACRRNDATLMLDEIREVDGREAGNIAYMLANGQGKARAKTDGSVRETNRWNLLFLSTG
FT                   ELSLVEHASNAGERTYAGVEVRMIQIPSDSGKHGVFEDLHQFASGKSLAEYLEQAVTKY
FT                   HGSPFRDWLKYLTHDLTSISGTAKALLKEYTANMMPENAGNQVGRAITRFALVAMAGEI
FT                   ATRAGITGWQQGEAYAAAEKCLAAWMKERGHTANQEDITALEQVTDFISRNQFSRFADW
FT                   YDENSRPLNMMGFRRVEKGTANQDPTVQFYVLSSAWKEICKGFDSRKVARLCVEKGWLE
FT                   AGKDGRIQTSIRLPEIGLKRVYLFNSDVLGSAE"
FT   regulatory      175666..175723
FT                   /regulatory_class="terminator"
FT   regulatory      175682..175741
FT                   /regulatory_class="promoter"
FT   CDS_pept        175853..176065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0192"
FT                   /product="Putative phage gene (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0192"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88280"
FT                   /db_xref="InterPro:IPR007684"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGZ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88280.1"
FT                   /translation="MKVLKVYCPECDGQATIKKIKTQELNNIPEIYCCCNDVECGHTYV
FT                   LTLSFSHSIRHSKFVQDPRNHVLKL"
FT   CDS_pept        complement(175911..176042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0193"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88281"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGZ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88281.1"
FT                   /translation="MDLAQTYCDVSSVKNLELKRMYDHIQHHYNNNKFPVCYSILAF"
FT   regulatory      176172..176221
FT                   /regulatory_class="terminator"
FT   operon          176585..177590
FT                   /operon="XNC1_operon0039"
FT   CDS_pept        176585..176794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0039"
FT                   /locus_tag="XNC1_0194"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0194"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88282"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGZ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88282.1"
FT                   /translation="MSMLKRPQLTLSLGGLLFYFVNGFRFVINASNAMLTIGGLMITLK
FT                   VSYPQHQSMLPTNLRGAIHGAPAI"
FT   CDS_pept        176775..177590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0039"
FT                   /gene="dinD"
FT                   /locus_tag="XNC1_0195"
FT                   /product="DNA-damage-inducible protein, part of SOS
FT                   response"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0195"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88283"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGZ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88283.1"
FT                   /translation="MEHQLFEEIKLLSEDGIEYWSARDLAPLLDYKDWRNFLKVLSKAL
FT                   QACKASNQEPSYHFVEANKMVTLGSGAERKIDDIKLSRYACYLVVQNGDPSKPVIAAGQ
FT                   TYFAVQTRRQELADNEAFRKLREDEKRLFLRNELKEHNKQLVETAQRAGVETNIDFAIF
FT                   QNHGYQGLYGGLDQKAIHQQKGLKKSQRILDHMGSTELAANLFRATQAEEKLRRDNVKG
FT                   KTQANQTHFDVGRKVRDTIQELGGTMPEDLPSPEKSIKQLETIAKKLKK"
FT   CDS_pept        177691..177936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0196"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0196"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88284"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGZ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88284.1"
FT                   /translation="MNSMNPVITRLHATYSMNRFKQNISQCQYTPCCSWLFYYQNIAER
FT                   ITIAHDYCVPLGCTTCDNKTHLVVHGYFLHWRLHNA"
FT   regulatory      177756..177815
FT                   /locus_tag="XNC1_0196"
FT                   /regulatory_class="promoter"
FT   regulatory      177770..177809
FT                   /locus_tag="XNC1_0196"
FT                   /regulatory_class="terminator"
FT   CDS_pept        177929..178087
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0197"
FT                   /product="Site-specific recombinase"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ88285.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        178075..178428
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0198"
FT                   /product="Site-specific recombinase (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ88286.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        178247..178504
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0199"
FT                   /product="Site-specific recombinase"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ88287.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        178523..178663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0200"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88288"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH03"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88288.1"
FT                   /translation="MTVYSTAVLSLYFRDGQTENKKPTLTVRGSPYSAIGCIICTSRDL
FT                   I"
FT   CDS_pept        complement(178697..179737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0201"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0201"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88289"
FT                   /db_xref="GOA:D3VA56"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:D3VA56"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88289.1"
FT                   /translation="MLYTSNPIIKHKAGLLNLAEELSNVSRACKVMGVSRDTFYRYQEL
FT                   VETGGIDALINQSRKTPNLKNRVDAETEHAVINSAIEFPAYGQARTSNELRKAGIFVSA
FT                   SGVRSIWLRHHLENFKKRLAALEKKVADEGIILTDEQVAALERKQHDDEACGEIETAHP
FT                   GYLGSQDTFYVGNLKGVGRLYQQTFVDTYSKVAFAKLYTSKTPITAADLLNDRVLPFFS
FT                   AHRLPMLRILTDRGTEYCGRVEHHDYQLYLAVNDIDHTRTKAMSPQTNGICERFHKTIL
FT                   NEFYQVTFRKKLYGSLDELQKDLDKWMDNYNNHRTHQGKMCCGRTPIETLQDGKSIWAE
FT                   KNLTQI"
FT   regulatory      complement(179837..179896)
FT                   /regulatory_class="promoter"
FT   regulatory      179878..179937
FT                   /regulatory_class="promoter"
FT   operon          179958..180574
FT                   /operon="XNC1_operon0040"
FT   CDS_pept        179958..180179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0040"
FT                   /locus_tag="XNC1_0202"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0202"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88290"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH05"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88290.1"
FT                   /translation="MRTYTSTQARANIAEVLDTAAHGEPVEITRRDGSSAVVISRAEFD
FT                   NWQNAKLDAEFDSIMQRHGHTIEALTNR"
FT   CDS_pept        180176..180574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0040"
FT                   /locus_tag="XNC1_0203"
FT                   /product="Death on curing protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0203"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88291"
FT                   /db_xref="GOA:D3VH06"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR006440"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH06"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88291.1"
FT                   /translation="MIWVSAQEVIAFHDRILQRLPGVAGMPDSGRAEALIYRVQNRTHH
FT                   EGITDIFELAATYWAAIARGHIFNDGNKRTAFFVTMTFLYRNGIKIRDNDNTLENLTVD
FT                   AATGEKTVDQLAQHLRELVDYTNPSCNP"
FT   regulatory      complement(180633..180682)
FT                   /regulatory_class="terminator"
FT   regulatory      180646..180694
FT                   /regulatory_class="terminator"
FT   operon          complement(180816..182554)
FT                   /operon="XNC1_operon0041"
FT   CDS_pept        complement(180816..181376)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0041"
FT                   /locus_tag="XNC1_0204"
FT                   /product="Plasmid-related protein (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type h :
FT                   extrachromosomal origin"
FT                   /db_xref="PSEUDO:CBJ88292.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        complement(181419..181715)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0041"
FT                   /locus_tag="XNC1_0205"
FT                   /product="plasmid-related protein (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type h :
FT                   extrachromosomal origin"
FT                   /db_xref="PSEUDO:CBJ88293.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        complement(181778..182554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0041"
FT                   /locus_tag="XNC1_0206"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0206"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88294"
FT                   /db_xref="InterPro:IPR021561"
FT                   /db_xref="InterPro:IPR033455"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH09"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88294.1"
FT                   /translation="MNSKINWLVNHTTPGSLVLQQWLVENGISHSLTQKYAQNGWLKKL
FT                   FTGVYYRPDPIKNHIPNWADALQALADQIHLQIHISGLTSLTHQGLSHYLPLKSEKVWI
FT                   GVRNKQSLPKWFKEFPNQNWQYCNNSKLRELSDKDFTIVLVNGKELKASTPELAAYEAV
FT                   DSIGKHISFEHTAELFQGLVNLSPRKVQSLLNRSKAVQTNRIFLYLSHYHDHQWVKRLD
FT                   ESQIELGSGKRQVVTQGRYDERYKITIPESLIPKSQ"
FT   regulatory      complement(182578..182637)
FT                   /regulatory_class="promoter"
FT   CDS_pept        182844..183014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0207"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0207"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88295"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH10"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88295.1"
FT                   /translation="MIRICQILSLPDEWFQDEEFEDELTSEEILGYAMARSGRYLSDLS
FT                   EIELKYPLPQN"
FT   regulatory      complement(183015..183054)
FT                   /regulatory_class="terminator"
FT   operon          complement(183070..184546)
FT                   /operon="XNC1_operon0042"
FT   CDS_pept        complement(183070..183837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0042"
FT                   /gene="tpiA"
FT                   /locus_tag="XNC1_0208"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0208"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88296"
FT                   /db_xref="GOA:D3VH11"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH11"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88296.1"
FT                   /translation="MRHPLVMGNWKLNGNTHMVNDLIAGLRKELSNVDGCGVAIAPPTV
FT                   YVSLAKNALAGSRIALGAQDVGVNLSGAFTGETSAEMLKDVGAQYIIIGHSERRTYHKE
FT                   SDEFIAKKFAILKEQGLIPVLCIGETEQENEDGQTEVVCARQIDAVLNTLGAEAFKGAV
FT                   IAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAKQDAAIAEQVIIQYGGSVNAGNAAELF
FT                   TQPDIDGALVGGASLKADAFAVIVKAAAEAKKA"
FT   CDS_pept        complement(183926..184546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0042"
FT                   /locus_tag="XNC1_0209"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0209"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88297"
FT                   /db_xref="InterPro:IPR009918"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH12"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88297.1"
FT                   /translation="MKTGMNKLLLTILIAFGLCLPLSATAGEPSVTPEINSSLMYLLPD
FT                   SPTFEDTIPVFREKYNKKHAEILLYEYKVVASKDISQPFIRAASKINDKIYSSAVLERG
FT                   SEKIKSLQITLLPSQNKQEDEQNFILAKQYMTALISQFEPTFSLEQAKNQLEKLLQAAG
FT                   KHPVFSQKMGAVRYVIVNSSENIMTFAIEPIKLSLSDASANEN"
FT   regulatory      184097..184156
FT                   /regulatory_class="promoter"
FT   CDS_pept        184389..185051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0210"
FT                   /product="putative membrane protein (modular protein)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0210"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88298"
FT                   /db_xref="GOA:D3VH13"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH13"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88298.1"
FT                   /translation="MVSSNVGESGSRYINDEFISGVTEGSPAVADNGKQRPKAINIVSR
FT                   SLFMPVFILLLVELNIGKTASTIGKEYMTLQQWGFSFKGRIGRREFWIGIGICFALIFT
FT                   LFTLHGMNVLSMNYAAVGVVLLLCPTAAIFSKRLHDRNKRGGWVLLLALAWVLLSLDWE
FT                   LMAPVWQWGVGRFVPTLIFVMIILDCGVFRGTEGANRFGQMAEMVDYISANEPTQKG"
FT   regulatory      complement(184685..184744)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(185066..185812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fpr"
FT                   /locus_tag="XNC1_0211"
FT                   /product="ferredoxin-NADP reductase"
FT                   /EC_number="1.18.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0211"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88299"
FT                   /db_xref="GOA:D3VH14"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH14"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88299.1"
FT                   /translation="MANWVTGKVTDITNWTDSLFSLKIHAPIEKFTAGQFAKLALEIEG
FT                   ERIQRAYSYVNSPDDNHLEFYLVTVPEGKLSPRLAALQTGDELLLTEQAAGFFVLDEIP
FT                   DCQTLWMLSTGTAIGPYLSILQQGKDLGRFENIVLVHATRWGKDLSYLTMMRELEETFQ
FT                   GKLRIQTVVSRENWPDSLMGRIPALIENNALESAVGLPLQAENSHVMLCGNPQMVRDTQ
FT                   QLLKEQRNMTKHLRRKPGHITSEQYW"
FT   regulatory      185103..185143
FT                   /regulatory_class="terminator"
FT   regulatory      185966..186025
FT                   /regulatory_class="promoter"
FT   regulatory      complement(185995..186054)
FT                   /regulatory_class="promoter"
FT   CDS_pept        186157..187311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="emrD"
FT                   /locus_tag="XNC1_0212"
FT                   /product="multidrug transport protein (MFS family)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0212"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88300"
FT                   /db_xref="GOA:D3VH15"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH15"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88300.1"
FT                   /translation="MLIALAAVGQMTQTIYVPVIADMAGDLGKPAGEVQRVMAAYLFSY
FT                   GLSQLFYGPLSDKVGRRPVILAGMSIFLAATTCALFAPNLLVLVIASACQGLGTGVAGV
FT                   MVRTMPRDLYTGTTLRYANSLLNMAVLVSPLVAPMIGGMIAHQFGWRSCYLFLLIWGTI
FT                   VTGFLFWYLTETRPVQTKHSPMLVSFHQLLSHGTFVAYLIMLVGGLAGVAVFEASSGVL
FT                   MGAVLGLDSLTVSILFILPIPAAFFGAWYAGREGKTFYRLMWHSVFCCLFAGILMWLPS
FT                   WFGVMNIWTLLVPAAIFFFGAGMLFPLATTGAMEPFPYLAGAAGALVGGFQNIGSGMAT
FT                   WLSAMLPQNNQSSVGMLMFSMALMILFCWLPISQRLQRQEQTIL"
FT   regulatory      complement(187358..187399)
FT                   /regulatory_class="terminator"
FT   regulatory      187370..187411
FT                   /regulatory_class="terminator"
FT   operon          complement(187415..189814)
FT                   /operon="XNC1_operon0043"
FT   CDS_pept        complement(187415..188938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0043"
FT                   /gene="glpK"
FT                   /locus_tag="XNC1_0213"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0213"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88301"
FT                   /db_xref="GOA:D3VH16"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH16"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88301.1"
FT                   /translation="MTIENITEKKYIVALDQGTTSSRAVVLDHDANIVCISQREFPQIY
FT                   PKPGWVEHDPMEIWASQSSTLVEVLAKADISSDQIAGIGITNQRETTIVWEKETGKPVY
FT                   NAIVWQCRRTADICTKLKQKEGLEEYIHHNTGLVIDPYFSGTKIKWILDNVAGVRERAE
FT                   KGELLFGTVDTWLVWKMTQGRVHVTDSTNASRTMLFNIHNLDWDQKILNELGIPRIILP
FT                   KVAASSEIYGQTNIGGKGGTRIPIAGIAGDQQAALYGQLCVHPGMAKNTYGTGCFLLMN
FT                   TGKDAVRSNHGLLTTIACGPRGEINYALEGAVFVGGASIQWLRDELKLIADAADSEYFA
FT                   SKVKDSNGVYVVPAFTGLGAPYWDPYARGAIFGLTRGTNSNHIIRATLESIAYQTRDVL
FT                   DAMQADAGTRLQALRVDGGAVANNFLMQFQADILGTRVERPEVRESTALGAAFLAGLAV
FT                   GFWQDLDEVKSKATIEKEFRPGIETTERNHKYNGWKKAVARAQEWEDRA"
FT   CDS_pept        complement(189017..189814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0043"
FT                   /gene="glpF"
FT                   /locus_tag="XNC1_0214"
FT                   /product="MIP channel, glycerol diffusion"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0214"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88302"
FT                   /db_xref="GOA:D3VH17"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH17"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88302.1"
FT                   /translation="MSQTTTPTLSGQCISEFMGTTLLVFFGLGCVAAARLAGAQLGLWE
FT                   ISIIWGFGVALAVYLTAGISGAHLNPAVTIALCLFANFDRKKVLPYIIAQMFGGFAAAA
FT                   IVYMMYYNLFLDYEQVHGIVRGSQESLFTAGVFSTYPATQISVLQAFIVEVIIAAILLC
FT                   LILALTDDGNGIPKGPLAPLLIGILIAVIGGSFGPLTGFALNPARDFGPKLVAYFAGWG
FT                   DIALTGGRDIPYCLVPLAAPIVGAILGAFGYRKLITRHLPREV"
FT   regulatory      189773..189832
FT                   /regulatory_class="promoter"
FT   operon          189869..190372
FT                   /operon="XNC1_operon0044"
FT   CDS_pept        189869..190060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0044"
FT                   /locus_tag="XNC1_0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0215"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88303"
FT                   /db_xref="GOA:D3VH18"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH18"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88303.1"
FT                   /translation="MYREKGTCEFIVNVRKREIAKLKSACCVNKMSEFAFIYDFISLGI
FT                   VISHTFWFSHYISRYTTH"
FT   regulatory      complement(189977..190036)
FT                   /regulatory_class="promoter"
FT   CDS_pept        190130..190372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0044"
FT                   /locus_tag="XNC1_0216"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0216"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88304"
FT                   /db_xref="GOA:D3VH19"
FT                   /db_xref="InterPro:IPR009252"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH19"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88304.1"
FT                   /translation="MSFEVFEKLESKVQQAIDTITLLQMEIEELKEQNAVLSQDVQNAA
FT                   DNRDALVRENEQLKQEQSAWQERLRTLLGKMEDVQ"
FT   regulatory      complement(190386..190415)
FT                   /regulatory_class="terminator"
FT   regulatory      190399..190428
FT                   /regulatory_class="terminator"
FT   operon          complement(190433..191962)
FT                   /operon="XNC1_operon0045"
FT   CDS_pept        complement(190433..191005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0045"
FT                   /gene="menG"
FT                   /locus_tag="XNC1_0217"
FT                   /product="putative methyltransferase protein in menaquinone
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0217"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88305"
FT                   /db_xref="GOA:D3VH20"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR014339"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH20"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88305.1"
FT                   /translation="MILPTLTLKGYTVCSLHKPDVNPMKYDTSELCDIYQEDINVVEPL
FT                   FSNFGGRTSFGGQIITVKCFEDNGLLYDLLEENGHGRILLVDGGGSVRKALVDAELAQL
FT                   AANNEWEGIVVYGAVRQVDYLSELDIGIQAMAAIPAGSNSEGVGESDIRVNFGGVTFFS
FT                   GDYLYADNTGIVLSDVPLELDEDNDDV"
FT   CDS_pept        complement(191045..191962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0045"
FT                   /gene="menA"
FT                   /locus_tag="XNC1_0218"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0218"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88306"
FT                   /db_xref="GOA:D3VH21"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH21"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88306.1"
FT                   /translation="MSSTTSTSQIQAWLESLRPKTLPLAVAAVVTGSALASWAGHFKWS
FT                   VALLALLTSAMLQILSNLANDYGDVAKGSDTEKRIGPMRGMQKDLITAKQMKNALKVTV
FT                   LLACLSGIALIIVACNSPSDIVGFFLLGLLAIVAAITYTVGTRPYGYMGLGDISVLIFF
FT                   GWLSVIGTYYLQAHGFSLSTILPATACGLLSVAVLNINNLRDIENDRQNGKNTLAVRLG
FT                   GKKARYYHAILLVGAVICLVSFTLLYLHGWSGWLFLLTLPLLFKHILQVLRDPTPEGMR
FT                   PRLVQMVKAALLTNVLFSIGLMLN"
FT   regulatory      complement(191995..192054)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(192009..192053)
FT                   /regulatory_class="terminator"
FT   operon          complement(192067..193940)
FT                   /operon="XNC1_operon0046"
FT   CDS_pept        complement(192067..193398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0046"
FT                   /gene="hslU"
FT                   /locus_tag="XNC1_0219"
FT                   /product="ATPase component of the HslUV protease, also
FT                   functions as molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0219"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88307"
FT                   /db_xref="GOA:D3VH22"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH22"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88307.1"
FT                   /translation="MSEMTPREIVSELDNHIIGQDKAKRAVAIALRNRWRRMQLDENLR
FT                   YEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLT
FT                   DAAVKMVRLQSIEKNRYRAEELAEERILDVLLPPAKNNWGQTETQSEPSSTRQAFRKKL
FT                   REGQLDDKEIEIEVSAAPVGVEIMAPPGMEEMTNQLQSMFQNMAGQRQKSRKLKIKDAF
FT                   KLLVEEEAAKLVNPEELKQQAIDAVEQHGIVFIDEIDKICKRGQTSGPDVSREGVQRDL
FT                   LPLVEGCTVSTKHGMVKTDHILFIASGAFQVSSPSDLIPELQGRLPIRVELQALTTEDF
FT                   ERILTEPNASLTEQYKALMATEGMNIEFTADGIRKIAEAAWQVNETTENIGARRLHTVL
FT                   ERMMEDISFDASERQGQFVEINSDYVKENLDELVANEDLSRFIL"
FT   CDS_pept        complement(193410..193940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0046"
FT                   /gene="hslV"
FT                   /locus_tag="XNC1_0220"
FT                   /product="peptidase component of the HslUV protease"
FT                   /EC_number="3.4.25.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0220"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88308"
FT                   /db_xref="GOA:D3VH23"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH23"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88308.1"
FT                   /translation="MTTIVSVRRNGKVVIGGDGQATMGHTVMKGNVRKVRRLYNDKVIA
FT                   GFAGGTADAFTLFELFERKLEMHQGHLTKAAVELAKDWRTDRMLRKLEALLAVADENAS
FT                   LIITGNGDVIQPENDLIAIGSGGSYAQAAARAMLETTDLGAREITERALSIAADICIYT
FT                   NHNHNFEELSSKA"
FT   operon          complement(194079..195946)
FT                   /operon="XNC1_operon0047"
FT   CDS_pept        complement(194079..194849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0047"
FT                   /gene="ftsN"
FT                   /locus_tag="XNC1_0221"
FT                   /product="essential cell division protein, epimerase-or
FT                   mutase-like"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0221"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88309"
FT                   /db_xref="GOA:D3VH24"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR011930"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH24"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88309.1"
FT                   /translation="MAQRDYVSRGRTNPRQKSTGNKKNQSQGLPKTTLAVAVALVVMLI
FT                   GGLYFIVHSKKESVQNEPQPAHPSKGHGLPPKPEERWSYIKELENRPVNETSIPDPAAT
FT                   LNPPLNQATQLTPEQKQLLEQMQADMRQPPISLKEVPYNSDPVPRSRVVINPPAQENAQ
FT                   NQPEPSAQPVPAPKLTATESRVMLQCGSFRAAEQAESVRASLAFAGIESQITTKDNWNR
FT                   VVLGPYKNQAGAEKMRTRVAEAGVSGCILRPAGG"
FT   CDS_pept        complement(194921..195946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0047"
FT                   /gene="cytR"
FT                   /locus_tag="XNC1_0222"
FT                   /product="transcriptional repressor for genes of nucleoside
FT                   catabolism and recycling (GalR/LacI family)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0222"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88310"
FT                   /db_xref="GOA:D3VH25"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH25"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88310.1"
FT                   /translation="MEKKNYTLATMKDVARVAGVSTATVSRTLMNSDKVSVRTRQKVES
FT                   AILEVGYYPHNLAKNLRRNESRAILAIVPNISDPFFNEIIRGIEETAAKHGYLVLIGDC
FT                   THQQQQEHAFINLLITKRIDGMVLLGSNIPFDVSKEEQKNLPPMVMANEFAPDLELPTV
FT                   HIDNLTAAFNATHHLQKLGHKFIACITGPDTMPLCHYRLQGYIQALRRTGEDIREEYIA
FT                   RGDFTHESGAHLAEKLLTLPTPPSAIFCHSDVMAMGVIWQAKKMGLKLPEDLSVIGFDN
FT                   LNLAQYCEPALTTVAQPRYEIGHHSMLLLLEQLQGRLVSKGSRLLDAELIIRESTCAPK
FT                   S"
FT   regulatory      complement(196050..196109)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(196250..198448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="XNC1_0223"
FT                   /product="primosomal protein N' (factor Y) directs
FT                   replication fork assembly at D-loops, ATP-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0223"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88311"
FT                   /db_xref="GOA:D3VH26"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH26"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88311.1"
FT                   /translation="MTVVQVVLPVPLARAFDYLLPSELPVPAIGVRVLVPFGKRNAIGV
FT                   VVGIADSSEFPPEQLKSVSSVLDTQPLFPDDLWQLLLWSAHYYHYPLGEVLFHAMPVLL
FT                   RQGKNAEFAPLWQWQITTEGRELPLEQLKRSAKQQQALATLRQKPIYRHQVSELELSES
FT                   ALQSLKKKALIALNPVQPEAENWHTSFTIIGARLTLNAEQATAVGAIRAEDRTFSPWLI
FT                   AGITGSGKTEVYLSVLENILAQGKQALILVPEIGLTPQTIRRFRERFKAPIDVLHSALN
FT                   DSERLAAWLRAKRGENAIVIGTRSALFTPFARLGMIIIDEEHDGSYKQQEGWRYHARDL
FT                   AVFRAKKEGIPIIMGTATPALETLYNVQQNKYRQLTLTKRAGHAQPATQHLLDLKGLPL
FT                   TVGLSQPLINRIHEHLKADNQVILFLNRRGYSPALLCHECGWIAECQRCDHYYTLHQNH
FT                   RHLRCHHCDSQRPVPRQCPQCGSTNLMPVGLGTEQLEDGITKLFPNTPITRIDRDTTSR
FT                   KGALEQQLAEVHQGGARILIGTQMLAKGHHFPDVTLVALLDVDGALFSADFRAAERFAQ
FT                   LYTQVSGRAGRAGKRGEVVLQTHHPEHPLLQVLLEKGYDAFAQQAMEERQQVHLPPFAS
FT                   HILLRSEDHDNQQAPAFLQHMRQLFEHHPQRDNHLWIMGPVPALQAKRSGRYRWQLMIQ
FT                   HPSRIFLQKIMTGIYPQITAMPQARKVKWNIDVDPTEG"
FT   regulatory      198514..198573
FT                   /regulatory_class="promoter"
FT   regulatory      complement(198571..198630)
FT                   /regulatory_class="promoter"
FT   CDS_pept        198675..198890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="XNC1_0224"
FT                   /product="50S ribosomal subunit protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0224"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88312"
FT                   /db_xref="GOA:D3VH27"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH27"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88312.1"
FT                   /translation="MKQGIHPKYEEITASCSCGNVMKINSTVGHDLNLDVCGDCHPFYT
FT                   GKQRDVATGGRVDRFNKRFSVPGAKK"
FT   regulatory      complement(198923..198969)
FT                   /regulatory_class="terminator"
FT   regulatory      198929..198988
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(198973..199290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metJ"
FT                   /locus_tag="XNC1_0225"
FT                   /product="transcriptional repressor for methionine
FT                   biosynthesis (MetJ family)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0225"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88313"
FT                   /db_xref="GOA:D3VH28"
FT                   /db_xref="InterPro:IPR002084"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR023453"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH28"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88313.1"
FT                   /translation="MAEWNGEYVSPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQ
FT                   VNNLRHATNSELLCEAFLHAFTGQPLPNDNDLRKERHDEIPEAAKVMMRELGIDPDTWE
FT                   Y"
FT   CDS_pept        complement(199283..199429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0226"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88314"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH29"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88314.1"
FT                   /translation="MNSYDWSDIVNSRIMLDYRLTDMKTDQKNHLSSDCNYLIQKLFKV
FT                   SHG"
FT   regulatory      complement(199394..199453)
FT                   /regulatory_class="promoter"
FT   regulatory      199493..199552
FT                   /regulatory_class="promoter"
FT   operon          199583..203188
FT                   /operon="XNC1_operon0048"
FT   CDS_pept        199583..200743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0048"
FT                   /gene="metB"
FT                   /locus_tag="XNC1_0227"
FT                   /product="cystathionine gamma-synthase, PLP-dependent"
FT                   /EC_number="2.5.1.48"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0227"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88315"
FT                   /db_xref="GOA:D3VH30"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR011821"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH30"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88315.1"
FT                   /translation="MGCKQATVAVHSGLNIDEQYGCVVPPIYLSSTYNFTGFNEPRTHD
FT                   YSRRGNPGRDVVQRVLAELESGAGAVMTSSGMSAIHLLCTVFLRPGDLLVAPHDCYGGS
FT                   YRLFDSLSKRGAYNVIFVDQADDNALKQALAQKPKWVLIETPSNPLLRIVDIQYICELA
FT                   HEAGALAIVDNTFLSPVLQKPLDLGADIVVHSCTKYLNGHSDLIAGAIIAKDPVIAEEL
FT                   AWWANNIGVTGAAFDSYLLLRGIRTLSARVLLQQNNAAIIADYLQQQPQVKKLYYPALK
FT                   NHPGHEIAVKQQKGFGAMLSFELEGDEQTMRRFLSALKLFTLAESLGGVESLISHTATM
FT                   THAGMSAEARAQAGITDLLLRVSVGIEDSQDLIADLDNAFRVAATR"
FT   CDS_pept        200753..203188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0048"
FT                   /gene="metL"
FT                   /locus_tag="XNC1_0228"
FT                   /product="bifunctional: aspartokinase II (N-terminal);
FT                   homoserine dehydrogenase II (C-terminal), methionine
FT                   sensitive"
FT                   /EC_number="2.7.2.4"
FT                   /EC_number="1.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0228"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88316"
FT                   /db_xref="GOA:D3VH31"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH31"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88316.1"
FT                   /translation="MSALATAEAGFDRQLHKFGGSSLADVRCYQRVAEIMMNYSQPGDL
FT                   MVVSAAGSTTNLLIDWLRLSQSDRISAHQMQQSLRRYQQELIRGLLPETVAEELVTMFI
FT                   ADLERLSALLDKPVTDITYAEVVGHGEIWSARLMAAVLEQKGVPSTWLDARQFLRAERV
FT                   AQPQVDVNLSQPLLDQLLSQHPNKRLVVTGFISSNQNGETVLLGRNGSDYSATQVGALA
FT                   GAKKVTIWSDVAGVYSADPRKVKDACLLPLLRLDEASELARLAAPVLHTRTLQPVSVSD
FT                   IDLQLRCSYQPEQGSTRIERVLATGTGAKIVTSHDDVCLIELHVSSAHDFKQIYKDIDS
FT                   LLKRTQIKPLATGLHADCNLIQLCYTSEVVNSALDVLQDASVPGKLSLREGLALVALVG
FT                   AGVCKNPLHSHRFYQQLKDQPVEFVWHAEEGISLVAVLRLNQTSHLIQGLHQSLFRAEK
FT                   RIGLVLFGKGNIGSRWLELFAREQKNISARSDFEFILAGVVDSRRSLLNYQGIDASRAL
FT                   AFFNDEAIEHEDDSLFLWMRAHPYDDLVVLDVTASEELAKEYIGFASYGFHVISANKIA
FT                   GSSDSNTYRMIRDAFAKTGRHWLYNATVGAGLPVNYSVRDLRESGDAILSISGIFSGTL
FT                   SWLFLQFDGSVPFSDLVEQAWQQGLTEPDPRIDLSGQDVRRKLVILAREAGYEIEPDQV
FT                   RVESLVPQEANLGSVEEFFENSTAVNAQMLQRLEAAREMGMVLRYVARFDVSGKAKVGV
FT                   EAVRSDHPLASLLPGDNVFAIESRWYRDNPLVIRGPGAGRDVTAGAIQSDLNRLSQLL"
FT   regulatory      203198..203257
FT                   /regulatory_class="promoter"
FT   operon          203373..206291
FT                   /operon="XNC1_operon0049"
FT   CDS_pept        203373..206012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0049"
FT                   /gene="ppc"
FT                   /locus_tag="XNC1_0229"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0229"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88317"
FT                   /db_xref="GOA:D3VH32"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH32"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88317.1"
FT                   /translation="MNQQYSAMRSNVSMLGKLLGDTIKEALGEDILDKVETIRKLSKSS
FT                   RAGNEVHRQQLLSTLENLSNDELLPVARAFNQFLNLANAAEQYHSISPHGEAASNPVAL
FT                   AALFNRLKDKQFSNDDLVKAIDELAIELVLTAHPTEIARRTLIHKLVEVNGCLAQLDHD
FT                   DLADYERNNIMRRLRQLIAQSWHTDEIRKIRPTPIDEAKWGFAVVENSLWEGVPAFLRE
FT                   FNEQLEESIGYSLPVEAVPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKAADLFLKD
FT                   IQILVSELSMSECTPEVRQMAGGDHVLEPYREIAKQLRTQLSHTLAYLEKCLKGEQVLP
FT                   PSDLLLHNEQLWQPLYACYQSLKACGMEIIANGQLLDTLRRIRCFGLCLVRIDIRQEST
FT                   RHTDAIAELTQYLEMGDYASWPEAEKQAFLLHELNSKRPLTPRDWQPSAETQEVFETCK
FT                   VIAETPQDAIAAYVISMAKVPSDVLAVKLLLKEAGCSLSLPVAPLFETLDDLNNAESVI
FT                   RKLLGITWYRELIQDKQMVMIGYSDSAKDAGVMAASWAQYQAQDALIKVCEQEGVTLTL
FT                   FHGRGGTIGRGGAPAHSALLSQPPGSLKGGLRVTEQGEMIRFKFGLPQVAISSLALYAS
FT                   AILEANLLPPPEPKPEWRQIMGILSDVSCNMYRDYVREQPEFVPYFRAATPEQELAKLP
FT                   LGSRPAKRRPTGGVESLRAIPWIFAWTQNRLMLPTWLGAGAALQQVIDAGKLSVLTDMS
FT                   RDWPFFNTRIAMLEMVFAKADLWLAEYYDQRLVDPKLWPLGLKLRNQLAEDIKTVLTIS
FT                   QDEQLMADLPWIAESIALRNVYTDPLNVLQVELLQRSRQQEEALDPHLEQALMVTIAGV
FT                   AAGMRNTG"
FT   CDS_pept        206088..206291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0049"
FT                   /locus_tag="XNC1_0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0230"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88318"
FT                   /db_xref="InterPro:IPR002622"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH33"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88318.1"
FT                   /translation="MGYSLDFRRRVLAYKDKHALTFEQTRDHFEVSIRTLFRWCNKIEP
FT                   CMTRDKPPTKISDETLIADVKN"
FT   operon          complement(206343..207301)
FT                   /operon="XNC1_operon0050"
FT   CDS_pept        complement(206343..207038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0050"
FT                   /locus_tag="XNC1_0231"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0231"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88319"
FT                   /db_xref="GOA:D3VH34"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH34"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88319.1"
FT                   /translation="MSLIRNAFKRLHYPTDIMAQCVRGYLAYALSLRNLEEMMAERAIE
FT                   VDHSTWHRWVTRLVPLLDNAFRRHKRPVGCRWRMDETYINIKGQWKYLYRAVDTGGQTI
FT                   DFLLTANRDAAAARRFFRKAIRHHGEPERVTIDKSSANTAAREALNRGKPEEEAIVVRQ
FT                   NKYLNNLIKQDHRNIKRRIRSRLGFKSFRRTQTLLAGIEIVSMLRKGQYFQPTGKPLSP
FT                   AAMFYHLVA"
FT   regulatory      206486..206518
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(207083..207301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0050"
FT                   /locus_tag="XNC1_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0232"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88320"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH35"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88320.1"
FT                   /translation="MVHSGKYTNAPIEHSGVTSKFVLDNLSKIPIPALDAYMFGNGGLR
FT                   AGDVIEIVWNRSDLERPIDESLPVLSH"
FT   regulatory      complement(207332..207391)
FT                   /regulatory_class="promoter"
FT   operon          complement(207395..209368)
FT                   /operon="XNC1_operon0051"
FT   CDS_pept        complement(207395..208783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0051"
FT                   /locus_tag="XNC1_0233"
FT                   /product="Sea14 (modular protein)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0233"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88321"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH36"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88321.1"
FT                   /translation="MKIVMTAMVIHDDGSTTQETLLTLQKTAEQDEPLGLSLNESKKLL
FT                   NHAQLSIIQSQTQAYMQTHRECPHCHQRRQIKDHQTRHYHTLFGVIPIKGLRLYRCNCE
FT                   RNNTKSVSLLSEWLPENIHPELKYIEAKWASLMSYNLTVDRLKDILPINKALNASTVRN
FT                   HLISVARRQEAELAEKPDFLNKTADDNDNLPRPGKPMVIGFDGGYIRDCHNRKNNFEII
FT                   TGKAYAENIQAKRFGYVHMFENNPRKRLLSVLGAQGMQTNQQISFLSDGADNLRMMQIG
FT                   IYPEAEHILDWFHISMRLTVLNQCAKGLITQSTDIGSILQNLLEKTKWYLWHGNVDEAL
FT                   DQLDSCLYTCDNEEDNPVYKHSKKMVRYLDEMMTYIGNNQAMIPNYGERHRYGEPISTA
FT                   FVESTVNEVIAKRMAKKQQMQWSQEGAHYLLQTRVAVLNDELESLFHCWYPKLASSGLN
FT                   AMAA"
FT   CDS_pept        complement(208808..209029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0051"
FT                   /locus_tag="XNC1_0234"
FT                   /product="Transposon Tn21 resolvase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0234"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88322"
FT                   /db_xref="GOA:D3VH37"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH37"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88322.1"
FT                   /translation="MSAFSQFERALIRERQAEGIAAKKHRGEKTGRPPADKRKVAMADE
FT                   LKAKGVRLKLACDNVGIGVSTYYKLRKR"
FT   CDS_pept        complement(209048..209368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0051"
FT                   /locus_tag="XNC1_0235"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0235"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88323"
FT                   /db_xref="GOA:D3VH38"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH38"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88323.1"
FT                   /translation="MIYAYIRISSAEQNSARQKIAIQNSGYEIKTVFTDIASGKDTHRP
FT                   NLQQLLSTLISGDTLIVHSIDRLCRNMMDMCYLTLDLKQRGISLIFLKENICFSAHENN
FT                   PL"
FT   regulatory      complement(209393..209452)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(209482..209997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0236"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0236"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88324"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH39"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88324.1"
FT                   /translation="MVNKTAQCDFYILLQFAFGWDNNYLRTFHIHGKDYGIRYEGGLVF
FT                   YDNPWTISLASFQFENRDKFTYEYNFFRHWLLDIRIEAIESDLNKNTPFCLSGQGMPDV
FT                   TEYDETEATIKLLEAIAESDDKTTWGDIQELIDEYNRVKFNRRRLNQLLKRYDFDTPNY
FT                   SQGLDWTL"
FT   regulatory      209680..209739
FT                   /regulatory_class="promoter"
FT   CDS_pept        209829..210188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0237"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88325"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH40"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88325.1"
FT                   /translation="MRQAKLSKDYHRKPVRLHSEYHSLYRGYERYGDSYYPSQKQIAVK
FT                   YKSRIELFYLPPYSPELNLDEYLNGDLKSALRHSSPARNQQELESKAKNHLRKLKKRNN
FT                   HVARFFLYLKICYAA"
FT   regulatory      210292..210351
FT                   /regulatory_class="promoter"
FT   operon          210479..216159
FT                   /operon="XNC1_operon0052"
FT   CDS_pept        210479..211390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0052"
FT                   /locus_tag="XNC1_0238"
FT                   /product="putative Dihydrodipicolinate synthase"
FT                   /EC_number="4.2.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0238"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88326"
FT                   /db_xref="GOA:D3VH41"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH41"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88326.1"
FT                   /translation="MTNKIIQGVLPVAILPYNSDFSLDEIGFRQQIDHILATGCDGFVI
FT                   GQISEISRLTAKERVRLAEIMADQIGDKGISIMSTGGESTAQAIEFSRQAEQVGCDALL
FT                   VMHPSMFELDDEQMFAYFASVIESVNIPVLIHHAKSLAKRPLSIDVQAKLLHTYGAEKV
FT                   QFKPESAPTAPKVSLLRDATQGQARIFEGDGGMMLVDTYHRGLAGVIPATEIAEITVAL
FT                   WRALQAGDDKTARAIGYPLSYLMCHMMTSIDCYLQISKYFLKRRGLMSNTLIRPPVDFK
FT                   LDAETLREVEFVYDNLFEIISE"
FT   CDS_pept        211441..211821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0052"
FT                   /locus_tag="XNC1_0239"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0239"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88327"
FT                   /db_xref="GOA:D3VH42"
FT                   /db_xref="InterPro:IPR008000"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH42"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88327.1"
FT                   /translation="MKRFGFSIEVVNDAALEMYKEMHKQVPQEISGDKGALKKIGLQRM
FT                   SIYLLPNNTLFMQIEANDDFDPLRDFTYALSLHPVVKEWDDKMHGKDNPLLRRSPNNNT
FT                   ELNWLRLEQVYDWSITEIANVS"
FT   CDS_pept        211811..212842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0052"
FT                   /locus_tag="XNC1_0240"
FT                   /product="putative Homocitrate synthase"
FT                   /EC_number="2.3.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0240"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88328"
FT                   /db_xref="GOA:D3VH43"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH43"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88328.1"
FT                   /translation="MLADTKGHVFTLLDCTLRDGGFQTQWYFSDEMVRDYFDICHITQV
FT                   DIVELGYLNLELNWNTTDTGHYKALPESLNPQQQKLTEKAGDIKIAVMIDAWRITELDA
FT                   QVACDIILAAIHRAPFNINILRIAALLNQFPACITLAKKLHQHGISVMLNIMQAAELTV
FT                   AELRSNLQLLDNVPIAALYFADSFGRMKPKQVFQLYHQISESINIPLGFHAHDNFGLAI
FT                   ANTDAAIRGGATFIDGTFGGIGRGAGNAPTETLCLLRSMNGEIAQCEDFLSKHIEQLKS
FT                   ELQWGYSSTYRYQAKYNIHPTYAQKLFETEKLTGDDRIEILRKIALHDNPKKFDINILN
FT                   LYM"
FT   CDS_pept        212902..213597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0052"
FT                   /locus_tag="XNC1_0241"
FT                   /product="putative Phosphoglycolate phosphatase"
FT                   /EC_number="3.1.3.18"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0241"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88329"
FT                   /db_xref="GOA:D3VH44"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH44"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88329.1"
FT                   /translation="MGKKLVFFDCDGVLIDSNNIKLAAVSDALYDLPQSILMRCLQNFK
FT                   MNFGRSRIWHFEVFYRIANPSGVAEHHFIHDRIQRYETYLKEHYILSLAVNGAKPLLEK
FT                   LTSAGITCLVISGGKETEIKAILNRIGLSHYFKQIVGSPVVKEQAISTFLTQYQCTPEQ
FT                   TVFFGDAQADAQAAMACQVPFLFVRQHALVESSVIHAHWPTYLWGGEITDLTPKQTVTL
FT                   FPCIHSNFD"
FT   CDS_pept        213621..214364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0052"
FT                   /locus_tag="XNC1_0242"
FT                   /product="putative Short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0242"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88330"
FT                   /db_xref="GOA:D3VH45"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH45"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88330.1"
FT                   /translation="MSSNETNGAETDGTEINGIKKLLKIAITGVSRGLGQMLSYALVAK
FT                   GHQVFGCTPSADMASETPDGFVLIEASVTEPNEMKKFATQANAGQAVDIIIANAGVIHE
FT                   RLPAWEIPIKEWARVMDVNLLGVVNTAQAFLPAMLERNEGVFIAISSGWGRSPSWGLGP
FT                   YCASKFAVEGMVGSLNDDLPVGVRAIALDPGNGINTQMLSVCLPDEHQNYISPKEWAEY
FT                   ASDYIINKIYQGDVAGSATVSHPGL"
FT   CDS_pept        214388..215140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0052"
FT                   /locus_tag="XNC1_0243"
FT                   /product="putative short chain dehydrogenase"
FT                   /EC_number="1.1.1.62"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0243"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88331"
FT                   /db_xref="GOA:D3VH46"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH46"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88331.1"
FT                   /translation="MSMFNDLKGKRVVVTGGGRDFGQAISVWLAREGAHVDLCARQLAS
FT                   AEATCDIIRSEGGIARSYQCDISDAQSVKVFAEQLQQDNQPVDILILSAAQWLEGYLSD
FT                   EDSDADIISTMNSGATGSMLLTKALLPSLRESQSADIIAMVSVCGISHFTQSVAHPVFF
FT                   AVKHAMSGFCQTISHQLSKDNIRVTGIYPPDFEVNGFDEVLDDHKTMGQQLLNGRSIWE
FT                   TIRFVLFQPRSCHISEIYFQGPTREDLE"
FT   CDS_pept        215140..216159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0052"
FT                   /locus_tag="XNC1_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0244"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88332"
FT                   /db_xref="GOA:D3VH47"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH47"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88332.1"
FT                   /translation="MNGNFAGGYSAPDFILARNDSELVSAMPQNMAAGYFRTDLMPEVF
FT                   YHKCAQYTAIKTLAPELVFNGRSVNTLTELPRKVVKPMVIRPAFSPQSKGSALIVGGND
FT                   RPSMDDVIQQLRHYSGPFQLHDYEEGQPLFINGILSIGTLIISDMWRCITLPIGYRDIL
FT                   TAVINLSEKALPEGLPQQLAELAIGMGMLAGPLHIELVLTADGPKIVKLTPRLASSPLP
FT                   DLCHFGGWQSQQQLWQTKSCNIQHKSLIGYVADYSFIFLQAGRVKQFFFEKEIKALSSF
FT                   SYYFMSPKIGQDVQMTIDGDTYGCTLFLRNNSLEILESEIAYLTTLNLKGAFHIESIK"
FT   regulatory      216188..216247
FT                   /regulatory_class="promoter"
FT   regulatory      216193..216245
FT                   /regulatory_class="terminator"
FT   operon          216267..223531
FT                   /operon="XNC1_operon0053"
FT   CDS_pept        216267..217586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0053"
FT                   /locus_tag="XNC1_0245"
FT                   /product="putative peptide monooxygenase"
FT                   /EC_number="1.14.13.59"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0245"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88333"
FT                   /db_xref="GOA:D3VH48"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH48"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88333.1"
FT                   /translation="MNFNNNLIDSPDENKVYDVIGIGFGPSNIALAIALREIAPHMNVA
FT                   FIESKNHFSWHSGMLFENTTMQVSFLKDLVSFRNPRSHFTFINYLYEKKRLAAFSNKKG
FT                   FFPSRIEFNDYFKWCAEKFSEQVYYGNKVIRITRRNQIEEGHPLLEVQLQVGTEEKTIL
FT                   TKALIHSAGLQPVMPEGVIPSEQATHVHQLIEQIKKSPPTENSHYVVVGGGQSAAEAVE
FT                   FLLDQHPSIKVTAIVSRFGYTPADDSPFVNEIFDPNVVDDFYSAPYQVRQNILNLHAST
FT                   NYAAVDLDLVESLYRGWYEEQVTGKHRLSIERLSRFQSVQKQGERLQVTFSHQLNGQLH
FT                   HFQCDHLVFATGFTPRNINHLLDENLKSCLRYEEGLPMLSRHYQLLCHEEPAPLLYSVG
FT                   ISENTHGLTATLISNMAIRAGEIVEDLLAEFSGRHYDQAV"
FT   CDS_pept        217570..218709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0053"
FT                   /locus_tag="XNC1_0246"
FT                   /product="putative Sarcosine oxidase"
FT                   /EC_number="1.5.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0246"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88334"
FT                   /db_xref="GOA:D3VH49"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH49"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88334.1"
FT                   /translation="MTRQFEFDCIIVGAGIIGATCFHQFTAAGKRCLLLEQRQLNAGIT
FT                   GASGCIVRVSHRTNEAIDAAALGFHFYQKLSHDSAGYVSFSRKGYLHFADEETLLRIHE
FT                   RLLHNGIRVEILTQASLRHQYPHFPVIATSAIYEPDSGYMDAKPTLEFLVQSAVVRGGK
FT                   YLDAVELQQLLWDQETHHVNGVMTSMGEFYAPNIVLAMGNATTAFLQQHFSDDCGMWNQ
FT                   LIQVTRFTHDVPLSGSPCFIDDLNELNGRWCPVTGGFFAGYPTGLCVPSNDSYRAVDKS
FT                   HALFTQQRAQQRFPWLKGASINGALCHSDCYSQQSIGVIGEQASLPKGIFVASGFSGGG
FT                   FKMAPYVAVTLLQSITGLQEITTQPSSSARAVITQELSS"
FT   CDS_pept        218706..220718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0053"
FT                   /locus_tag="XNC1_0247"
FT                   /product="putative Aminoacyl-tRNA synthetase, class
FT                   Ia:Cupin region"
FT                   /EC_number="6.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0247"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88335"
FT                   /db_xref="GOA:D3VH50"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH50"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88335.1"
FT                   /translation="MKKINIFSPSVLSYNVASRPVELVGTNASLMGCSLAPRQESSAHN
FT                   HFENEIFIFTAGKGVVKTGHESVNVQAGDAVLCQRFENHIIVNTSEEDSLQFHSIYWDV
FT                   GDINAFVTDTSAPSGQRNTLIFSTPPTPNGDLHLGHLSGPYLAGDVLKRVLLQSGTSVH
FT                   HGTGRDDNQTYVVTSAAKEQRQPTESADFYASAINETWQGFGIDFDLFITPDNQGEYAD
FT                   FVHHYIELLYKKDFIYEKETTAYVDHHGNTLHEAYIHGLCPYCEESSDGNACEACGRPN
FT                   ECTDLKQPQVKADGNQPLSRKEFRLYFRLSAFAHQLAQYVQTANMPAHVHQLCHDMLSQ
FT                   QLPDICISHASHWGIKHRLPNYEQQVVYVWFEMAMGYLWAASEYPTSRGNNRMEKAADV
FT                   YSGDTNIVHCYGFDNAYYHTLLFPAIYFALGLTPPQTHIVNELLDLEGSKFSTSRRHLI
FT                   WGKDFLKLAGADYARMALILMRPEGIRENFSVERVAATMNALFPQRLSHWLSSLQECVM
FT                   RYGGKIPESGAWLADQKNHYYELLHVMTSYQHFSQTENFSPRRMAEHVTKLIDMAYRFN
FT                   ASQRHLFPRNSNALSNYARTALALDVLAARMLVYALKPLMPALSADIAALLRINATEET
FT                   WQQATTFLASQHMIQPHKIMLPELSATGLGQLMPQ"
FT   CDS_pept        220748..221536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0053"
FT                   /locus_tag="XNC1_0248"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0248"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88336"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH51"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88336.1"
FT                   /translation="MSTAGLIGMVGPLSGPRSAYGELLRQSARGSSLSMLWRDDAANPE
FT                   QACIVAQAFIDSGVQAVIGHFNSECARVAGRLYQSAGIPLLLPAATASDLCSTVSAYRL
FT                   CASERQQITAIVKYLQQHQWVLNELWSDGTVYGNRLVAALAASVSRHSPDKISAVGLMG
FT                   AHHAIAKEIQRRNQSGTCYLVPDDCVIEEFDQLLQGSGVTTLCPHATPDFGSCVRLALQ
FT                   LISEAIDKGKNIGEFLHQHHDFEQRQYRHAGFSLISRHYG"
FT   CDS_pept        221563..223005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0053"
FT                   /locus_tag="XNC1_0249"
FT                   /product="Decarboxylase, pyridoxal-dependent"
FT                   /EC_number="4.1.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0249"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88337"
FT                   /db_xref="GOA:D3VH52"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH52"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88337.1"
FT                   /translation="MSQLLNHPISTHPYSLNYLPNIGGDNIVHADIDTMLGVLRQMLTT
FT                   ERPAVAAPDNIQKLTQQIEHTVGETITADGIGIDSALKIFVSLLAKQGVPSDHANYLAY
FT                   IGASPTPSAVLMDSLLSATGMVGSGWIAGAGLIWAENQVLRWLADLVGLSEQAGGCFVT
FT                   GGTAGNLSALVAARHRFRQRFPQYKQSLLLVAESAHSSIANCAALLDLTMINVACNDEG
FT                   RVTAAALSAQLALLAAEGKLDNIVAIVATAGATNSGQIDDLEGIGVIAQQRGIWFHVDA
FT                   AYGGAFLCVPEMQYRFNGIALADSVIIDPHKGLFAPYDCCALLYAHPMGVMPAFVQNAS
FT                   YLDQVNTSHEWNPMHYAFHLTRRARGVPLWFSLAIYGRDAYTRSLARILEITDTLRQRI
FT                   AQHPELLLIDASSLSIILFKRRSWQPQHYSSWSEYCLEKGIAFIVPSQWQGESVIRLCI
FT                   MSTRLENAQIDILLESLATYPG"
FT   regulatory      223009..223068
FT                   /operon="XNC1_operon0053"
FT                   /regulatory_class="promoter"
FT   CDS_pept        223088..223531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0053"
FT                   /locus_tag="XNC1_0250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0250"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88338"
FT                   /db_xref="GOA:D3VH53"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH53"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88338.1"
FT                   /translation="MEKVYRWEKEEFVITTDKNMLDISTIHQFLTQSHWAKGINQEVIC
FT                   RSIEHSLTFGLFHHTRQVGFARFITDFTTFGYFCDIFILDSYQGLGLGRWLMTCCMQHP
FT                   LMSQLRRIMLVTTYASWLYEKVGYLPINKENFVWEIVNPNIYQ"
FT   CDS_pept        complement(223626..223889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0251"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88339"
FT                   /db_xref="GOA:D3VH54"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH54"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88339.1"
FT                   /translation="MNAHNKELFQDYLRKRHSVSKLVVHLVFTTKYRRKIFTGVMIEQL
FT                   KEAFESACVKLECQLIEMDGEQDHVHLLISPPSSGEGLRRNC"
FT   regulatory      223808..223867
FT                   /regulatory_class="promoter"
FT   CDS_pept        223946..225088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0252"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0252"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88340"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH55"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88340.1"
FT                   /translation="MLRATKVRIYPTQEQADFLMAQFGAVRFAYNKALHLKSHMYRKQG
FT                   VTLNPKKDIKPLLAAAKKSRKYQWLKQYDSIALQQSVINLHQAFDHFFNPKLKAKYPQF
FT                   KRRHGKQSSYHCVGVKVFDSAIKLPKIQPVKANIHREISGVVKSITVSLSKTGKFYASI
FT                   LVDDGVEAPDLPHTVSKVTGLDLGLSHFAIESNGRKTANPGFVKRAEKNLRRKQRQLSR
FT                   KAKGSANRAKARLLVAKCHEKVANARADFQHKLSRTLVDENQAVIVETLKSANMMKNRK
FT                   LAKHIADASWHGFVVKLEYKAKEQGKHLVKLDQWYASSKTCHCCGHKTEDMPLSVRQWD
FT                   CPSCGTTDIDRDLNAALNIRDKGILELKAAGRSSLLMEAA"
FT   operon          complement(225502..226521)
FT                   /operon="XNC1_operon0054"
FT   CDS_pept        complement(225502..226140)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0054"
FT                   /locus_tag="XNC1_0253"
FT                   /product="Transposase (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ88341.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        complement(226141..226521)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0054"
FT                   /locus_tag="XNC1_0254"
FT                   /product="Transposase (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ88342.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   regulatory      complement(226763..226822)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(226930..227043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0255"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88343"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH58"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88343.1"
FT                   /translation="MVTHVARVNDEYKTSTRPNKLARIAWAITTRQNEYQA"
FT   CDS_pept        complement(227019..227780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0256"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0256"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88344"
FT                   /db_xref="GOA:D3VH59"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH59"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88344.1"
FT                   /translation="MPRRMLSDPVWDKLSLFMRQSRLVYHKPEHRLALEGILFRMRTGI
FT                   PRRELPSEYGKWNTVFKRFNEWSKKGIFDLFFKELSKDSDTEWLFIDSSIVRAHQHSSG
FT                   ATSKKDEAIGKSRGGRSTKIHLAVDSDGLPVNFELSGGQVHDIVHAESLVVQSPPSDFV
FT                   TADKGYDSQAFRTDIEQQGATAVIPYRKNNLKSDKKIDNGLYRYRHLVENTFARIKHFR
FT                   AIATRYDKLARNYASTLALAFVIIWLPMWLE"
FT   regulatory      complement(227808..227867)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(227859..228080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0257"
FT                   /product="transposase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0257"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88345"
FT                   /db_xref="GOA:D3VH60"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH60"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88345.1"
FT                   /translation="MGLVPRQYCTGGKPTLLGISKRGNKNLRRLRVQCARAFMMRLEHQ
FT                   HGRRAEWIQAQLSKKHSNVVACALARAC"
FT   CDS_pept        complement(227963..228694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0258"
FT                   /product="putative transposase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0258"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88346"
FT                   /db_xref="GOA:D3VH61"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH61"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88346.1"
FT                   /translation="MQNVTLIGIDLGKPSFHIHCQDKCGKTMLRKKFTRPKLMEFLAGC
FT                   SSTTVVMEACAGAHFMARRIADLGHNAKLISPQFVRPFVKSNKNDFVDAKAICEAASRP
FT                   SMRFVQPRTETQQAMRALHRVRESLIRDKVKTTNQMHAFLLEFGISLPKGEAVIKRLSL
FT                   VLAEHDVPDYLSRLLMKLHARYLHPSQVTENNFHAAGILLLRWGLFPGNTVQGENLLCW
FT                   VSANAATKICADCGFNAPGRL"
FT   regulatory      228389..228448
FT                   /regulatory_class="promoter"
FT   CDS_pept        228693..228977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0259"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88347"
FT                   /db_xref="GOA:D3VH62"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH62"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88347.1"
FT                   /translation="MMDSPEKILCKEYGSQGGEDHLVSLNKSIALYKQSKSELYRLFYN
FT                   SLLCLETFEGDMHYAYIRVSSVDQHVEHQKEALSASGFEIDKIYLVLSH"
FT   regulatory      complement(228811..228870)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(229014..229709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0260"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0260"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88348"
FT                   /db_xref="GOA:D3VH63"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH63"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88348.1"
FT                   /translation="MSLIRNAFKRLHYPTDIMAQCVRGYLAYALSLRNLEEMMAERGIE
FT                   VDHSTWHRWVTRLVPLLNNAFRRHKRPVGRRWRMDETYINIKGQWKYLYRAVDTGGQTI
FT                   DFLLTANRDAAAARRFFRKAIRHHGEPERVTIDKSSANTAAREALNRGKPEEEAIVVRQ
FT                   NKYLNNLIEQDHRNIKRRIRSRLGFKSFRRAQTLLAGIEIVSMLRKGQYFQPTGKPLSP
FT                   AAMFYHLVA"
FT   regulatory      229157..229189
FT                   /regulatory_class="terminator"
FT   CDS_pept        229684..229860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0261"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88349"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH64"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88349.1"
FT                   /translation="MKALRIKDMMKPQSKSHYFTSLRLNATEPPLEPSIEFVEKRLNIP
FT                   LIAYPMRYLPDIV"
FT   regulatory      complement(229876..229935)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(229955..230233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinJ"
FT                   /locus_tag="XNC1_0262"
FT                   /product="damage-inducible protein J"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0262"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88350"
FT                   /db_xref="GOA:D3VH65"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR026262"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH65"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88350.1"
FT                   /translation="MAANAFVRARIDETLKNEATEVLSSMGLTVSDLIRITLTKVAKEK
FT                   TLPFEMRIPNQTTAKTIASSEKGIDVHKAKDVDDLFEQLAPIHSTST"
FT   regulatory      complement(230256..230315)
FT                   /regulatory_class="promoter"
FT   CDS_pept        230417..230548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0263"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88351"
FT                   /db_xref="GOA:D3VH66"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH66"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88351.1"
FT                   /translation="MMVYYASALMEKYGRRNTFVIGNLVGKAGNGWVGIARNMNSLN"
FT   regulatory      complement(230524..230571)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(230606..231493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="XNC1_0264"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0264"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88352"
FT                   /db_xref="GOA:D3VH67"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH67"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88352.1"
FT                   /translation="MSFFHANQREALNQNLAELEGQIRVSFEFFPPSTTEMEQTLWQSI
FT                   DRLSRLKPKFVSVTYGANSGERNRTHSIIKGIKEKTGLDAAPHLTCIDASREELRDIAH
FT                   DYWQSGIRHIVALRGDLPNNCCKPEMYGADLVELLKEEADFDISVAAYPEVHPEAKSAQ
FT                   SDLINLKHKIDAGANRAITQFFFDVESYLRFRDRCVATGIDVEIVPGILPVSNFRQLQR
FT                   FSTMTNVRIPSWMTRMFEGLDDDPESRNLVGASIAMDMVKILSREGVKDFHFYTLNRAE
FT                   LSYAICHTLGVRPV"
FT   regulatory      complement(231521..231580)
FT                   /regulatory_class="promoter"
FT   CDS_pept        231943..232053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0265"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0265"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88353"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH68"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88353.1"
FT                   /translation="MDEALLEAVEGAVVAIAIEIEERRPIPLGSEPKEDE"
FT   regulatory      232001..232060
FT                   /regulatory_class="promoter"
FT   CDS_pept        232081..232281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0266"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0266"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88354"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH69"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88354.1"
FT                   /translation="MKAALHNAMIETGTRKSELARKMGQKPTQIDRLLDVEHSSKVETV
FT                   ELALHQLNRNVGVSVVVTAPF"
FT   regulatory      232286..232322
FT                   /regulatory_class="terminator"
FT   regulatory      complement(232343..232376)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(232445..233602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argE"
FT                   /locus_tag="XNC1_0267"
FT                   /product="acetylornithine deacetylase"
FT                   /EC_number="3.5.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0267"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88355"
FT                   /db_xref="GOA:D3VH70"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH70"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88355.1"
FT                   /translation="MNIKLPSFIKLYHQLIAAPSISANDAELDQSNEVVINLLAEWLKE
FT                   IGFTIEIQPVPATRGKFNLLATLGEGTGGVLLCGHTDTVPFDDGRWTQDPFTLTERDGK
FT                   LYGLGTADMKGFFAFIIDAVRDIDTSKLSHPLYILATADEETSMAGARYFAANTNIRPD
FT                   FAIIGEPTSLQPIRAHKGHLSQAIRIEGKSGHSSDPARGVNAIDLMHESITQLMELRNT
FT                   LQERYHNPAFVIPYPTMNFGHIHGGDAANRICACCELHMDIRPLPGLSLQDLDGLLNDA
FT                   LEPVKQRWPGRLSVTELHPPIPGYECPTDHKLVGVIEKLLGTKADTVNYCTEAPFIQAL
FT                   CPTLVLGPGSIEQAHQPDEFLDMAFIEPTRKLLSQLVAHFCLEAG"
FT   regulatory      233573..233632
FT                   /regulatory_class="promoter"
FT   regulatory      complement(233626..233685)
FT                   /regulatory_class="promoter"
FT   operon          233705..239221
FT                   /operon="XNC1_operon0055"
FT   CDS_pept        233705..234709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0055"
FT                   /gene="argC"
FT                   /locus_tag="XNC1_0268"
FT                   /product="N-acetyl-gamma-glutamylphosphate reductase,
FT                   NAD(P)-binding"
FT                   /EC_number="1.2.1.38"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0268"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88356"
FT                   /db_xref="GOA:D3VH71"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH71"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88356.1"
FT                   /translation="MLNTLIVGASGYTGAELAAYLQRHSHVHLSGLMVSSQSSDAGKCF
FT                   SELYPQYKGRLDLPLQPLTNVSEAAEGIDVVFLATDHAISHDIAPIFLEAGCIVFDLSG
FT                   AYRVQNTQFYKKYYGFEHKNAEWLQQAVYGLAEWQAEKIKQARLIAVPGCYPTVSQLSL
FT                   KPLLEQGLLDIEHWPVINAVSGVSGAGRKASITNSFCEVSLHPYGVFNHRHQPEIATHL
FT                   GTEVIFTPHLGNFSRGILATITCKLKSGVEEAQISAAYQQAYHDKPLIRLYNKGLPALK
FT                   AVVGLPFCDIGFAVQGQYLIIVGAEDNLLKGAAAQAVQCMNIRFGYEETQALL"
FT   CDS_pept        234777..235550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0055"
FT                   /gene="argB"
FT                   /locus_tag="XNC1_0269"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0269"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88357"
FT                   /db_xref="GOA:D3VH72"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041731"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH72"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88357.1"
FT                   /translation="MVPLVIKLGGVLLDSEEALERLFTTLQLYRKTHKRPLVIVHGGGC
FT                   LVDEMMQKLQLPILKKQGLRVTPEDQIDIITGTLAGTANKKLLAWAIKLRLPAIGLCLG
FT                   DGGMVKVSQLDKTFGHTGMAIAGEPDLLKILLDVGYMPIISSIGITEHGELMNVNADQA
FT                   ATAIAQVLNADLVLLSDVSGILDGKGQKIPEATAEKIEQLIEQGIITDGMIVKVNAALD
FT                   AAKTLGQPVDIASWRHSEQLIALFNGIPVGTRILA"
FT   CDS_pept        235568..236779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0055"
FT                   /locus_tag="XNC1_0270"
FT                   /product="Argininosuccinate synthase (Citrulline--aspartate
FT                   ligase)"
FT                   /EC_number="6.3.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0270"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88358"
FT                   /db_xref="GOA:D3VH73"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH73"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88358.1"
FT                   /translation="MTKSIKKIVLAYSGGLDTSAIIPWLKEHYDDCEVIAFVADVGQSR
FT                   EDLEGVEQKALSSGASECHVVDLREVFIKEYVYPVLKTGALYEGSYLLGTSMARPIIAK
FT                   AQVELALKVGADAVAHGATGKGNDQVRFESTYTALVPHLKVVAPWREWDLCSREALLDY
FT                   LKVRDIPTTATLEKIYSRDENAWHISTEGGVLESTWNAANKDCWAWTTEPEDAPNEPEY
FT                   VTVTVEKGEVIGVNGQVLSPYQCLNALNELGAKHGIGRIDIVENRLVGMKSRGCYETPG
FT                   GTIMMEALRGIEQLVLDRDSFKWRQQLGLEMSYVVYDGRWFAPLRQSIQAAAETLAASV
FT                   SGEVILKLYKGQVTAVQKKSTHSLYSEEFATFGEDEVYDHSHAEGFIRLYSLSSRIRAL
FT                   NSKK"
FT   CDS_pept        236831..238204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0055"
FT                   /gene="argH"
FT                   /locus_tag="XNC1_0271"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0271"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88359"
FT                   /db_xref="GOA:D3VH74"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH74"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88359.1"
FT                   /translation="MALWGGRFSQEADQQFKQFNDSLRFDYRLAEQDIVGSVAWSKALV
FT                   TVAVLTSEEQQKLELALNELLDEVRTNPKAILQSDAEDIHSWVEGRLIAKVGDLGKKLH
FT                   TGRSRNDQVATDLKLWCKDQIAHIQQALIELQQALVFTAENNQDAVMPGYTHLQRAQPI
FT                   TFAHWCLAYVEMLARDESRLQDALKRLDVSPLGCGALAGTAYDIDREQLASWLGFSSAT
FT                   NNSLDSVSDRDHVLELLSGASISMIHLSRFAEDLIFFNSGEAGFIELSDRVTSGSSLMP
FT                   QKKNPDALELIRGKCGRVQGSLTGMMMTLKGLPLAYNKDMQEDKEGLFDALDTWLDCLH
FT                   MAALVLDGIQVKQARCEEAAKQGYANATELADYLVAKGVPFREAHHVVGEVVVDAIAKG
FT                   KALEAFSLLELQKFSDVIAVDVYSVLLLKSCLDKRLAKGGVAQEQVQQAVAQAKQRFR"
FT   regulatory      238208..238267
FT                   /operon="XNC1_operon0055"
FT                   /regulatory_class="promoter"
FT   CDS_pept        238304..239221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0055"
FT                   /gene="oxyR"
FT                   /locus_tag="XNC1_0272"
FT                   /product="transcriptional regulator of oxidative stress,
FT                   regulates intracellular hydrogen peroxide (LysR family)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0272"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88360"
FT                   /db_xref="GOA:D3VH75"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH75"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88360.1"
FT                   /translation="MNIRDLEYLVALAEHRHFRRAADACHVSQPTLSGQIRKLEDDLGV
FT                   MLLERTSRKVLFTQQGMLLVEQAKTVLREVKVLQEMASLQGESMSGPLHIGLIPTIGPY
FT                   LLPLIIPELHRLFPKLEMYLHEAQTQSLLAQLDSGKLDCAILALVKETEAFIEVPLFDE
FT                   PMKLAVYEDHKWSERDRVKMAELSGEKLLMLDDGHCLRDQAMGFCFQAGAKEDTHFRAT
FT                   SLETLRNMVAAGSGITLLPGLAVPKESKRDGVCYLECYEPEPQRTVILVYRPGSPLRGR
FT                   YEQLAEAIRTKMSNYSGERGKISK"
FT   CDS_pept        complement(239213..240610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sthA"
FT                   /locus_tag="XNC1_0273"
FT                   /product="soluble pyridine nucleotide transhydrogenase"
FT                   /EC_number="1.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0273"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88361"
FT                   /db_xref="GOA:D3VH76"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR022962"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH76"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88361.1"
FT                   /translation="MQYTHFDAIVIGSGPGGEGAAMGLVKQGKNVAVIERYNNVGGGCT
FT                   HWGTIPSKALRHAVSRIIEFNQNPLYSDSSRILRSSFSEILRHAEVVINQQTRMRQGFY
FT                   ERNRCRMFSGEATFIDEHRVSVRYADNSVDVLSADKIIIATGSRPYCPPDVDFTHSRIY
FT                   NSDTILQLDHEPRHVIIYGAGVIGCEYASIFRGLGVKVDLINTRDHLLSFLDQEMSDAL
FT                   SYHFWNSGIIIRHNEEYEKIEGVDDGVIIHMKSGKKVKADCLLYANGRTGNTDTLGLEN
FT                   VGLETDSRGLLKVNRVYQTSNQNIYAVGDVIGYPSLASAAYDQGRIAAKAMTTGEADLH
FT                   LVEDIPTGIYTIPEISSVGKTEQQLTAMKIPYEVGRAQFKHLARAQIAGMNVGSIKILF
FT                   HRDTKQILGIHCFGERAAEIIHIGQAIIEQKGEGNNIEYFVNTTFNYPTMAEAYRVAAL
FT                   NGLNRLF"
FT   regulatory      239278..239330
FT                   /regulatory_class="terminator"
FT   regulatory      complement(240641..240700)
FT                   /regulatory_class="promoter"
FT   regulatory      240729..240788
FT                   /regulatory_class="promoter"
FT   operon          240819..241880
FT                   /operon="XNC1_operon0056"
FT   CDS_pept        240819..241379
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0056"
FT                   /locus_tag="XNC1_0274"
FT                   /product="HTH-type transcriptional repressor fabR
FT                   (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type r :
FT                   regulator"
FT                   /db_xref="PSEUDO:CBJ88362.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        241298..241468
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0056"
FT                   /locus_tag="XNC1_0275"
FT                   /product="HTH-type transcriptional repressor fabR
FT                   (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type r :
FT                   regulator"
FT                   /db_xref="PSEUDO:CBJ88363.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        241503..241880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0056"
FT                   /gene="yijD"
FT                   /locus_tag="XNC1_0276"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0276"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88364"
FT                   /db_xref="GOA:D3VH79"
FT                   /db_xref="InterPro:IPR009867"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH79"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88364.1"
FT                   /translation="MEQYRQDKSTMLLALIVGLATHGTFSAFFNSHVPFSIFPIIALVL
FT                   SLYCLHQRYLNYPMAEGLPKLATGCFFLGMFMYSAFIRMEHPAIGSNFFPVVIGTALVF
FT                   WIYLKVRGRKQQAILTSKSQS"
FT   regulatory      complement(241866..241914)
FT                   /regulatory_class="terminator"
FT   regulatory      241904..241951
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(241963..243063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmA"
FT                   /locus_tag="XNC1_0277"
FT                   /product="tRNA (uracil-5-)-methyltransferase"
FT                   /EC_number="2.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0277"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88365"
FT                   /db_xref="GOA:D3VH80"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH80"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88365.1"
FT                   /translation="MQNALPTENYENQLMEKVHRLKGMMSPFSVPEPDVFRSPASHYRM
FT                   RAEFRIWHEEDDLYHIMFDQQTKQRIRIDQFPVANQLINSMMQAIIAGVKDNPVLRHKL
FT                   FQVDYLSTRSNKIIVSLLYHKKLNDEWREQAIDLRNQLIAEGFDVQLIGRASKTKIMLD
FT                   HDYIDEELSVAGKTMIYRQVENSFTQPNASINIHMLEWAIDITKDSKGDLLELYCGNGN
FT                   FSLALAQNFERVLATEIAKPSVAAAQFNIAANQIDNVQIIRMSAEEFTQAMNGEREFNR
FT                   LQGIDLKSYQCETIFVDPPRSGLDEKTVRMVQAYPRILYISCNPETLCQNLETLTQTHH
FT                   VSKLALFDQFPYTHHMECGVLLEKRS"
FT   regulatory      243007..243066
FT                   /regulatory_class="promoter"
FT   regulatory      complement(243245..243304)
FT                   /regulatory_class="promoter"
FT   operon          243252..245904
FT                   /operon="XNC1_operon0057"
FT   CDS_pept        243252..245096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0057"
FT                   /gene="btuB"
FT                   /locus_tag="XNC1_0278"
FT                   /product="outer membrane porin: vitamin B12/cobalamin
FT                   transport, receptor for E colicins, bacteriophage BF23"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0278"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88366"
FT                   /db_xref="GOA:D3VH81"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010101"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH81"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88366.1"
FT                   /translation="MINKKQPFLSVISLVVFSCWSPVSIADNQDRLVVTANRFKQPISS
FT                   VLAPMTVVTREDIDRWQSNNLVDVLRRLPGVDIAQNGGLGQNSSLYVRGTNSSHTLVLV
FT                   DGIRLNQAGIMGAADFSQIPIAIVQRIEFIRGARSAVYGSDAIGGVINIITKRESRGTT
FT                   LNAGIGSNGYQNYNGSTQQKLGENTLLTAASGYTYTKGFDVIVDGKTGGYRQPDRDGFM
FT                   SKTLWLEIDHKINEQMSGFARTYGFNNRTAYDAGGIGGTDTRELFSRTYDAGLQFNQGI
FT                   YSSQLIASYSHVKDYNHAPDDGRYGKNTSLSDSKQYNVQWGNLWQVGHGAISSGVDWKR
FT                   ELVAAGSNYIPVQKSVDNTGLYLTAQQKIHDFTLEGAVRSDHHSEYDWNTTWQTGAGWE
FT                   FIDGYRLIVSYGTAFKAPTLGQLYGWGANPTLKPEKSKQWETGIEGLTGTLNWRLSAYR
FT                   NDIEQLIDYNIVTNHYRNLGQAKIRGVEWTGTMDTSIFQHQLTLQYIDPRDGNNKRLIR
FT                   RAKQQIKYQLDWEALNVDWGVTYQYIGPRHDLDYKVFPARTVKSGGVSLWDINASYPIT
FT                   DHLTIRAKIANLFDKNYETAYGYRTAGREYSLTGSYNF"
FT   CDS_pept        245041..245904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0057"
FT                   /gene="murI"
FT                   /locus_tag="XNC1_0279"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0279"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88367"
FT                   /db_xref="GOA:D3VH82"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH82"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88367.1"
FT                   /translation="MAIARQEENTPSLAVTTSDLNKTARPTILVFDSGVGGLSVYKEIR
FT                   KLLPDLHYIYAFDNEAFPYGEKTADVIIDRVVKVVDAIQKKHPLAVVVIACNTASTVSL
FT                   PVLRERFSFPVVGVVPAIKPAAKLSCNRIVGLLATRATVNRGYTKELITRFATDCQVHS
FT                   IGSAELVELAERKLHGKDVPLDELEKVLKPWLRMKEPPDTVILGCTHFPLIAEELSQVL
FT                   PDGTRLIDSGAAIARRTAWLIKNRADLFLTTVDNLAYCTKLDADSEALSPVLYEYGFLT
FT                   LEKLAT"
FT   CDS_pept        246151..246282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0280"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88368"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH83"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88368.1"
FT                   /translation="MCGHSQDTIERRKAQKIKQVLKSEQQLIHYELTTVEFFEHQTL"
FT   rRNA            246305..247801
FT                   /locus_tag="XNC1_rRNA0005"
FT                   /product="16S ribosomal RNA"
FT   tRNA            247906..247981
FT                   /gene="GluTTC"
FT                   /locus_tag="XNC1_tRNA0002"
FT                   /product="tRNA-Glu"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   rRNA            248167..248706
FT                   /locus_tag="XNC1_rRNA0006"
FT                   /product="23S ribosomal RNA"
FT   rRNA            248721..250728
FT                   /gene="LSU_RRNA"
FT                   /locus_tag="XNC1_rRNA0007"
FT                   /product="23S ribosomal RNA"
FT   rRNA            251177..251289
FT                   /locus_tag="XNC1_rRNA0008"
FT                   /product="5S ribosomal RNA protein"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT   tRNA            251342..251417
FT                   /gene="ThrGGT"
FT                   /locus_tag="XNC1_tRNA0003"
FT                   /product="tRNA-Thr"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   rRNA            251454..251564
FT                   /locus_tag="XNC1_rRNA0009"
FT                   /product="5S ribosomal RNA protein"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT   CDS_pept        complement(251569..251703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0286"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88369"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH84"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88369.1"
FT                   /translation="MAVVYQTLHLKDKPTVNQCLYLIEKIKKSEMQNATQMSGILTRY"
FT   regulatory      251643..251702
FT                   /regulatory_class="promoter"
FT   operon          251727..253723
FT                   /operon="XNC1_operon0058"
FT   CDS_pept        251727..252767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0058"
FT                   /gene="murB"
FT                   /locus_tag="XNC1_0287"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase,
FT                   FAD-binding"
FT                   /EC_number="1.1.1.158"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0287"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88370"
FT                   /db_xref="GOA:D3VHN1"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHN1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88370.1"
FT                   /translation="MFVYQSTQLKAFNTFSILAYADHIVAATTIESLLSLWQEAQRKNH
FT                   PILLLGGGSNVLFTENFKGTVILNRILGINIQESDTAWHIHVGAGENWHNLIISLLNQQ
FT                   IYGLENLALIPGNVGSAPIQNIGAYGIEFKHVCEYVDFIELESGNSIRLMTDECQFAYR
FT                   DSIFKHQYKDGYAITAVGLCLNKAWEPILTYGSLTQLSRKDVTPEQIFHSVCEMRQSKL
FT                   PDPAITGNAGSFFKNPIISPELAQKIKSQYPSCPQYHHNENSVKIAAGWLIDQCHLKGY
FT                   SIGGAAVHTQQALVLVNKGNATGKDVIALAAYVRSKVVEKFNIFLEPEVRFIGSQGEID
FT                   AVECIS"
FT   CDS_pept        252764..253723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0058"
FT                   /gene="birA"
FT                   /locus_tag="XNC1_0288"
FT                   /product="bifunctional: biotin-[acetylCoA carboxylase]
FT                   holoenzyme synthetase; transcriptional repressor of biotin
FT                   synthesis (BirA family)"
FT                   /EC_number="6.3.4.15"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0288"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88371"
FT                   /db_xref="GOA:D3VHN2"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR004409"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHN2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88371.1"
FT                   /translation="MKDISIPLRLIKVLSDGETHSGQQLGQELGMSRAAINKHIQTIRE
FT                   WGVEILTLPGKGYHFPAPMNLLDKDIIANYLPNDCIAVIPVIDSTNQYLLDQLASLNSG
FT                   DACVAEYQYAGRGRRGRQWVSAFGRNLYLSMYWRLDQGPAAAVGLSLVVGIVIAEVLNR
FT                   LGAERVKVKWPNDLYLDDKKLAGILVELTGKTGDAAQIVIGIGMNISMSSEQQELINQQ
FT                   WTNLQQAGMSVERNKLIAEIIVELKEALLQFENEGLVPFISRWLKLDNFINRKVKLIIG
FT                   EQEIYGIARGIDQQGALLLDINGVITPHIGGEISLRGC"
FT   regulatory      253732..253761
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(253758..254708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaA"
FT                   /locus_tag="XNC1_0289"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0289"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88372"
FT                   /db_xref="GOA:D3VHN3"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHN3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88372.1"
FT                   /translation="MNNKESFLTTPYLQFDREHWATLRDSVPLTLTEEEVVALKGINEE
FT                   ISINEVVEIYLPLSRLLNFYISSNLRRQAVLEQFLGTDEQKVPYVIGIAGSVAVGKSTT
FT                   ARLLQALLSRWPEHRRVKLVTTDGFLHSNNVLNERGLMKKKGFPESYDMRSLVKFVADI
FT                   KSGTEKVSAPVYSHLSYDIVPNEQLIIEKPDILILEGLNVLQSGMDYPHEPHHVFVSDF
FT                   VDFSIYVDASEELLEQWYISRFLKFRQGAFSDPDSYFHDYSKLTTEEAIKIASNIWQEI
FT                   NGLNLQQNILPTRERASLIMTKGNNHSIESVRLRK"
FT   regulatory      complement(254817..254876)
FT                   /regulatory_class="promoter"
FT   operon          complement(255155..256174)
FT                   /operon="XNC1_operon0059"
FT   CDS_pept        complement(255155..255793)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0059"
FT                   /locus_tag="XNC1_0290"
FT                   /product="transposase (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ88373.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        complement(255794..256174)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0059"
FT                   /locus_tag="XNC1_0291"
FT                   /product="transposase (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ88374.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   regulatory      256297..256356
FT                   /regulatory_class="promoter"
FT   regulatory      complement(256416..256475)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(256507..256818)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0292"
FT                   /product="transposase (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ88375.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        256601..256825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0293"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88376"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHN7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88376.1"
FT                   /translation="MNARAHRTNNLRKCLLPRLLIPGRVGLPPVLDCRGTSPIDAAKSR
FT                   LHENCLPSPGWDESRLAVMGPTPGIVIIR"
FT   CDS_pept        complement(256867..257451)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0294"
FT                   /product="transposase (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ88377.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        257450..257671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0295"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88378"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHN9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88378.1"
FT                   /translation="MIASPERNRYKEYGSQGGGGHLIMLKLCGCFWQSFLVSSKKYRSG
FT                   ANSLPKMINKYIYRFLLCKIICLLFKLN"
FT   regulatory      complement(257477..257536)
FT                   /regulatory_class="promoter"
FT   tRNA            257785..257860
FT                   /gene="ThrTGT"
FT                   /locus_tag="XNC1_tRNA0004"
FT                   /product="tRNA-Thr"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   tRNA            257877..257961
FT                   /gene="TyrGTA"
FT                   /locus_tag="XNC1_tRNA0005"
FT                   /product="tRNA-Tyr"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   regulatory      257911..257979
FT                   /regulatory_class="terminator"
FT   tRNA            258062..258136
FT                   /gene="GlyTCC"
FT                   /locus_tag="XNC1_tRNA0006"
FT                   /product="tRNA-Gly"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   tRNA            258143..258218
FT                   /gene="ThrGGT"
FT                   /locus_tag="XNC1_tRNA0007"
FT                   /product="tRNA-Thr"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   regulatory      258187..258246
FT                   /regulatory_class="promoter"
FT   CDS_pept        258325..259509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufB"
FT                   /locus_tag="XNC1_0297"
FT                   /product="putative protein chain elongation factor EF-Tu;
FT                   GTP-binding factor (duplicate of tufA)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0297"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88379"
FT                   /db_xref="GOA:D3VHP0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHP0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88379.1"
FT                   /translation="MSKEKFERSKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGNAR
FT                   AFDQIDNAPEEKARGITISTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAVL
FT                   VVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDF
FT                   PGDDTPIIRGSALKALEGEAEWEAKIIELAEALDSYIPEPERDIDKPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIVKVGDEVEIVGIKETTKTTCTGVEMFRKLLDEGRAGENVGVLLRG
FT                   TKRDEIERGQVLAKPGSIKPHTQFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNINMIVSLIHPIAMDEGLRFAIREGGRTVGAGVVAKVIA"
FT   regulatory      259535..259569
FT                   /regulatory_class="terminator"
FT   CDS_pept        260001..260408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0298"
FT                   /product="putative Retron-type reverse transcriptase-like"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0298"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88380"
FT                   /db_xref="GOA:D3VHP1"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHP1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88380.1"
FT                   /translation="MLINDAQVQNNAATGRSSGRYPPGLPGGAEINTSVSGRTKAERPL
FT                   TMETVIERANMMLAYQRVVENKGAAGVDNLSVTELEPWLNTLGDTQNGYPETGRWRENM
FT                   GYPNGGRPAYPTSDSTTVNSSRGIHILQLRL"
FT   CDS_pept        260275..260439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0299"
FT                   /product="CP4-6 prophage; putative reverse transcriptase
FT                   (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0299"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88381"
FT                   /db_xref="GOA:D3VHP2"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHP2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88381.1"
FT                   /translation="MDIPKPDGGVRTWGIPTVVDRLIQQAIAQQLTPLVGSTFFSYGFR
FT                   PNRNAWQAV"
FT   CDS_pept        260526..260702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0300"
FT                   /product="Group II intron-encoding maturase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0300"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88382"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHP3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88382.1"
FT                   /translation="MMSRLAQIIKDTRLLKLIRRYLEAEMFNGKEREKREQGMPQGGPN
FT                   TPRTQKVTFARSL"
FT   operon          complement(260565..261816)
FT                   /operon="XNC1_operon0060"
FT   CDS_pept        complement(260565..260990)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0060"
FT                   /locus_tag="XNC1_0301"
FT                   /product="DNA invertase (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ88383.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        complement(260983..261816)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0060"
FT                   /locus_tag="XNC1_0302"
FT                   /product="DNA invertase (fragment)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="PSEUDO:CBJ88384.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        complement(261726..261941)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0303"
FT                   /product="DNA invertase (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ88385.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   operon          complement(261945..262315)
FT                   /operon="XNC1_operon0061"
FT   CDS_pept        complement(261945..262130)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0061"
FT                   /locus_tag="XNC1_0304"
FT                   /product="DNA invertase (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ88386.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        complement(262067..262315)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0061"
FT                   /locus_tag="XNC1_0305"
FT                   /product="DNA invertase (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ88387.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        complement(262194..262508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0306"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88388"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHP9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88388.1"
FT                   /translation="MPRPCACSLAKPMATSERRERTRCVQLEPVFDRLLAVKLEQVYRI
FT                   LVPERAYIAGSVPRVKGKIDEYCRDLCQSLFQPAKREEHDCQPDCCAARVRSRTRFQRS
FT                   "
FT   regulatory      complement(262407..262442)
FT                   /locus_tag="XNC1_0306"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(262459..262746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0307"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88389"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHQ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88389.1"
FT                   /translation="MAHGLLTHGLSVAEAALSLSRQFELSRRQAYRYVEEAKKLNRPMP
FT                   AVEPTAAVTFKLPPGLVASVRSRALAEGMTISKLVAQALRVFIGEANGNE"
FT   regulatory      complement(262793..262852)
FT                   /regulatory_class="promoter"
FT   CDS_pept        262891..263019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0308"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88390"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHQ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88390.1"
FT                   /translation="MCYRPLLSNILLDELDKELESRGHSFCRYADDCVPRRHAPGT"
FT   CDS_pept        263026..263157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0309"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0309"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88391"
FT                   /db_xref="UniProtKB/TrEMBL:D3VD01"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88391.1"
FT                   /translation="MQLCNTRDEGRPLGVGVQAQAPNPPLLLRLRDVVVSEMGKGRA"
FT   regulatory      complement(263036..263064)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(263113..263307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0310"
FT                   /product="transposase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0310"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88392"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHQ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88392.1"
FT                   /translation="MPDAAQAVNRLPPALIPQERLHHGFDIIYTLSTHHQRFTFVRLFD
FT                   PYLIGSCPTFSHLAHHHVS"
FT   regulatory      263258..263317
FT                   /regulatory_class="promoter"
FT   CDS_pept        263397..264290
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0311"
FT                   /product="Reverse transcriptase/maturase (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ88393.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   regulatory      264303..264362
FT                   /regulatory_class="promoter"
FT   regulatory      264328..264360
FT                   /regulatory_class="terminator"
FT   operon          264477..265504
FT                   /operon="XNC1_operon0062"
FT   CDS_pept        264477..264815
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0062"
FT                   /locus_tag="XNC1_0312"
FT                   /product="Reverse transcriptase/maturase (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ88394.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        264812..265504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0062"
FT                   /locus_tag="XNC1_0313"
FT                   /product="putative Reverse transcriptase (partial)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0313"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88395"
FT                   /db_xref="GOA:D3VHQ6"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHQ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88395.1"
FT                   /translation="MSGDVHVRFRERLGGRFPEATRRNLSVSSRKAGEHLLSDINAFLN
FT                   DRLKLKVNEKKSAVARPWERKFLGYSVTRHKQSRLKIAISSVNRLKEKIRSLTMGNMSK
FT                   SVSTAINELILRGWISYFRYTEVKGVLEELDSWFNRKLRCLLWRQWKRPYTRAKILMRA
FT                   GLKEKRAWRSVCNQRGAWWNAGANHISGDKDLTVQKAWLNITVGTATANMSRRIRNRTY
FT                   GDVRGRRE"
FT   regulatory      265554..265613
FT                   /regulatory_class="promoter"
FT   regulatory      265642..265682
FT                   /regulatory_class="terminator"
FT   operon          265708..266454
FT                   /operon="XNC1_operon0063"
FT   CDS_pept        265708..265902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0063"
FT                   /gene="bfd"
FT                   /locus_tag="XNC1_0314"
FT                   /product="regulatory or redox component complexing with
FT                   Bfr, in iron storage and mobility"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0314"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88396"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHQ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88396.1"
FT                   /translation="MYICLCNAISDKTIRNAVHQQHIRSIRELRNLVPIGSDCGKCIRQ
FT                   AREIMNEEIASLLPINNVA"
FT   CDS_pept        265978..266454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0063"
FT                   /gene="bfr"
FT                   /locus_tag="XNC1_0315"
FT                   /product="bacterioferritin, an iron storage homoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0315"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88397"
FT                   /db_xref="GOA:D3VHQ8"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHQ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88397.1"
FT                   /translation="MKGDKKIIAHLNKLLGNELVAINQYFLHARMFKNWGLMRLNEVEY
FT                   HESIDEMKHADKFIERILFLEGLPNLQDLGKLNIGEDVEEMLRSDLDLELRGAKDLREA
FT                   IAYADSVHDYVSRDLMIEVLADEENHIDWLETQLELITRIGIQNYIQSQLAEAE"
FT   regulatory      266467..266506
FT                   /regulatory_class="terminator"
FT   regulatory      266539..266598
FT                   /regulatory_class="promoter"
FT   operon          266767..277447
FT                   /operon="XNC1_operon0064"
FT   CDS_pept        266767..267078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rpsJ"
FT                   /locus_tag="XNC1_0316"
FT                   /product="30S ribosomal subunit protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0316"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88398"
FT                   /db_xref="GOA:D3VHQ9"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHQ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88398.1"
FT                   /translation="MQNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTR
FT                   KERFTVLISPHVNKDARDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG"
FT   CDS_pept        267111..267743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rplC"
FT                   /locus_tag="XNC1_0317"
FT                   /product="50S ribosomal subunit protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0317"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88399"
FT                   /db_xref="GOA:D3VHR0"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHR0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88399.1"
FT                   /translation="MIGLVGKKVGMTRIFTEDGVSIPVTVIEIENNRVTQVKNDETDGY
FT                   RAIQVTTGSKKANRVNKSEAGHFAKAGVEAGRILREFRLSEGDAEFTVGQSISVEIFAD
FT                   VKKVDVTGTSKGKGFAGTVKRWNFRTQDATHGNSLSHRVPGSIGQNQTPGKVFKGKKMA
FT                   GQLGNERVTVQSLDVVRVDAERNLLLVKGAVPGATNSNLIVKPAVKA"
FT   CDS_pept        267760..268365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rplD"
FT                   /locus_tag="XNC1_0318"
FT                   /product="50S ribosomal subunit protein L4, regulates
FT                   expression of S10 operon"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0318"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88400"
FT                   /db_xref="GOA:D3VHR1"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHR1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88400.1"
FT                   /translation="MELVMKDAQSALTVSETTFGRDFNEALVHQVVVAYAAGARQGTRA
FT                   QKTRAEVSGSGKKPWRQKGTGRARSGSIKSPIWRSGGVTFAAKPQDHSQKVNKKMYRGA
FT                   LKSILSELVRQDRLIIVEKFSVEAPKTKLLVQKLKEMALEDVLIVTGEVDENLFLAARN
FT                   LYKVDVRDAAGIDPVSLIAFDKVVMTAEAVKQVEEMLA"
FT   CDS_pept        268362..268664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rplW"
FT                   /locus_tag="XNC1_0319"
FT                   /product="50S ribosomal subunit protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0319"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88401"
FT                   /db_xref="GOA:D3VHR2"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHR2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88401.1"
FT                   /translation="MIREERLLKVLRAPHVSEKASTAMEKTNTIVLKVAKDATKAEIKA
FT                   AVQKLFEVEVEGVNTLLAKGKVKRHGQRVGRRSDWKKAYVTLKEGQNLDFVGGAE"
FT   CDS_pept        268684..269508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rplB"
FT                   /locus_tag="XNC1_0320"
FT                   /product="50S ribosomal subunit protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0320"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88402"
FT                   /db_xref="GOA:D3VHR3"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHR3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88402.1"
FT                   /translation="MAVVKCKPTSPGRRHVVKVVNPELHKGKPYAPLLEKNNKTGGRNN
FT                   NGRITTRHIGGGHKQHYRLIDFKRNKDGIPAVVERLEYDPNRSANIALVLYKDGERRYI
FT                   LAPKGLKAGDQIQSGADSAIKAGNALPMRNIPVGSTVHNIEMKPGKGGQLARSAGAYAQ
FT                   IVARDGSYVTLRLRSGEMRKVLSDCRATLGEVGNAEHMLRVLGKAGASRWRGIRPTVRG
FT                   TAMNPVDHPHGGGEGRNFGKHPVTPWGIQTKGKKTRSNKRTDQYIVRRRSKK"
FT   CDS_pept        269523..269801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rpsS"
FT                   /locus_tag="XNC1_0321"
FT                   /product="30S ribosomal subunit protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0321"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88403"
FT                   /db_xref="GOA:D3VHR4"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHR4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88403.1"
FT                   /translation="MPRSLKKGPFIDLHLLKKVEKAMESGDKKPIKTWSRRSTIFPNMI
FT                   GLTIAVHNGRQHVPVFVSDEMVGHKLGEFAPTRTYRGHAADKKAKKR"
FT   CDS_pept        269816..270148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rplV"
FT                   /locus_tag="XNC1_0322"
FT                   /product="50S ribosomal subunit protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0322"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88404"
FT                   /db_xref="GOA:D3VHR5"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHR5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88404.1"
FT                   /translation="METIAKHRHARSSAQKVRLVADLIRGKKVSQALETLTYTNKKAAG
FT                   LVKKVLESAIANAEHNDGADIDDLKVTKIFVDEGPTMKRIMPRAKGRADRILKRTSHIT
FT                   VVVSDR"
FT   CDS_pept        270166..270840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rpsC"
FT                   /locus_tag="XNC1_0323"
FT                   /product="30S ribosomal subunit protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0323"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88405"
FT                   /db_xref="GOA:D3VHR6"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHR6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88405.1"
FT                   /translation="MGQKVHPNGIRLGIVKPWNSTWYANTKEFADNLDSDFKVRQYLNK
FT                   ELVKASISRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKAVADIAGVPAQINIA
FT                   EVRKPELDAKLVADSISSQLERRVMFRRAMKRAVHNAMRLGAKGIKEEVSGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQAEKTGC
FT                   ST"
FT   CDS_pept        270779..270916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /locus_tag="XNC1_0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0324"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88406"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHR7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88406.1"
FT                   /translation="MRSWVVWLQLNRRKKPAAQPKKQQRKGPQVKEQSLMLPTQAYEIP
FT                   "
FT   CDS_pept        270918..271295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rplP"
FT                   /locus_tag="XNC1_0325"
FT                   /product="50S ribosomal subunit protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0325"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88407"
FT                   /db_xref="GOA:D3VHR8"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHR8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88407.1"
FT                   /translation="MHKGRNRVLAAGAEVSFGTFGLKAVGRGRLTARQIEAARRAMTRA
FT                   IKRQGKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLYEMDGVPEELARE
FT                   AFKLAAAKLPIKTTFVTKTVM"
FT   CDS_pept        271295..271486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rpmC"
FT                   /locus_tag="XNC1_0326"
FT                   /product="50S ribosomal subunit protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0326"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88408"
FT                   /db_xref="GOA:D3VHR9"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHR9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88408.1"
FT                   /translation="MKAQELREKSVEELNTELLNLLREQFNLRMQAASGQLQQSHLLKQ
FT                   VRRNIARVKTLLTEKAGA"
FT   CDS_pept        271486..271740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rpsQ"
FT                   /locus_tag="XNC1_0327"
FT                   /product="30S ribosomal subunit protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0327"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88409"
FT                   /db_xref="GOA:D3VHS0"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHS0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88409.1"
FT                   /translation="MTDKIRTLQGRVVSDKMEKSIVVAIERKVKHPLYGKFIKRTTKLH
FT                   VHDENNECGIGDVVEIRETRPLSKTKSWTLVRVVEKAVL"
FT   regulatory      271759..271809
FT                   /operon="XNC1_operon0064"
FT                   /regulatory_class="terminator"
FT   regulatory      271775..271834
FT                   /operon="XNC1_operon0064"
FT                   /regulatory_class="promoter"
FT   CDS_pept        271916..272287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rplN"
FT                   /locus_tag="XNC1_0328"
FT                   /product="50S ribosomal subunit protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0328"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88410"
FT                   /db_xref="GOA:D3VHS1"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHS1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88410.1"
FT                   /translation="MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAHVGDIIKITIKE
FT                   AIPRGKVKKGDVLKAVVVRTKKGVRRPDGSVIRFDSNACVLLNNNSEQVIGTRIFGPVT
FT                   RELRNEKFMKIISLAPEVL"
FT   CDS_pept        272298..272612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rplX"
FT                   /locus_tag="XNC1_0329"
FT                   /product="50S ribosomal subunit protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0329"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88411"
FT                   /db_xref="GOA:D3VHS2"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHS2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88411.1"
FT                   /translation="MAAKIRRDDEIIVLTGKDKGKRGKVKQVLSSGKVIVEGINLVKKH
FT                   QKPVPALNQPGGIVEKEAAINVSNVAIFNVATGKADRVGFRFEDGKKVRFFKSNNETIK
FT                   "
FT   CDS_pept        272626..273165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rplE"
FT                   /locus_tag="XNC1_0330"
FT                   /product="50S ribosomal subunit protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0330"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88412"
FT                   /db_xref="GOA:D3VHS3"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHS3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88412.1"
FT                   /translation="MAKLHDYYKDEVVQKLMTQFGYHSVMQVPRVEKITLNMGVGEAIA
FT                   DKKLLDNAAADLTAISGQKPLITKARKSVAGFKIRQGYPIGCKVTLRGKRMWEFFERLI
FT                   SIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTAKSD
FT                   DEGRALLAAFNFPFRK"
FT   CDS_pept        273178..273483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rpsN"
FT                   /locus_tag="XNC1_0331"
FT                   /product="30S ribosomal subunit protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0331"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88413"
FT                   /db_xref="GOA:D3VHS4"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHS4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88413.1"
FT                   /translation="MAKQSMKARDVKRAKLAEKFFAKRVELKAIISDVNASDEDRWNAV
FT                   LKLQTLPRDSSPCRQRNRCRQTGRPHAFLRKFGLSRIKVREAAMRGEIPGLKKASW"
FT   CDS_pept        273517..273909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rpsH"
FT                   /locus_tag="XNC1_0332"
FT                   /product="30S ribosomal subunit protein S8, and regulator"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0332"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88414"
FT                   /db_xref="GOA:D3VHS5"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHS5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88414.1"
FT                   /translation="MSMQDPIADMLTRIRNGQAANKVAVTMPSSKLKVAIAKVLKEEGY
FT                   IEDFKIEGDIKPELEVTLKYFQGKAVVESIQRVSRPSLRIYKKKDELPQVMAGLGIAVV
FT                   STSKGVMTDRAARQAGLGGEILCYVA"
FT   CDS_pept        273924..274457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rplF"
FT                   /locus_tag="XNC1_0333"
FT                   /product="50S ribosomal subunit protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0333"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88415"
FT                   /db_xref="GOA:D3VHS6"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHS6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88415.1"
FT                   /translation="MSRVAKAPVVIPAGVEVKLNGQVISIKGKNGELSREIHNAVEVTH
FT                   ADNQLTFAPREGFADAWAQAGTTRSLLNAMVIGVNEGFTKKLQLVGVGYRAAVKGNAVS
FT                   LSLGFSHPVEHQLPAGITAECPSQTEIVLKGADKQVIGQVAADLRAYRRPEPYKGKGVR
FT                   YADEVVRTKEAKKK"
FT   CDS_pept        274467..274820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rplR"
FT                   /locus_tag="XNC1_0334"
FT                   /product="50S ribosomal subunit protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0334"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88416"
FT                   /db_xref="GOA:D3VHS7"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHS7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88416.1"
FT                   /translation="MDKKAARIRRATRARRKLQELGATRLVVHRTPRHIYAQVIAPNGS
FT                   ETLVAASTTEKAISEQLKFTGNKDAAAVVGKIVAERALEKGITNVSFDRSGFQYHGRVQ
FT                   ALADAAREAGLQF"
FT   CDS_pept        274835..275335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rpsE"
FT                   /locus_tag="XNC1_0335"
FT                   /product="30S ribosomal subunit protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0335"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88417"
FT                   /db_xref="GOA:D3VHS8"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHS8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88417.1"
FT                   /translation="MAHIEKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGR
FT                   VGFGYGKAREVPAAIQKAMEKARRNMKTVALNSGTLYHPVKGSHTGSRVFMQPAHEGTG
FT                   IIAGGAMRAVLEVSGVRNVLAKTYGSTNPINVVRATLDALDSMKSPEMVAAKRGKSVEE
FT                   ILG"
FT   CDS_pept        275341..275520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rpmD"
FT                   /locus_tag="XNC1_0336"
FT                   /product="50S ribosomal subunit protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0336"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88418"
FT                   /db_xref="GOA:D3VHS9"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHS9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88418.1"
FT                   /translation="MAKTIKITQVRSSIGRLPKHKATLTGLGLRRIGHTVEREDTPAVR
FT                   GMVNLVSYMVKVEE"
FT   CDS_pept        275524..275958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rplO"
FT                   /locus_tag="XNC1_0337"
FT                   /product="50S ribosomal subunit protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0337"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88419"
FT                   /db_xref="GOA:D3VHT0"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHT0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88419.1"
FT                   /translation="MRLNTLSPAEGAKHASKRVGRGIGSGLGKTGGRGHKGQKSRSGGG
FT                   VRRGFEGGQMPLYRRLPKFGFTSRKAMITAEIRLSDFAHVEGDVIDLNALKAANIIGPQ
FT                   IEFAKVMLSGEVNRAVTVRGLRVTKGARAAIEAAGGKIEE"
FT   CDS_pept        275966..277297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="secY"
FT                   /locus_tag="XNC1_0338"
FT                   /product="preprotein translocase, membrane component,
FT                   transport across inner membrane (General Secretory
FT                   Pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0338"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88420"
FT                   /db_xref="GOA:D3VHT1"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHT1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88420.1"
FT                   /translation="MAKQPGLDFQSAKGGLGELKRRLLFVIGALIVFRIGSFIPIPGID
FT                   AAVLAKLLEQQRGTIIEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVNPRLAE
FT                   IKKEGEAGRRKISQYTRYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVS
FT                   LVTGTMFLMWLGEQITERGIGNGISIIIFAGIVAGLPPAIGHTIEQARQGDLHFLLLLL
FT                   VAVLVFAVTFFVVFMERGQRRIVVNYAKRQQGRKVFAAQSTHLPLKVNMAGVIPAIFAS
FT                   SIILFPGTIASWFGGGTGWNWLTTISMYLQPGQPLYVLLYASAIIFFCFFYTALVFNPR
FT                   ETADNLKKSGAFVPGIRPGEQTARYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPF
FT                   YFGGTSLLIVVVVIMDFMAQVQTLMMSSQYESALKKANLKGYNR"
FT   CDS_pept        277331..277447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rpmJ"
FT                   /locus_tag="XNC1_0339"
FT                   /product="50S ribosomal subunit protein X"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0339"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88421"
FT                   /db_xref="GOA:D3VHT2"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHT2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88421.1"
FT                   /translation="MKVRASVKKLCRNCKIVKRNGIVRVICSAEPKHKQRQG"
FT   regulatory      277476..277517
FT                   /regulatory_class="terminator"
FT   regulatory      277488..277547
FT                   /regulatory_class="promoter"
FT   operon          277596..280461
FT                   /operon="XNC1_operon0065"
FT   CDS_pept        277596..277952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0065"
FT                   /gene="rpsM"
FT                   /locus_tag="XNC1_0340"
FT                   /product="30S ribosomal subunit protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0340"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88422"
FT                   /db_xref="GOA:D3VHT3"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHT3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88422.1"
FT                   /translation="MARIAGINIPDQKHTVIALTSIYGIGKTRSQAICAAAGIAENVKI
FT                   RELSEEQIDKLRDEVAKYVVEGDLRREVTLSIKRLMDLGCYRGLRHRRGLPVRGQRTKT
FT                   NARTRKGPRKPIKK"
FT   CDS_pept        277968..278357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0065"
FT                   /gene="rpsK"
FT                   /locus_tag="XNC1_0341"
FT                   /product="30S ribosomal subunit protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0341"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88423"
FT                   /db_xref="GOA:D3VHT4"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHT4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88423.1"
FT                   /translation="MAKAPIRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWA
FT                   TAGGSGFRGSRKSTPFAAQVAAERCAEAVKEYGIKNLEVMVKGPGPGRESTIRALNAAG
FT                   FRITNITDVTPIPHNGCRPPKKRRV"
FT   CDS_pept        278393..279013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0065"
FT                   /gene="rpsD"
FT                   /locus_tag="XNC1_0342"
FT                   /product="30S ribosomal subunit protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0342"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88424"
FT                   /db_xref="GOA:D3VHT5"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHT5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88424.1"
FT                   /translation="MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKLEQAPGQHGARK
FT                   PRLSDYGVQLREKQKVRRIYGVLERQFRNYYKEATRLKGNTGENLLNLLESRLDNVVYR
FT                   MGFGATRAESRQMVSHKAITVNGRVVNIASYQVSPNDVVSVREKAKKQARIKAALELAE
FT                   QREKPTWLEVDAAKMEGVFKRIPERTDLSADINEHLIVELYSK"
FT   CDS_pept        279039..280028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0065"
FT                   /gene="rpoA"
FT                   /locus_tag="XNC1_0343"
FT                   /product="RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0343"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88425"
FT                   /db_xref="GOA:D3VHT6"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHT6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88425.1"
FT                   /translation="MQGSVTEFLKPRLVDIEQVSSTHAKVTLEPLERGFGHTLGNALRR
FT                   ILLSSMPGCAVTEVEIDGVLHEYSTKEGVQEDILEILLNLKGLAVKVQGKDEVILTVNK
FT                   SGIGPVTAADIIHDGDVEIVKPQHVICHLTDESASISMRIKVQRGRGYVPASARIHSEE
FT                   DERPIGRLLVDACYSPVERIAYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIRRAAT
FT                   ILAEQLEAFVDLRDVRQPEVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDL
FT                   VQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIADE"
FT   CDS_pept        280069..280461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0065"
FT                   /gene="rplQ"
FT                   /locus_tag="XNC1_0344"
FT                   /product="50S ribosomal subunit protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0344"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88426"
FT                   /db_xref="GOA:D3VHT7"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHT7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88426.1"
FT                   /translation="MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRHEIIKTTLPKAKELR
FT                   RVVEPLITLAKTDSVANRRLAFARTRDNEIVAKLFNELGPRFASRAGGYTRILKCGFRA
FT                   GDNAPMAYIELVDRAAESQTEAASAE"
FT   regulatory      280471..280519
FT                   /regulatory_class="terminator"
FT   regulatory      280473..280532
FT                   /regulatory_class="promoter"
FT   CDS_pept        280660..281073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zntR"
FT                   /locus_tag="XNC1_0345"
FT                   /product="Zn(II)-responsive transcriptional regulator,
FT                   regulates Zn export (MerR family)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0345"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88427"
FT                   /db_xref="GOA:D3VHT8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011788"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHT8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88427.1"
FT                   /translation="MYRIGQLAKLASVTPDTIRFYEKQGLMEHEERTEGGYRLYQEQDL
FT                   QRLRFIRYAKQLGFTLEAIVELLSIRVDPEHHTCQESKLIVDSRLKEIEEKLLEMQRMR
FT                   DSLKMLSDACCGSTHISTYCSILEILEEGAANK"
FT   regulatory      281093..281152
FT                   /regulatory_class="promoter"
FT   regulatory      complement(281178..281227)
FT                   /regulatory_class="terminator"
FT   CDS_pept        281208..281408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0346"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0346"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88428"
FT                   /db_xref="GOA:D3VHT9"
FT                   /db_xref="InterPro:IPR005589"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHT9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88428.1"
FT                   /translation="MTTYNHKKGVIKDNALEALLHDPLFRQRVEKNKKGKGSYSRKEKR
FT                   GKNSSWEANNNNFFKLLLLAF"
FT   operon          complement(281456..285790)
FT                   /operon="XNC1_operon0066"
FT   CDS_pept        complement(281456..282832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0066"
FT                   /gene="trkA"
FT                   /locus_tag="XNC1_0347"
FT                   /product="potassium transport protein, NAD(P)-binding (Trk
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0347"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88429"
FT                   /db_xref="GOA:D3VHU0"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHU0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88429.1"
FT                   /translation="MKIIILGAGQVGGTLAENLVDENNDITVVDTDTNRLRQLQDKFDL
FT                   RVVNGHGSHPRVLREAGAEDADMLVAVTNSDETNMIACQIAYSLFNTPNKVARIRSSEY
FT                   IRESEKLFQPDDIPIDYLISPEQLVIDYIYKLIQYPGALQVVNFAEGRVSIVAVKAYYG
FT                   GSLVGNALSSLREHMPHIDSKVAAIFRQDRPIRPQGSTVIEAGDEVFFVAASQHIRAVM
FT                   SELQRLEKPYKRIMIVGGGNVGAGLALRLEKDYSVKLIEHNQERAIELAELLHDTIVFY
FT                   GDASDQELLAEEHIEQVDVFIALTNDDEANIMSAMLAKRMGAKKAMVLIQRSAYVDLVQ
FT                   GGVIDIAISPQQATVSALLGHVRKADIVSVFSLRRGVAEAIEAIAHGDENTSKVVGRKI
FT                   GDIKLPPGTTIGAIVRDEEVIIANDYSIIEQGDHVIMFITDKKFVPEVEKLFQPSPFFL
FT                   "
FT   CDS_pept        complement(282908..284221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0066"
FT                   /gene="rsmB"
FT                   /locus_tag="XNC1_0348"
FT                   /product="16S rRNA m5C967 methyltransferase,
FT                   S-adenosyl-L-methionine-dependent"
FT                   /EC_number="2.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0348"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88430"
FT                   /db_xref="GOA:D3VHU1"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR023541"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHU1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88430.1"
FT                   /translation="MKNTYNLRSIAAKAITQVLEQGQSLSSVIPELQQRVSDKDKALLQ
FT                   ELCFGVMRVLPQLEWFMSQLMAKPLKGKQRIFHYLIMVGLYQLTYTRIPAHAALAETVN
FT                   GAINLKRPQLKGLINGVLRQFQRQQQELVERSNKHINQHLHPKWLQERIQKSYPQNWQT
FT                   IIDANNQKPPMWLRVNQLHHTANEYLSLLENANIEAELDTKHPNAIRLLNPCPVHSLPG
FT                   FNQGWVTIQDRSAQGCAELLTPCNGEFILDLCAAPGGKTTHILEIAPKSKVLAIDIDEQ
FT                   RLKRVKENLQRLNLHAVVKTGDGRLPHEWAAGEQFDRILLDAPCSATGVIRRHPDIKWL
FT                   RRNEDIDQLVTLQSEILDAIWPYLKKNGTLVYATCSILPQENSEQIKAFLKRHTDAVLS
FT                   ETGSLEKPGTQIIPEVEGGDGFFYARLIKPIISLSRSR"
FT   regulatory      complement(284244..284303)
FT                   /operon="XNC1_operon0066"
FT                   /regulatory_class="promoter"
FT   regulatory      complement(284260..284293)
FT                   /operon="XNC1_operon0066"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(284305..285252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0066"
FT                   /gene="fmt"
FT                   /locus_tag="XNC1_0349"
FT                   /product="10-formyltetrahydrofolate:L-methionyl-tRNA(fMet)
FT                   N-formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0349"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88431"
FT                   /db_xref="GOA:D3VHU2"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHU2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88431.1"
FT                   /translation="MSDSLRIIFAGTPDFAARHLAALLNSQHHVVGVLTRPDKPAGRGK
FT                   KLTPSSVKVLAEEHGIPVFQPITLRAEESQQWVMEQQADIMIVVAYGLILPQTVLDIPR
FT                   LGCLNIHGSLLPSWRGAAPIQRSVWAGDKETGVTIMQMDAGLDTGDMLLKTICPIEKED
FT                   TSASLYEKLANIGPTALLDTLDLITSGICQPEAQDNALATYAEKLSKDEAKIDWNLPAI
FT                   QLERCIRAFNPWPLSFFSIDEQPIKIWQAEVISEQTTQAPGTIINADKKGIQVATTDGI
FT                   LNIIQLQPPGKKAMSAADLLNSRREWFTPGSKIN"
FT   CDS_pept        complement(285278..285790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0066"
FT                   /gene="def"
FT                   /locus_tag="XNC1_0350"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0350"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88432"
FT                   /db_xref="GOA:D3VHU3"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHU3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88432.1"
FT                   /translation="MSVLQVLHYPDERLRTIAKPVEKVDAEIQRIIDDMFETMYAEEGI
FT                   GLAATQVDIHQRIVVIDVSEDRKQLLVLINPELLNESGETGIEEGCLSVPEQRGFVPRF
FT                   EQIKIKALDYHGQPFELEADGLLAICIQHEMDHLVGKLFVDYLSPLKRQRIRQKVEKID
FT                   RLRAKSK"
FT   regulatory      285717..285776
FT                   /regulatory_class="promoter"
FT   regulatory      complement(285829..285888)
FT                   /regulatory_class="promoter"
FT   operon          285922..289291
FT                   /operon="XNC1_operon0067"
FT   CDS_pept        285922..287010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0067"
FT                   /locus_tag="XNC1_0351"
FT                   /product="Protein smf"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0351"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88433"
FT                   /db_xref="GOA:D3VHU4"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHU4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88433.1"
FT                   /translation="MEAMEIWLRMKMVSHLSVVKAIPIIERLLQTKNCSTAFLKECGLS
FT                   LAQCLQFTNASPSMLASAFNWLEKPDNHLLTFSHPEYPPLLKQIHSPPLVLFVMGDVSV
FT                   LSQKQISMVGSRAATFYGEKWGRIFAGELAKNNLVITSGLAIGIDGFCHQSALDAGGKT
FT                   IAVLGSGLENIYPTRHQPLAQRIKENGTLVSEFFPDTSPKAKNFPRRNRIISGLSLVLV
FT                   IVEAHKNSGSLITARCALEQGRDIFALPGPLGVPSNEGNHWLIKQGAYLATNVADIMEH
FT                   INTSFQWMNIEDKGREDENKQFEQTELPFADVLVNVSNEVTPIDVIAQRSSLPVAEVMT
FT                   KLLELELMGKVAVTAGGYVLIN"
FT   CDS_pept        287075..287635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0067"
FT                   /gene="yrdD"
FT                   /locus_tag="XNC1_0352"
FT                   /product="putative DNA topoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0352"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88434"
FT                   /db_xref="GOA:D3VHU5"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHU5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88434.1"
FT                   /translation="MSKKVPFAIKKTEYCPECGSKLVIRNGTYGSFYACSSYPSCHYLR
FT                   SLKVQIDGHVVKELDGQICPRCGLTLVLRQGRYGMFISCSQYPECGHTELIDKPDDTSI
FT                   SCPQCQQGKLLQRKSRFGKIFHSCSRYPECQFALNNKPISGECMFCHYPLLIEKRTSQG
FT                   IKLFCASKLCSKQQFNEIENKNE"
FT   CDS_pept        287628..288197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0067"
FT                   /gene="yrdC"
FT                   /locus_tag="XNC1_0353"
FT                   /product="putative RNA-binding protein with unique protein
FT                   fold, with YrdC/RibB domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0353"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88435"
FT                   /db_xref="GOA:D3VHU6"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHU6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88435.1"
FT                   /translation="MSNEISPAFDSIVTALKEGKVIAYPTEAVFGLGCDPDSENAVQEL
FT                   LALKNRPWEKGLILIADNYERLCSYIDDVQLSDEQKETIFSFWPGPVTWVIPAKKITPK
FT                   WLTGKFSTLAVRVTDHPLVKQLCSLYGKPLVSTSANLSGLEPCRSVEEVRLQFGNRIPV
FT                   LSGEVGGRKNPSEIRDALTGKLYRQG"
FT   CDS_pept        288204..289022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0067"
FT                   /gene="aroE"
FT                   /locus_tag="XNC1_0354"
FT                   /product="dehydroshikimate reductase, NAD(P)-binding"
FT                   /function="16.15 : Symbiosis"
FT                   /EC_number="1.1.1.25"
FT                   /note="Evidence 1a : Function experimentally demonstrated
FT                   in the studied strain; PubMedId : 16164547; Product type e
FT                   : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0354"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88436"
FT                   /db_xref="GOA:D3VHU7"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHU7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88436.1"
FT                   /translation="MDKFVVFGNPVAHSKSPYIHQLFSEQTGIDHQYGRILAPIEQFEQ
FT                   VLDYFFEQGGLGANITVPFKEKAYQLSDKLTERAKISGAVNTLKRIEGNRLLGDNTDGI
FT                   GLVVDLQRLNFISQGKNVLIIGAGGAAKGVISPLFSLGCSITITNRTFERAQIIANKFS
FT                   QLGNIRAIEIESLHSKDFDIIINATASGLDGQIPSVSPLIFQSNCACYDMYYQQGLTPF
FT                   LNFAHQNGVSHLADGLGMLVGQAAYAFELWHGVFPEIEPVLVALRRELHS"
FT   CDS_pept        289019..289291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0067"
FT                   /locus_tag="XNC1_0355"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0355"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88437"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHU8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88437.1"
FT                   /translation="MNQSIQFPDREEWDEAEKRVLFPAIVDGLLVECMISADVIIKRYG
FT                   KAYCPLELFRQHRWDLEEEFETVILSGRDDKFGRYSLPSDCSANK"
FT   CDS_pept        complement(289255..289812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrdA"
FT                   /locus_tag="XNC1_0356"
FT                   /product="putative acyl transferase with trimeric LpxA-like
FT                   domain , ferripyochelin-binding"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0356"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88438"
FT                   /db_xref="GOA:D3VHU9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHU9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88438.1"
FT                   /translation="MSTVLRQYLDLYPQVGRKVFLDSSSVVIGDVRLAEDISIWPLVVI
FT                   RGDVNYVSIGSRTNIQDGSVLHVTHKSRDNPNGFPLIIGEDVTVGHKAILHGCTVGNRV
FT                   LVGMGSILLDGVIVEDDVIIGAGSLVPPRKKLESGYLYVGSPAKQVRKLKPEELEGLLY
FT                   SANNYARWKDDYLLAEQSEGKE"
FT   CDS_pept        289847..290221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0357"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88439"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHV0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88439.1"
FT                   /translation="MEMLLWKRSPCNEKFVSKLVRLGGFHDNWFKKCSFKNKIKKNYCQ
FT                   RRKTPYNAPPLTDAELRHAAEDSRRDSENKRLTPEAKSVRYAASQPGRRFPVAPLFNKL
FT                   IRQSVWALTRHYRTPKGAKD"
FT   regulatory      complement(289946..290005)
FT                   /regulatory_class="promoter"
FT   CDS_pept        290169..290300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0358"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88440"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH83"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88440.1"
FT                   /translation="MCGHSQDTIERRKAQKIKQVLKSEQQLIHYELTTVEFFEHQTL"
FT   rRNA            290323..291818
FT                   /locus_tag="XNC1_rRNA0010"
FT                   /product="16S ribosomal RNA"
FT   tRNA            291923..291998
FT                   /gene="GluTTC"
FT                   /locus_tag="XNC1_tRNA0008"
FT                   /product="tRNA-Glu"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   rRNA            292184..292723
FT                   /locus_tag="XNC1_rRNA0011"
FT                   /product="23S ribosomal RNA"
FT   rRNA            292738..294749
FT                   /gene="LSU_RRNA"
FT                   /locus_tag="XNC1_rRNA0012"
FT                   /product="23S ribosomal RNA"
FT   rRNA            295198..295310
FT                   /locus_tag="XNC1_rRNA0013"
FT                   /product="5S ribosomal RNA protein"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT   tRNA            295369..295445
FT                   /gene="AspGTC"
FT                   /locus_tag="XNC1_tRNA0009"
FT                   /product="tRNA-Asp"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   tRNA            295454..295529
FT                   /gene="TrpCCA"
FT                   /locus_tag="XNC1_tRNA0010"
FT                   /product="tRNA-Trp"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   regulatory      complement(295561..295592)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(295698..296540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0364"
FT                   /product="HTH-type transcriptional regulator hdfR
FT                   (H-NS-depdendent flhDC regulator)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0364"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88441"
FT                   /db_xref="GOA:D3VHV2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR020890"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHV2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88441.1"
FT                   /translation="MHVDTELLKTFLEVSKTRHFGRAAESLYLTQSAVSFRIRQLENQL
FT                   GTNLFTRHRNNIRLTAAGERLVPYAESLMNTWQLAKKEINYVAQHTELSIGSTASLWEG
FT                   YLTSWLNTFYHLHQETRIESLVSTRQSLVKQLHSRELDLLITTEPPKMDEFQSQLIGNI
FT                   QLILSTTRHNLEKGVENYIKLEWGADFHQQEQQILKNDHPPIITTTSAHIARELLDSVN
FT                   AATFLPVHWQKEYPKLVSSSNNTLIERPLYAVWLQNSDQQSLIQQLIKLPVEKAPITA"
FT   regulatory      296567..296626
FT                   /regulatory_class="promoter"
FT   CDS_pept        296651..296989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yifE"
FT                   /locus_tag="XNC1_0365"
FT                   /product="putative transcriptional regulator with pssR"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0365"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88442"
FT                   /db_xref="InterPro:IPR007335"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHV3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88442.1"
FT                   /translation="MAESFITTNRFFDNKHYPRGFSRHGDFTIKEAQLLERHGYAFNEL
FT                   DLGKREPQTEEEKLFVAVCRGERAPVTTAEKVWAKYLTKISRPKRFHTLSGGKPQVDPS
FT                   EDYTDTDD"
FT   regulatory      complement(296720..296779)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(297010..297036)
FT                   /regulatory_class="terminator"
FT   regulatory      297016..297053
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(297047..298573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yifB"
FT                   /locus_tag="XNC1_0366"
FT                   /product="putative enzyme (N-terminal); transcriptional
FT                   regulator with P-loop containing NTP hydrolase domain
FT                   (C-terminal)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0366"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88443"
FT                   /db_xref="GOA:D3VHV4"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHV4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88443.1"
FT                   /translation="MALSVIRTRATIGIDSPLVTIEAHISNGLPGLTLVGLPETTVKEA
FT                   RDRVRSALLNSGFTYPPKRITVNLAPADLPKEGGRYDLPIAIAVLAASKQISTDKLQNY
FT                   EFLGELALSGEIRRVMGAIPAALSAKGAGRQLILSSENSVELAILPSDEALMAEHLLQV
FT                   CHFLEGKNTSLSPPLPIKLQTEPSILDMQDIIGQEQAKRALEITAAGGHNLLLLGPPGT
FT                   GKTMLASRLCSLLPPLTHQEALEVASINSLVGYSMNPQKWHTRPFRAPHHSSSMAALVG
FT                   GGSIPRPGEISLAHNGVLFLDELPEFNRSVLDALREPLESGEIVISRAKAKVCFPAQVQ
FT                   LIAAMNPSPTGYHQGLHNRSSPQQVLRYLSKLSGPFLDRFDLSIEVPLLPPGILSQSSA
FT                   KHGESSHDVKKRVQTARKIQIERCGCINAVLNSKQTEDICQLKIEDAVFLENTLLKLGL
FT                   SIRAWHRILKVSRTIADLKEQKRIEKPDIMEALSYRSMDRLLIQLQKQAG"
FT   CDS_pept        complement(298602..298724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0367"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88444"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHV5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88444.1"
FT                   /translation="MLLLRFEEQNDFQSSDSNNYLYESLRKITTGDFLLFFIDS"
FT   regulatory      complement(298822..298881)
FT                   /regulatory_class="promoter"
FT   operon          299423..305765
FT                   /operon="XNC1_operon0068"
FT   CDS_pept        299423..301069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0068"
FT                   /locus_tag="XNC1_0368"
FT                   /product="Acetolactate synthase isozyme II large subunit
FT                   (AHAS-II) (Acetohydroxy-acid synthase II large subunit)
FT                   (ALS-II)"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0368"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88445"
FT                   /db_xref="GOA:D3VHV6"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHV6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88445.1"
FT                   /translation="MNGAQSVIEALRTQRIEKVFGYPGGTIMPVYDALYDGGIEHVLCR
FT                   HEQGAAMAAIGYARASGKPGVCIATSGPGATNLVTGLADALLDSVPVVAITGQVSTALI
FT                   GTDAFQEIDMLGMSLSCTKHSFLVDSLEKLPQIMADAFTIAMSDRPGPVLVDLPKDIQL
FT                   AQGDFAPYLVPESPELSLPEQEIGQARQLLASSQKPILYVGGGVGMSGAVPELRRFVAE
FT                   TGMPVVSTLKGLGAADFEHECYLGMLGMHGTKAANLAVQACDLLVAVGVRFDDRVTGKL
FT                   STFAPHAKVIHLDVDPAEFNKLRQIHVSLLGDVKTLLPYLQQSLSIQAWQQEVQQLKSE
FT                   HAWRYDYQGESIYAPLLLKQISDRAPSSTVITTDVGQHQMWTAQHMSFSQPENFITSSG
FT                   LGAMGFGIPAAIGAQMARPQDMVICISGDGSFMMNVQELGTIKRKQLPVKIVLLDNQRL
FT                   GMVRQWQELFFDKRYSETTLTDNPDFLTLAQAFGIPGQRITDKSQVSGALDALFNSEGA
FT                   YLLHVSIDELENVWPLVPPGASNEAMLEKSL"
FT   CDS_pept        301066..301323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0068"
FT                   /gene="ilvM"
FT                   /locus_tag="XNC1_0369"
FT                   /product="acetolactate synthase II, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0369"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88446"
FT                   /db_xref="GOA:D3VHV7"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHV7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88446.1"
FT                   /translation="MMQHQLAIQARFCPEILERILRVTRHRGFQICALNMDQTTDSGNV
FT                   SIELTVSSQRSINLLFSQLMKLVDVAGIEIKHKESQLISA"
FT   CDS_pept        301348..302274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0068"
FT                   /gene="ilvE"
FT                   /locus_tag="XNC1_0370"
FT                   /product="branched-chain amino-acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0370"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88447"
FT                   /db_xref="GOA:D3VHV8"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHV8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88447.1"
FT                   /translation="MTKQADYIWFNGEMVPWADAKVHVMSHALHYGTSVFEGIRCYDSY
FT                   KGPVVFRHREHMQRLHDSAKIYRFPVSQNVDELMEACRETLRKNKLVSAYIRPLVFIGD
FT                   VGMGVNPPAGYKTDVIIAAFPWGAYLGEEALEQGIDAMVSSWNRAAANTIPTAAKAGGN
FT                   YLSSLLVGSEARRHGYQEGIALDIHGYISEGAGENLFEVKDGILFTPPFTSSALPGITR
FT                   DAIIKLAQDLGLEVREQTLSRESLYLADEVFMTGTAAEITPVRSVDDIQVGIGKCGPIT
FT                   KKIQNAFFGLFDGTTEDKWGWLDPVNP"
FT   CDS_pept        302365..304215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0068"
FT                   /gene="ilvD"
FT                   /locus_tag="XNC1_0371"
FT                   /product="dihydroxyacid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0371"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88448"
FT                   /db_xref="GOA:D3VHV9"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHV9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88448.1"
FT                   /translation="MPKYRSATTTHGRNMAGARALWRATGMTDADFGKPIIAVVNSFTQ
FT                   FVPGHVHLRDLGKLVAEQIEASGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSV
FT                   EYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTRLSDQIIKLD
FT                   LVDAMIQGANPNVSDEQSDQIERSACPTCGSCSGMFTANSMNCLTEALGLSQPGNGSLL
FT                   ATHADRKTLFINAGKRIVALTKRYYEKNDDSALPRNIATKAAFENAMTLDIAMGGSTNT
FT                   VLHLLAAAQEGEVDFTMADIDRLSRQVPHLCKVAPSTQKYHMEDVHRAGGVMGILGELD
FT                   RAGLLRRGVKNILGLDLAQTLVQYDIMLTENEHVKHMYSAGPAGIRTTQAFSQDCRWPS
FT                   LDIDRQEGCIRERAYAYSQDGGLAVLFGNVAANGCIVKTAGVDEGSLTFRGPAKVYESQ
FT                   DDAVDAILGGKVVAGDVVIIRYEGPKGGPGMQEMLYPTTYLKSMGLGKSCALITDGRFS
FT                   GGTSGLSIGHVSPEAANGGLIGLIQDGDIIEIDIPNRKIQLDVAETELAERAQAELSRG
FT                   DKAWTPKSRERQVSFALRAYASLATSADKGAVRDKTKLGC"
FT   CDS_pept        304218..305765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0068"
FT                   /gene="ilvA"
FT                   /locus_tag="XNC1_0372"
FT                   /product="threonine deaminase"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0372"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88449"
FT                   /db_xref="GOA:D3VHW0"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHW0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88449.1"
FT                   /translation="MAVYPLNSEPNGAEYLKAALSAPVYDVAQVTPLQEMKKISSRLNN
FT                   TILVKREDRQLVHSFKLRGAYAMIAGLTEEQKTKGVITASAGNHAQGVALSASKVGVKA
FT                   TIVMPIATADIKVDAVRSFGGAVLLHGANFDEAKAKAIEMAKEHGYTFVPPFDHPVVIA
FT                   GQATLAMELLQQDVHLDRIFVPVGGGGLIAGVAVLIKQLVPEMKVIGVEAEDSACLKAA
FT                   LEAGHPVDLPRIGLFAEGVAVKRIGDETFRLCQQYVDDVITVDSDAICAAMKDIFEDVR
FT                   AIAEPSGALALAGLKKYVQQYQIQGERLAHILSGANVNFHGLRYVSERCELGEQREALL
FT                   AVTIPEQKGSFLHFCQILGPRVVTEFSYRYSDATDPNKACIFVGIRLSRGNAERREIIE
FT                   ELNSSGYQVADFTDDEMAKLHVRYMIGGRPSKPLQERLFSFAFPESPGALLKFLQTLGT
FT                   HWNITLFHYRSHGTDYGRVLAAFELAEPEVRFDRHLEVLGYEYHDETDNPSFNLLLK"
FT   regulatory      305970..306029
FT                   /regulatory_class="promoter"
FT   operon          306069..306984
FT                   /operon="XNC1_operon0069"
FT   CDS_pept        306069..306404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0069"
FT                   /locus_tag="XNC1_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0373"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88450"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHW1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88450.1"
FT                   /translation="MLVLSEIKTLEALKAKGSFKKVMAEINKLIPIKARGWKHLWEKIL
FT                   ELRKYAENDDLVHAAIFFKTEDLAAIKKYLWMVIVTLRQYNLYISSMYEGINYFKYENS
FT                   ENEVRWN"
FT   CDS_pept        306385..306984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0069"
FT                   /locus_tag="XNC1_0374"
FT                   /product="putative cell filamentation protein, induced in
FT                   stationary phase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0374"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88451"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHW2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88451.1"
FT                   /translation="MKYDGTDKYCYDAHPDVLINKFGIADEELLDHRIIKEQMRVIDNI
FT                   KIHSPYSLNTLCDIHRKMFSCAFNWAGKLRDIDISKGNTRFCHNIYLDKEGEKIFVNVN
FT                   KLHKDLLVMPDNKKKTDNPDLVKKMDELGKIICDLNFLHPFREGNGRTLRLFVELFLFN
FT                   LGIIISWPELPTCWMKASIDDQGESMKGLFLLKSSK"
FT   regulatory      complement(307037..307078)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(307105..307992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvY"
FT                   /locus_tag="XNC1_0375"
FT                   /product="transcriptional activator for isoleucine and
FT                   valine synthesis (LysR family)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0375"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88452"
FT                   /db_xref="GOA:D3VHW3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037404"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHW3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88452.1"
FT                   /translation="MDLRDLKLFLHLAESCHFGRTATAMHVSPSTLSRQIQRLEELLGH
FT                   PLFLRDNRTVKLTSAGEQLKQFAQQTLLQYKQLQHSLNHQSSSLTGELRLFCSVTAAYS
FT                   HLPQVLDKFRAEHPLVEIKLTTGDAADAVNKVQSDAADLGIAGKPEKLPDNISFTKIGE
FT                   IPLVLIAPSLPCTVRSLAIEAQPDWNSIPFILPEHGPSRKRIELWFRRHQILHPVIYAT
FT                   VSGHEAIVSMVALGCGIALIPAVVVENSPEPVRNRISLLDNISLVEPFELGICALSKRL
FT                   NEPLIKAFWKLLSA"
FT   regulatory      308018..308077
FT                   /regulatory_class="promoter"
FT   CDS_pept        308149..309627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="XNC1_0376"
FT                   /product="ketol-acid reductoisomerase, NAD(P)-binding"
FT                   /EC_number="1.1.1.86"
FT                   /note="Evidence 1a : Function experimentally demonstrated
FT                   in the studied strain; PubMedId : 16164547; Product type e
FT                   : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0376"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88453"
FT                   /db_xref="GOA:D3VHW4"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHW4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88453.1"
FT                   /translation="MANYFDTLNLRQQLAQLGKCRFMAREEFADEAGYLKGKKVVIVGC
FT                   GAQGLNQGLNMRDSGLDIAYALRKEAIEEKRASWRKATENGFRVGTYEELIPQADLVIN
FT                   LTPDKQHSSVVRAVQPLMKEGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVRE
FT                   EYKRGFGVPTLIAVHPENDVKGEGMAIAKAWVAATGGHRAGVLESSFVAEVKSDLMGEQ
FT                   TILCGMLQAGSLLCYDKLVADGAEPSYAGKLIQFGWETITEALKQGGITLMMDRLSNSA
FT                   KLRAYALAEQLKTLLAPLFQKHMDDIISGAFSSTMMADWANDDKNLLTWREETGKTPFE
FT                   NYPDYSGNISEQEYFDHGVLMIAMVKAGVELAFDTMIDAGIIEESAYYESLHELPLIAN
FT                   TIARKRLYEMNVVISDTAEYGNYLFSHIAVPLLKEKFMATLQAGDLGKEVADSGIDNAQ
FT                   LRDVNEAIRHHPIETIGHTLRGYMTDMKRIAVGG"
FT   regulatory      complement(308152..308211)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(309682..310797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0377"
FT                   /product="Histone deacetylase-like amidohydrolase
FT                   (HDAC-like amidohydrolase) (HDAH)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0377"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88454"
FT                   /db_xref="GOA:D3VHW5"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHW5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88454.1"
FT                   /translation="MLRKTGFFFDELCFWHNSGLQHVVTFPVGGWVQPPNSAGHAESPE
FT                   TKRRMKSLMDVSGLTRSLHLRNAEPLDDATLKLVHTEEYLQRFKSVSDSGAGILGPEAS
FT                   IGQGSYEIAKLSAGLTYAAVKAVLEDELDNAYSLSRPPGHHCLPDQAMGFCLLANIALA
FT                   IEHAKEKLGVGRVAVLDWDVHHGNGTQHIFWERDDVLTISLHQDGCYPEGYSGEEDIGA
FT                   GKGEGFNINIPLMAGAGHNSYLYAMDQIVLPALQRYQPELIIVACGYDANAYDPLARMQ
FT                   LHSDSFREMTRKIQQAADELCHGKLVMVHEGGYAEAYVPFCGLAVMEELSGIRTEVTDP
FT                   ALSIIQSQQPKERFDAFQRQAIDELKLKFNL"
FT   regulatory      310799..310858
FT                   /regulatory_class="promoter"
FT   regulatory      complement(310840..310899)
FT                   /regulatory_class="promoter"
FT   CDS_pept        311054..313084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="XNC1_0378"
FT                   /product="Rep helicase, a single-stranded DNA-dependent
FT                   ATPase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0378"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88455"
FT                   /db_xref="GOA:D3VHW6"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHW6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88455.1"
FT                   /translation="MRLNPSQQQAVEFVTGPCLVLAGAGSGKTRVITNKIAHLIRACGY
FT                   QARHIAAVTFTNKAAREMKERVAQTLGRKETKGLMISTFHTLGLEIIKREYQALGMKSN
FT                   FSLFDDQDQMALLKDLTADLLEEDKDLLQKLISSISNWKNDLMSPEQVVRSARSAQEHQ
FT                   FAECYRRYDLHLNSCNILDFDDLITKPTLLLMRDENVRERWQNRIRYLLVDEYQDTNTS
FT                   QYQLVKLLVGNRARFTVVGDDDQSIYSWRGARPQNLILLKEDFPQLNVIKLEQNYRSSG
FT                   RILKAANILIANNPHVFEKKLFSELHYGDPLRVLEANNEDHEAERVIGELIAHHFINKT
FT                   EYKDYAILYRGNHQSRIFEKMLMQNRIPYRISGGTSFFSRPEIKDLLSYLRVLTNPEDD
FT                   SAFLRIVNTPRREIGAVTIQKLGEWANQRNKSLYQASFDLGLEQHLTGRGLAALHRFTH
FT                   WMEEISRQVEREPLLAVRDLLRGMDYESWLYETSPSPKAAEMRMKNVNQLFTWMSEMLE
FT                   GDDLNEPMTLSQVVARFTLRDMLERGEEDDALDQVQLMTLHASKGLEFPYVFLVGMEEG
FT                   LLPHQSSIDEENIEEERRLAYVGITRAQRVLFFTLSKERRQYGELIRPEPSRFLLELPQ
FT                   DDLDWPRGKRVVSAEERMKQGQSRLADIKSRLGLGQKNVGK"
FT   operon          complement(313114..315967)
FT                   /operon="XNC1_operon0070"
FT   CDS_pept        complement(313114..314625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0070"
FT                   /gene="gpp"
FT                   /locus_tag="XNC1_0379"
FT                   /product="guanosine pentaphosphatase, also has
FT                   exopolyphosphatase activity"
FT                   /EC_number="3.6.1.40"
FT                   /EC_number="3.6.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0379"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88456"
FT                   /db_xref="GOA:D3VHW7"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR023709"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHW7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88456.1"
FT                   /translation="MLASSSLYAAIDLGSNSFHMLVVREVSGSIQVVTRIKRKVRLAAG
FT                   LDKHNHLSQQAMERGWQCLQLFSEYLQDIPATHIRVVATATLRLAANSDEFVRKASEIL
FT                   GISVSIISGKEEAQLIYHGVAHTTGGPEKRLVVDIGGGSTELVTGTGAKANQLFSLEMG
FT                   CVTWLERYFSDRNLTEDNFAKAESAAHDILSPVTAILLEQGWQICVGASGTVQALQEIM
FT                   IAQGMDELITLPKLQQLKYQAIECGKLEELEIDGLTLERALVFPSGLAILIAIFQALNI
FT                   ESMTLAGGALREGLVYGMLNLSVEQDIRTRTLHNIQQRFQLDTEQAQRVKQLTEYFCQQ
FT                   IAKPWELDERCRELLSSACLLHEIGLCIDFRQGAEHSAYLISHLDLPGYTPAQKRLLAI
FT                   LLKNQSGSVDLASLSQQNSLPLLQVQRLCRLLRLAIIFTSRRRNDDTLSALRLQVENET
FT                   LIITLPQQWQIQHPLRAEALQQEIKWQGYVQWSLFLEEQNNFYLG"
FT   CDS_pept        complement(314684..315967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0070"
FT                   /gene="rhlB"
FT                   /locus_tag="XNC1_0380"
FT                   /product="putative ATP-dependent helicase with nucleoside
FT                   triP hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0380"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88457"
FT                   /db_xref="GOA:D3VHW8"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHW8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88457.1"
FT                   /translation="MSKTHLTEKKFSDFALHPKVLGALDKKGFSNCTPIQALTLPFTVE
FT                   GRDVAGQAQTGTGKTLAFLASTFHYLLTHPAGKERKINQPRALIMAPTRELAVQIYSDA
FT                   KELAEVTGLKMGLAYGGDGYDKQLKVLESGVDIVIGTTGRLIDYAKQGHIHLGAIQVVV
FT                   LDEADRMYDLGFIKDIRWLFRRIPAATERLNLLFSATLSYRVRELAFEQMNNPEYVEVE
FT                   PLQKTGHRIREELFYPSNEEKMRLLQTLLEEEWPDRCIIFANTKHRCEDIWTHLAADGH
FT                   RVGLLTGDVAQKKRLRILEEFSLGNLDILVATDVAARGLHIPSVTHVFNYDLPDDCEDY
FT                   VHRIGRTGRAGESGHSISLACEEYVLNLPSIEEYIQHQIPVSKYNSDALLKDLPVPKRR
FT                   NRTRPGGHPRRINMPRRGNPTRNRKHPS"
FT   regulatory      complement(316059..316118)
FT                   /regulatory_class="promoter"
FT   CDS_pept        316087..316443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="XNC1_0381"
FT                   /product="thioredoxin 1, redox factor"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0381"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88458"
FT                   /db_xref="GOA:D3VHW9"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHW9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88458.1"
FT                   /translation="MNEKIVNDDVVNAGIVHLSDSDFNEDKLNLKGIVLVDFWAEWCGP
FT                   CKMIAPILDEIASDYAGKLTVAKLNVDDHTGTAPKFGIRGIPTMILFKDGEKVAVKVGA
FT                   LSKTQLKEFLEPHL"
FT   regulatory      complement(316379..316438)
FT                   /regulatory_class="terminator"
FT   regulatory      316570..316628
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(316599..316835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0382"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88459"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHX0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88459.1"
FT                   /translation="MSTAYNYKNYNYKNIRLRDVQYRDAIGELTYILNILYRLNEFTKC
FT                   DMLSDTSGDPEITDLSDTTDFLVCNIHNVNFLH"
FT   regulatory      complement(316922..316981)
FT                   /regulatory_class="promoter"
FT   CDS_pept        317089..318348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="XNC1_0383"
FT                   /product="transcription termination factor Rho; polarity
FT                   suppressor"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0383"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88460"
FT                   /db_xref="GOA:D3VHX1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHX1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88460.1"
FT                   /translation="MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFSILKQHAKS
FT                   GEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPP
FT                   KEGERYFALLKVNEVNFDKPENARSKILFENLTPLHANNRLRMERGNGSTEDLTARVLD
FT                   LAAPIGRGQRGLIVAPPKAGKTMLLQNIAANIAHNYPDCVLMVLLIDERPEEVTEMQRL
FT                   VKGEVIASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPAS
FT                   GKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGN
FT                   MELHLSRKIAEKRVFPAIDYNRSGTRKEELLTTQDELQKMWILRKIIHPMGEIDAMEFL
FT                   INKLAMTKTNEEFFDFMKRS"
FT   regulatory      318393..318422
FT                   /regulatory_class="terminator"
FT   operon          318689..328408
FT                   /operon="XNC1_operon0071"
FT   CDS_pept        318689..319777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0071"
FT                   /gene="rfe"
FT                   /locus_tag="XNC1_0384"
FT                   /product="UDP-GlcNAc:undecaprenylphosphate
FT                   GlcNAc-1-phosphate transferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0384"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88461"
FT                   /db_xref="GOA:D3VHX2"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR012750"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHX2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88461.1"
FT                   /translation="MNISRMSVDIFCVFIFSFVFLFLARKIAKSIGLVDKPNYRKRHHG
FT                   LVPLVGGISIFFGVCFAFSITKEFMPHKSLYLTCAGVLVFVGMLDDRFDISVKIRATIQ
FT                   ALVGVSMMYFADLKIESLGDIFGSWEMILGPFSYIVTLFAVWASINAFNMMDGIDGLLG
FT                   GLSCVSFGALGILLYENGNTALAFWCFTFIAGILPYIFLNLGLLGRRFKVFMGDAGSTL
FT                   IGFTIIWLLTEVTQGENRSINPVTALWIIAIPLMDMVAIMYRRLRKGMSPFSPDRQHIH
FT                   HLIMRAGFTSRQAFMLITLAAALLASIGIIGERLSFVPEWVMLALFLLAFMLYGYCIKR
FT                   AWRVARFIKRLKRRMRREASHH"
FT   CDS_pept        319808..320878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0071"
FT                   /gene="wzzE"
FT                   /locus_tag="XNC1_0385"
FT                   /product="modulator of enterobacterial common antigen (ECA)
FT                   polysaccharide chain length"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0385"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88462"
FT                   /db_xref="GOA:D3VHX3"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032895"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHX3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88462.1"
FT                   /translation="MINSETKSKQDQPAIEYELDVRTLCRALWKGKIWIIALAMIFAAV
FT                   ALGASYLMQQKWSATAIVDLPTTNNLGSYYSQQQFLRNLDTHINASPEAQLPTIPDGAY
FT                   KEFMTQVAAYDTRREFWLHSDYYKQRREGGAKADAVLLDELINDIKITRGDDKNAPNDS
FT                   IKLTAETATDSNQLLRKYIAFANQRASEHLNNEIKGAWATRTQSMKALVKRQEMVAKAM
FT                   YTRELNVLQQSSNVAEKQGIHRNQTDIPIEELPESKMFMLGTSLLQAQIETLEATGPDY
FT                   SIDYDQNIAMLATLNVGPTLQDTFQTYRYLRTPEEPVGRDSPRRIFMMVMWGAVGMLMG
FT                   AGLALVRRHRYSNPEQ"
FT   CDS_pept        320965..322095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0071"
FT                   /gene="rffE"
FT                   /locus_tag="XNC1_0386"
FT                   /product="UDP-N-acetyl glucosamine-2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0386"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88463"
FT                   /db_xref="GOA:D3VHX4"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="InterPro:IPR032892"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHX4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88463.1"
FT                   /translation="MKVLTVFGTRPEAIKMAPLVHALSRDTAFDAKVCVTAQHREMLDQ
FT                   VLHLFGITPDFDLNIMQKGQDLTDITCRILQGIKPVLEEFKPDVVLVHGDTTTTMATSL
FT                   AAFYQHIPVGHVEAGLRTGDLYSPWPEEANRKIAGHLAMYHFAPTVTSQNNLLKESIAE
FT                   NRIFVTGNTVIDALLSVRDRIMNDDALYGQLAELYPFIDPNKKLILVTGHRRESFGKGF
FT                   ERICEALAQIARAHPEVQVVYPVHLNPNVCEPVKRILHDIDNVILIKPQDYLPFVYLMN
FT                   HAYMILTDSGGIQEEAPSLGKPVLVMRNTTERPEAIDAGTVRLVGTETQTIVAEVTRLL
FT                   TDDTAYQQMSHAHNPYGDGQACQRILEALKKNQVTL"
FT   CDS_pept        322092..323354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0071"
FT                   /gene="rffD"
FT                   /locus_tag="XNC1_0387"
FT                   /product="UDP-N-acetyl-D-mannosaminuronic acid
FT                   dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0387"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88464"
FT                   /db_xref="GOA:D3VHX5"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR032891"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHX5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88464.1"
FT                   /translation="MSFETISVIGLGYIGLPTAAAFASCKKKVIGVDVNQHAVETINRG
FT                   AIHIVEPDLDKVVKTAVEGGYLKAVTVPQAADAFLIAVPTPFKGDHEPDMAYVRSAAES
FT                   IAPVLKKGDLIILESTSPVGATEQMAEWLAAIRSDLSFPQQAGDNSDIDIAYCPERVLP
FT                   GQVMVELVKNDRVVGGMTGKSSRRASELYKIFLEGECVITNAKTAEMCKLTENSFRDVN
FT                   IAFANELSLICAEQGINVWELISLANRHPRVNILQPGPGVGGHCIAVDPWFIVSQNPEQ
FT                   SRLIHTARLVNDGKPLWVIDQVKAAVADCLAESGKRASEINIACFGLAFKPNIDDLRES
FT                   PAVHIAKMVAQWHAGQTMVVEPNVHELPGSLKDWVKLVDMELALEEADVVLMLVDHRQF
FT                   KAIHGNAIKQQWIIDTKGVWR"
FT   CDS_pept        323351..324421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0071"
FT                   /gene="rffG"
FT                   /locus_tag="XNC1_0388"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0388"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88465"
FT                   /db_xref="GOA:D3VHX6"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHX6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88465.1"
FT                   /translation="MKRILITGGAGFIGSAVVRHIINQTEDSVVVVDSLTYAGNLESLA
FT                   PVAEHPRYAFEQVDICQREALDRVFQQYQPDAVMHLAAESHVDRSIDGPAAFIETNIIG
FT                   TYILLEAARTYWQQLDEEKRAAFRFHHISTDEVYGDLDGQESFFTETTPYAPSSPYSAS
FT                   KASSDHLVRAWRRTYGLPTVITNCSNNYGPYHFPEKLIPLMILNAQAGKPLPVYGKGEQ
FT                   IRDWLYVEDHARALHLVVTKAVPGETYNIGGHNERRNIDVVETICGLLEELCPEKPAGV
FT                   SHYRDLITYVTDRPGHDMRYAIDAAKIERELGWTPQETFESGIRKTVQWYLGHENWWCR
FT                   VQDGSYAGERLGLGNE"
FT   CDS_pept        324440..325321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0071"
FT                   /gene="rffH"
FT                   /locus_tag="XNC1_0389"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0389"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88466"
FT                   /db_xref="GOA:D3VHX7"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHX7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88466.1"
FT                   /translation="MKGIILAGGSGTRLYPITRGISKQLLPIYDKPMIYYPLSVLMLSG
FT                   IRDILIISTPEDLPAFKRLLGNGEQFGIHLSYAEQPSPDGLAQAFLLGEAFIGDDACCL
FT                   VLGDNIFFGQAFSPKLRSVAERETGATVFGYQVMDPERFGVVEFDEQYRVRSIEEKPVQ
FT                   PKSNWAVTGLYFYDNKVVDFAKHVKPSARGELEITSINQMYLESGELNVELLGRGFAWL
FT                   DTGTHDSLIEASTFVQTVEKRQGFKIACLEEIAWRNGWLNSEQVKAAAADLSKTGYGKY
FT                   LTDLLNVYSRQS"
FT   CDS_pept        325299..326024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0071"
FT                   /gene="rffC"
FT                   /locus_tag="XNC1_0390"
FT                   /product="putative acyl-CoA N-acyltransferase,
FT                   lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0390"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88467"
FT                   /db_xref="GOA:D3VHX8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012752"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHX8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88467.1"
FT                   /translation="MSIHANLEPLAWDSQFFGLSTARLNLSPGAAVITAAHLDEYALVQ
FT                   AKIPAQQTAVLDALSALSFSLAEGEADLLLSLDAGDQTEIQTGQNAVPKFVIAKPQDIP
FT                   ALKAVAEQVFKVSRFRAPWYQPDDSGRFYAVWVENAVLGTFDHECLMINDEHGQMMGFV
FT                   TLRDIGSHEARIGLLATVPGSHHQGIGKKLMSAAQQWCQQHQIQRLRIATQISNIAALR
FT                   LYTRRGAIIESTAYWLYRG"
FT   CDS_pept        326026..327156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0071"
FT                   /gene="rffA"
FT                   /locus_tag="XNC1_0391"
FT                   /product="TDP-4-oxo-6-deoxy-D-glucose transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0391"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88468"
FT                   /db_xref="GOA:D3VHX9"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR012749"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR032894"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHX9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88468.1"
FT                   /translation="MIPFNKPPVVGTELEYMKQAMASGKLCGDGEFTKRCETWMEQRFG
FT                   CPKVLLTPSCTASLEMAAILLDIQPGDEIIMPSYTFVSTSNAFVLRGATIVFVDIRPDT
FT                   MNIDETRIEAAITEKTRAIVPVHYAGVACEMDTIMALAEKYNLYVVEDAAQGVMSTYKG
FT                   RALGTIGHIGCFSFHETKNYSAGGEGGATLINDKSLIARAEIIREKGTNRSQFFRGQVD
FT                   KYTWRDIGSSYLMSDLQAAYLWGQLEIAEKINQRRLALWDNYYQALKPLSDGGHLTLPI
FT                   VPNGVEHNAHMFYIKLKDVEERSEFNRYMKEHGVLSVFHYVALHTSPAGEKCGRFHGED
FT                   RFTTRESDRLVRLPMFYNMTDEEQQVVINRSKEFFA"
FT   CDS_pept        327158..328408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0071"
FT                   /gene="wzxE"
FT                   /locus_tag="XNC1_0392"
FT                   /product="O-antigen translocase in LPS biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0392"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88469"
FT                   /db_xref="GOA:D3VHY0"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR032896"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHY0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88469.1"
FT                   /translation="MSLAKASVWTAGSTLIKIGVGLLVIKLLAVSFGPTGVGQAGNFRQ
FT                   LITVLGVLSGAGIFNGVTKYVAEYHQQPERLSALLGTSSSIILGFSTLLAVIFLLFSDA
FT                   ISVGLFGHNHYKIVVQALAFIQMGIAYANYFLAILKGFRDAQGNALAIILGSLVGVIAY
FT                   SLCYWLGGYEGTLAGLALVPALVVLPAGMMILHRKVMAFSSLKPLWDRAIASHLGKFTL
FT                   MALLTSITLPVAYIMMRNLLAARYSWEDVGIWQGVSSISDAYLQFITASFTVYLLPTLS
FT                   RLESRQEISREIVKALKFVLPAVAAASFSVWLLRDFVIWLLFSDKFTAMRDLFVWQLVG
FT                   DVLKVGAYVFGYLVIAKAALRFYILTEVSQFLLLTGFSHWLIPMNGALGAAQSYMATYI
FT                   VYFILCCSVFIIYRRRA"
FT   regulatory      328424..328483
FT                   /regulatory_class="promoter"
FT   regulatory      328463..328510
FT                   /regulatory_class="terminator"
FT   operon          328522..331659
FT                   /operon="XNC1_operon0072"
FT   CDS_pept        328522..329511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0072"
FT                   /gene="rffT"
FT                   /locus_tag="XNC1_0393"
FT                   /product="TDP-Fuc4NAc:lipid II transferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0393"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88470"
FT                   /db_xref="GOA:D3VHY1"
FT                   /db_xref="InterPro:IPR009993"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHY1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88470.1"
FT                   /translation="MVVSKDHTGLSNYPNLSISVYDSKSALSRSVIEKAQGNRTIRFFF
FT                   HGQFNAALWMALLVGKIKRHQFWWHVWGADLYEESRQLKFRLFYLLRRLAQNRVGHIFA
FT                   TRGDLQHFFQRVCHHSEQSKSNVPSSLLYFPTRMDPTLTVTEKTFSRAGITILLGNSGD
FT                   QSNLHIEALHKIQRQFGREARIIVPMGYPDNNQSYIQRVEQTALSLFPAQNVRILKGKM
FT                   AFGEYLSLLRECDLGYFIFNRQQGIGTLCLLIQCGIPFVLSRQNPFWHDLTEQQIPVLF
FT                   DGDELNKHWVQEAQRQMLSLDKKAIAFFDPNFIEGWKTALSAASGEYQ"
FT   CDS_pept        329423..329608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0072"
FT                   /locus_tag="XNC1_0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0394"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88471"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHY2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88471.1"
FT                   /translation="MIKRRLPFLTPILLRGGKLPYRLHLESINDLGTIQWVTCRLRDLI
FT                   GLHPDFDVSGVSACPL"
FT   CDS_pept        329508..330935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0072"
FT                   /gene="wzyE"
FT                   /locus_tag="XNC1_0395"
FT                   /product="putative ECA polymerization protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0395"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88472"
FT                   /db_xref="GOA:D3VHY3"
FT                   /db_xref="InterPro:IPR010691"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHY3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88472.1"
FT                   /translation="MTLAQFSGLLVVYVISLVFILTLTYQEFRRVRFNFNIFFSLLYLL
FT                   TFYFGFPLTSMLVFKFDVEVVPVDALLHAMLASSCFYAIYYVAYKTRLSYKIRSHSDIE
FT                   SDTPSAAVSRKPLFTMNRVETNLTWLLLAGIAFFTVGSFFMQNGFLLFKLQSYSQIFSS
FT                   QVSGVALKRFFYFFIPAMLVVFFLKPTKIRWVCFLVGTVGFGILTYVIVGGTRANIIIA
FT                   FALFLFIGIVRGWITLWMLFAAGGMGIIGMFWLALKRYSLDVSGAEAFYTFLYLTRDTF
FT                   SPWENLALLLDNYSKIDFQGLAPIIRDFYVFIPSWLWPDRPNLVWNTANYFTWDVLNNH
FT                   SGLAISPTLIGSLVVMGGVFFIPLGAIMVGFIIKWFDWVYEAGKQETNRYKAAILQAFC
FT                   FGAIFNMIVLAREGVDSFVSRVVFFCIVFGLCLIAAKLLYWLFESAGLIRKFVVSNLTA
FT                   SQKAAVILDVRKKNGVE"
FT   CDS_pept        330922..331659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0072"
FT                   /gene="rffM"
FT                   /locus_tag="XNC1_0396"
FT                   /product="putative UDP-N-acetyl-D-mannosaminuronic acid
FT                   transferase, with FMN-linked oxidoreductase domain"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0396"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88473"
FT                   /db_xref="GOA:D3VHY4"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="InterPro:IPR023085"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHY4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88473.1"
FT                   /translation="MGLNNIPKYRIRGLNIWGFRGMSHFLDHLFQGGRVQTGTLVAINA
FT                   EKVLTAEQDNALNMLLNEAEYLYADGISIVRAIRRKYPDADVSRIAGADLWEALMERAG
FT                   REGTPVFLVGGKPAILVQTENKLRTQWNVNIVGSQDGYFTPETRDAVFERIRASGAAII
FT                   TVAMGSPKQEIFMRDCRKVYPDALYMGIGGTYDVFTGHIKRAPKVWQNLGLEWLYRLLS
FT                   QPSRIRRQIKLLRFLGYYYSGKL"
FT   regulatory      331819..331878
FT                   /regulatory_class="promoter"
FT   CDS_pept        332053..333420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yifK"
FT                   /locus_tag="XNC1_0397"
FT                   /product="putative amino-acid transport protein (APC
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0397"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88474"
FT                   /db_xref="GOA:D3VHY5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHY5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88474.1"
FT                   /translation="MSDSKQSLQRGLEARHIELIALGGTIGVGLFMGSASTLKWAGPSV
FT                   LLAYIIAGLFVFFIMRSMGEMLFIEPVTGSFAAFGHKYLSPYWGCLTAWGYWFMWVSVG
FT                   ISEITAIGVYAEFWFPDLPQWVSALAAVGLVALANMAAVRLYGELEFWFAMIKVTTIIV
FT                   MILIGVGLIFFGLGNDWQPIGLDNLTSHGGFFSGGWKGFLFALCIVVASYQGVELVGIT
FT                   AGEAKNPQVTIKKAINNILWRILIFYVGAIFIVVTLFPWTEVGAHGSPFVMTFAKVGIV
FT                   SAAAVINFVVLTAALSGCNSGMYSGGRMLYALAQNRQLPASLLKLSKNGVPVKCIAITI
FT                   GCLIAGSSLNYIIPNPQSVFVYVYSASVLPGMVPWFVILVSQLRFRKHHEEALKQHRFK
FT                   SILFPYVNYLTLIFLCCVLVGMAINPDTRFSLMVGGIFLLLVSSIYWLMKLICRKN"
FT   tRNA            333587..333663
FT                   /gene="ArgCCG"
FT                   /locus_tag="XNC1_tRNA0011"
FT                   /product="tRNA-Arg"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   CDS_pept        complement(333702..333818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0398"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88475"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHY6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88475.1"
FT                   /translation="MANETRTRDDWNHNPGLYQLSYSHHNYYLFRYCFSQRR"
FT   tRNA            333747..333822
FT                   /gene="HisGTG"
FT                   /locus_tag="XNC1_tRNA0012"
FT                   /product="tRNA-His"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   tRNA            333838..333924
FT                   /gene="LeuCAG"
FT                   /locus_tag="XNC1_tRNA0013"
FT                   /product="tRNA-Leu"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   CDS_pept        complement(333871..334167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0399"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88476"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHY7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88476.1"
FT                   /translation="MKGKTFNDTLKLHKEIEEKEKRKQNVLGWQENKKEKAPLFAGLSQ
FT                   NLVGERGFEPPTHWSQTSCATKLRYSPKCLSLISFLWCEGGDLNPHVRKDTNT"
FT   regulatory      complement(333937..334011)
FT                   /locus_tag="XNC1_0399"
FT                   /regulatory_class="terminator"
FT   tRNA            333952..334028
FT                   /gene="ProTGG"
FT                   /locus_tag="XNC1_tRNA0014"
FT                   /product="tRNA-Pro"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   operon          complement(334021..334455)
FT                   /operon="XNC1_operon0073"
FT   CDS_pept        complement(334219..334455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0073"
FT                   /locus_tag="XNC1_0400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0400"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88477"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHY8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88477.1"
FT                   /translation="MSIYTPFNAFNVPIFSFKINSSSPRVNLISVIPISLSLESIQNTV
FT                   SHLRHSTREFKILIKNQSIKCLLFETLKGIVCR"
FT   CDS_pept        334325..334447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0401"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88478"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHY9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88478.1"
FT                   /translation="MFWMLSSESEIGITEIKLTRGEEEFILKEKIGTLNALKGV"
FT   regulatory      complement(334621..334650)
FT                   /regulatory_class="terminator"
FT   regulatory      complement(334664..334723)
FT                   /regulatory_class="promoter"
FT   operon          complement(334766..338878)
FT                   /operon="XNC1_operon0074"
FT   CDS_pept        complement(334766..335971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0074"
FT                   /gene="hemY"
FT                   /locus_tag="XNC1_0402"
FT                   /product="protein in late step of protoheme IX synthesis
FT                   with TPR-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0402"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88479"
FT                   /db_xref="GOA:D3VHZ0"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHZ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88479.1"
FT                   /translation="MLKILLLFIILIVGIILGPVMSGHQGYVLIQTDSNNITTSITAVV
FT                   IMFLLLQFLLIFIGWCYRRLKRTSTSTHSWIFGGFKRNRARSQTRQALLKLAEGDFKQV
FT                   EHLMTRNADHAEYPVVNYLLAAEAAQQRGDYFHTNQYIERAAEVADKDQLPVDISRVRI
FT                   QLAQGEIHAARNGVDKLLNHAPRHPEVLRLAERAYSLSGAYQALIDVLPSMIKAKLYDE
FT                   EKIHAIRQQAYVGLMNQVFAEKGCTGLKAWWKDQGRKIRQDIVLQVVMAEHLIACNDHD
FT                   TAQQIILDGLKQQYDERLLLLIPHLKANDAEAIQKNLTHLLKQHGATPLLNSTMGQVAL
FT                   RHGEWANAEAAFKAALAQRPDAHDYAWLADALDKLQKHEEATQTRSKGFMLTLKRDSNT
FT                   GA"
FT   CDS_pept        complement(335974..337179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0074"
FT                   /gene="hemX"
FT                   /locus_tag="XNC1_0403"
FT                   /product="uroporphyrinogen III methylase"
FT                   /EC_number="2.1.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0403"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88480"
FT                   /db_xref="GOA:D3VHZ1"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHZ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88480.1"
FT                   /translation="MTEQKQSTDAVETKHPQQPEKAPHNPQKNGWVGHTLSIAISLAIG
FT                   MGGFYIYYHSKQQNAVLSTENATLQQQFTSLVQQQSANQQSFDSKLQELETSLQQAKSQ
FT                   NQQLDDRMAALQDRVAAISNTNIENWRLAQASSLVKIAGRKIWSEQDIPTAIALLEDAD
FT                   QNLAEMDDPSLLYARNAIRSDIDTLTKIKQIDLDGIILSLNQLSNQVDHLRLADDVAKN
FT                   TSKADNKREITSSLTDWRENLTTSWHSFMDNFITITPRDGSKEPLLAPNQNIYLRENIR
FT                   AKLLIAAQAAPRHQNKIYKDALDHVGEWAKSYFDTANPDTKAFLDNVNSLAKRPLSIDV
FT                   PEQLSSQPILADLVRKRIYNLPHSAPSQKKSEDNPQNKPEISSQPTTIEESGQAKIAVE
FT                   ES"
FT   CDS_pept        complement(337200..337940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0074"
FT                   /gene="hemD"
FT                   /locus_tag="XNC1_0404"
FT                   /product="uroporphyrinogen III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0404"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88481"
FT                   /db_xref="GOA:D3VHZ2"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHZ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88481.1"
FT                   /translation="MSILITRPAPAGEELVKRLQAVGKTAFSAPLIEIYSGADLPLLSQ
FT                   KMQRLSAGDLVFLLSKNAVHYANGQLIQEGHSWPDKLSYYGIGKSTSLMFHQQTGRKIS
FT                   WSEQGETSEDLLQLPALQQMDNKKVLLLRGNGGREVIASTLRMRGGEVDYCECYSRQPV
FT                   KYHAAEFSRHWQQSGIQTIVVTSGEMLQLLYNLVTDSDGKAWLLGCCLIVVSERLANIA
FT                   RSLGWQVIKVAKSADNDALMQALE"
FT   CDS_pept        complement(337937..338878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0074"
FT                   /gene="hemC"
FT                   /locus_tag="XNC1_0405"
FT                   /product="hydroxymethylbilane synthase (porphobilinogen
FT                   deaminase)"
FT                   /EC_number="2.5.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0405"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88482"
FT                   /db_xref="GOA:D3VHZ3"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHZ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88482.1"
FT                   /translation="MTMKTIRIATRQSPLAMWQAHYVQKQLQHFHPELKVELVPMVTRG
FT                   DIILDTPLAKVGGKGLFVKELELALLEKRADIAVHSMKDVPVEFPNGLGLVTICERDDP
FT                   RDAFVSVKYASLDDLPTGSVVGTSSLRRQCQLRQLRPDLVIRDLRGNVGTRLSKLDNGD
FT                   YDAIILATAGLKRLGLEERIRMPLAPELLLPAVGQGAVGIECRLDDQQTRELLAPLNHA
FT                   RTEICVLAERAMNTRLEGGCQVPIGSYAIWQEDKIWLRALVGAPDGTVSVRGERVVSPE
FT                   EARQAGVALAEELLEKGARQILASVYQRNPPE"
FT   regulatory      complement(339034..339093)
FT                   /regulatory_class="promoter"
FT   regulatory      339340..339399
FT                   /regulatory_class="promoter"
FT   CDS_pept        339587..342109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaA"
FT                   /locus_tag="XNC1_0406"
FT                   /product="adenylate cyclase"
FT                   /EC_number="4.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0406"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88483"
FT                   /db_xref="GOA:D3VHZ4"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="InterPro:IPR024686"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHZ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88483.1"
FT                   /translation="MSAAFKQVYSLIPVLLHHHHPMMPGYIKNNTPHGVCFFAPDESQQ
FT                   FWINDLEGRLSGVLPYAPNGELPITGIYSMGSTSSIGQSCSSDIDIWVCHQSWLDNGEK
FT                   ALLEQKCTLIGQWAASLGIEATFFLIDENRFRHNASGSLNGEDCGSTQHILLLDEFYRT
FT                   AVCMAGKRLLWTMVPVEEEAHYDEYVLSLYAQGVLTPNEWLDLGGLGQLSAEEYFGASL
FT                   WQLYKSVDSPYKAVLKSLLLEAYSWEYPNGKLLAMEMKQHLHDGAIVSFGLDAYSMMLE
FT                   RVTRYLTATNDLTRLDLARRCFYLKVCEKWSASHHDAGCTGWRRQVISQLVNEWGWDDS
FT                   KLTMLNNRNAWKIEQVREAHNELLDTMMQSYRNLIRFARRNHLSVSASPQDIGVLTRKL
FT                   YAAFEALPGKVTLVNPQISPDLSEQDLTFIYVPPGRVNRSGWYLYNHTPTIEAIIGHQP
FT                   LEYNRYLNKLVSWTYFNGLLTKETRIHIHNGNSPCNKHKLCDLVNDIATHFPIRLPAPT
FT                   PKALYSPCEIRHLAIIVNLEQDPTVEFSNRVIHFDFRNMNVFSFGESQQCLVGSIDLLY
FT                   RNSWNEVRTLHFSGEQSVLEALKTILGKMHRDAAPPAGVEVFCYSRHLRGLICTRIQQL
FT                   VSECIELRLSSNRQDPNRFKALRISGQTWGLFFERLNVSVQKLENAVEFYGAISNTKLH
FT                   GLPVKIDTKEKHLPPVIDGFACEGIIQFFFENIEKNQGFNIYILDESNRVEIYSHCEGS
FT                   KEELVRDISRFYSSSHDRFTYGSSFINFNLPQFYQIIQKGERTHVVPFVDGTFPSDDME
FT                   ANETRLNIDSCLEEACRPHDPYRSLYHY"
FT   CDS_pept        complement(342187..342507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0407"
FT                   /product="Protein cyaY"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0407"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88484"
FT                   /db_xref="GOA:D3VHZ5"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHZ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88484.1"
FT                   /translation="MNDSEFHQLADQLMLHLEEQLDNYDGDADIDCETNGGVMTLSFEN
FT                   GSKIIINRQEPFHQIWLATKNGGYHFDYRDNQWMCDRSGNDLISILAQAITEQSGESFQ
FT                   FS"
FT   regulatory      342451..342510
FT                   /regulatory_class="promoter"
FT   regulatory      complement(342537..342596)
FT                   /regulatory_class="promoter"
FT   operon          342564..343623
FT                   /operon="XNC1_operon0075"
FT   CDS_pept        342564..342764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0075"
FT                   /locus_tag="XNC1_0408"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0408"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88485"
FT                   /db_xref="InterPro:IPR032831"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHZ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88485.1"
FT                   /translation="MNHRHYSMIMKKQLRWSLAIITLLSLAGCGLKGPLYFPPAETPSP
FT                   AKKVDTAQPADAKQPIVGAQQ"
FT   CDS_pept        342781..343623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0075"
FT                   /gene="dapF"
FT                   /locus_tag="XNC1_0409"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0409"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88486"
FT                   /db_xref="GOA:D3VHZ7"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHZ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88486.1"
FT                   /translation="MILGSYMQFSKMHGLGNDFMVVDAVTQNVYFSPELICRLADRNTG
FT                   IGFDQLLVVEAPYDPDLDFHYRIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDIKVS
FT                   TRSGQMVLSVTNDDQIRVNMGEPDFEPQRVPFRANKAEKTYIIRAVERTVLCGVVAMGN
FT                   PHCVIQVEDVNTADVEVLGPALENHERFPERVNVGFMQIMNRGHIRLRVFERGAGETRA
FT                   CGSGACAAVAVGIQQDLLDNQVSVDLPGGSLQIRWDGPGKPLFMTGPATHVYDGMIHL"
FT   operon          343777..348224
FT                   /operon="XNC1_operon0076"
FT   CDS_pept        343777..344376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0076"
FT                   /locus_tag="XNC1_0410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0410"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88487"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHZ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88487.1"
FT                   /translation="MVERIRVPHPVRESTSLMEWHMNRQRKRICYLEDDLICLVEQAKQ
FT                   NEVLFSHLLQLLSDLSGAKSLQDFLSRLSSWSKTLGLSNSYIRLFSDTWRLGAPMNSPE
FT                   LSLSRYSFEPVRIKRFGDSNHYLGSLHGPEILLLMPQARHVGSVAISLLGTQGNLGMVI
FT                   FNSHDKQHYHDGMGTDLLDQLAKLLPGLLSRWIERA"
FT   CDS_pept        344373..345287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0076"
FT                   /gene="xerC"
FT                   /locus_tag="XNC1_0411"
FT                   /product="site-specific tyrosine recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0411"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88488"
FT                   /db_xref="GOA:D3VHZ9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHZ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88488.1"
FT                   /translation="MTQPMDLLLAPVEAFLRYLRVERRLSPLTITHYRHHLTVLAEISL
FT                   KIGISEWQALDPVNVRLFVSRSRRAGLESASIALRLSALRSFLDWMVMQGKLAANPAKM
FT                   VSAPRKKRHLPKNMDVDEVNQLLNINLNDPLSVRDRTMLEVMYGAGLRLSELVGLNWRD
FT                   VDLDSGDVWVRGKGSKERKVPFGRMAQEWLQRWLEMRELFEPENDAVFISSKSGKRISA
FT                   RNVQKRFEQWGIRQGVNSHINPHKLRHSFATHILESSGDLRAVQELLGHANLSTTQIYT
FT                   HLDFQHLTKVYDVAHPRAKRGKS"
FT   CDS_pept        345287..346003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0076"
FT                   /gene="yigB"
FT                   /locus_tag="XNC1_0412"
FT                   /product="putative enzyme with a phosphatase-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0412"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88489"
FT                   /db_xref="GOA:D3VI00"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI00"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88489.1"
FT                   /translation="MRFYRPLAPFAAMTFDLDDTLYDNHPVIDKTEKEVLCFIRQYNTK
FT                   FRYFERKDLHLYRQAVLEQAPDIYHDITLWRQQSVELMFRHHGFNHEETICGTDEIMAC
FT                   FMYWRNQIIVPESTHDTLSTLAKKIPLVAITNGNAEPAACGLSPYFTFVLKAGVNGRSK
FT                   PCPDMYYLAAERLNLPINQILHVGDSLKTDVEGALCSGMQACWINLENKNLMQESEGRL
FT                   VPHVEISDLASLIALI"
FT   CDS_pept        346059..348224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0076"
FT                   /gene="uvrD"
FT                   /locus_tag="XNC1_0413"
FT                   /product="DNA-dependent ATPase I and helicase II"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0413"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88490"
FT                   /db_xref="GOA:D3VI01"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005753"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI01"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88490.1"
FT                   /translation="MDISYLLESLNDKQREAVAAPRTNMLVLAGAGSGKTRVLVHRIAW
FT                   LLSVENASPFSIMAVTFTNKAAAEMRHRIENLIGTSQGGMWIGTFHSLAHRLLRAHHLD
FT                   ANLPQDFQILDSEDQHRLIKRIIKAMNLDDKQWPARQGMWYINGKKDEGLRPQHIESYG
FT                   NPVEATWLKIYQAYQEACDRAGLVDFAELLLRAHELWLNKPQILQHYRERFTNILVDEF
FT                   QDTNSIQYAWIHLLAGESGKVMIVGDDDQSIYGWRGAQVENIQRFLNDFPGAETIRLEQ
FT                   NYRSTSNILKAANVLIAHNSDRLGKNLWTEGGEGEPISLYCAFNELDESRYVVGRIKHW
FT                   LDNGGALKECAILYRSNAQSRVLEEALLQASMPYRIYGGQRFFERQEIKDALSYLRLVS
FT                   NRQDDAAFERVVNTPTRGIGDRTLDVVRQAARDQQKTLWESSQLLIQEKVLAGRAASAL
FT                   QRFIELINALESETQDMPLHVQADRIVRDSGLWAMYQQEKGEKAQARIENLEELVTATR
FT                   QFSYTDEDENLLPLQAFLSHAALESGESQADAYQDAVQLMTLHSAKGLEFPQVFIVGME
FT                   EGMFPSQMSIEEGDRLEEERRLAYVGVTRAMEKLTLTYAESRRLYGKEVYHRPSRFIGE
FT                   LPTECVAEIRLRATVSRPVNHKQLGTPISANDSGYALGQRVRHPKFGEGTIINIEGEKE
FT                   HCRLQIAFQGEGIKWLVAAYARLETGQ"
FT   CDS_pept        complement(348150..348314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0414"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0414"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88491"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI02"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88491.1"
FT                   /translation="MYHKSPETPYVYRKARMLRLEEKACQHSTGLLASFKSGIGGYQPF
FT                   DAFPLKRDL"
FT   regulatory      348228..348287
FT                   /regulatory_class="promoter"
FT   CDS_pept        348313..349263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="corA"
FT                   /locus_tag="XNC1_0415"
FT                   /product="Mg2+/Ni2+/Co2+ transport protein (Mg transport
FT                   system I) (MIT family)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0415"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88492"
FT                   /db_xref="GOA:D3VI03"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI03"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88492.1"
FT                   /translation="MLNAFKLENNRLLRLELEEGDKLSDSMWVDLVGLGDNDRLQVQNE
FT                   LGQVLATRTELDDIEASARFFEDEDGMHVHSFFYFEDAEDHAGNSTVAFTIRDSRLYTL
FT                   RERELPAFRLYRMRARNQTMVDGNAYELLLDLFETKIEQLADVIENIYSVLESLSRVIM
FT                   EGKQGDEFDSALSNLAEQEDIGWKVRLCLMDSQRALNFLVRRARLPANQLEQAREILRD
FT                   IESLLPHNESLFQKVNFLMQAAMGFINIEQSRIIKIFSVVSVVFLPPTLVASSYGMNFE
FT                   FMPELHWTFGYPGAIGLMIAAGLAPYLYFKRKNWL"
FT   regulatory      complement(348541..348600)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(349236..349328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0416"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88493"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI04"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88493.1"
FT                   /translation="MTEINWDNQQSYGLKSMQSVDFYSQFFRLK"
FT   regulatory      349268..349310
FT                   /regulatory_class="terminator"
FT   regulatory      349324..349383
FT                   /regulatory_class="promoter"
FT   operon          349526..350175
FT                   /operon="XNC1_operon0077"
FT   CDS_pept        349526..349753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0077"
FT                   /locus_tag="XNC1_0417"
FT                   /product="Virulence-associated protein vagC"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0417"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88494"
FT                   /db_xref="GOA:D3VI05"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI05"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88494.1"
FT                   /translation="MRTVAIFKNGNNRAIRLPKDLDFEGVNELEIIREGEAIILRPIKP
FT                   SWDSFLYEDKADADFLSERPDIVEEGRVNL"
FT   CDS_pept        349750..350175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0077"
FT                   /locus_tag="XNC1_0418"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0418"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88495"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI06"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88495.1"
FT                   /translation="MKTVYMLDTNICSFIMREQPVAVIKQLQRCVMNNHLIVVSAITYA
FT                   EMRFGAVGKKASPKHIVLVDEFCRRLDKILPWDKSAVDATTKTKIALAAAGTPIGHNDA
FT                   AIAGHALSVGATLITNNSREFSRVTGLSLEDWANGLI"
FT   CDS_pept        complement(350310..351200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rarD"
FT                   /locus_tag="XNC1_0419"
FT                   /product="chloramphenicol resistance"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0419"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88496"
FT                   /db_xref="GOA:D3VI07"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI07"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88496.1"
FT                   /translation="MNNQQTAKGILYALGAYLIWGLAPIYFKSIQYVPPDEIVSHRVIW
FT                   SVFFMVLMLTVTRHWRQVWAIVHRPKTLLLLGFTAFTITSNWLTYIWAINNNHLLEASL
FT                   GYFINPLVSVLFGMLFLGERFRRMQWVAVVLACIGVLIQVVQFGSVPVIALYLATTFAV
FT                   YGLIRKKLGVDAQTGMLIETVWVFPVALSYLLFFTNSPTSNMLENTYSLNLMLIAAGII
FT                   TTVPLLFFTAAAAHLRLSTLGFFQYLGPTLMFLLATLVYGEEIGPDRLITFGFIWAALI
FT                   LFTLDALYTQRRLRK"
FT   regulatory      complement(351346..351405)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(351695..352180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0420"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0420"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88497"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI08"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88497.1"
FT                   /translation="MENMLQADKILTLEEAQQFLNEIFIYQMPFNQLLGLELLRFEQDY
FT                   AELQFRKQEKLIGNIAQKILHGGAIASILDVAGGLICAHRALVTLEMLTIPEMQKRLST
FT                   LGTIDLRVDYLRPGRGEVFTASSNIIRAGNKVSVARIELHNEQQVHIASATGTYLVG"
FT   regulatory      352101..352160
FT                   /regulatory_class="promoter"
FT   regulatory      complement(352323..352382)
FT                   /regulatory_class="promoter"
FT   CDS_pept        352390..352587
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0421"
FT                   /product="Outer membrane phospholipase A1 (fragment)"
FT                   /EC_number="3.1.1.32"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ88498.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        352517..352795
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0422"
FT                   /product="Outer membrane phospholipase A1 (fragment)"
FT                   /EC_number="3.1.1.32"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ88499.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   regulatory      352717..352763
FT                   /locus_tag="XNC1_0422"
FT                   /regulatory_class="terminator"
FT   regulatory      352775..352834
FT                   /regulatory_class="promoter"
FT   CDS_pept        352864..353100
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0423"
FT                   /product="outer membrane phospholipase A1 (fragment)"
FT                   /EC_number="3.1.1.32"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ88500.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   regulatory      353126..353185
FT                   /regulatory_class="promoter"
FT   regulatory      353144..353180
FT                   /regulatory_class="terminator"
FT   operon          353229..356967
FT                   /operon="XNC1_operon0078"
FT   CDS_pept        353229..355055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0078"
FT                   /gene="recQ"
FT                   /locus_tag="XNC1_0424"
FT                   /product="ATP-dependent DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0424"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88501"
FT                   /db_xref="GOA:D3VI12"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI12"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88501.1"
FT                   /translation="MSTAELISTASLAEQTLRKTFGYQQFRPGQQQVIDAVLDGLDCLV
FT                   VMPTGGGKSLCYQIPALVKDGLTLVVSPLISLMKDQVDQLRANGVEAECLNSTQSREQQ
FT                   FDIIQRCRQGSIKLLYIAPERLVTDNFLEQLHDWRPVVLAVDEAHCISQWGHDFRPEYR
FT                   ALGQLRRRFPNLPVIALTATADNTTRQDIVRLLELHEPIIHLSSFDRPNIRYTLVEKYK
FT                   PLDQLWSFVRAQQGKSGIIYCNSRTKVEETAERLQKRGLSVAPYHAGLENDQRAWVQDA
FT                   FQRDDLQIVVATVAFGMGINKPNVRFVVHFNIPRNIESYYQETGRAGRDGLPAEAVLFY
FT                   DPADMVWLRRCLEEKPAGEQQDIERHKLNAMGAFAEAQTCRRLVLLNYFGESRQKDCGN
FT                   CDICLDPPKRYDGLVDAQKALSCIYRVGQRFGIGYIVEVLRGANNQRIRDFGHDKLPVY
FT                   GIGKAQSQEHWMSVLRQLIHLGFISQNIANYSALQLTEASRPILKGEVSLQLAVPRIQS
FT                   LKSRNQQHKSYSGNYDRKLFAKLRKLRKSIADENNIPPFVVFNDVTLIEMAEQYPVTPN
FT                   ELLLINGVGQRKLERFGDAFMALIRDHFEGFE"
FT   CDS_pept        355100..356098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0078"
FT                   /gene="pldB"
FT                   /locus_tag="XNC1_0425"
FT                   /product="lysophospholipase L(2)"
FT                   /EC_number="3.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0425"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88502"
FT                   /db_xref="GOA:D3VI13"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI13"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88502.1"
FT                   /translation="MAPERLKASWLNREPQFSAFTNGLLLDFWQTREERQFTGVDDVPI
FT                   HYVSFCAPHHDKTLVILPGRSESYVKYPEVAYDFYHLGYDIFIIDHRGQGRSGRMLDDR
FT                   QKGHVEVFDHYVDDFAKFVELEVSPRLPHRCYALAHSMGGAILSRFLLRHQESVFRAVV
FT                   LCAPMFGINLPIPRWLANFLVNQAEPNVKRRNAYALSTGHWQPLPYLINILTHSYARYQ
FT                   RYLRYYADYPELRLGGPTYHWIRESMLTGDCLIENADKIQTPLIVLQASEDKVVNNREL
FT                   LAFCGSRQKAGTGKKEQKPLVIQGAHHEILFEKDILRAKALNAICDFFDKN"
FT   CDS_pept        356167..356967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0078"
FT                   /locus_tag="XNC1_0426"
FT                   /product="putative hydrolase, contains phosphatase-like
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0426"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88503"
FT                   /db_xref="GOA:D3VI14"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI14"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88503.1"
FT                   /translation="MYHVVASDLDGTLLSPDHKLTPYTKETLNLLITQGVHFIFATGRH
FT                   HVDVGQIRDGLGIDAYMITSNGARVHNTQNELVFSHNLDPEIAHDLCLLEFDNPEVLTN
FT                   YFNNDDWLMNREAPEQAEFFQESVFHYQLFRRDNFSTDGVCKVYYTSDDHDYLVDLEGR
FT                   IKARWGEKVNVSFSLRNCLEVMSGGVSKGHALEQVCQFLGYQLNDCIAFGDGMNDREML
FT                   SVAGKGCIMQGAHQRLKDILPEMEVIGSNGDDAVSRYLRGMYRV"
FT   regulatory      356988..357040
FT                   /regulatory_class="terminator"
FT   regulatory      357342..357401
FT                   /regulatory_class="promoter"
FT   operon          357490..359973
FT                   /operon="XNC1_operon0079"
FT   CDS_pept        357490..358887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0079"
FT                   /gene="ydfJ"
FT                   /locus_tag="XNC1_0427"
FT                   /product="putative transport protein (MFS family)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0427"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88504"
FT                   /db_xref="GOA:D3VI15"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI15"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88504.1"
FT                   /translation="MPYKNTALAVAQRQHASEAYLTTKEGRKGFWRAIFSCWLGTTIEY
FT                   ADFALYGLAAGIIFGDVFFPEMTPAVALFASFATYSVGFIARPIGALVFGWLGDRKGRK
FT                   IVMIMTVILMSVSTTLIGLIPSYAHIGAWAPACLVMLRFIQGLGAGAALSGGTVILGEF
FT                   APPARRGLVSSAIALGSNSGTLLASLVWLLVLTMDKESLLDWGWRIPFLSSAIIAIVAL
FT                   YIRRYMSETPVFERYKEMLAEQRLQALTENEKRHTDDERRSFWQRTKAFWIMMGLRIGE
FT                   NGPSYLAQGFMIGYVANVLMLDKFTPTIAVFIASILGFLIIPLAGYLSDRFGRRIIYRW
FT                   FCLLLILYAFPAFILLDSREPMIVIPTIVIGMGLASLGIFGAQAAWGVELFGVANRYTK
FT                   MALAKELGAVLSGGTAPLIASALFSFAGHWWPIACYFALMASIGFITTFFAPETRGRDL
FT                   NLLEDAI"
FT   CDS_pept        358966..359973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0079"
FT                   /locus_tag="XNC1_0428"
FT                   /product="putative transcriptional repressor for ribose
FT                   metabolism (GalR/LacI family)"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0428"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88505"
FT                   /db_xref="GOA:D3VI16"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI16"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88505.1"
FT                   /translation="MNSRLKRVTRSDVAKEAGISVAVVSYVINGGPRPVAETTRQRVLA
FT                   AIQKTGYRPNSIAKALVSGTTNAYGLILPNIANPFLSSVAHALQQEAFKHGQVLLPGDS
FT                   GDNRTRERELINNLLNRQIDGLLYTSVDRHPYIDLIRASGTPCVMLDWVNAGSNVSAIR
FT                   VNERIAAFKVTQHLIQHGNRDIAIICGPLDMLNTQDRLSGWRDALMQANLTAHDEWVFS
FT                   TEYTRQGGYEATLQMLKGKRPRALFATNELQAFGCLRALAENGIAVPDDIALVCFNATQ
FT                   QSQFNVPSLTAVRQPIDKMAQTAIEILRTWNGHAQEREFEFELQIGESCGCNLR"
FT   regulatory      359993..360056
FT                   /regulatory_class="terminator"
FT   regulatory      360326..360385
FT                   /regulatory_class="promoter"
FT   CDS_pept        360423..360689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0429"
FT                   /product="putative membrane protein (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0429"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88506"
FT                   /db_xref="GOA:D3VI17"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI17"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88506.1"
FT                   /translation="MFYLFNLIASVALIILGSIVDENAGIALLAVYSIVTLIPNLAVTV
FT                   RRLHDTNHSGWWLLISIIPFASIVLLVFYCTEGTTGEDPKKVA"
FT   regulatory      360734..360771
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(360977..361156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0430"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88507"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI18"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88507.1"
FT                   /translation="MHTHKQMTPGLVQFDNVSYIDKEKINFGAIRQGKIEMFKRFLAAK
FT                   KTAERKGKIMVKPL"
FT   regulatory      complement(361207..361266)
FT                   /regulatory_class="promoter"
FT   operon          complement(361276..367938)
FT                   /operon="XNC1_operon0080"
FT   CDS_pept        complement(361276..362481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0080"
FT                   /locus_tag="XNC1_0431"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0431"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88508"
FT                   /db_xref="GOA:D3VI19"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI19"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88508.1"
FT                   /translation="MTRRIPFQVSGLLALNGVSILGNAITEIAIPWLILEISGSPLLVA
FT                   TVMSAKILPLILSIFFSAQWVDKYGAFRISLLSDAVNFLSVLLIPVFYTMDILHFYLLA
FT                   VLLIFSTILDSSGRLAKDVMLAKEIKRNKSEHELINGINSTIENICDLIGPVIGSLIIA
FT                   LLGTINALYFDAISFLIVTLGIIILKKHFVANINEVVETPFRPRHYFLEALRYIRSEKE
FT                   LFSVLMISSIVNFVLSPFLIVYLPYVNKQEFNSILSLGISMTCFGVGTTFSSLLYGAYG
FT                   KYFSSHRIILSGYSLLALFLLSLNLFSGQYALYAQLFAIGLCIGFSAPVEITLIQRQVP
FT                   ENLFGRIMTFFSSTRFLSVPVGYLCFGALLESRLAGLTPLIMAAVVLGGLASYWFVQRT
FT                   SK"
FT   CDS_pept        complement(362494..365838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0080"
FT                   /gene="yjeP"
FT                   /locus_tag="XNC1_0432"
FT                   /product="putative periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0432"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88509"
FT                   /db_xref="GOA:D3VI20"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI20"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88509.1"
FT                   /translation="MRLIISLLLSLLIANPALAAITPLDEIQLKPELKQVSGNKSPKDA
FT                   EIAQVLQGAESWANDTKATNQRIQKYQQAIDDFPAIIKELRQKILAESDAVPPIPANQS
FT                   TSSLEQQIIQISSQLLDQGHQLQQEQDKTREISDSMNQLPQQQVEAKRLLAEATSRLQT
FT                   LGSPGTPLAEAQLTLAQAEVSARKAVTNELEMAQLSANNRQEIARIRTDLFKKRYQRLD
FT                   LKLQQLRSRLSIQRQQKAESALEHTEMLAEQSGGKLPQFLLDELQQNRQLSQMLSQQTQ
FT                   SMDVIGSQQRKAANDILQVRQTLNTIREQAQWLKDSTALGEALRAQVTRIPDMPKSQQL
FT                   DRNIVELRVERLKYEEMLERSQRDTDQASSSYNALTPAQKQVYQSLIRTRKELLSSLLS
FT                   GYDNEILELTKLKVATSQLNDTLKEVQDTAHRYLFWVADVNPISLHYPLLVVQDLTRLL
FT                   SLDTFSQLGGAIHSMLTTQDTLLYLVGTLLLVIFSISSHRQYHAFLERSSNRIGKVTQD
FT                   HFTLTLRTVFWAIVAALPLPMLWSAIGYGLQNAWQYPMANAIGNGVRETTPVLWIFMLS
FT                   AAFAHPNGLFIAHFRWPEERIKRAMSFYRLSIFLIVPLMMALITFDHYSDREFTATLGR
FT                   LCFIVLCVFLSLVTSSLKRAGIPLYMDKQGAGENLINTVLWWILLSAPILAVLAAILGY
FT                   LQTSQALLGRLETSVAIWFFLLVIYHIVRRWMLIQRRKIAFERAKQRRAEILAQRAKSE
FT                   EDTSNINSSVEGAIEVEEPVIDLDAISAQSLGLVRSILTMIALVSLILLWSELHSAFSF
FT                   LENIRLWDVSTTINGVDTVQPITMGSVLIAILIIVITTQLVRNLPALLELALLQHLELT
FT                   PGTGYAITTLTKYSITLIGGLVGFSLIGLEWSKLQWLIAAMGVGLGFGLQEIFTNIISG
FT                   LIILFEKPIRIGDTVTIRGLTGSITKINTRATTLSDWDRKEIIVPNKAFITEQFINWSL
FT                   SDTITRIVLTIPVPVGTESAKATDILMAAAKSSPLILDNPMPEAYLVDLQQGIQIYELR
FT                   AYAAEMGHRMPARHEVHQHILQEFHKHDITLPFPPFQARVDIFGQEIRSATTNISGRNP
FT                   PRKPGEL"
FT   CDS_pept        complement(365865..366833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0080"
FT                   /gene="psd"
FT                   /locus_tag="XNC1_0433"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0433"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88510"
FT                   /db_xref="GOA:D3VI21"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI21"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88510.1"
FT                   /translation="MVGFCPICQEKIQEVDVLDNIKIRLQYLLPKQCITHLAGWFANKK
FT                   AGWLTQLAIKTFAKAYKVDMNEAKNPSFTAYSTFNEFFVRPLKEDIRPIVNEANQLALP
FT                   ADGAVSQLGAIREDQIIQAKGHYYTVEALLAGQHQLAEQFRDGQFVTIYLSPKDYHCVH
FT                   MPCDGVLKEMIYVPGDLFSVNPLTAANVPNLFARNERVICLFDTAFGLMVQILVGATIV
FT                   GSIETVWSGCVTPPREGIIKRWTYPAEGEEGAVSLKKGEEMGRFKLGSTVISLFAPNQI
FT                   NFANNLYSGSQTRMGGLMAQSVMPEEPAVNADESLNQDIVS"
FT   CDS_pept        complement(366880..367938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0080"
FT                   /gene="yjeQ"
FT                   /locus_tag="XNC1_0434"
FT                   /product="putative enzyme with 2 nucleoside triP hydrolase
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0434"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88511"
FT                   /db_xref="GOA:D3VI22"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI22"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88511.1"
FT                   /translation="MAKSKLSKGQQRRVQANHQRRLNKAESKKPEMDDSQLGEPQEGRV
FT                   ISRFGQHADIEATDSSIQRCNIRRTIRSLVTGDRVVWRPALQRQSDVKVNGIVEAVHER
FT                   TSVLTRPDYYDGIKPIASNINQIVIVSAILPELSLNIIDRYLVACETLNIEPLIVLNKI
FT                   DLLDAESREWVNGVMDIYRDIGYRVLEVSSQTGEGIPELISQLADKISIFAGQSGVGKS
FT                   SLLNTLLPDDEEDILVNEVSDNSGLGQHTTTASRLYHFPLGGDVIDSPGVREFGLWHLT
FT                   PEQVTQGFVEFRKYLGGCKFRDCKHQDDPGCALREALEQGDITEERFENYHRILESMAQ
FT                   VKPRRNFTDGQK"
FT   regulatory      367912..367971
FT                   /regulatory_class="promoter"
FT   regulatory      complement(367992..368051)
FT                   /regulatory_class="promoter"
FT   CDS_pept        368050..368595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orn"
FT                   /locus_tag="XNC1_0435"
FT                   /product="oligoribonuclease"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0435"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88512"
FT                   /db_xref="GOA:D3VI23"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI23"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88512.1"
FT                   /translation="MSKSENNLIWIDLEMTGLDPERDRIIEIATIVTDSELNILAEGPV
FT                   IAVHQSDEQLALMDDWNIRTHTGSGLVERVKQSQCDDAQAEKATIAFLEQWVPAGKSPI
FT                   CGNSVGQDRRFLFRYMPELEKYFHYRYLDVSTLKELARRWKPELLSEFSKKNTHQALDD
FT                   IRESIAELVYYREHFIQK"
FT   CDS_pept        complement(368681..368821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0436"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88513"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI24"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88513.1"
FT                   /translation="MLYQLSYSRLHFGTRTVEIIHRYGVRIIREIILVASPCRQKIVFF
FT                   L"
FT   tRNA            368795..368870
FT                   /gene="GlyGCC"
FT                   /locus_tag="XNC1_tRNA0015"
FT                   /product="tRNA-Gly"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   regulatory      368820..368889
FT                   /regulatory_class="terminator"
FT   tRNA            368978..369053
FT                   /gene="GlyGCC"
FT                   /locus_tag="XNC1_tRNA0016"
FT                   /product="tRNA-Gly"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   regulatory      complement(369088..369113)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(369191..372571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0438"
FT                   /product="putative oxyreductase protein"
FT                   /EC_number="1.2.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0438"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88514"
FT                   /db_xref="GOA:D3VI25"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI25"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88514.1"
FT                   /translation="MARYYHSKFVTGTEALVDLLLAQAELDEIYNLNTAGFVSGYRGSP
FT                   LARLDQILWQRSKELIQANIRFQPAINEDLAANALIGTQKVESDPDRQVSGVFGMWYGK
FT                   GPGVDRSGDALRHGNAYGSSPHGGVLVILGDDHGCVSSSLSHQSDLSLMSWSMPVLHPA
FT                   STADYLDVGLWGWAASRVSGAWIGFKAISETVESGAVRENKPFPDYKIPHVDPGPDGLH
FT                   WRWPDLPGPQLEKRLCYKLKAVEDFAGLNPIDCLLSPCKHPQALLVSVGKAHQDVMEVL
FT                   RVGGLTPADLAQQGVALLHVRLVYPLSPLLTELAAQATHIFVIEEKAAVVEILLAHHLV
FT                   KVQKNVRLIGKHNHLGQKLLPADLELRPSRIATPLAEWLQQFNLSLPVPLEWSTSVIPY
FT                   DATLPKRTPYFCAGCPHSTSTKLPEGSHAQIGIGCHIMAAWMDRNTGSGLLPMGGEGID
FT                   WIGHAPFVNRSHVFQNIGDGTYFHSGHLAIRQSVAAGSHITYKLLFNDAVAMTGGQPLD
FT                   GNISIPQIASLMLAEGVKEVAVVTDDLDKYKGKIRLPANVKLYGRDYLEDVQMRFREIV
FT                   GVTVVIYDQACATELRRKRKRGLLPKATHRAIINESVCEGCGDCQIQSNCLAVTPVKTP
FT                   LGTKRRIDQHICNSDLSCLKGFCPSFITVENANPRSDFSKVMSQADLDNIISELPLPTL
FT                   APMETPYEILLVGIGGTGIVTAGHLLANAAQLDNCAVSLLNFTGFAQKGGAAITHVRLC
FT                   HDANKLHQVRIDRGRANLVIAADLVAATGKNSLEVMSRGSTKCLLNTHETQIGAMLRAP
FT                   MLDLDQPNMLNILNQHIQKLRSIDAEMMAAHLVGDRDQINIILIGYAWQLGKLPITLSS
FT                   IDKTIQELGHSADNARRAFHIGRIAAEQPEILLKHLDIDPQETLESLDDLIMNRYQLLV
FT                   DYQNERYAMRYLSRIAQVQMAAQQIDAEELTKSVAKNLFKLMAYKDEYEVARLYVKTDF
FT                   LAKLRSQFDNVDNIRFHLSFPLFNRKNPRTGQRAKREYGSWIIPLFHFLAACKPLRGTV
FT                   FDIFGYQEERKQERNILLEYEQIVDFMINKLDRNNLAICQQLAVLPDQVRGFGHVKQKT
FT                   IENMMERKKNLLKELKKAM"
FT   regulatory      complement(372649..372708)
FT                   /regulatory_class="promoter"
FT   tRNA            372981..373056
FT                   /gene="GlyGCC"
FT                   /locus_tag="XNC1_tRNA0017"
FT                   /product="tRNA-Gly"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   CDS_pept        complement(373314..374216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0441"
FT                   /product="putative transcriptional regulator (LysR family)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0441"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88515"
FT                   /db_xref="GOA:D3VI26"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI26"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88515.1"
FT                   /translation="MNHDLTLWHLFFRIVERGSLIKAAKDLHLDPSVASRRLAALEHQL
FT                   KAQLINRSTRKLSLTAAGTVAYEQMRPLLDEIDGVLSDINNKSLVGKIKITAPVNFGEH
FT                   YVTQWLTLFQLQNPDITFDLVLSDQCLDLRQEGIDLAIRIGELPASTLIAKKLGNMSGV
FT                   LCASPEYLLKHGTPKHPQDLNYHKSVIYSLRQNTSPTRLQLSRDRVVEHVELSGSFYLN
FT                   NVGAIYQAVCHGVGIHAGPAWLFNEAILNKKLVRLLPDWQLPTLPIHLLRMKNHYVPSQ
FT                   ISALIDWIVLCWKESEKLE"
FT   regulatory      374228..374287
FT                   /regulatory_class="promoter"
FT   regulatory      complement(374246..374305)
FT                   /regulatory_class="promoter"
FT   operon          374342..380741
FT                   /operon="XNC1_operon0081"
FT   CDS_pept        374342..375847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0081"
FT                   /locus_tag="XNC1_0442"
FT                   /product="Major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0442"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88516"
FT                   /db_xref="GOA:D3VI27"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI27"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88516.1"
FT                   /translation="MQMKKSLSRYWVLVAVCMAGLILPLEYTGPAVALPAIQNELGGSG
FT                   IALSWVINAFALSFGSAVMAAGALADQYGRKKMFVIGIAGFTLFSVIVSVAGNVVFLDL
FT                   VRGLQGFFAALTMAGGNASLAQEFDGRARTKAFGLLGTAFGAGLAFGPVISGVLVETLG
FT                   WRSVFLLGAVFGGIALIIGGIHMRDSRDPDAAKLDIKGLTSFTSFLVLLTFGIMQIPQS
FT                   GIGSLTVILLLSAAVMMLAIFIACELTHARPMLDISLFRYKKFVGVQFLPLATAVCFIV
FT                   LLILLPIRLIGIEGYSAIQAGEMMLALSAPMLFVPFLAALLTRWVSSPILSCMGLLCAA
FT                   IGLAWLANMPVGTEPTTLMLPLLLIGIGTGFPWGLMDDLSIRVVPIERAGMATGIFTTM
FT                   RACGEAICVAGALAMLNFLLHLNLRQVSQQSPDVISTAANNMTTGNFEGAKGVLASLSG
FT                   QDFMTIYSGAFSILTYTLMGITLFAAAVSFFTLRNDRIVSYSN"
FT   CDS_pept        375897..376601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0081"
FT                   /locus_tag="XNC1_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0443"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88517"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI28"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88517.1"
FT                   /translation="MNTNSNLSLEKLSFTLKLIPISEILLSDEFYSGTWKTVAQWCVDY
FT                   LCNPHPELGRSGVVCPHSQVSMKKETFWITEIKTKGRTEKEIKEDIVSLAHLFYEQEPR
FT                   NGNEVQFKTIVSVWDDLYPEEYISNLHSEMKPIFLRMGLMLGEFFSSCEKTGLRNPIFY
FT                   PLCSPVPLLVVRDMLEFDIAFLSDSEEYVSEYINKYGERGVLAINNVLNNNKKIHLSDK
FT                   QVSILKSYLMHK"
FT   CDS_pept        376643..378046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0081"
FT                   /gene="tnaA"
FT                   /locus_tag="XNC1_0444"
FT                   /product="tryptophan deaminase, PLP-dependent"
FT                   /EC_number="4.1.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0444"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88518"
FT                   /db_xref="GOA:D3VI29"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR011166"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI29"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88518.1"
FT                   /translation="MSSSFPEPWRIKMVEPIKMTTRAQRVNRLIEAGLNPFILKSEDVF
FT                   IDLLTDSGTGAMSDRQWAGMFLGDESYAGSKSYYQLSQTVEDLFGFQYTIPVHQGRGAE
FT                   QILFPLLVELAKEKGASEPVFLSNHHFDTTKAHIELSGARANNLICASSLQTEIADDWK
FT                   GNFDLEQLSNEINNNQKNIVAIIITITCNSVGGQPVSMENIRSAAQMARDSGIPVIIDA
FT                   ARFSENAYFIKKRESAFFHKSISTIVKEMFNEADIFTMSAKKDGMVNIGGLCCFRNNES
FT                   LFRQVQLRCVLMEGFVTYGGLAGRDMSAMAIGLREALDENHLHSRIAQVEYLGTKLQQA
FT                   GIPIQTPVGGHAVFVDVRKIFPDIKPENFPAQVLCNALYLESGIRATEIGSLMMGRDPI
FT                   TGQQEPSLFELMRLTIPRRTYTDSHMNYVADSLIEVVKKADMLKPLEFEYEPKILRQFT
FT                   ARFREIERR"
FT   CDS_pept        378057..379274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0081"
FT                   /locus_tag="XNC1_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0445"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88519"
FT                   /db_xref="GOA:D3VI30"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI30"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88519.1"
FT                   /translation="MQTTMYSEWGKNSNVIPTSADQFHQMALNIRRVLREKQDEHNKLG
FT                   TYALGLHEWFLKQGFYRLLQPKKYGGFEFSFSEYYRIMLAISEGHPSLGWGLTLGASHV
FT                   FLIASHWPESVQNELLNGNEQFIAAHKAFPAGTCKRVSQGYIVDGIFSYCSGITYASHV
FT                   ILSVMCDSQYPINCIIPKQDFEILNDWGEQRTLGMWASGSNSIRLNSVFVPERMVSPFR
FT                   AFYADQNVDHGTEGTRVHNNSMYLGYLMAPYHANLLVPIIGASKAALEEFRKYEKPGDI
FT                   NEMMFIRALGLATLLSDSAEAILFNVFDKYSSFCQRWEEHRLPMTVDENLRLWGLLQQA
FT                   GRLASESIDTLFRNAGSSAALKGSRLLQYFNDTQMYRGHVGSQWEQLSLYVGRSILNRK
FT                   ISFLDL"
FT   CDS_pept        379308..380741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0081"
FT                   /locus_tag="XNC1_0446"
FT                   /product="putative 4-hydroxyphenylacetate 3-monooxygenase,
FT                   oxygenase component (4-HPA 3-monooxygenase large component)
FT                   (4-HPA 3-hydroxylase)"
FT                   /EC_number="5.3.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0446"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88520"
FT                   /db_xref="GOA:D3VI31"
FT                   /db_xref="InterPro:IPR004925"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR024674"
FT                   /db_xref="InterPro:IPR024719"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI31"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88520.1"
FT                   /translation="MIRTGEQYIEDLRDGRTIFINGEKIIHHVDHPAFKNAIRTIAGLY
FT                   DYQKENFEKMTFMTESGHRVGRYWEFPTTHQKLIERGQATYDWAIQGAGWIGRSPDHVS
FT                   SALVGMMTHIDVFESYSQERADALRNYFAYVSEKDLYLTYALVNPQGDRSKTPGEHSKN
FT                   LYHTLGLVEKNVHGIIVRGAKMLATGAPLADEILVGVQNPLKPGIDERYALSFALPLNT
FT                   KGIKIISRRAYGLDVNSKDYPLSYRFDENDAVLYFDDVFVPWERVFLFENIEMCRKQFH
FT                   STGAEMLMDTQSMARYAVKLHFLAGLAQTMAEANGIDKYPAVRESLAELACYAMNIEGL
FT                   FRSLIHNPKTYNGYYLPDQTQLYACQVVAQSIYPKVVNTIRNLAGGGVIMLPSSEEDLL
FT                   NDEILSVIEKTQYSSIFSPVEKIRLMKLVWDSVGSEFASRHLQYEMFYSGSRVVTLNRL
FT                   YNRYDWTFAKELIKRIKEP"
FT   regulatory      380771..380831
FT                   /regulatory_class="terminator"
FT   CDS_pept        380772..380858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0447"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0447"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88521"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI32"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88521.1"
FT                   /translation="MRVKVLTGDVGTFFYIIVLGTTFEHLEL"
FT   CDS_pept        380904..380984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0448"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88522"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI33"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88522.1"
FT                   /translation="MLLAITIAQEFDIAFQADPQEYISVR"
FT   regulatory      381151..381210
FT                   /regulatory_class="promoter"
FT   CDS_pept        381232..382665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0449"
FT                   /product="putative 4-hydroxyphenylacetate 3-monooxygenase,
FT                   oxygenase component (4-HPA 3-monooxygenase large component)
FT                   (4-HPA 3-hydroxylase)"
FT                   /EC_number="5.3.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0449"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88523"
FT                   /db_xref="GOA:D3VI34"
FT                   /db_xref="InterPro:IPR004925"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR024674"
FT                   /db_xref="InterPro:IPR024719"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI34"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88523.1"
FT                   /translation="MIRTGEKYLDDLRDGRTIFINGEKITNHVDHPAFKNAIRSVASLY
FT                   DYKVAHADSMTFKTETGNQLSLYWQLPSAPEKLIARGHAAYEWAKQTMGWLGRSPDYVS
FT                   SALTGMITHIELFESYSQERADALRNYFSYVSENDLYLAYALINPQGDRSKTPGEHTKN
FT                   IYHTLGVVEKNARGMIVRGTKMLATGAVLADEVLVGSHRPLKPGIDERYALSFALPLNT
FT                   KGIKIISRKSYEFGVNPKDYPISSQFDETDSMIYFDDVLVPWERVFVFEDIEMVVNQLD
FT                   LTASEAMMDIQSLARYAVKLHFLAGLAQSMVEVNGVAQLPAVKESLAQLACYAMNVEAL
FT                   FNSVLHCPTVHNGFYLPEKMQLDTYRVISQSIYPKVLETIRKLAGGGVLMLPSSEADLE
FT                   NDEILGIIEKAQYSSVVSPIERVRMMKLVWDVIGSEFASRHHQYELFYAGAEYQTLGRL
FT                   YNQYDWGASKALVEKIKTF"
FT   regulatory      382713..382748
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(383238..384395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0450"
FT                   /product="putative electron transport protein yjeS"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0450"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88524"
FT                   /db_xref="GOA:D3VI35"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI35"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88524.1"
FT                   /translation="MAIPLDLNLLAANIKQWGISLGFQQIGICDTDLSTEEPKLQEWLD
FT                   KQYHGEMDWMARHGMMRARPHELLPGTLRVISVRMNYLPAKAAFASTLNNPQMGYVSRY
FT                   SLGRDYHKLLRQRLKKLGDQIQNYCSEHEYQGTLNFRPFVDSAPIMERPLAAKAGLGWV
FT                   GKHSLILNRESGSWFFLGELLIDLPLPVDTPQEEQCGRCVACMTTCPTGAIVAPYTIDA
FT                   QRCISYLTIELEGVIPEEFRPLMGNRIYGCDDCQLICPWNRFSQLTDEADFSPRAALHT
FT                   PELLDLFNWSEEKFLRITEGSAIRRIGYLRWLRNISVTLGNAPYQDNIVLALEKRIGLS
FT                   DILDEHIHWAIGQQTTRRNAHAVNVQTSQQKRLIRAITKGLPRDA"
FT   regulatory      384367..384426
FT                   /regulatory_class="promoter"
FT   CDS_pept        384604..385065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjeE"
FT                   /locus_tag="XNC1_0451"
FT                   /product="putative enzyme with nucleoside triP hydrolase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0451"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88525"
FT                   /db_xref="GOA:D3VIH5"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIH5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88525.1"
FT                   /translation="MKELVLSLPNENATVALGNAVAAISDRGYVIYLYGDLGAGKTTFS
FT                   RGFLQALGHQGHVKSPTYTLVEPYALQPRPVYHFDLYRLADPEELEFMGIRDYFHQDSI
FT                   CLVEWPQQGTGVLPDADIELHLSYDSEGRQARFIALSEYGESLLDNLKS"
FT   regulatory      385071..385130
FT                   /regulatory_class="promoter"
FT   operon          385203..389296
FT                   /operon="XNC1_operon0082"
FT   CDS_pept        385203..386390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0082"
FT                   /gene="amiB"
FT                   /locus_tag="XNC1_0452"
FT                   /product="N-acetylmuramoyl-l-alanine amidase II, a murein
FT                   hydrolase"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0452"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88526"
FT                   /db_xref="GOA:D3VIH6"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIH6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88526.1"
FT                   /translation="MTTAAAATLSHIHVSNGPSEATVTLEFTGGHPDYRFFSLHSPERL
FT                   VVDICQTGKITGLPMRLSGQDLVRQVRSSQPPDSHHQRVVLELAYKATATSLVKKVGSG
FT                   YQVAITLKTNMLKTNGAVNKTSAFKNSASQNDAPQNGSKQLLTKPANQTAQRKGIHPVV
FT                   IAIDAGHGGQDPGAVGQRGLKEKNVTISVARKLETHLRNDPMFKPVLTRGGDYFISVAG
FT                   RSEVARKHRANMLISIHADAAPNRSARGASVWVLSNRRANSEMGSWLEQHEKQSELLGG
FT                   AGNALANGTDPFLSQAVLDLQFGHSQRVGYDVAVQVLSQLTKIGALHKRTPEHASLGVL
FT                   RSPDIPSILVETGFISNQYEEELLGSEQYQEKLAQSIHLGLRHYFQANPLQTAPK"
FT   CDS_pept        386440..388362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0082"
FT                   /gene="mutL"
FT                   /locus_tag="XNC1_0453"
FT                   /product="enzyme in methyl-directed mismatch repair,
FT                   stimulates binding of Vsr and MutS to heteroduplex DNA"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0453"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88527"
FT                   /db_xref="GOA:D3VIH7"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIH7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88527.1"
FT                   /translation="MAIKILPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDID
FT                   IERGGAKLIRIRDNGCGISQQDLTLALARHATSKIASLDDLEAIMSMGFRGEALASISS
FT                   VSRLTLTSRPENQTEAWQSYAEGRDMEITVKPAAHPVGTTVEVLDLFYNTPARRKFLRT
FT                   EKTEFGHIDEVVRRIALARLDIAINLNHNGKLVRQYRPAKEESQYERRLAAICGTAFVQ
FT                   QALALSWQHDALLIKGWIADPMSTTTGSDIQYCYVNGRMMRDRLINHAIRQAYQDLIQG
FT                   EQQPAYVLYLEIDPHQVDVNVHPAKHEVRFHQARLVHDFIYQGVAAVLKQRSKGDELAL
FT                   GCQEPTEHWVPENRPSAGENHFLRKKIVPADSVSARHHDNDNIRQREPDKRQPLGREAP
FT                   PLHHGESYQKKQGDLYQKLMQFAPEEKQPLFPERAASASSSSVQSSLEKNSNASSGYHH
FT                   SFGKILSIYAGCYALLESSIGIGLLSLPVAERWLKQAQLTPGEQGLKSQPLLIPLKLAL
FT                   NQAEMGSLKQNSELLKTFGIESTSANGKVTIHAVSLPLRQQNLPKLLPELLGYLGEQSV
FT                   VSAEQIAIWLSRHLGSEHETWNVAQAVQLLADVERLCPQLVGSPPEGLLQLIDLQAVVA
FT                   LLNHE"
FT   CDS_pept        388355..389296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0082"
FT                   /gene="miaA"
FT                   /locus_tag="XNC1_0454"
FT                   /product="delta(2)-isopentenylpyrophosphate tRNA-adenosine
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0454"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88528"
FT                   /db_xref="GOA:D3VIH8"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIH8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88528.1"
FT                   /translation="MSDLKTQHLPTAIFVMGPTASGKTALSIALRQHLPVELVSVDSAL
FT                   IYRGMDIGTAKPSAEEQAQAPHRLIDILDPAETYSAADFRRDALKEMADITAAGRIPLL
FT                   VGGTMLYFKALLEGLSPLPSANPEIRAQIEQQAEERGWDALHQQLQEIDPVAAVRIHPN
FT                   DPQRLTRALEVFRISGKTLTELTETAGEILPYHVHQFAIAPASREVLHQRIAARFEQMI
FT                   KSGFEDEVKALYARRDLHTDLPSIRCVGYRQMWSYLAGEISHDEMVYRGICATRQLAKR
FT                   QITWLRSWDNVTWLDSDQPKQVLNTVIQVIGT"
FT   regulatory      389301..389360
FT                   /regulatory_class="promoter"
FT   operon          389404..391084
FT                   /operon="XNC1_operon0083"
FT   CDS_pept        389404..389706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0083"
FT                   /gene="hfq"
FT                   /locus_tag="XNC1_0455"
FT                   /product="host factor I for bacteriophage Q beta
FT                   replication, plays a role in degradation of RNA
FT                   transcripts"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0455"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88529"
FT                   /db_xref="GOA:D3VIH9"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIH9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88529.1"
FT                   /translation="MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVIL
FT                   LKNTVSQMVYKHAISTVVPSRPVSHHGSNQNAPAGVGNYHAGSNPATQQESDGAE"
FT   regulatory      389711..389770
FT                   /operon="XNC1_operon0083"
FT                   /regulatory_class="promoter"
FT   regulatory      389737..389773
FT                   /operon="XNC1_operon0083"
FT                   /regulatory_class="terminator"
FT   CDS_pept        389804..391084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0083"
FT                   /gene="hflX"
FT                   /locus_tag="XNC1_0456"
FT                   /product="putative GTPase subunit of protease with
FT                   nucleoside triP hydrolase domain, together with HflC-HflK
FT                   involved in stability of phage lambda cII repressor"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0456"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88530"
FT                   /db_xref="GOA:D3VII0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:D3VII0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88530.1"
FT                   /translation="MFDRYEGGELAVLVHVFFSQEKDTENLSEFESLVTSAGVSPVQIV
FT                   TGSRKAPHPKYFVGEGKAEEIAEAVKNSGADVVLFNHTLSPAQERNLERLCQCRVVDRT
FT                   GVILDIFAQRARTHEGKLQVELAQLRHLSTRLVRGWTHLERQKGGIGLRGPGETQLESD
FT                   RRMLRDKIKQILGRLSKVEKQREQGRQARNKADIPTVSLVGYTNAGKSSLFNSITSAKV
FT                   YAADQLFATLDPTLRRIDVDDVGTVVLADTVGFIRHLPHDLVAAFKATLQETRQAKLLL
FT                   HVVDAADHRLDENIIAVDSVLEEIESNEIPSLMVMNKIDMLEDFTPRIDRDEENRPVRV
FT                   WLSAQTGEGISLLLQALTERLSGETAHYELHLPPEAGRLRSRFYQLQAIEREWMEEDGQ
FT                   VGLEVRMPMVDWRRLCKQEPNLPDYVV"
FT   CDS_pept        complement(391114..391248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0457"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88531"
FT                   /db_xref="UniProtKB/TrEMBL:D3VII1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88531.1"
FT                   /translation="MGDTFDRAVQSLQFWHSHSITAIPSQLLHDNKYFTISTLKWRVK"
FT   CDS_pept        391219..391395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0458"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88532"
FT                   /db_xref="UniProtKB/TrEMBL:D3VII2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88532.1"
FT                   /translation="MNSTVKSITQIILVAYKNDEVCRFCPWRPLSDLSGTGTAWEVGSL
FT                   TRLGGEQSPLKNQ"
FT   operon          391420..393659
FT                   /operon="XNC1_operon0084"
FT   CDS_pept        391420..392655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0084"
FT                   /gene="hflK"
FT                   /locus_tag="XNC1_0459"
FT                   /product="with HflC, part of modulator for protease
FT                   specific for FtsH phage lambda cII repressor"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0459"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88533"
FT                   /db_xref="GOA:D3VII3"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D3VII3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88533.1"
FT                   /translation="MAWNQPGNNGQDRDPWGSSNNNGGNSGGNNKGGRNRGATDLDDLF
FT                   RKLSQKLGGLGGNKGGNGSEQNPKFGGRLIGLAVAAAVAVWVVSGFYTIKETERGVVTR
FT                   LGKFSHVVQPGLNWKMTFIDRVRAVNVESVRELATSGVMLTSDENVVRAEMNVQYRVTD
FT                   PAAYLFNVTNPDNSLRQATDSAVRGVVGKYTMEKILTADRTIVRNDTQKVLEETIRPYH
FT                   MGITLLDVNFQTARPPEEVKAAFDDVIAAREEEQKTIREAEAYKNSVLPIAKGDAQRMI
FT                   EEAKAYKASVVFNARGEVASFAKILPEYKAAPEITRERLYIETMERVLSHTRKVIANEK
FT                   SNNMLVLPLDQVLRNQAEAPKFHQNTKVAPEKGNTTHSTSTQEYNSNAGYDSSGYGNSN
FT                   NLRGDALRQGRP"
FT   CDS_pept        392658..393659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0084"
FT                   /gene="hflC"
FT                   /locus_tag="XNC1_0460"
FT                   /product="with HflK, part of modulator for protease
FT                   specific for FtsH phage lambda cII repressor"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0460"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88534"
FT                   /db_xref="GOA:D3VII4"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D3VII4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88534.1"
FT                   /translation="MRKSLVFTIAAVLVVLYSSIFIVYEGQRGIMLRFGKVVRDSDNKP
FT                   LVYQPGPHFKVPFIETVKTLDARIQTMDIKADRFLTSENKDLIVDSYLKWRIKDFSSYY
FT                   LATGNGEIAQAELLLKRKFSDRLRSEIGRLDVRGIVTDSRGRLTTDVRNALNLGTSEDD
FT                   SSADSDIASAAARIEKETKGKQPVLNPNSMAALGIEVVDVRIKQINLPDEVSGAIYQRM
FT                   RAEREAVARRHRSQGLEEAEKVRAAADKTATEIKAEANSEALVLRGEGDAEATKLFADA
FT                   FSKDPEFYAFIRSLRAYEKSFQNDGNIMVLSPDSDFFRYMKEPSKPRHNQND"
FT   regulatory      393760..393797
FT                   /regulatory_class="terminator"
FT   regulatory      393846..393905
FT                   /regulatory_class="promoter"
FT   CDS_pept        393930..395228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="XNC1_0461"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0461"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88535"
FT                   /db_xref="GOA:D3VII5"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:D3VII5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88535.1"
FT                   /translation="MGKNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLV
FT                   INGEKTVLHLIPSGILRENVISIIANGVVLAPDALMKEMRELESRGVPVHERLLISEAC
FT                   PLILPYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAAKLK
FT                   EIIEYHNFQLVNYYKEPAVDYQQTLDDILAVADILTGMVVDVSDLLYKATQKGELVMFE
FT                   GAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPT
FT                   ELFDETGEYLREKGQEFGATTGRSRRTGWLDIVAIRRAIQINSLSGFCMTKLDVLDGLK
FT                   EVKICVGYRQADGSVIDTTPLAAENWEGIEAVYETLPGWDESTFGAKEHSQLPQAALDY
FT                   IKRVEELTGVPVDIISTGPDRAETMILRDPFDA"
FT   regulatory      395259..395287
FT                   /regulatory_class="terminator"
FT   regulatory      395264..395323
FT                   /regulatory_class="promoter"
FT   operon          395411..399125
FT                   /operon="XNC1_operon0085"
FT   CDS_pept        395411..395830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0085"
FT                   /locus_tag="XNC1_0462"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0462"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88536"
FT                   /db_xref="GOA:D3VII6"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3VII6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88536.1"
FT                   /translation="MQLTSFTDYGLRALIYMASLPEGQMTSITEVTEVYGVSRNHMVKI
FT                   INQLSHLGLVNAVRGKNGGISLGKPAREIRIGDVVRSLEPLALVNCSACQITSACRLKS
FT                   VLNQAVENFLEELDKHTLADMVKDNSPLYQLLLVK"
FT   CDS_pept        395874..398333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0085"
FT                   /gene="rnr"
FT                   /locus_tag="XNC1_0463"
FT                   /product="RNase R, 3'-5' exoribonuclease"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0463"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88537"
FT                   /db_xref="GOA:D3VII7"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:D3VII7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88537.1"
FT                   /translation="MSKDPFREREAEKYESPIPSREYILDIISKHTIPVSRQELAQELQ
FT                   LTSADAQEALRRRLRAMERDGQLVFTRRQCYALPERLDLLKGTVIGHRDGYGFLRAEGH
FT                   KEDFYLPADQMKMAIHGDVILAQPLRPDRKGRIEVRIVRVLEPKSSQIVGRYFMDAGMG
FT                   FVVPDDSRLCFDILIPKEEVCGARMGNVVVVELMNRPTRRTKAIGKIVEVLGETMGTNM
FT                   AVEIALRTHEIPHSWPPMVEKQVASLDENVPESAKQGRIDLRELPLVTIDGEDARDFDD
FT                   AVYCERKRGGGWRLWVAIADVSYYVRPQTVLDTEARSRGNSVYFPSQVVPMLPEVLSNG
FT                   LCSLNPEVDRLCMVCEMTISAQGKLSSYKFYEAVMNSHARLTYTKVWKILQGDQEQREH
FT                   YKPLVTHIEHLHELYQALEHAREERGAISFESEEAKFIFNAERRIERIEPVVRNDAHKL
FT                   IEECMILANIAAARFVEKHHEPALYRIHDRPREESILNLRSVFNELGLSLLGGLKPEPK
FT                   DYAQLMKDVAERPDHELLQTMLLRSMKQAIYEPENRGHFGLALRAYSHFTSPIRRYPDL
FT                   ALHRAIKYLLSKEKLAQENEVVEHRWTPTGGWHNDMEHMLQLGDHCSMTERRADEATRD
FT                   VADWLKCDFMQDQVGNVFTGLITSVTGFGFFVRLNDLFIDGLVHVSTLDNDYYRYDNVG
FT                   QRLIGESSGQTYRLGDEVEIRVEAVHMDERNIDFNLLSTTRKARNQGKTERDKAKKGKP
FT                   ERKNGKKGRDNKKSANFEPDRAFRKKKKAEEPKSSNKPSKKKKQSDKTQKITANLKAKR
FT                   AKKSTGE"
FT   CDS_pept        398388..399125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0085"
FT                   /locus_tag="XNC1_0464"
FT                   /product="putative tRNA/rRNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0464"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88538"
FT                   /db_xref="GOA:D3VII8"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR024915"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D3VII8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88538.1"
FT                   /translation="MSEIIYGIHAVKALLESDPQRFMEVYVLKGREDRRLTPLFQELES
FT                   IGITVQLANRQWLDAQTEGAVHQGIIARVKPGRQYQENDLPDLLSQLDRPFLLVLDGVT
FT                   DPHNLGACLRTADAAGVDAVIVPRDRSAQLNATAKKVACGAAENVPLIRVTNLARTLRL
FT                   LQEHNIWIVGTAGEATHALYESKLTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSV
FT                   SSLNVSVATGVCLFEIVRQRRSQ"
FT   regulatory      399171..399230
FT                   /regulatory_class="promoter"
FT   operon          399323..400767
FT                   /operon="XNC1_operon0086"
FT   CDS_pept        399323..399721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0086"
FT                   /gene="rpsF"
FT                   /locus_tag="XNC1_0465"
FT                   /product="30S ribosomal subunit protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0465"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88539"
FT                   /db_xref="GOA:D3VII9"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:D3VII9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88539.1"
FT                   /translation="MRHYEIVFMVHPDQSEQVPGMIERYSATITNAQGQIHRLEDWGRR
FT                   QLAYPINKLHKAHYVLLNVEAPQEAIDELETNFRFNDAVIRSMVMRVKHAVTEASPMVK
FT                   AKDERRSRDLVLEEGLVDDVDEAGDSEE"
FT   CDS_pept        399727..400044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0086"
FT                   /gene="priB"
FT                   /locus_tag="XNC1_0466"
FT                   /product="primosomal replication protein N"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0466"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88540"
FT                   /db_xref="GOA:D3VIJ0"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR023646"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIJ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88540.1"
FT                   /translation="MTTNRLVLSGTVCKAPIRKVSPSGIPHCQFVLEHRSQQQEAGFSR
FT                   QSWCRMPVIASGQLLQEYTHSITVGSRITVSGFINSHYGRNGLSKLVLHAEQIELIDSG
FT                   D"
FT   CDS_pept        400049..400276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0086"
FT                   /gene="rpsR"
FT                   /locus_tag="XNC1_0467"
FT                   /product="30S ribosomal subunit protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0467"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88541"
FT                   /db_xref="GOA:D3VIJ1"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIJ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88541.1"
FT                   /translation="MARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRIT
FT                   GTRAKYQRQLARAIKRARHLSLLPYTDRHQ"
FT   CDS_pept        400315..400767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0086"
FT                   /gene="rplI"
FT                   /locus_tag="XNC1_0468"
FT                   /product="50S ribosomal subunit protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0468"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88542"
FT                   /db_xref="GOA:D3VIJ2"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIJ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88542.1"
FT                   /translation="MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNVE
FT                   FFEARRAELEAKLSDVLAAAEARAAKITALDSVTITSKAGDEGKLFGSIGTRDIADAVT
FT                   AAGVEVSKSEVRLPNGVLRTVGEHEVDFQVHSDVFAKLNVNIVPEA"
FT   regulatory      400793..400839
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(400902..401819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0469"
FT                   /product="putative Glycerophosphodiester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0469"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88543"
FT                   /db_xref="GOA:D3VIJ3"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIJ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88543.1"
FT                   /translation="MIRIVRHTLQQGIFMCVLLLSSYSAFAQSPKIVAHRAGTTDAPEN
FT                   TFYAIDTALKNKADAIWITAQLSKDNQLVLYRPSNLNALTDHDGTVSNYTTQELAKVNA
FT                   SYQFSKKNNIKLPLQQTTIPLLESVLKKYPDVEFYIDLKSPDANPDIQAKAVLNVLNKT
FT                   QSFEHTRFYSTNEKFLDTLSHYSDKINVFESRDQTRTILANSVMSHHCELPQKEAANAE
FT                   STRWYGFELHRKIEVVERYTLGEARSPATLTWDKDAIDCFRKISNAHIILFGVNNLNDY
FT                   QLAKDIGADAVMVDSPQLFQKIRN"
FT   regulatory      402067..402126
FT                   /regulatory_class="promoter"
FT   CDS_pept        402374..402994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fklB"
FT                   /locus_tag="XNC1_0470"
FT                   /product="FKBP-type 22KD peptidyl-prolyl cis-trans
FT                   isomerase (rotamase)"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0470"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88544"
FT                   /db_xref="GOA:D3VIJ4"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIJ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88544.1"
FT                   /translation="MTKPSFESTEARASYGIGLQVGQQLQESGLQGLEPEALLAGLCDA
FT                   LESHAPAIPVEELHRALREIHERADSVRQERQQAMAEEGKKFLTENAQREGVSSTESGL
FT                   QFSVLTQGEGAIPARSDRVRVHYTGRLIDGTVFDSSVQRGTPAEFPVSGVIPGWIEALT
FT                   LMPVGSKWELYIPHNLAYGERGAGASIPPYSALIFEVELLEIL"
FT   regulatory      402995..403036
FT                   /regulatory_class="terminator"
FT   regulatory      403144..403203
FT                   /regulatory_class="promoter"
FT   operon          403229..403815
FT                   /operon="XNC1_operon0087"
FT   CDS_pept        403229..403486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0087"
FT                   /locus_tag="XNC1_0471"
FT                   /product="putative SpoVT/AbrB-like"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0471"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88545"
FT                   /db_xref="GOA:D3VIJ5"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIJ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88545.1"
FT                   /translation="MTAVVIRQSGGANIVSIPKAIVKTLNLHTGSKLELSIQDNKIVLT
FT                   PVEEELTLESLLAGSPKECFRVTDEDREWLEANSVGKEVI"
FT   CDS_pept        403486..403815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0087"
FT                   /locus_tag="XNC1_0472"
FT                   /product="PemK-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0472"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88546"
FT                   /db_xref="GOA:D3VIJ6"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIJ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88546.1"
FT                   /translation="MYIPDKGDIVSLNFDPSAGKEIMKRRPVFVISRKMFNERTGFAVV
FT                   VPITSTARGMKLEVVLPEEVSVQGSILIHQVKSLDFSERQVKFIEKAPQYIIDRVTELT
FT                   KAIIL"
FT   regulatory      403841..403900
FT                   /regulatory_class="promoter"
FT   CDS_pept        403985..404728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ"
FT                   /locus_tag="XNC1_0473"
FT                   /product="protein that acts on
FT                   3'-phosphoadenosine-5'-phosphosulfate with sugar
FT                   phosphatase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0473"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88547"
FT                   /db_xref="GOA:D3VIJ7"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIJ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88547.1"
FT                   /translation="MLQQICQLAREAGAAIMEVYQAEQPLQVEHKTDDSPVTAADIAAH
FT                   KIIKAGLLRIAPDIPLLSEEDPPVWEERKNWRRYWLVDPLDGTKEFIRRNGEFTVNIAL
FT                   IEDGVPVMGVVYVPVQNVLYSGQGHQARKEANGQILPIKVISAALPVVVVSRSHRDDEE
FT                   LQDYLSQLGVHNTLSIGSSLKFCMVAEGKAQLYPRFGPTNIWDTGAGHAVAIAAGAHVT
FT                   DWEGKTLNYSPRESFLNPGFRVSIF"
FT   regulatory      404743..404775
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(404820..405377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0474"
FT                   /product="Protein ytfJ precursor"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0474"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88548"
FT                   /db_xref="InterPro:IPR006513"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIJ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88548.1"
FT                   /translation="MLKNIMLSSILSLMPIFAFAHNITLEQHVPAVSVTDKGELLLNEG
FT                   KFSYQSWSSAELPGKVRTIQHIAGRSSAKEMNDPLIQALKDADLPKDKYQTTSIVNTDD
FT                   AIFGTSVFVRNSLEDSKKQFPWSQFIVDSNGVAKNAWGLEPKSSAIIVLDKKGNVKFVK
FT                   DGKLSSEEIAHVISIIEDELKK"
FT   regulatory      complement(405480..405539)
FT                   /regulatory_class="promoter"
FT   regulatory      405485..405544
FT                   /regulatory_class="promoter"
FT   CDS_pept        405704..405910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0475"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0475"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88549"
FT                   /db_xref="InterPro:IPR009491"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIJ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88549.1"
FT                   /translation="MKIFHHYNPLKIALYVKTLFRGRLYIKDMGAFEFNYGKILLPKIK
FT                   DKRHFNVMSEVNQQVLRLQTEMG"
FT   regulatory      complement(405966..405991)
FT                   /regulatory_class="terminator"
FT   regulatory      405978..406003
FT                   /regulatory_class="terminator"
FT   operon          complement(406025..408089)
FT                   /operon="XNC1_operon0088"
FT   CDS_pept        complement(406025..407356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0088"
FT                   /gene="ytfL"
FT                   /locus_tag="XNC1_0476"
FT                   /product="putative hemolysin-related membrane protein with
FT                   CBS regulatory domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0476"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88550"
FT                   /db_xref="GOA:D3VIK0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIK0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88550.1"
FT                   /translation="MLNSLLVIFLLCAISAFFSLSEISLAASRKIKLKLMADEGNLNAA
FT                   HVLKLQETPGLFFTVVQIGLNAVAILGGVVGESAFSPALKTLFLRFMNPEWAEQLGFIC
FT                   SFIIVTSFFILFADLTPKRIGMIKPEAVAVRIVNPMRFCLAICRPLVWLFNGLADYIFK
FT                   IFKIPMARNEDITSDDIYAVVEAGAVAGILRKQEHELIENVFELDSRAVPSAMTSRESV
FT                   VYFDKNEDENSIKEKISTHPHSKFLVCDGDIDHVIGYVDSKDLLNRVLNGQSLNLKEGV
FT                   QICNALMIPDTLSLSDTLESFKAAGEDFAIILNEYALVMGVITLNDVMTTLMGDLVGQG
FT                   QEEQIVVRDENSWLVEGGTPIEDVMRILDIDDFPDSSHYETIAGFMMFRLRKIPKRTDS
FT                   VKFGGYKFEVVDIDNYKIDQLLVTRIIDPTAQTNPSNTDQSYEA"
FT   regulatory      complement(407393..407431)
FT                   /operon="XNC1_operon0088"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(407442..408089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0088"
FT                   /gene="msrA"
FT                   /locus_tag="XNC1_0477"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0477"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88551"
FT                   /db_xref="GOA:D3VIK1"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIK1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88551.1"
FT                   /translation="MPNSADESQHVSLQETLADRATPITVSPYHVITQHAINTIPENME
FT                   IAYVGMGCFWGVERLFWQQEGIYTTSVGYSGGITPNPTYEAVCTGSTGHAEVVRIIFDP
FT                   TKITYMQLLTLFWENHDPAQGMRQHGDIGTQYRSALYTVSPQQLEQALASREQFQQAMI
FT                   QNGDQRAITTEIREAGPFYFAEDYHQQYLYKNPEGYCGLGGMGICFPPTHRN"
FT   regulatory      408141..408200
FT                   /regulatory_class="promoter"
FT   regulatory      complement(408141..408200)
FT                   /regulatory_class="promoter"
FT   operon          408221..414116
FT                   /operon="XNC1_operon0089"
FT   CDS_pept        408221..409963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0089"
FT                   /gene="ytfM"
FT                   /locus_tag="XNC1_0478"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0478"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88552"
FT                   /db_xref="GOA:D3VIK2"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIK2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88552.1"
FT                   /translation="MSRYPLICALFVSIATPSAYSANLRLKVEGLSGELEKNARVQLSN
FT                   ISTDEVSPDGRFRARVEKAIREGLRPLGYYAPTVEFTYQENIPPARPVLTAKVTLGEPV
FT                   RVAQVKVELEGGAKTDKDYATLIQEKMPKEGEILNHGEYENFKSAFTNLAVKKGYFDAE
FT                   MKKSELGVSKALHESIWAFDFDSGQRYRFGPVIFQGSQIRETYLNNLIPFKQGEYYTSE
FT                   QLAEFNRRLVDTGWFNSAVVVPDFKTGRGNQDKLLPLDASLVPRSANYVELGGGYATDV
FT                   GPRLQTKWKKPWLNSRGHSLGASINVSSREQLIDASYKIPLKANPLEEYYELQTGYKRK
FT                   DLNDTISDTATLNFARNWDRSTGWQYGVNLRWSLSHFTQANVTNTTMLLYPGANLSRIR
FT                   QRGGTMPYWGDSQRYSIDISDTRWQSDVDFLVIQAHHVWIRTYNENHRFVARADLGWIE
FT                   TNDFNKVPPDLRFFAGGDRSIRGYKYQKVSPTDGKGKLTGASKLAVGSLEYQYNIYGNW
FT                   WSALFVDSGEAVNDIKRSNFKTGAGIGVRWASPVGPIKFDLATPIGDPDSHNVEFYIGL
FT                   GAEL"
FT   CDS_pept        409960..413772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0089"
FT                   /locus_tag="XNC1_0479"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0479"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88553"
FT                   /db_xref="GOA:D3VIK3"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIK3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88553.1"
FT                   /translation="MKWVKRVSIAFLLIVGLLLMTVVGLVGTQSGLHFMLNSAARWVPG
FT                   LDIASVSGGWRDLTLKGVKYQIPGVNVSADNLYLSLRLSCLKDSHLCVNALTAEDVSVS
FT                   VNTAELSPSEPSPPSEPLTELKTPYPVSLDLLSLKNIHVKVDDIAITLDEFKAGAQWQE
FT                   KQLVLKPTEINQLLVALPKTPSEPIATVATTQPGESEKSIPKKSISEKSLGETLKALFA
FT                   NPLLAELPNIPIPLDITVENIHGRQLHLTGDTDITINDLRLQASNQGQQIDIKNLNVQA
FT                   PEGAIAIQGMAKLSEQWAVKLAIKGQADNLNHLNLNELTGQKIDLTLEGALLKQLDLAL
FT                   HLSGPVVAGLDAQVELAKAGLPVHLTLESQQLQWPLTGKPEYQLDGLKLRLNGQASHYD
FT                   LSLRSAIKGNDIPPALLTLDAKGNEERFRLTRLRLAALQGKADVTGVVDWSKAISWNAK
FT                   LVLDGINTAEQWPEWPAKMAGNMAVRGSMYGGSWQLQIPEIAFHGHVKQNIVKAYGKTS
FT                   GNAAGQWDIPQFDLAFGRNTLNVQGRLTDETWKLEGEINAPQLNGLLPGLAGLVTGHVK
FT                   LRGNMKAPQIVADLNARGVRWQDTLRVDSAIIKGDVRSAEQIQGQLSVVVHQLRQADLT
FT                   IKNLVLNAKGTEKQHDLQLKIEGDPVSGELALNGSFDRQQERWKGSINNTHFDTPVGEW
FT                   RLSKAISIDYSNLQQKVTVGAHCWLNPNAHVCLSKPIDAGSSGHAQVALERFDLAMIQP
FT                   FLDKDTQLKGIFSGNADIKWTADQGLPQAKIALQGEGVRVRQVVDGIILPIDFETLTLN
FT                   AGLANGKARLAWLFKLAGNGQLKGNVQVVDLEGRRNLSGNIDLQALSLNLIKPVLDKGE
FT                   KAEGGVNANLHLGGNAKNPQLFGLLKADNLQMVSHWLPFDISQGQLAVHFDGTRSDLNG
FT                   MIKTPKGQLNLNGSADWRNLDAWYARIAANGDKLRVIVPPMVKVDVSPDLVLEATPNLL
FT                   KLNGNVDIPWARITVQELPESAVGVSSDEVMLDRNLQPIEKKKSSIQIQTNLNIHIGND
FT                   VQLSAFGLTAQLNGALKVLQDQQGLGLNGQIDIPEGRFQAYGQDLQVRKGTIIFSGSPD
FT                   QPLLNIEAIRNPESTANGVIAGVRVTGLADKPKVEIFSDPAKSQQEALSYLLRGQGLEK
FT                   GDSDNSQMTTILIGLGVAQSGQLIGKIGETFGVSDLALDTQGIGDKSQVVVSGRITNDL
FT                   QVKYGVGIFDSLATLTLRYRVMPRLYLEAVSGIDQALDLLYEFEF"
FT   CDS_pept        413775..414116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0089"
FT                   /locus_tag="XNC1_0480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0480"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88554"
FT                   /db_xref="GOA:D3VIK4"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="InterPro:IPR039126"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIK4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88554.1"
FT                   /translation="MRVIVYGSLRRKQGNHHWMTDAQLLGEHQLEGYEIYDLGHYPAVI
FT                   RGKGTIVCEVYRITPSILTELDELKKNAQEYYRELIETPYGKAWIYLYKLPVEGLHRIT
FT                   SGDWLKRHG"
FT   regulatory      414127..414151
FT                   /regulatory_class="terminator"
FT   regulatory      complement(414165..414200)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(414255..414785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /locus_tag="XNC1_0481"
FT                   /product="inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0481"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88555"
FT                   /db_xref="GOA:D3VIK5"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIK5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88555.1"
FT                   /translation="MSLNNVPAGKELPEDIYVIIEIPANADPIKYEVDKESGALFVDRF
FT                   MSTAMFYPCNYGYINNTLSLDGDPVDVLVPTPYPLQPGSVIRCRPVGVLKMTDESGEDA
FT                   KLVAVPHTKLSKEYDHIKDVNDLPELLRAQITHFFEHYKDLEKGKWVKVDGWDNVEAAK
FT                   AEIVSSFERAAKK"
FT   regulatory      complement(414821..414880)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(415234..415273)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(415296..416300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbp"
FT                   /locus_tag="XNC1_0482"
FT                   /product="fructose-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0482"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88556"
FT                   /db_xref="GOA:D3VIK6"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIK6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88556.1"
FT                   /translation="MKTLGEFIVEKQQDFPHATGELTALLSAIKLGAKIIHRDINKAGL
FT                   VDILGASGVSNVQGEVQMKLDLYANEKLKAALKARGEVAGIASEEEDEIVIFDGDRAET
FT                   AKYVVLMDPLDGSSNIDVNVSVGTIFSIYHRITPIGQPVTEEDFLQPGHRQVAAGYVVY
FT                   GSSTMLVYTTGCGVHTFTYDPSLGVFCLTHEKVQFPAKGNMYSINEGNYIKFPLGVKKY
FT                   IKYCQEQDEATQRPYTTRYIGSLVADFHRNLLKGGIYIYPSTASHPTGKLRLLYECNPI
FT                   AFLAEQAGGKASDGANRILEIVPSKLHQRVPFFVGTKSMVEKAESFMAEFPDE"
FT   regulatory      complement(416365..416424)
FT                   /regulatory_class="promoter"
FT   regulatory      416387..416446
FT                   /regulatory_class="promoter"
FT   CDS_pept        416473..417843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpl"
FT                   /locus_tag="XNC1_0483"
FT                   /product="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate
FT                   ligase"
FT                   /EC_number="6.3.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0483"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88557"
FT                   /db_xref="GOA:D3VIK7"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIK7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88557.1"
FT                   /translation="MRIHLLGICGTFMGGLAILARSLGHEVTGSDASVYPPMSTLLEKQ
FT                   GIELIQGYDPAQLDPVPDIVIIGNAMTRGNPCVEAVLDRGIPYTSGPQWLHDHVLPERW
FT                   VLAVAGTHGKTTTAGMLAWVLEACGYKPGFLIGGVPGNFAVSAQIGESPFFVIEADEYD
FT                   SAFFDKRSKFVHYSPRTLIMNNLEFDHADIFENLASIQKQFHHLVRVVPSTGKIIVPDN
FT                   DINLKHVLSMGCWSEQEQLGDGGSWQAKKLSQDSSNYQVFHHGEWVGEVNWSLVGEHNM
FT                   HNGLMAIAAAHHIGIQPADACQALGEFINARRRLELRGEVNGISVYDDFAHHPTAILAT
FT                   LEALRSKVGGVARILAVLEPRSNTMKMGMSKSDIAPSMGRADEVFLYQPVNMPWQVVEI
FT                   AEQCVQPARWSADIDTLVRMIVETAQPGDHILVMSNGGFDGIHEKLLTELAKKADAV"
FT   regulatory      417900..417932
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(417980..418450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argR"
FT                   /locus_tag="XNC1_0484"
FT                   /product="transcriptional repressor of arginine synthesis
FT                   (ArgR familiy)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0484"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88558"
FT                   /db_xref="GOA:D3VIK8"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIK8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88558.1"
FT                   /translation="MRIPSKQEDLVKAFKALLKEEKFSSQGEIVSALQEEGFENINQSK
FT                   VSRMLTKFGAVRTRNAKMEMVYCLPAELGVPTATSPLKNLVLDVDYNHSVVVIRTSPGA
FT                   AQLIARLLDSLGKTEGILGSIAGDDTIFTTPAQNFTTKQLYEAILNLFEQEL"
FT   regulatory      complement(418478..418537)
FT                   /regulatory_class="promoter"
FT   regulatory      418768..418827
FT                   /regulatory_class="promoter"
FT   CDS_pept        418884..419822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="XNC1_0485"
FT                   /product="malate dehydrogenase, NAD(P)-binding"
FT                   /EC_number="1.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0485"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88559"
FT                   /db_xref="GOA:D3VIK9"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR023958"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIK9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88559.1"
FT                   /translation="MKVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVD
FT                   LSHIPTEVKVTGFAGEDATPALAGADVVLISAGVARKPGMDRSDLFNINAGIIRNLVQQ
FT                   VAKTCPKALIGIITNPVNTTVAIAAEVLKKEGVYDKNRLFGVTTLDVIRSNTFVAELKG
FT                   KKLEDLEVPVIGGHSGVTILPLLSQIPDVSFTDEEIEALTKRIQNAGTEVVEAKAGGGS
FT                   ATLSMGQAAARMGLSMIRGLQGESNVIECSYVEGDGEHARFFAQPVRLGKNGIEERLDI
FT                   GKLSDFEQKALDDMLGVLQKDIELGEKCING"
FT   regulatory      complement(419871..419907)
FT                   /regulatory_class="terminator"
FT   regulatory      419883..419919
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(419923..420201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsB"
FT                   /locus_tag="XNC1_0486"
FT                   /product="transcriptional activator of maltose metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0486"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88560"
FT                   /db_xref="GOA:D3VIL0"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR038722"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIL0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88560.1"
FT                   /translation="MISMKSDWHPADIIAALRKRGTTLAAVSRNAGLSSSTLANTLSRP
FT                   WPKGEWIIANYLELHPSEIWPSRYFDPYTGELLERKVRDRKNNYLSI"
FT   regulatory      420197..420256
FT                   /regulatory_class="promoter"
FT   regulatory      complement(420379..420438)
FT                   /regulatory_class="promoter"
FT   operon          420389..421214
FT                   /operon="XNC1_operon0090"
FT   CDS_pept        420389..420736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0090"
FT                   /locus_tag="XNC1_0487"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0487"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88561"
FT                   /db_xref="GOA:D3VIL1"
FT                   /db_xref="InterPro:IPR003314"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIL1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88561.1"
FT                   /translation="MKKEWYTAMELTGVGELPRSPQGVNARAKREEWLRQKRTGVQGRA
FT                   IEYHYSCFPESTLTVLELNETSPEYQVQKQDPLSIWVSAFNLLTEEEKEVITEVILRDG
FT                   IRSFLEKITAT"
FT   regulatory      420753..420787
FT                   /operon="XNC1_operon0090"
FT                   /regulatory_class="terminator"
FT   CDS_pept        420813..421214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0090"
FT                   /locus_tag="XNC1_0488"
FT                   /product="Complete genome; segment 16/17"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0488"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88562"
FT                   /db_xref="GOA:D3VIL2"
FT                   /db_xref="InterPro:IPR003314"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIL2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88562.1"
FT                   /translation="MKKEWYSAKELIGLAGLPSSPQGVNLMARREGWEQRRKRGVQGKA
FT                   LEYNVNSFPEDVFNVLTVSENTVEYYRNKRQDPFMIWVEAYYQLTKPEREQMVKFILRK
FT                   GLASLVQYLGIQETGIQEIGSKDKRSIPD"
FT   regulatory      complement(421185..421230)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(421242..422213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispB"
FT                   /locus_tag="XNC1_0489"
FT                   /product="octaprenyl diphosphate synthase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0489"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88563"
FT                   /db_xref="GOA:D3VIL3"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIL3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88563.1"
FT                   /translation="MNLESIIKLTADDMAAVNETILNQLNSDVALINQLGYYIISGGGK
FT                   RIRPMIAVLAGKALQCGDEKHIKVAALIEFIHTATLLHDDVVDESDMRRGKETANAIYG
FT                   NAASVLVGDFIYTRSFQMMTDLDSMRVLKLMSDATNVIAEGEVMQLMNCNDPDISEDDY
FT                   MRVIYSKTARLFEVAAHSAAILANATPEQEIALRDYGCYLGTAFQLIDDLLDYDSDNNT
FT                   LGKNTGDDLNEGKPTLPLLHAMNHGTPEQSALIRDAIEKGNGRHLLDTVLATMKQCGSL
FT                   KYTRQRAEEEADKAISALQILDDSPYKAALVGLAHIAVQRVS"
FT   regulatory      421350..421377
FT                   /regulatory_class="terminator"
FT   regulatory      complement(422280..422339)
FT                   /regulatory_class="promoter"
FT   regulatory      422339..422398
FT                   /regulatory_class="promoter"
FT   operon          422465..424347
FT                   /operon="XNC1_operon0091"
FT   CDS_pept        422465..422773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0091"
FT                   /gene="rplU"
FT                   /locus_tag="XNC1_0490"
FT                   /product="50S ribosomal subunit protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0490"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88564"
FT                   /db_xref="GOA:D3VIL4"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIL4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88564.1"
FT                   /translation="MYAVFQSGGKQHRVSEGQTIRLEKLDIATGETVEFDQVLMVANGE
FT                   DIKIGAPVVEGVKIKAEVVAHGRGEKIKIVKFRRRKHSRKQQGHRQWFTDVKITGIA"
FT   CDS_pept        422794..423051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0091"
FT                   /gene="rpmA"
FT                   /locus_tag="XNC1_0491"
FT                   /product="50S ribosomal subunit protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0491"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88565"
FT                   /db_xref="GOA:D3VIL5"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIL5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88565.1"
FT                   /translation="MAHKKAGGSTRNGRDSESKRLGVKRFGGESVLAGSIIVRQRGTKF
FT                   HAGNNVGCGRDHTLFALADGKIKFEVKGPKNRKFISIEAE"
FT   CDS_pept        423057..423197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0091"
FT                   /locus_tag="XNC1_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0492"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88566"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIL6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88566.1"
FT                   /translation="MTLVELEALQCVLRGFLYFGLRHLWVLPAIQLYSGYPTEKKDEIC
FT                   R"
FT   regulatory      423059..423118
FT                   /operon="XNC1_operon0091"
FT                   /locus_tag="XNC1_0492"
FT                   /regulatory_class="promoter"
FT   regulatory      423074..423117
FT                   /operon="XNC1_operon0091"
FT                   /locus_tag="XNC1_0492"
FT                   /regulatory_class="terminator"
FT   CDS_pept        423181..424347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0091"
FT                   /gene="obgE"
FT                   /locus_tag="XNC1_0493"
FT                   /product="putative GTP-binding protein with nucleoside triP
FT                   hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0493"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88567"
FT                   /db_xref="GOA:D3VIL7"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIL7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88567.1"
FT                   /translation="MKFVDEARILVVAGDGGNGCVSFRREKYIPKGGPDGGDGGDGGDV
FT                   YLLADENLNTLIDYRFEKSFRAERGQNGQSRDCTGKRGQDITIKVPVGTRVRDIGTGEV
FT                   LGDMLRHEQRFMVAKGGFHGLGNTRFKSSVNRAPRQRTMGTPGESRELMLELMLLADVG
FT                   MLGMPNAGKSTFIRAVSAAKPKVADYPFTTLVPSLGVVRMDNEQSFVVADIPGLIEGAS
FT                   EGAGLGIRFLKHLERCRVLLHLIDLCPIDESNPVENARIIIRELYKYSEKLAEKPRWLV
FT                   FNKVDLIDSEEAKQRAKAIADELGWEGDYYMISAVNRQGVKELCWDIMEFMKTQPRSME
FT                   MSEEAQPEKVEFMWDDYHKEQLEQSSEDDFDDDWDEDDDEGIEFIYKR"
FT   regulatory      complement(424366..424399)
FT                   /regulatory_class="terminator"
FT   regulatory      424375..424414
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(424423..425961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacB"
FT                   /locus_tag="XNC1_0494"
FT                   /product="D-alanyl-D-alanine carboxypeptidase,
FT                   penicillin-binding protein 4"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0494"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88568"
FT                   /db_xref="GOA:D3VIL8"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIL8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88568.1"
FT                   /translation="MDHRLLFPELHLSIIHTNIIEIHPLSYARSMALLKISSRIACMLS
FT                   LSLSVFSVNASAVEEGTQYLPTGTNFSFIAQKIGSKTPLMDYHGQQLALPASTQKIVTA
FT                   LSALLQLGKDYRFVTTLESDANISDGTLEGNLTARFVGDPMLTRSQLRNMTEALKQSGI
FT                   KQINGDLIIDVSIFASHDKAPGWVWNDMTQCFSSPPTAAIVDKNCFSVSLNSAEQPGKL
FT                   AFVRIPSFYPVSVLSEVKTLAKGSPEAKYCELDVTAGDLNRYTLTGCLTQRDEALPLAF
FT                   AIQNGASYAGKILKNELTIAGIELKGHIRRQSLPQQPEKILALNQSVPLHDMLKIMLKK
FT                   SDNMIADALFRTLGHRYFNVPGTWRAGSDAVRQILKQKAGIDLGNTIIVDGSGLSRHNL
FT                   ISAATMMEILQFIAQNNEELDFISMLPKAGYDGTLAYRPGLHEAGVDGKVFAKTGSLQG
FT                   VYNLAGFLTAVSGQQIAFVQFISSYSVPPEDQRTRRVPLTRFENYLYKSLYKNH"
FT   regulatory      425949..426008
FT                   /regulatory_class="promoter"
FT   regulatory      complement(425992..426051)
FT                   /regulatory_class="promoter"
FT   CDS_pept        426145..426621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="XNC1_0495"
FT                   /product="transcription elongation factor, cleaves 3'
FT                   nucleotide of paused mRNA"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0495"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88569"
FT                   /db_xref="GOA:D3VIL9"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIL9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88569.1"
FT                   /translation="MKQIPMTVRGADKLREELEHLRNVRRPQIITAIADAREHGDLKEN
FT                   AEYHAAREQQGFCEGRIQEIEAKLSNAQVIDVTKMTNNGRVIFGATVTVLNVDSDEEQT
FT                   YRIVGDDEANIKENLLSVNSPIARGLIGKEVDDAVVIATPGGQVEYEVLNVDYL"
FT   regulatory      complement(426651..426677)
FT                   /regulatory_class="terminator"
FT   regulatory      426657..426697
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(426729..427055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhbY"
FT                   /locus_tag="XNC1_0496"
FT                   /product="putative RNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0496"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88570"
FT                   /db_xref="GOA:D3VIM0"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIM0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88570.1"
FT                   /translation="MSFSIPTKQKKMTLNKKQVQYLKSLAHSLKPVVMIGNNGLTEGVL
FT                   AEIEQTLSHHELIKVKVAGEDREIKTLIAEAIVRETGAHNVQIIGKMLVLYRPSEERKI
FT                   SLPK"
FT   regulatory      427008..427067
FT                   /regulatory_class="promoter"
FT   regulatory      complement(427130..427189)
FT                   /regulatory_class="promoter"
FT   operon          427156..429747
FT                   /operon="XNC1_operon0092"
FT   CDS_pept        427156..427785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0092"
FT                   /gene="ftsJ"
FT                   /locus_tag="XNC1_0497"
FT                   /product="23 S rRNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0497"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88571"
FT                   /db_xref="GOA:D3VIM1"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR004512"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIM1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88571.1"
FT                   /translation="MANKKRSASSSRWLQEHFSDKYVLQAQKKGLRSRAWFKLDEIQQS
FT                   DKIFKPGMTVVDLGAAPGGWSQYVVSQIGNSGRVIACDLLPMDPIVGVDFLQGDFRDEL
FT                   VLKTLLERVGDNKVQVVMSDMAPNMSGTPAVDIPRSMYLIELALDMCRDVLAPGGSFIV
FT                   KVFQGEGFDEYLREIRSLFAKIKIRKPEASRARSREVYIVATGRKV"
FT   CDS_pept        427834..429747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0092"
FT                   /gene="ftsH"
FT                   /locus_tag="XNC1_0498"
FT                   /product="ATP-dependent zinc-metallo protease"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0498"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88572"
FT                   /db_xref="GOA:D3VIM2"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIM2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88572.1"
FT                   /translation="MSDMAKNLILWLVIAVVLMLLFQSFGPSDSSGRRVDYSNFINEIS
FT                   QNQVSEVRISGRDIDFTKKDNGGKYSTYMPIQDEKLLDTLLNKQVKVVGEPPEQQGLLA
FT                   TLFISWFPMLLLIGVWIFFMRQMQGGGGKGAMSFGKSKARMLTEDQIKTTFADVAGCDE
FT                   AKEEVGELVEYLREPGRFQKLGGKIPKGILMVGPPGTGKTLLAKAIAGEAKVPFFTISG
FT                   SDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQ
FT                   MLVEMDGFEGNEGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMR
FT                   RIPLDTDIDASIIARGTPGFSGADLANLVNEAALFAARGNKRVVSMVEFEKAKDKIMMG
FT                   AERRSMVMTEEQKESTAYHEAGHAIIGRLVPEHDPVHKVTIIPRGRALGVTFFLPEGDQ
FT                   ISASRQKLESQVSTLYGGRLAEEIIYGVDSVSTGASNDIKVATSIARNMVTQWGFSEKL
FT                   GPLLYAEEEGEVFLGRSVAKAKHMSEDTARLIDQEVKAIVDRNYIRARQILMDNLDILH
FT                   SMKDALMKYETIDAPQIDDLMNRTTVRPPAGWEGDNNGGNNRQTPSSSQQTAKPADGNP
FT                   TA"
FT   regulatory      429780..429810
FT                   /regulatory_class="terminator"
FT   operon          429822..432566
FT                   /operon="XNC1_operon0093"
FT   CDS_pept        429822..430655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0093"
FT                   /gene="folP"
FT                   /locus_tag="XNC1_0499"
FT                   /product="7,8-dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0499"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88573"
FT                   /db_xref="GOA:D3VIM3"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIM3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88573.1"
FT                   /translation="MKLTARGSVLDLSCPQVMGILNITPDSFSDGGSHNTFDTALKHAA
FT                   KMIAEGATIIDVGGESTRPGADEVSEQQELDRVVPVIEALAQRFDAWISVDTSKAVVMR
FT                   ESAQAGAHIINDIRALQEPGALNAAAQTGLPVCLMHMQGQPRTMQTEPHYEDVVSEVKS
FT                   FLIQQIELCIAAGVAKNNLILDPGFGFGKNLSHNYQLLAHLQEFHPLGLPILAGMSRKS
FT                   MIGQLLHVPPQERVTGSVACAVIAAMQGAQIIRVHDVKETVQAMRIVQATLSVRN"
FT   CDS_pept        430714..432051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0093"
FT                   /gene="glmM"
FT                   /locus_tag="XNC1_0500"
FT                   /product="phosphoglucosamine mutase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0500"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88574"
FT                   /db_xref="GOA:D3VIM4"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIM4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88574.1"
FT                   /translation="MSNRKYFGTDGIRGKVGNTPITPDFVLKLGWAAGKVLARHGSRKI
FT                   IIGKDTRISGYMLESALEAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHN
FT                   PYYDNGIKFFSIDGTKLPDDVEEAIEAEMEKPLTCVESAELGRANRIVDAAGRYIEFCK
FT                   GTFPSEQSLNGLKIVLDCANGATYHIAPNVLRELGAEVITIGCEPNGININEECGATDV
FT                   RLLQKRVLEEQANVGLAFDGDGDRIIMVDHLGHKVDGDQILYIIAREALRQGQLRGGAV
FT                   GTLMSNMGLELALKQLGIPFERAKVGDRYVLEKLQEKGWRLGAENSGHVILLDKTTTGD
FT                   GIVAGLQVLSAMVRNNMNLHDLCSGMKLLPQILVNVRFAGNTDPLQSDSVLEAVKSVEA
FT                   ELNGRGRVLLRKSGTEPLIRVMVEGEDEKQVTALAHRIADTVKKMG"
FT   regulatory      432074..432133
FT                   /operon="XNC1_operon0093"
FT                   /regulatory_class="promoter"
FT   CDS_pept        432228..432566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0093"
FT                   /gene="secG"
FT                   /locus_tag="XNC1_0501"
FT                   /product="preprotein translocase, membrane component,
FT                   transport across inner membrane (General Secretory
FT                   Pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0501"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88575"
FT                   /db_xref="GOA:D3VIM5"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIM5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88575.1"
FT                   /translation="MYEALLGIFLLVGIGLIALVLLQQGKGADMGASFGAGASNTLFGS
FT                   SGSGNFMTRMTAILATLFIVISLILGNMTSNKVGSGSKWDNLSEPEKVEKQTDIPAEPV
FT                   KPNSDIPQ"
FT   tRNA            432653..432742
FT                   /gene="LeuGAG"
FT                   /locus_tag="XNC1_tRNA0018"
FT                   /product="tRNA-Leu"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   regulatory      432687..432754
FT                   /regulatory_class="terminator"
FT   tRNA            432801..432877
FT                   /gene="MetCAT"
FT                   /locus_tag="XNC1_tRNA0019"
FT                   /product="tRNA-Met"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   CDS_pept        complement(432882..433013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0502"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88576"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIM6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88576.1"
FT                   /translation="MDPIYCQWSQPTSSYTFFSKQPCKLGSMSKWLLNDYYGKDTCC"
FT   regulatory      433024..433083
FT                   /regulatory_class="promoter"
FT   operon          433136..439321
FT                   /operon="XNC1_operon0094"
FT   CDS_pept        433136..433558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0094"
FT                   /locus_tag="XNC1_0503"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0503"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88577"
FT                   /db_xref="GOA:D3VIM7"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIM7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88577.1"
FT                   /translation="MISAPVEALGFELVGLEFIRARVSTLRVYIDSEEGITVDNCADVS
FT                   HQVSAVLDVEDPISVLYNLEISSPGLERPLFTAEHYQRFIGEEVNVVLRMAMQNRRRWQ
FT                   GIIKAVDGEMITVTVDGKDEVFALSNIQKANLVPHF"
FT   CDS_pept        433580..435088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0094"
FT                   /gene="nusA"
FT                   /locus_tag="XNC1_0504"
FT                   /product="transcription pausing; L factor"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0504"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88578"
FT                   /db_xref="GOA:D3VIM8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIM8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88578.1"
FT                   /translation="MNKEILAVVEAVSNEKSLPREKIFEALEIALATATKKKYEQEIDV
FT                   RVCIDRKSGDFDTFRRWLVVEEVTLPTREITLDAAKFEDPEIELGSYVEDQIESVTFDR
FT                   ITTQTAKQVIVQKVREAERAMVVDQFREQQGEIVTAQVKKVNRENITLDLGNNAEAVIL
FT                   REDMLPRENFRPGDRVRGVLYDVRPEARGAQLFITRSRPEMLVELFRIEVPEIGEEIIE
FT                   IKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSSELGGERIDIVLWDDNPA
FT                   QFVINAMAPADVASIVVDEDNCTMDVAVENSNLAQAIGRNGQNVRLAAQLLKKHRGDDK
FT                   WELNVMTAEELQAKHQAEAHASIDTFTKHLDIDEDFATVLVEEGFSTLEELAYVPINEL
FT                   LAVEGLDEESVEVLRERAKAALTTLELAQKESLSDQQPAEDLLNLPGMERTLAFNLAAH
FT                   GICTLEDLAEQGIDDLSDIEGLNDEKAGELIMAARNICWFGDDA"
FT   CDS_pept        435114..437885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0094"
FT                   /gene="infB"
FT                   /locus_tag="XNC1_0505"
FT                   /product="protein chain initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0505"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88579"
FT                   /db_xref="GOA:D3VIM9"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIM9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88579.1"
FT                   /translation="MTEVTVKLLAEEIQTSVERLIQQFSDAGIQKTATDSVSQKEKEAL
FT                   LAHLNREQGGSGGQPGKLTLQRKTRSTLNVPGTGGKSKSVAIEVRKKRTYVNRDAIEQA
FT                   KAEEQAKREAEEQARREVEEKARLEAEAKKLAEEQAKREAEEKAKREAEESAQRVAEDK
FT                   AKRDETKLSQREAAEKEKVTKQHTENKPKSVQTESAAQNEKARREAEAADLKRKAEEEV
FT                   RRKVEAEAKRVAEEARRMAEENQDKWSDDSETSDSNDYHVTTSRYARDAEDENDAKVEG
FT                   DRRSRSRGGKSTRQKKNNKHSESKADREEARAVGRTKGKQRKGSALQQSFTKPVVAVNR
FT                   DVVIGETITVAELANKMAVKGSQVVKTMMKMGAMVTINQVIDQETAQMVAEEMGHKVIL
FT                   RRENELEEALMSDRDTGETLAEFRAPVVTIMGHVDHGKTSLLDYIRSTKVASGEAGGIT
FT                   QHIGAYHVKTEKGMITFLDTPGHAAFTSMRARGAKATDIVVLVVAADDGVMPQTIEAIQ
FT                   HAKAANVPVVVAVNKIDKPEADPDRVKNELSQYGIIPEDWGGETQFISVSAKAGLGIDE
FT                   LLEAILLQAEVLELQAVRTGMANGVVIESFLDKGRGPVATILVQSGTLNKGDIVLCGFE
FT                   YGRIRAMRNELGREVTSAGPSMPVEILGLSNVPSAGDEATVVRDEKKAREVALYRQGKF
FT                   REVKLARQQKSKLENMFANMEEGKASELNIVLKTDVQGTCEAICDSLLKLSTDEVKVKI
FT                   IGSGVGGITETDATLAAASNAIILGFNVRADASARRIIENENLDLRYYSVIYSLIDEIK
FT                   QAMSGMLAPEFKQQIMGLAEVRDVFKSPKFGAIAGCMVTEGTIKRHNPIRVLRDNVVIY
FT                   EGELESLRRFKDDVNEVRNGMECGIGVKNYNDVRVGDMIEVFEVIEVKRSID"
FT   CDS_pept        437961..438371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0094"
FT                   /gene="rbfA"
FT                   /locus_tag="XNC1_0506"
FT                   /product="ribosome-binding factor, role in processing of
FT                   10S rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0506"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88580"
FT                   /db_xref="GOA:D3VIN0"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIN0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88580.1"
FT                   /translation="MARDFSRTQRVAQEMQKEIAIILQREIKDPRIGMATVSGVEVSRD
FT                   LAYAKVFVTFLNVLVEGHDSDQVKEGIKALNDASGFIRSLLGKAMRLRIVPELTFSYDS
FT                   SLVEGMRMSNLVSNVVKNDEQRRASADHNEEE"
FT   CDS_pept        438371..439321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0094"
FT                   /gene="truB"
FT                   /locus_tag="XNC1_0507"
FT                   /product="tRNA pseudouridine 5S synthase"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0507"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88581"
FT                   /db_xref="GOA:D3VIN1"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIN1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88581.1"
FT                   /translation="MGRRRRGRAIHGVLLLDKPQDISSNDALQKVRRIFNASKAGHTGA
FT                   LDPLATGMLPICLGEATKFSQFLLDSDKRYRVIARLGQRTDTSDSHGQIISEREVQITQ
FT                   SQLDTALDTFRGDTMQVPSMYSALKHQGKPLYEYARQGIEVKREARPITVYELQFIRWE
FT                   GNELELEIHCSKGTYIRTIIDDLGELLGCGAHVIYLRRLQVANYPHQRMVTLEQLYELK
FT                   QQAEDQEIDAGKLLDPLLLPMDTAVAHFPVIHLVSVVASYFKQGQPVRSKHNLVSGEWV
FT                   RVTEGDENKFIGIAVIDDDGLVAPRRLVVETDIES"
FT   regulatory      439367..439426
FT                   /regulatory_class="promoter"
FT   regulatory      439383..439437
FT                   /regulatory_class="terminator"
FT   operon          439494..442151
FT                   /operon="XNC1_operon0095"
FT   CDS_pept        439494..439763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0095"
FT                   /gene="rpsO"
FT                   /locus_tag="XNC1_0508"
FT                   /product="30S ribosomal subunit protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0508"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88582"
FT                   /db_xref="GOA:D3VIN2"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIN2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88582.1"
FT                   /translation="MSLSTAAKAQILVDFGRGANDSGSSEVQIALLTADINQLQGHFSE
FT                   HKKDHHSRRGLLRKVAQRRKLLNYLKRKDLARYTTLIERLGLRR"
FT   regulatory      439784..439814
FT                   /operon="XNC1_operon0095"
FT                   /regulatory_class="terminator"
FT   regulatory      439813..439872
FT                   /operon="XNC1_operon0095"
FT                   /regulatory_class="promoter"
FT   CDS_pept        440013..442151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0095"
FT                   /gene="pnp"
FT                   /locus_tag="XNC1_0509"
FT                   /product="polynucleotide phosphorylase, has polyadenylase
FT                   activity"
FT                   /EC_number="2.7.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0509"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88583"
FT                   /db_xref="GOA:D3VIN3"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIN3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88583.1"
FT                   /translation="MLNPIVRKFQYGQHTVTIETGMMARQATAAVMVNMDDTAVFVTVV
FT                   GQKKMKPGQDFFPLTVNYQERTYAAGRIPGSFFRREGRPGEGETLVARLIDRPLRPLFP
FT                   EGFLNEVQIIATVVSVNPQVNPDIVAMIGASAALALSGIPFNGPIGAARVGYINDQYVL
FT                   NPTSDELKNSRLDLVVAGTESAVLMVESEAELLTEDQMLGAVVFGHEQQQIVIENINSL
FT                   AAEAGKEKWDWAPEPINQSLHDRVAELAESRLGDAYRITEKQERYAQVNIIKEEVSVVI
FT                   LAESAEKGVELEEGEVLDALSGLEKNVVRGRVLSGEPRIDGREKDMVRALDVRTGVLPR
FT                   THGSSLFTRGETQALVAATLGTERDAQVIDELMGERTDRFLFHYNFPPYSVGETGMVGS
FT                   PKRREIGHGRLAKRGVLAVMPNASEFPYTVRVVSEITESNGSSSMASVCGASLALMDAG
FT                   VPIKAAVAGIAMGLVKEGDNFVVLSDILGDEDHLGDMDFKVAGSRDGISALQMDIKIEG
FT                   ITREIMQIALNQAKGARLHILSVMEQAIESPRNDISEFAPRIHTIKINPDKIKDVIGKG
FT                   GSVIRALTEETGTTIEIEDDGTVKIAATDGDKARHAISRIEEITAEVEVGRIYTGKVTR
FT                   IVDFGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQVGQEVPVKVLEIDRQGRIRLSMK
FT                   EAVATTDEAPQSPESSVE"
FT   regulatory      442167..442203
FT                   /regulatory_class="terminator"
FT   regulatory      442234..442293
FT                   /regulatory_class="promoter"
FT   CDS_pept        442339..443223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nlpI"
FT                   /locus_tag="XNC1_0510"
FT                   /product="NlpI lipoprotein believed to be involved in cell
FT                   division with transferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0510"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88584"
FT                   /db_xref="GOA:D3VIN4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023605"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIN4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88584.1"
FT                   /translation="MNSFLRWCYVVAIFLLVGCSNTGWRKNEIIAIPLQPTLQQEVILA
FT                   RMEQILASRSLTEDEYAQLLYERGVLYDSLGLRALAQNDFSVALSIRPDIPEIFNYLGI
FT                   YFTQAGNFDSAYEAFDSVLELDPTYNYARMNRGIALYYGGRYRLAQDDLQAFYQDDPND
FT                   PFRSLWLYLVEAKIDPKVAMTNLSHHFDKANRGLWGWNIAEFYLGKISEKILMERLQQN
FT                   SADNTSLAEHLSETDFYLGKHYLSLGDEDSAVALFKLTVANNVHYFVEHRYALLELALL
FT                   SQRQDDLSESNQQ"
FT   regulatory      443251..443293
FT                   /regulatory_class="terminator"
FT   regulatory      443306..443365
FT                   /regulatory_class="promoter"
FT   CDS_pept        443395..445344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deaD"
FT                   /locus_tag="XNC1_0511"
FT                   /product="cold-shock DeaD box ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0511"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88585"
FT                   /db_xref="GOA:D3VIN5"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028618"
FT                   /db_xref="InterPro:IPR034415"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIN5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88585.1"
FT                   /translation="MTTETEISFADLGLSAPILSALGDMGYEKPSPIQQQCIPHLLNGR
FT                   DVLGMAQTGSGKTAAFTLPLLHNINAELKAPQILVLAPTRELAVQVAEACSDFSKHMRS
FT                   VNVVALYGGQRYDVQLRALRQGPQIVVGTPGRLLDHLKRGTLDLSNLKGLVLDEADEML
FT                   RMGFIEDVENIMSQIPAEHQTALFSATMPEAIRRITRRFMNDPQEVRIQSSVTNRPDIS
FT                   QSYWSVYGVRKNEALVRFLEAEDFDAAIIFVRTKNATLEVAEALERNGYNSAALNGDMN
FT                   QTLREQTLERLKNGRLDILIATDVAARGLDVERISLVVNYDIPMDAESYVHRIGRTGRA
FT                   GRAGRALLFVENRERRLLRNIERTMKLTIPEVELPDAELLGQRRLEKFAANVQQQLESS
FT                   DLDQYRALLAKLGTDEELEMETLAAALLKMAQGERPLILPPDPVRRPRREFNDRDDRRR
FT                   NGNGFGDRDKSDRGDRGDRGDRPRRERRDVGDMELYRIEVGRDDGVEVRHIVGAIANEG
FT                   DISSRYIGNIKLFATHSTIELPKGMPGELLSHFTRTRILNKPLNMQLMGDAQPFERRER
FT                   RGGGRNGNGNGGNGPRRDRDNAGNGNNGGRRFNNERRGGGERGSFRGRNNDNFSGGAPR
FT                   RRQSNDNGNSTSNV"
FT   regulatory      complement(445411..445448)
FT                   /regulatory_class="terminator"
FT   regulatory      445423..445460
FT                   /regulatory_class="terminator"
FT   operon          complement(445534..447952)
FT                   /operon="XNC1_operon0096"
FT   CDS_pept        complement(445534..446343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0096"
FT                   /gene="yehT"
FT                   /locus_tag="XNC1_0512"
FT                   /product="putative response regulator in two-component
FT                   regulatory system"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0512"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88586"
FT                   /db_xref="GOA:D3VIN6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIN6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88586.1"
FT                   /translation="MVSKFSVNQKNLPVSFYVYHWKNRLENGVNMNVLIVDDEPLAREN
FT                   LRCLLEKETDIQIIGECANAVEAIGTIHRLKPDVVFLDIQMPRITGLEMVGMLDPEHRP
FT                   YIVFLTAFDEYAVQAFEEHAFDYLLKPLEKERLSKTLQRLRSGYQKQNLAGLPREDEQL
FT                   KYIPCTGHSRIWLMPLDDVLYVTSRLSGVYVTNTCGQEGFTELTLRTLESRTSLTRCHR
FT                   QYLVNMTHLREIVFGESGQTELVVRNDERIPVSRRYLKPLKEELGLN"
FT   CDS_pept        complement(446273..447952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0096"
FT                   /gene="yehU"
FT                   /locus_tag="XNC1_0513"
FT                   /product="putative sensory kinase in two-component
FT                   regulatory system"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0513"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88587"
FT                   /db_xref="GOA:D3VIN7"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIN7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88587.1"
FT                   /translation="MYEFNLVLLLLQQMCIYLVIAWLLSKTPLFIPLLQITVRLPHKMM
FT                   CYVIFSIFCIMGTYFGLNVNDSIANTRAIGAVLGGFLGGPTVGAMVGFTGGLHRYSLGG
FT                   MTAFSCMVSSIVEGVLGGLVHIYLMKRGQINKLLNPWTAAIVTLLAECAQMGIILLLAS
FT                   PFDEALSLVKDIAAPMIIANSTGAAMFIRILLDRRAIFEKYTSAFSAQALKIAVCTEGI
FT                   LRKGFNEDNSMRVAKVIYQELEIGAVAITDREKLLAFIGIGSDHHLPGTPIASEQSRRA
FT                   IEKNEVMYADGNETPYCCSLSPTCKLGSALVIPLRGENQQVIGTIKLYEVKNRLFSSIN
FT                   RTLGEGIASLLSAQILAGQYERNKQSLLQSEVKLLHAQVNPHFLFNALNTLQAVIRRDS
FT                   QQAGQLVQYLSTFFRKNLKRPEEIATLKNEIEHVNAYLQIEKARFREHLQIAIEIPESL
FT                   CGARLPAFSLQPMVENAIKHGTSQLLDTGKITIKAHQKNNLLLVEIEDNAGLYCPKQTG
FT                   DGLGMSLVDKRLQLRYGEQYGVKVQCQPEEFTRVILCLPLEK"
FT   regulatory      complement(447991..448050)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(447997..448051)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(448118..451159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0514"
FT                   /product="putative invasin"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0514"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88588"
FT                   /db_xref="GOA:D3VIN8"
FT                   /db_xref="InterPro:IPR003535"
FT                   /db_xref="InterPro:IPR008541"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015217"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR024519"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR038177"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIN8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88588.1"
FT                   /translation="MNKKFDKSRLHNQQGLLKRVAWVNIVTQLMFPLVGAFTPALTTAE
FT                   THTSQNEKWAIPTEPYILQSGETINTVAKRYGLTVNGLKKINQLRTFDKPFTALGTGSE
FT                   IDVPKPRENKFLPFNYSALTHSTLSHSTLSNSEPDNTPATDETSRRFAEASSQASHFLA
FT                   QPSHIGKNAVSQLSHLAMREANRQIQDWLGRYGTARVQANIDSRGRLNGSQLDMLLPLH
FT                   DTKSQMIFTQFGLRRIDKRNTINLGVGQRQFFDGWMLGYNAFLDHDFTGENTRFGLGAE
FT                   YARDYLKLGVNSYFRLSHWKESRLLTDYDERPANGFDLRAQGYVPSLPQLGGKLVYEHY
FT                   FGDEVGLINKDHRSTNPSAFTAGINYTPIPLLTFVIDRRQDASGNGETQFNMELNYEIG
FT                   TPWAQQIDPGAVTFKRTLQGSRYDLVDRNNQIVLEYRKREVISLAMDNSIVGNAGDIKP
FT                   IHISIKSKYGLKEIKWDAPGLFANGGTIKSQGGTHYLLTLPKYQIQGNNTYTVGAIAYD
FT                   EKGNASNRAEMQLHVLRAEANANQSTFTAKDKELAADGHSKTLLILALKNKQGDPISGI
FT                   APDIKLGASGLSGKGRDPQIETMQETQPGIYQSLLTAGEKTGVLKITPQVDGITIKPVE
FT                   ILFVHPEAPLIKNLTIFGKLAMGQTLRATYTFNSNHGDATDKSRYVWGDKGSTDISKGH
FT                   AITESGKIPDYPLTLSDAGTVKELAVQARNALGIIGNTNIVDTSMSAEQGNHTYDSGKG
FT                   GTVRGLADSMTTTISTGKVKKGESITLTIKTLNHGKAVRNVAVRVNAIKALNRQNVSES
FT                   PTVLLNGQSGIYQDFTDKQGMLSVVITDPNGLGVKTTLSVTADRTAAPQTQDVIFTVVT
FT                   SPDVDVANFWGHMDEAAVAENGIVFTRPKLQAEVTRMHFKAMDTHTEAGEVWPKRIHFG
FT                   AELYCKGIHGTLPTKEELMGLYNAHPNNAMHDIYGWPQQRAYRSSTPHIEKNSRKNEHY
FT                   SVNIDLGVLHIVGKTTTEYTICKQ"
FT   regulatory      complement(451193..451252)
FT                   /regulatory_class="promoter"
FT   regulatory      452439..452498
FT                   /regulatory_class="promoter"
FT   operon          452552..453321
FT                   /operon="XNC1_operon0097"
FT   CDS_pept        452552..452809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0097"
FT                   /locus_tag="XNC1_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0515"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88589"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIN9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88589.1"
FT                   /translation="MGDLLSILDVESGNAAGSWLTLFFQRRLRIEGNTELGLHVKNLLD
FT                   STELESMPSILRFGLLRLAEFIKAGQKEGVDQHDRALSPC"
FT   CDS_pept        452803..453321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0097"
FT                   /gene="yhbS"
FT                   /locus_tag="XNC1_0516"
FT                   /product="putative acyl-CoA N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0516"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88590"
FT                   /db_xref="GOA:D3VIP0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIP0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88590.1"
FT                   /translation="MLIRVEIPVDAMGIDRLLRQSFETSAEAEVVSQLREDGLLTLGIV
FT                   ATDDEGHVIGYVGFTPVDINGEDHQWVSLGPLAIAEPYRHHGLSEKLVYEGLDSLNEFG
FT                   YRAVVALGDPEYYSRFGFQFANEYQLYCPWPDCEDYFLIYPLADVSLEGCQGLVTYPAH
FT                   FDNLWSRPE"
FT   CDS_pept        complement(453344..453655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0517"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0517"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88591"
FT                   /db_xref="GOA:D3VIP1"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR022992"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIP1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88591.1"
FT                   /translation="MTESSWYLYLIRAQNGALYTGITTDVSRRLMQHTSGKGAKALRGK
FT                   GPLILVYQGLVKDRGTALKAEYRVKRLSKQQKERLIMIQPLCITTYLVTIGFSETFFT"
FT   regulatory      453398..453436
FT                   /regulatory_class="terminator"
FT   regulatory      complement(453760..453819)
FT                   /regulatory_class="promoter"
FT   regulatory      453767..453826
FT                   /regulatory_class="promoter"
FT   CDS_pept        453933..454184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0518"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0518"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88592"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIP2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88592.1"
FT                   /translation="MKVVKNIMAILTLSAISFGSFAATEVKDAKSDKIGVVSVTGASTL
FT                   DSLTEELSKKADKAGATYFRVVFANGQNQLNGVAEIYK"
FT   regulatory      454234..454274
FT                   /regulatory_class="terminator"
FT   CDS_pept        454300..454731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0519"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0519"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88593"
FT                   /db_xref="GOA:D3VIP3"
FT                   /db_xref="InterPro:IPR011194"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIP3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88593.1"
FT                   /translation="MDLNKEILTIQRYLAKQHVFTLCTYSTQDFWCASCFYVFDADSMA
FT                   FWFMTETDTRHGHLMQKNPVVAGTVAGQTRNIAKIKGIQFRGEVIRLTGEDEAVARARY
FT                   CRRFPVALTAKSPVWQLNLNEIKMVDNTLGFGKKWYWQR"
FT   operon          complement(454767..457110)
FT                   /operon="XNC1_operon0098"
FT   CDS_pept        complement(454767..455231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0098"
FT                   /gene="nrdG"
FT                   /locus_tag="XNC1_0520"
FT                   /product="anaerobic ribonucleotide reductase activating
FT                   protein"
FT                   /EC_number="1.97.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0520"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88594"
FT                   /db_xref="GOA:D3VIP4"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIP4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88594.1"
FT                   /translation="MNYHQYYSVDAVNGPGTRCTLFVSGCLHQCRGCYNQSTWRSDSGL
FT                   PFTQATEDQIIADLKDHKIKRQGLSLSGGDPLHPQNVPAILQLVKRVRKECPDQDIWLW
FT                   TGYVLNELSEIQCEVINDINVLVDGKFEQALYDPTLIWRGSHNQIIHYLR"
FT   CDS_pept        complement(455236..457110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0098"
FT                   /gene="nrdD"
FT                   /locus_tag="XNC1_0521"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0521"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88595"
FT                   /db_xref="GOA:D3VIP5"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIP5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88595.1"
FT                   /translation="MNYHQWHDQLDQEVRGLIEQNNFALLNENANKDSKVIPTQRDLLA
FT                   GIIARQYAKQYMLPHDVVAAHEKGEIHYHDLDYAPFFPMFNCMLIDLKGMLTQGFKMGN
FT                   AEIEPPKSISTATAVTAQIIAQVASHIYGGTTINRIDEVLAPFVTASYDKHLSIAKEWK
FT                   VADPVAYAEARTEKECYDAFQSLEYEVNTLHTANGQTPFVTFGFGLGISKASRLIQVSI
FT                   LRNRIAGLGKNRKTAIFPKLVFAIRDGLNHRFGDPNYDIKLLALECASKRMYPDILNYE
FT                   QVVKVTGSFKTPMGCRSFLSVYEENGQQIHEGRNNLGVISLNLPRIALEAKGNETVFWQ
FT                   LLDQRLLLAKKALMTRIERLENTKARVAPILYMEGACGVRLKADDDIAEIFKHGRSSIS
FT                   LGYIGIHETINALYGNQVHLFDDHQHQQKAISIVQHLRKAVDKWKLETGYGFSLYSTPS
FT                   ENLCDRFCRLDKKAFGVIQGVTDKGYYTNSFHLDVEKKVNPYDKLDFEASYPPLTNGGF
FT                   ICYGEYPNLQHNLKALEDVWDYSYSRVPYYGTNTPIDECYQCGFTGEFDCTSKGFTCPQ
FT                   CGNHNSAHVSVIRRVCGYLGSPDARPFNTGKQEEVKRRVKHLGSGHMG"
FT   CDS_pept        complement(457130..457351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0522"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0522"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88596"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIP6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88596.1"
FT                   /translation="MIISLSGLLFLARLSPFLITLPFFVLDQLCRLYISLNKLYIVFKY
FT                   MHNTIYGVYTQNYPHLIKASIHVIFACG"
FT   regulatory      complement(457243..457302)
FT                   /locus_tag="XNC1_0522"
FT                   /regulatory_class="promoter"
FT   regulatory      complement(457316..457356)
FT                   /regulatory_class="terminator"
FT   operon          complement(457386..458413)
FT                   /operon="XNC1_operon0099"
FT   CDS_pept        complement(457386..457817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0099"
FT                   /locus_tag="XNC1_0523"
FT                   /product="putative translation initiation inhibitor (YjgF)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0523"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88597"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIP7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88597.1"
FT                   /translation="MAVSHNFLDVKQEFLMSRSIHTENAPAAIGPYVQGVDLGSMVITS
FT                   GQIPVDPKTGAIPEDITAQARQSLENVKAIIEQSGLKVSDIVKTTVFVKDLNDFSTVNA
FT                   AYEAFFAEHNAPFPARSCVEVARLPKDVKIEIEAIAVRG"
FT   CDS_pept        complement(457949..458413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0099"
FT                   /gene="pyrI"
FT                   /locus_tag="XNC1_0524"
FT                   /product="aspartate carbamoyltransferase, regulatory
FT                   subunit (allosteric regulation)"
FT                   /EC_number="2.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0524"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88598"
FT                   /db_xref="GOA:D3VIP8"
FT                   /db_xref="InterPro:IPR002801"
FT                   /db_xref="InterPro:IPR020542"
FT                   /db_xref="InterPro:IPR020545"
FT                   /db_xref="InterPro:IPR036792"
FT                   /db_xref="InterPro:IPR036793"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIP8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88598.1"
FT                   /translation="MTQDHQLQVEAIKCGTVIDHIPAHIGFKLLSLFKLTETDQRITIG
FT                   LNLPSNHLGKKDLIKIENTFLTEQQANQLALYAPQATINNIENYVVVKKMPINLPEQID
FT                   SVLVCPNSNCISHNEPVNSSFHVKTAENDVVLRCKYCEKEFDRQAVINND"
FT   regulatory      458575..458634
FT                   /regulatory_class="promoter"
FT   regulatory      complement(458589..458648)
FT                   /regulatory_class="promoter"
FT   operon          458711..460269
FT                   /operon="XNC1_operon0100"
FT   CDS_pept        458711..459136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0100"
FT                   /locus_tag="XNC1_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0525"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88599"
FT                   /db_xref="GOA:D3VIP9"
FT                   /db_xref="InterPro:IPR000755"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIP9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88599.1"
FT                   /translation="MEKITVDRGFDWPTMNKIPIDECYEPLEKIIDTDKLKQKPVYVTL
FT                   FDIASGQALWLGTAFDEVSELSYTAALEKSPDENMPATLYRRLLYQAMTQVGFSNLPTE
FT                   WWHYDYGNSLWAFYKNKTAIYGATAGVIPPKYRSVHK"
FT   CDS_pept        459182..459448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0100"
FT                   /locus_tag="XNC1_0526"
FT                   /product="Low calcium response locus protein S"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0526"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88600"
FT                   /db_xref="GOA:D3VD11"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D3VD11"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88600.1"
FT                   /translation="MKKSRFTDSQILTILKQAEAGAPVPELCREHGISSARFYKWRAKY
FT                   GGMDASLMTRLKEREEENRRLKKMYAEERLKAEIIQEAMIKKW"
FT   CDS_pept        459469..460269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0100"
FT                   /locus_tag="XNC1_0527"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0527"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88601"
FT                   /db_xref="GOA:D3VIQ1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIQ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88601.1"
FT                   /translation="MAKNAVEQKSISIRRACRIFRLSESRYHYKAQLSSENQQIAEWLL
FT                   TITAQQRNWEFGLCYLYLRNVKGFHWNHKRVYRIYCELALNKRIKPKKRLKREQPDPLK
FT                   IPGTPNESGSMDFMHDQLSDGRSVRLLNIIDDFNREALTIEVDFSLPSCRVIRTLEQLM
FT                   EWRGKPVSIRCDNGPEYTSTEFQAWAKQHQIQLNFIQPGKPQQNAYVERYNRTVRYDWL
FT                   GQYLFASLSELQDSATKWTWFYNHERPNMALGGYTPKQHLLRVA"
FT   CDS_pept        complement(460279..460662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0528"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88602"
FT                   /db_xref="GOA:D3VIQ2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIQ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88602.1"
FT                   /translation="MQESNNKKTTEADILLSNIAQDIDFIMKKRNIDSQTLSKLTGLGI
FT                   ATINSLKRGVGNPTISTISSIADIFGVNIGEITDSKLSELTESEEIISSVPLVRYDELD
FT                   GYISGEIANINLYKLSIQDDHGG"
FT   regulatory      complement(460726..460785)
FT                   /regulatory_class="promoter"
FT   CDS_pept        461415..463733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeP"
FT                   /locus_tag="XNC1_0529"
FT                   /product="putative formate dehydrogenase (C-terminal),
FT                   related to acid resistance with formate dehydrogenase/DMSO
FT                   reductase, domains 1-3 and ADC-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0529"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88603"
FT                   /db_xref="GOA:D3VIQ3"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIQ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88603.1"
FT                   /translation="MKFKSKIKPYHSAAGGWGSLEATTRFVFDSKQALKNMVNLMRMNK
FT                   PKGFDCPGCAWGDDNKSLFSFCENGAKAMTWEATRRYVDRVFFATHSVSKLYQQSDYFL
FT                   EYQGRVVEPMSYNPQTDHYEPISWDNAFALIASHIKAMDNPNQLELYTSGRASNEASWL
FT                   YQLFGRVLGTNNFPDCSNMCHEASGYGMLQSLGIGKGTIRLQDFDHADAIFVFGQNPGT
FT                   NHPRMLHSLRHAAEHGARIVTFNTLRERGLERFADPQKPLEVITPMAGEISHRYYQPKL
FT                   GGDMAVVRGMVKALLETHNALLAEGKSGIFDLAFISAYTEGVDAYLQEVAMTEWSFIEN
FT                   QSGLTEAQLREAAAIYQNAERVICTWAMGITQHKHSLVTVREIINLQLLFGQLGKSGAG
FT                   LCPVRGHSNVQGNRTMGINEKPNPLFLDSMATHFGFEPPRAHGHHVVEALGAMLRDEVK
FT                   VLIALGGNLAAAAPDSPRTEEALQHCDLTVHISTKLNRSHLVTGKKGALILPTLGRTER
FT                   DIQATGPQFVTVEDSFSMVHASEGVNKPLFDTQRSETAIIAGIANATTGNTETINWLEL
FT                   AGDYNKIRDHIAATISGFEGFNKKCEHPGGFYLGNAAAELHFATPSKKAEFSHAPLPKT
FT                   LFPQIDGADVPFTLQTLRSHDQYNTTIYGLDDRYRGVYGQREVLFMNPEDIAQSGYQAG
FT                   DLVDIETIWNDGIQRKVFGFKLVPYAIPRGNLAAYYPETNPLVPMESIGEGTGTPTSKS
FT                   VPVTLSLTEQKQSEPRRIV"
FT   regulatory      463851..463910
FT                   /regulatory_class="promoter"
FT   regulatory      463876..463936
FT                   /regulatory_class="terminator"
FT   operon          463944..464590
FT                   /operon="XNC1_operon0101"
FT   CDS_pept        463944..464216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0101"
FT                   /locus_tag="XNC1_0530"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0530"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88604"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIQ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88604.1"
FT                   /translation="MAITRLRQQGGAVVVTIPSDVATVMGWSVGMQLDIKSSGDTISIK
FT                   PVERIARGRKSLSELLQSIDETEVRAFNEATAGDLNSPPVGNEVI"
FT   CDS_pept        complement(463964..464341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0531"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88605"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIQ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88605.1"
FT                   /translation="MIQCKFRDNQIIIGPFELSAANRIAVSVPDFTLAWDVPSTHHQIT
FT                   SLPTGGEFKSPAVASLKARTSVSSMLCNSSESDFLPLAILSTGLMLIVSPDDFISNCIP
FT                   TDHPITVATSLGIVTTTAPPC"
FT   CDS_pept        464216..464590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0101"
FT                   /locus_tag="XNC1_0532"
FT                   /product="putative plasmid-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0532"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88606"
FT                   /db_xref="GOA:D3VIQ6"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIQ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88606.1"
FT                   /translation="MVSRRNVPGKGEIWHTNGNPVSGREFKGADYYLVISEFALNQKLG
FT                   TALCVPITSGGGPARSEAITVYLDGSSTDAGKITGIALCYQIRSLDLNERKATYAAQAE
FT                   PDIVDEILAKVIDILDPQLN"
FT   CDS_pept        complement(464660..464806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0533"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88607"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIQ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88607.1"
FT                   /translation="MTLYGVTPRKELTSHNFRLHDADISLIDQQELLLAMPLKKEVMNT
FT                   RLI"
FT   CDS_pept        465042..465203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0534"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88608"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIQ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88608.1"
FT                   /translation="MMNILVNLEQAKNKKYRRVYPGRERERFLSLNCMLYNHISSKNNS
FT                   EWSYQGIY"
FT   regulatory      complement(465520..465573)
FT                   /regulatory_class="terminator"
FT   operon          complement(465591..467245)
FT                   /operon="XNC1_operon0102"
FT   CDS_pept        complement(465591..466532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0102"
FT                   /gene="pyrB"
FT                   /locus_tag="XNC1_0535"
FT                   /product="aspartate carbamoyltransferase, catalytic
FT                   subunit"
FT                   /EC_number="2.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0535"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88609"
FT                   /db_xref="GOA:D3VIQ9"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIQ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88609.1"
FT                   /translation="MANPLYRKHIISINDLNRTDLELVLQTAAALKANPQTELLKHKVI
FT                   ASCFFEASTRTRLSFETAIQRLGASVVGFADSSNTSLGKKGETLADTISIISQYADAIV
FT                   MRHPQEGAARLASEFSANIPIINAGDGANQHPTQTLLDLFTIQETQGKLENLKIAMVGD
FT                   LKYGRTVHSLTQALAKFNGNHFCFIAPDALAMPSYILHMLDEKQVSYSLYNNFEDVLPE
FT                   LDILYMTRVQKERLDPSEYANIKAQFVLRAADLENVKENLKVLHPLPRIDEITVDVDKT
FT                   PYAYYFQQAGNGIFARQALLSLVLNEEVVINN"
FT   CDS_pept        complement(466590..466757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0102"
FT                   /locus_tag="XNC1_0536"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0536"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88610"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIR0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88610.1"
FT                   /translation="MNTIVSIMRDDLLGENMKDDAVKAVKHQPNENLSAGSVGVLFFPL
FT                   LNRTFKKPLN"
FT   regulatory      complement(466630..466662)
FT                   /operon="XNC1_operon0102"
FT                   /locus_tag="XNC1_0536"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(466728..466787)
FT                   /operon="XNC1_operon0102"
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(466817..467245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0102"
FT                   /locus_tag="XNC1_0537"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0537"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88611"
FT                   /db_xref="GOA:D3VIR1"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIR1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88611.1"
FT                   /translation="MNYAKVSPKIINPLYKCYEEIHAAELDQALILLVETRVSQINGCA
FT                   YCCHLHAEAIRKDHGIEQVKLDKLPAWFNANIYSEKEQLALEWAEALTTNQRQSVLDGI
FT                   KSRLDTLFTEKEIVDLTAAISLMNALNRMAISLGDRSE"
FT   regulatory      complement(467361..467420)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(467457..467609)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0538"
FT                   /product="Ribonuclease Z (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ88612.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   regulatory      complement(467462..467516)
FT                   /locus_tag="XNC1_0538"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(467588..467971)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0539"
FT                   /product="Ribonuclease Z (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ88613.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   regulatory      468064..468123
FT                   /regulatory_class="promoter"
FT   CDS_pept        468342..468620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0540"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0540"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88614"
FT                   /db_xref="GOA:D3VIR4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIR4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88614.1"
FT                   /translation="MKLTTHKELHKKWMKDPEYCAAYEEETRKERLRETLQAWRRHAGL
FT                   TRQEIAKIMGVNPSTVSRMESNVDKASVNTLARYARACGIENPTIAL"
FT   regulatory      468630..468689
FT                   /regulatory_class="promoter"
FT   CDS_pept        468734..469183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0541"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88615"
FT                   /db_xref="GOA:D3VIR5"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIR5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88615.1"
FT                   /translation="MKTNTYNLLTQENGAPVKMWTNGVPVDPKVVTQLQNMAKMPFIFK
FT                   HLAVMPDVHVGKGSTIGSVIPTRGAIIPAAVGVDIGRVMSRNEAKKRFTLIDQKRATAH
FT                   VECRKDSDVIDEIPMAYKDIDAVMQAQSSLVEIVHTLRQVVCVKG"
FT   regulatory      469218..469277
FT                   /regulatory_class="promoter"
FT   operon          469325..469908
FT                   /operon="XNC1_operon0103"
FT   CDS_pept        469325..469594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0103"
FT                   /locus_tag="XNC1_0542"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0542"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88616"
FT                   /db_xref="GOA:D3VIR6"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIR6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88616.1"
FT                   /translation="MRTTQQMSITLPKEMAELVKSKVRDGEYATESEVIRDGLRALLAR
FT                   DRAVENWLHNQVASAYDALITDPSRAVSIEQIRARLAERHGNSK"
FT   CDS_pept        469591..469908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0103"
FT                   /locus_tag="XNC1_0543"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0543"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88617"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIR7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88617.1"
FT                   /translation="MSYTVIFSPEAETQIIELYDYIAAEASSNIAIRYTESIVNYCENL
FT                   STFPHRGIMRDDIRPGLRITNYKKRVVIAFIVNSERVSILGVFYGGQDFKTRLQSDDDN
FT                   H"
FT   regulatory      469910..469946
FT                   /regulatory_class="terminator"
FT   regulatory      469929..469988
FT                   /regulatory_class="promoter"
FT   CDS_pept        470068..470316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0544"
FT                   /product="2'-phosphotransferase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0544"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88618"
FT                   /db_xref="GOA:D3VIR8"
FT                   /db_xref="InterPro:IPR002745"
FT                   /db_xref="InterPro:IPR042080"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIR8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88618.1"
FT                   /translation="MDQSDRKISKFLSYVLRHQPESIGLTLDSEGWADIGTLIKCAAKY
FT                   GKRLNRVIIENIVESNDKKRFSISADQKHIRQITEFG"
FT   CDS_pept        complement(470419..470727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0545"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0545"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88619"
FT                   /db_xref="GOA:D3VDB9"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:D3VDB9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88619.1"
FT                   /translation="MIEQLKEAFESACVKLECQLIEMDGEQDHVHLLISYPPKLSISVI
FT                   VNNLKAVSSRMLRLQNTHLTRQSQSSALWSRSYFACTAGGATIETLKAYVESQATPD"
FT   regulatory      470501..470557
FT                   /regulatory_class="terminator"
FT   regulatory      470766..470825
FT                   /regulatory_class="promoter"
FT   regulatory      complement(470876..470935)
FT                   /regulatory_class="promoter"
FT   CDS_pept        470904..472046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0546"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0546"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88620"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIS0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88620.1"
FT                   /translation="MLRATKVRIYPTQEQADFLMAQFGAVRFAYNKALHLKSHMYRKQG
FT                   VTLNPKKDIKPLLAAAKKSRKYQWLKQYDSIALQQSVINLHQAFDHFFNPKLKAKYPQF
FT                   KRRHGKQSSYHCVGVKVFDSAIKLPKMQLVKANIHREISGVVKSITVSLSKTGKFYASI
FT                   LVDDGVEAPDLPHTVSKVTGLDLGLSHFAIESNGRKTANPRFVKRAEKNLRRKQRQLSR
FT                   KAKGSANRAKARLLVAKCHEKVANARADFQHKLSRTLVDENQAVIVETLKSANMMKNRK
FT                   LAKHIADASWHGFVVKLEYKAKEQGKHLVKLDQWYASSKTCHCCGHKTEDMPLSVRQWD
FT                   CPSCGTTDIDRDLNAALNIRDKGILELKAAGRSSLLMEAA"
FT   CDS_pept        472148..472771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0547"
FT                   /product="putative LysE family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0547"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88621"
FT                   /db_xref="GOA:D3VIS1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIS1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88621.1"
FT                   /translation="MTVMDSLLAFTVAATLLTLTPGLDTALVLRTATAEGGKKAFQAAL
FT                   GINVGCFIWGAMVAFGLGTLIAVSELAFNILKWCGALYLCWLGMQMIWHPKKDLGGEVS
FT                   SSVKGQNWFIKGMLGNVLNPKMGVFYVSFLPQFIPQGHSPILWTFSLVVIHVLLGTLWS
FT                   LSLIYAIRPLSHILRRENVIKWMNRATGGLFLLFAFKLVLSSRR"
FT   regulatory      complement(472831..472869)
FT                   /regulatory_class="terminator"
FT   operon          complement(472940..473611)
FT                   /operon="XNC1_operon0104"
FT   CDS_pept        complement(472940..473461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0104"
FT                   /locus_tag="XNC1_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0548"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88622"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIS2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88622.1"
FT                   /translation="MTAGAIQSNHVRQTAAIAAKYGLKCVALLENPIRNQDSNFLNNGN
FT                   KLLTELFNAQCVMCNELTDPNVQMKALINQFKLEDAYIIPVGGSDVLLWDNYFAPMYGM
FT                   PNKKGLDAITLLAQKEGILLDPVYTGKAMAGLIDNVLNNTIDSQKPLLFVHTGGAPALF
FT                   AYSGIDAIID"
FT   CDS_pept        complement(473480..473611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0104"
FT                   /locus_tag="XNC1_0549"
FT                   /product="D-cysteine desulfhydrase, PLP-dependent enzyme
FT                   (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0549"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88623"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIS3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88623.1"
FT                   /translation="MDKLENLSHYLGRDVYIKRDDLTPLTMGGNKLRKLEYLIADAL"
FT   regulatory      complement(473678..473737)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(473741..473944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0550"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88624"
FT                   /db_xref="GOA:D3VIS4"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIS4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88624.1"
FT                   /translation="MNGYGVLTIITPAVKIILAILTRQVILSLILGILVSFTVINDPNF
FT                   LLGIQGTISGRERERLFFNQPL"
FT   regulatory      complement(474171..474230)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(474390..474423)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(474451..475464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argI"
FT                   /locus_tag="XNC1_0551"
FT                   /product="ornithine carbamoyltransferase 1"
FT                   /EC_number="2.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0551"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88625"
FT                   /db_xref="GOA:D3VIS5"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIS5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88625.1"
FT                   /translation="MNPFFQRSILRLLDITPIEINTLLTLSHKLKANKKSGIESPLLTG
FT                   KNIALIFEKDSTRTRCAFEVAAHDQGASVTYLGTHGSQIGHKESIKDTARVLGRLYDGL
FT                   QYRGHGQHIVETMAQYAGVPVWNGLTDEFHPTQLLADLLTIQEHSQKSLSQIKFAYLGD
FT                   ARNNMGNTMLEAATLTGMDLRLIAPETCWPDVNLIAECQKLAEKTGGQITLTEDIAQGV
FT                   KDADFLYTDVWVSMGEPKSVWQERIALLRSYQVNMGVIKLTGNPEVKFLHCLPAFHNEE
FT                   TTLGKQLAEEFNLYGGLEVTNEVFESEHSIVFDQAENRMHTIKALMVATMVENLVV"
FT   regulatory      complement(475498..475557)
FT                   /regulatory_class="promoter"
FT   CDS_pept        475529..475672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0552"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88626"
FT                   /db_xref="GOA:D3VIS6"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIS6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88626.1"
FT                   /translation="MQALTWVFVSVMILRWLINQSIMVCISPWTKWDRYILCTEKMGEC
FT                   KK"
FT   regulatory      475609..475668
FT                   /locus_tag="XNC1_0552"
FT                   /regulatory_class="promoter"
FT   CDS_pept        475699..476124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0553"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0553"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88627"
FT                   /db_xref="GOA:D3VIS7"
FT                   /db_xref="InterPro:IPR009671"
FT                   /db_xref="InterPro:IPR016716"
FT                   /db_xref="InterPro:IPR036701"
FT                   /db_xref="UniProtKB/Swiss-Prot:D3VIS7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88627.1"
FT                   /translation="MADPHVLEEQFEETRSIIEELLEDGSDPDATYIIEHHFSAEDFDQ
FT                   LEKAAVEAFKLGYEVTDAEELETEDRVILMCCDVISESRLEVDLINAQVKQLADLAEKM
FT                   GVNYDGWGTYFEDPNAPDDEDDNDDLFPPEEDEPRLH"
FT   regulatory      complement(476138..476177)
FT                   /regulatory_class="terminator"
FT   regulatory      476155..476188
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(476200..476703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0554"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0554"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88628"
FT                   /db_xref="GOA:D3VIS8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIS8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88628.1"
FT                   /translation="MTTETTHNYVIRPITPQDNAGIAAVIREVSAEHGLTADKGFAVAD
FT                   PILDTLYEVYSQPRSAYWVVEMEGEVVGGGGVAPLAGGDGDICELQKMYLSSVLRGKGV
FT                   ARQIVKQSLEFGTEQGFKRCYLETTENLKAAIALYENLGFSYLDEALGNTGHSDCEVRM
FT                   IKAL"
FT   regulatory      complement(476757..476816)
FT                   /regulatory_class="promoter"
FT   CDS_pept        477105..477227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0555"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0555"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88629"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIS9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88629.1"
FT                   /translation="MKRAKDILSYFSSLFDQKSKMEEHIKKQEIIKKEKSETIS"
FT   CDS_pept        477148..477522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0556"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88630"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIT0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88630.1"
FT                   /translation="MIKSQKWKNILKNKKLLKKKKAKQLASEYVVKNFLHHLDKRGEEE
FT                   IFQYAAQISIPYIRKSVSEFSEDWNEKIVKPAMDLYAATYSLISVLKNISASEETVVSV
FT                   MAKSLFDDNYSRIIILCHNT"
FT   regulatory      477451..477510
FT                   /locus_tag="XNC1_0556"
FT                   /regulatory_class="promoter"
FT   operon          477548..478951
FT                   /operon="XNC1_operon0105"
FT   CDS_pept        477548..477871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0105"
FT                   /locus_tag="XNC1_0557"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0557"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88631"
FT                   /db_xref="InterPro:IPR002622"
FT                   /db_xref="UniProtKB/TrEMBL:D3VBA0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88631.1"
FT                   /translation="MGYSLDFRRRVLAYKDKHALTFEQTRDHFEVSIRTLFRWCNKIEP
FT                   CMTRDKPPTKISDETLIADVKNYPDDYQWERAKRLGVSQSAIHYALKRLKITVKKNAQT
FT                   SRR"
FT   CDS_pept        477969..478379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0105"
FT                   /locus_tag="XNC1_0558"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0558"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88632"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:D3VBA1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88632.1"
FT                   /translation="MPRTHGYSLKGSRCFGLHDWQHKGRINAIGAIIKNTFVTLSLFAG
FT                   TLNANVFHAWLTQDLLPKLPKGTVIVMDNAPFHKRGDTRQAITDHGCQLEWIPPYSPDL
FT                   NPIENKWAETKTTRRRERCSIDELFTKHVTYV"
FT   CDS_pept        478400..478573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0105"
FT                   /locus_tag="XNC1_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0559"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88633"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIT3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88633.1"
FT                   /translation="MSGVGMFFNYFGFSSQALTLDDVGVRNQVIALMDKSGGFARSEGS
FT                   IQSRFISQIQKG"
FT   CDS_pept        478637..478951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0105"
FT                   /locus_tag="XNC1_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0560"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88634"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIT4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88634.1"
FT                   /translation="MWAIGGATIRGEFTDVFDVKDLGDKYRLSGTIDYYLYDKFADPLD
FT                   MKNLIGEEWDGLGVPFDISDEWIETVSFDIDKGIYDNKIKPMVEQKQKEMIEQMKKMQQ
FT                   "
FT   regulatory      478967..478999
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(479494..480420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeaT"
FT                   /locus_tag="XNC1_0561"
FT                   /product="putative transcriptional regulator with
FT                   periplasmic binding protein domain (LysR family)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0561"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88635"
FT                   /db_xref="GOA:D3VIT5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIT5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88635.1"
FT                   /translation="MNNLPILQDLRVFLLVAKRASFAAAAEEMGVSPAFISKRIAILES
FT                   VLNVTLLHRTTRRVSITEDGERIYEWAQRILNDVNQMLDELSELRQEPQGTIRIVSSFG
FT                   FGRQFVAPALSALVQAYPQLEIRFDVEDRIIDLVTEGIDLDIRVGDDIDNNLIARKLAS
FT                   NRRILCAAPSYLARHPMPKSLNELPSHACLVIKERDHPFGIWQLQSSAGYQSVKVTGPM
FT                   SSNHGEIIHQWCLDGHGITLRSYWDIRENIKSGALVHILPEYYQSADIWAVYVTRLAMS
FT                   ARIRVTIEFLERYFQLHYSDQIEVKSG"
FT   regulatory      480427..480486
FT                   /regulatory_class="promoter"
FT   regulatory      complement(480460..480519)
FT                   /regulatory_class="promoter"
FT   CDS_pept        480525..481607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeaU"
FT                   /locus_tag="XNC1_0562"
FT                   /product="putative tartrate dehydrogenase"
FT                   /EC_number="1.1.1.93"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0562"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88636"
FT                   /db_xref="GOA:D3VIT6"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIT6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88636.1"
FT                   /translation="MKQPFKIAAIPGDGIGHEVLPEGIRVLQTVAEKWDLHLSFDSFEW
FT                   ASCDYYLKYGVMMPDDWFNQLTAFDAIYFGAVGWPEKVPDYISLWGSLLKFRREFQQYV
FT                   NLRPVRLLPGVPCPLANKKPEDIDFYVVRENTEGEYSAIGGRLHAGTEHEVVIQESVFT
FT                   RRGVDRILKYAFELAQSRPRKRLTSATKSNGIAISMPYWDERVEAMAKQYPEIKWDKQH
FT                   IDILCARFVLEPERFDVVVASNLFGDILSDLGPACTGTIGLSPSANLNPKRNFPSLFEP
FT                   VHGSAPDIYGRNIANPIAMIWSGAMMLQFLGEDDERYQHAHDDILSAIEAVIAEGTVTP
FT                   DMKGKASTQQVGDAIVRHLS"
FT   regulatory      481733..481769
FT                   /regulatory_class="terminator"
FT   regulatory      482014..482073
FT                   /regulatory_class="promoter"
FT   operon          482099..486262
FT                   /operon="XNC1_operon0106"
FT   CDS_pept        482099..483643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0106"
FT                   /gene="yeaV"
FT                   /locus_tag="XNC1_0563"
FT                   /product="putative betaine/choline/glycine transport
FT                   protein (BCCT family)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0563"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88637"
FT                   /db_xref="GOA:D3VIT7"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIT7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88637.1"
FT                   /translation="MLSSTKKDIPLIAISLVCIVVIAITLSLFPEETRVIANSIFNGLT
FT                   RLLGSTIQILVLIALMFVLYLAISKYGNIRLGEGKPKYATIPWLFMFICAGLGSSTLYW
FT                   GVMEWAYYYQMPGLNISPKTPKALEYSISYSFFHWGLSAWATYALASLIMAYHFHVRKN
FT                   KGLSLSGIISAIIKINPYGFWGRLIDMTYLIATVGALTISLVVTAATLSGGLSSLIGTP
FT                   NDFTVQAGITLLAAVIFCLSSYIGIDKGMQRLSQMVGWGALGFALLVLIVGPTEFTINN
FT                   MINAVGLTTQNFLQMSLFTDPMGDGQFTRSWTVFYWLWWVSYTPGVAMFVTRVSHGRKI
FT                   KDVIWALLLGSTFGCWFFFGVLESYAMHQFITGAINVPEILNTLGGETAVHQLLSALPL
FT                   GQFFLAAYLFIMVIFLASHMDAVAYTMAATSTRNLREGQDPCRKLRLFWCVVITLIPLS
FT                   ILFTQASLETMKTSVVLTALPFLVILLMKTYGFICWIKQDYAQVPAHLIQDTHFAK"
FT   CDS_pept        483657..484775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0106"
FT                   /gene="yeaW"
FT                   /locus_tag="XNC1_0564"
FT                   /product="putative di(mono)oxygenase, alpha subunit with
FT                   ISP and Bet v1-like domains"
FT                   /EC_number="1.14.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0564"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88638"
FT                   /db_xref="GOA:D3VIT8"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="InterPro:IPR039004"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIT8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88638.1"
FT                   /translation="MSIQDPYLTLPRNFCANPAEAYTMPARFYTSQDVFDYEKEAIFAK
FT                   SWICVAHGSELANPNDYVTREIIGESIVIVRGRDNILRAFFNVCPHRGHQLLKGEGKAK
FT                   NVITCPYHAWTFKLDGSLAHARNCENVANFDKGLAQLTPVKLEEYAGFVFINMDMNAGT
FT                   VEAQLPGLSTRVLAACPDVYDLKLAARFTTATPANWKSIVDNYLECYHCGPAHPGFSTS
FT                   VQVDRYWHTMYEKWSLQFGYAIPSDQSFKFEGESSFHGFWLWPCTMYNVTPVKGMMTVI
FT                   YEFPVDAETTLQYYDIYFTNEDITEEQKSLIEWYRDVFRPEDLRLVESVQKGLKSRGYR
FT                   GQGRIMADSTGSGISEHGIAYFHHLIAQTYHE"
FT   CDS_pept        484829..486262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0106"
FT                   /gene="gabD"
FT                   /locus_tag="XNC1_0565"
FT                   /product="succinate-semialdehyde dehydrogenase I,
FT                   NADP-dependent"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0565"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88639"
FT                   /db_xref="GOA:D3VIT9"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIT9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88639.1"
FT                   /translation="MNISENPFFHQQAYINGQWCDADNKETLTVSDPATGKVIGQIPNM
FT                   AASEVKQAIQAAYDALPKWQVQTGHQRAQLLQNWFRLISENKKRLAEIMTLEQGKPLVE
FT                   AEGEITYAASFIEWFAEQGKRTNGEIIPSPTSDKRLMVIKQGIGVCAAITPWNFPAAMI
FT                   TRKAAPALAAGCTMIIKPANETPFTALAMVDLAIQAGIPAGVINIITGHSRIIGEILTS
FT                   DDRVRKLSFTGSTEVGRLLMRQCSDSIKKVSLELGGNAPFIVFEDADIEKAVEGAMAAK
FT                   FRNAGQTCVCANRLYIHRDIYPAFSQRFVEDVQKLQVGNGFDQGTQIGPLINAESADKV
FT                   QFLLDDALNKGADLLYGGKRHALGDNFFIPTVIGRVAENSLILEEEIFGPIAPLVIFDD
FT                   EESVIASANNTIYGLAAYFYTENPQRIWRVSEKLDYGMVGINTGLISNEVAPFGGIKQS
FT                   GLGREGSTHGIDDYLAISA"
FT   regulatory      486388..486447
FT                   /regulatory_class="promoter"
FT   CDS_pept        486526..487668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0566"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0566"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88640"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIU0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88640.1"
FT                   /translation="MLRATKVRIYPTQEQADFLMAQFGAVRFAYNKALHLKSHMYRKQG
FT                   VTLNPKKDIKPLLAAAKKSRKYQWLKQYDSIALQQSVINLHQAFDHFFNPKLKAKYPQF
FT                   KRRHGKQSSYHCVGVKVFDSAIKLPKMQLVKANIHREISGVVKSITVSLSKTGKFYASI
FT                   LVDDGVEAPDLPHTVSKVTGLDLGLSHFAIESNGRKTANPGFVKRAEKNLRRKQRQLSR
FT                   KAKGSANRAKARLLVAKCHEKVANARADFQHKLSRTLVDENQAVIVETLKSANMMKNRK
FT                   LAKHIADASWHGFVVKLEYKAKEQGKHLVKLDQWYASSKTCHCCGHKTEDMPLSVRQWD
FT                   CPSCGTTDIDRDLNAALNIRDKGILELKAAGRSSLLMEAA"
FT   CDS_pept        487847..488812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeaX"
FT                   /locus_tag="XNC1_0567"
FT                   /product="putative oxidoreductase with ferredoxin-like
FT                   NADP-linked, 2Fe-2S ferredoxin-like and with
FT                   ferredoxin-like NADP-linked and riboflavin synthase-like
FT                   domains"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0567"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88641"
FT                   /db_xref="GOA:D3VIU1"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039003"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIU1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88641.1"
FT                   /translation="MSIYQTISVIVSNIEAITPNIKRFTLIPAENTQLPAFTGGSHIFV
FT                   QMQDGDKRYSNAYSLLSSPFDKHSYQIAVKREEHSRGGSAFMHDKVVIGNTLIISEPNN
FT                   LFALVPGAKKHILIAGGIGITPFMSHLYELKHQDAEYELHYCYRNSDDNAFTQELMAAG
FT                   FKAKIDCYISSEGTRLELDTLISRLPEGSHVYTCGSSALNNGVKQAAQNAGFPDHQLHF
FT                   EQFTIEDKTGDAFTVVLAKSGIELEVDSESTILQVIERNKAVHVECMCREGVCGTCETM
FT                   ILEGEADHRDQYLSDEEKQSQTSMLICCSRAKGKRLVLDL"
FT   CDS_pept        488845..489117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0568"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0568"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88642"
FT                   /db_xref="InterPro:IPR007400"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIU2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88642.1"
FT                   /translation="MNIRYLTLKSVHSSIAVSGGCCLAAACCFPGTVASHLYYANAVNG
FT                   NSVVRIEHLSGISEFSITHDGEYIAYASVQRNAQILMKGEFFIYL"
FT   regulatory      488898..488932
FT                   /locus_tag="XNC1_0568"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(489204..489235)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(489240..489539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0569"
FT                   /product="Cro-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0569"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88643"
FT                   /db_xref="GOA:D3VIU3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIU3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88643.1"
FT                   /translation="MATLKELMAKRSPESQAKIEEKAAEMLLETQLYQIREALALSQTQ
FT                   VAKNLGIAQSSVAAIEQRGNELKISTLKKYIEAMGGEMTLGVKLPDGKLMNFSI"
FT   regulatory      complement(489693..489752)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(489696..489732)
FT                   /regulatory_class="terminator"
FT   operon          complement(489759..492059)
FT                   /operon="XNC1_operon0107"
FT   CDS_pept        complement(489759..490547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0107"
FT                   /gene="fliY"
FT                   /locus_tag="XNC1_0570"
FT                   /product="cysteine transport protein (ABC superfamily,
FT                   peri_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0570"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88644"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIU4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88644.1"
FT                   /translation="MRKNIAKKLLSLLLAGATALAVSAPGYAGKDFDAIKASGVFKIGT
FT                   EGTYPPFTYHDTNNKLTGFDVDIAQEIAKRLNVKSEFMEVKWDGLIAGLDAKRFDAVIN
FT                   QVGITPERAAKYNFSIPYTTSQVVLITRNNNDVIKTFADIKGKRSAQSLTSNYGQLATS
FT                   YGANLVSTDGFNQAIDLVVTGRADATLNDRLSFLDFKKQRPDAPVKIVAQQADASKSAV
FT                   LVRKGDAELVKAINKALQEMKDDGTYARISGKYFGVDISK"
FT   CDS_pept        complement(490601..491365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0107"
FT                   /gene="yecC"
FT                   /locus_tag="XNC1_0571"
FT                   /product="putative amino acid transport protein (ABC
FT                   superfamily, atp_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0571"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88645"
FT                   /db_xref="GOA:D3VIU5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIU5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88645.1"
FT                   /translation="MIQLTNIEKSFDGQKVLKNISLTIKEGSLTALIGPSGSGKSTLLR
FT                   CINLLEIPQAGKLDIGKEQITFNGKERLPHREIQRFSLQTGMVFQNFQLFPHLTVIENI
FT                   MEGLIWVQKWPRERARARAVALLEKVGMSHKADVWPSTLSGGQQQRVAIARAMAPSPKV
FT                   LLCDEPTSALDPELSKEVVSVLKHLAEEGTTMLMATHDLRLAANLAHDVVFLESGEIIE
FT                   SGPAKTIFTRPNKVRTVEFISTLTETLPDWEI"
FT   CDS_pept        complement(491343..492059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0107"
FT                   /gene="yecS"
FT                   /locus_tag="XNC1_0572"
FT                   /product="putative amino acid transport protein (ABC
FT                   superfamily, membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0572"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88646"
FT                   /db_xref="GOA:D3VIU6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIU6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88646.1"
FT                   /translation="MTPSWLSLALDSLWPMLYAGLTFTIPLTLITFALGISLGFIVALI
FT                   RLYGPKPLIAVVRFYVWLIRGTPLLVQLFLIFYALPSVGITLEAFTSAVIGFTLNVGAY
FT                   TSEVIRAALISVPKGQWEASHSIGMSWWQSLRRIVLPQAARFSIPPLSNTFISLVKDTS
FT                   LASVITVPEMFLAAQRIAAVTYQPLILYTEAAILYLLLSSVLSALQVRLEKKFAQQNSH
FT                   QQSSNKEAKDDSAHQH"
FT   regulatory      492039..492098
FT                   /regulatory_class="promoter"
FT   regulatory      complement(492094..492153)
FT                   /regulatory_class="promoter"
FT   CDS_pept        492121..492273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0573"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88647"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIU7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88647.1"
FT                   /translation="MIWQEKDNVIYNKVLAYTRRLSSCRFVGCILKSIGYRTLRQVGYI
FT                   GKSRR"
FT   regulatory      complement(492251..492283)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(492343..493116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0574"
FT                   /product="putative cysteine transport protein (ABC
FT                   superfamily, peri_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0574"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88648"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIU8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88648.1"
FT                   /translation="MKILLTILLAGISQLSFTHLAYAQSTLDTIQSTGIFRIGTEGAYA
FT                   PFSYHDASGKLTGFDVEVGREIALRMKIKPEFIEGKWDGLIGGLDAGRSDAVMNQIAIT
FT                   PEREKRYSFSLPYVISEAVLITRTDNNDIKTFSDLKGKKSAHTLTNNFAQMARHYKAEI
FT                   MGTNGFNQEIELVSTGRADATINDKLSYLDYKKHRPDAPVKIVAADTQAAKTAVLLRKN
FT                   DTELKTAVDNAITEIKADGTYQRIWDKYFAEGNAE"
FT   regulatory      complement(493147..493206)
FT                   /regulatory_class="promoter"
FT   operon          complement(493320..494028)
FT                   /operon="XNC1_operon0108"
FT   CDS_pept        complement(493320..493781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0108"
FT                   /locus_tag="XNC1_0575"
FT                   /product="transposase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0575"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88649"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIU9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88649.1"
FT                   /translation="MAETTGSRPRLNRLGALNLHRIEDTVLREDPGINAENIAYFAGAR
FT                   RETDPLSQKSPIILDNAGYPRAECVKDIAYGRNIELHYLPPDSPNLSPIERLWKYMNEP
FT                   VRNNVYFPDAQTFRETLRHFFHVMLPEKAKELTTRLTDHFQILKPASSG"
FT   CDS_pept        complement(493744..494028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0108"
FT                   /locus_tag="XNC1_0576"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0576"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88650"
FT                   /db_xref="GOA:D3VIV0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIV0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88650.1"
FT                   /translation="MLATLKIHLTPDQKCPPELMHNTTRDSRVCDRIKAGLLAHEGWTA
FT                   QRIARALRIHDSTVSRHRKDFLAQEKLTPESRKKSGKSGRNDRQSSPSQ"
FT   CDS_pept        494037..494378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0577"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88651"
FT                   /db_xref="GOA:D3VIV1"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIV1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88651.1"
FT                   /translation="MDKKSSIFNGDWYIPKDDGYIKIHVAKNKNGLFSDLICEKLEVND
FT                   LLWIYGPYGDFTAQNRSEMRDIVFVATGTGFAPIKSLVESGVFNENKVSLFLGREKKSR
FT                   SLFLRKRLI"
FT   regulatory      complement(494088..494147)
FT                   /regulatory_class="promoter"
FT   operon          complement(494392..496962)
FT                   /operon="XNC1_operon0109"
FT   CDS_pept        complement(494392..495963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0109"
FT                   /locus_tag="XNC1_0578"
FT                   /product="putative transposase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0578"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88652"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIV2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88652.1"
FT                   /translation="MEPPFPDDIAQLKGLLREQMAANKILTENNRLLSQRVASYASEIT
FT                   RLKARVVKLQRMQFGQSSEKIRQKAERQIREVQAHISHLQEEMVDILGKQPDPALPPAL
FT                   RQSSSRKPLPATLPREIQLLLPAEKNCPECGGERHALGCDISEQLEIISSAFKVIETQR
FT                   PKLACGRCDGIVQSPMPSKPIERSYAGPGLLARIVTAKFAEHMPLYRQSEIYNRQGVAL
FT                   SRATLGRWSGAVSELLEPLYDVLRQYVLMPGKVHGDDIPVPVQAPGNGKTRTGRLWVYV
FT                   RDDRNAGSVMPPAVWFAYSADRKGVHPQQHLAGYSGVLQADAYGGYRALYETGNITEAA
FT                   CMAHARRKIHDVHVRSPTAITTEALKRIGELYAIEAEIRGSPAEERLALRKARSAPLMQ
FT                   LLFDGIQQQRATLSRHSEIAKAFAYMLKLWDSLNEYCRNGWMEIDNNIAENALRCVAVG
FT                   RKNGLFAGSDSGGERAAILYSLIGSCRLNGVEPEAWLRYTISHIADWPSNKVHELLPWK
FT                   LNLTNI"
FT   CDS_pept        complement(495983..496330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0109"
FT                   /locus_tag="XNC1_0579"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0579"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88653"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIV3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88653.1"
FT                   /translation="MSILPAGTRIWIVAGVTDMRNGFNGLASKVQNALKDNPFSGQVFI
FT                   FRGRRGDMLKVLWADADGLCLFTKRLERGRFVWPVTREGKVHLTPAQLSMLLEGINWKH
FT                   PQRMERSGLRI"
FT   CDS_pept        complement(496330..496962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0109"
FT                   /locus_tag="XNC1_0580"
FT                   /product="Aec51"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0580"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88654"
FT                   /db_xref="GOA:D3VIV4"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIV4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88654.1"
FT                   /translation="MKYRTLLLDALRLHFDEHLSRLDVGRRLGIPKSTICDLFVRFKRQ
FT                   GMSWPLPDNMTADKLESQLYPARPHAVRLDIPAPVLADEPIVRKRSRRPNFPLAFKIAL
FT                   AEKSLQPGANVAQLAREHGINDNLLFNWRHLYKRGLLYPREDRSWLLPVTLSEITVPVK
FT                   LPIPAMQQPAAREPCCELALPAGILRIRGELTSELLRMLISEMKGGG"
FT   regulatory      complement(497107..497166)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(497121..497174)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(497182..498174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiH"
FT                   /locus_tag="XNC1_0581"
FT                   /product="thiamin biosynthesis enzyme subunit, with ThiG"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0581"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88655"
FT                   /db_xref="GOA:D3VIV5"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR012726"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIV5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88655.1"
FT                   /translation="MALLSPAALPYLEQLARRAQQLTRQRFGNTVGFFIPLYLSNLCAN
FT                   DCTYCGFSMSNHIKRKTLDEQEIEAECLALKKRGFEHILLVTGEHQNKVGMDYFRRYLP
FT                   LVHRHFSSVSMEVQPLAQEEYAELKTLGLDGVMVYQETYHQPSYQLHHLKGKKQDFHWR
FT                   LETPERLGRAGIDKIGLGALIGLSHNWRTDCYMVAEHLLFLQKQFWKSRYSISFPRLRP
FT                   CTGGIEPASIMGEAELVQLICAFRLLAPDVELSLSTRESPFFRDHVVPLAINSISAGSK
FT                   TQPGGYADEHHELEQFAPHDNRSVIQVAEALVKSGLQPVWKDWDSYLGR"
FT   operon          complement(498303..502708)
FT                   /operon="XNC1_operon0110"
FT   CDS_pept        complement(498303..499070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0110"
FT                   /gene="thiG"
FT                   /locus_tag="XNC1_0582"
FT                   /product="thiamin biosynthesis enzyme subunit, with ThiH"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0582"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88656"
FT                   /db_xref="GOA:D3VIV6"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIV6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88656.1"
FT                   /translation="MLKIADTTFHSRLFTGTGKFANAGLMIDAIRASGSQLVTMAMKRI
FT                   DLHGNDDGILVPLQQLGVKLLPNTSGAKTAEEAVFAARLAKEALGTHWVKLEIHPDVKY
FT                   LLPDPIETLKAAEQLLKEGFIVLPYCGADPVLCRRLEEAGCAAVMPLGAPIGSNKGLLT
FT                   RDFLQIIIEQANVPVVVDAGIGAPSHALTAIEMGADAVLVNTAIAVARHPVKMAQAFKT
FT                   AIEAGELSHQAGVASQKSHAETSSPLTDFLGAL"
FT   CDS_pept        complement(499089..499289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0110"
FT                   /gene="thiS"
FT                   /locus_tag="XNC1_0583"
FT                   /product="C-terminally thiocarboxylated form is
FT                   intermediate sulfur donor in thiazole formation; part of
FT                   ThiF/ThiS complex; complexes with ThiG also"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0583"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88657"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIV7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88657.1"
FT                   /translation="MNIIVNDQSITLSASITIQQLLEHMQRTQSGIALAINQTIIPRSE
FT                   WHTHQVNDGDNILLFQAIAGG"
FT   CDS_pept        complement(499286..500065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0110"
FT                   /gene="thiF"
FT                   /locus_tag="XNC1_0584"
FT                   /product="adenylation of ThiS; with ThiI, thiolation of
FT                   ThiS; in thiazole synthesis"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0584"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88658"
FT                   /db_xref="GOA:D3VJA2"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJA2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88658.1"
FT                   /translation="MLNDQEFMRYSRQLLLEDIGPEGQAKLKASKVLIVGLGGLGSPAA
FT                   LYLAAAGVGHLYLADDDQLHISNLQRQILYRTGDIPANKATLAGQQLTDLNPLITVTEL
FT                   TERQDNESLLNAVRKADLVLDCCDNMATRHAINAACVAENKPLISGSAVGFSGQLMVIT
FT                   PPYQHGCYACLYPDQEEPQRNCRTAGVLGPIVGVIGTLQSLEAIKMLTGFPSSLNGKLR
FT                   LFDGKQQSWSTLQLTQSSQCPVCRVVIRKNEAGKEVV"
FT   CDS_pept        complement(500059..500733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0110"
FT                   /gene="thiE"
FT                   /locus_tag="XNC1_0585"
FT                   /product="thiamin phosphate synthase (thiamin phosphate
FT                   pyrophosphorylase)"
FT                   /EC_number="2.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0585"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88659"
FT                   /db_xref="GOA:D3VJA3"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJA3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88659.1"
FT                   /translation="MKNTSDTFTLPSAPFAPTAHRLGLYPVVDSLIWIERLLEAGVRTL
FT                   QLRIKDQPEEQAEKDIQSAIALGRQYYARLFINDYWRLAIKHHAYGVHLGQEDLDVADL
FT                   NAIQQAGLRLGISTHDQQELVRAKALRPSYIALGHIFPTSTKEMPSSPQGLEALKHQVE
FT                   ITPEYPTVAIGGISLERVPDVVATGVGGVALVSAITKAQDWRQATARLLHLVESQDRGL
FT                   LC"
FT   CDS_pept        complement(500717..502708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0110"
FT                   /gene="thiC"
FT                   /locus_tag="XNC1_0586"
FT                   /product="5'-phosphoryl-5-aminoimidazole =
FT                   4-amino-5-hydroxymethyl-2-methylpyrimidine-P"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0586"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88660"
FT                   /db_xref="GOA:D3VJA4"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJA4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88660.1"
FT                   /translation="MSKSNDTVVSNTAIQNTIIPTADISLQAHPARPRKAQRDAAQAFI
FT                   NSVQGITFPNSKRIYLEGSRPDIQVPMREIRLSPTLIGSTKENPQFEENESIPVYDTSG
FT                   PYGDPTSVLDVQTGLSQIRQPWIDERNDTEPVPVLSSDFTQQRLADAGLDHLRFHHRPH
FT                   PLKARQGKRVTQLHYARQGIITPEMEFIALRENMGRERIRSEVLRQQHPGQNFGANLPE
FT                   NITPEFVRQEVAAGRAIIPANINHPESEPMIIGRNFLVKVNANIGNSSVTSSIEEEVEK
FT                   LIWSTRWGADTVMDLSTGRYIHETREWILRNSPVPIGTVPIYQALEKVNGIAENLTWEM
FT                   FRDTLLEQAEQGVDYFTIHAGVLLRYVPMTAKRLTGIVSRGGSIMAKWCLSHHQENFLY
FT                   THFREICEICAAYDVSLSLGDGLRPGSIQDANDEAQFSELHTLGELTKIAWEYDVQVMI
FT                   EGPGHIPMQLIRRNMTEELEHCHEAPFYTLGPLTTDIAPGYDHFTSGIGAAMIGWFGCA
FT                   MLCYVTPKEHLGLPNKEDVKQGLITYKIAAHAADLAKGHPGAQIRDNAMSKARFEFRWE
FT                   DQFNLALDPDTARAYHDEALPQESGKVAHFCSMCGPKFCSMKITQDVRDYAAKLEQESG
FT                   MEQMSETFRARGSELYHSADEVAHEKYV"
FT   CDS_pept        complement(502831..503079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0587"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88661"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJA5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88661.1"
FT                   /translation="MIYVEKVRQKPRKISRFLLGDLCRKNSYTLKCFLVGVPSVHPLSR
FT                   RWTQAETVYSGSAEPDRANTREGNKSNYSAVSTHTPR"
FT   operon          complement(503620..505249)
FT                   /operon="XNC1_operon0111"
FT   CDS_pept        complement(503620..503793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0111"
FT                   /locus_tag="XNC1_0588"
FT                   /product="transposase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0588"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88662"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJA6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88662.1"
FT                   /translation="MVYRVQKLPDEQCNGLQRWLKGVIARSGSNKAAVALANNNARIAW
FT                   ALVNQQSVYEAR"
FT   CDS_pept        complement(503753..505249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0111"
FT                   /locus_tag="XNC1_0589"
FT                   /product="transposase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0589"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88663"
FT                   /db_xref="GOA:D3VJA7"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJA7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88663.1"
FT                   /translation="MDLKFVIASGCNSAGLNRLREPISQTLTQLETKLNTLLERVTDNI
FT                   NADANDFVKCQPRSNRLTWSLANKRWKTPVDNPIYSQLKHKGIIDIMNYVNRKTGYLGV
FT                   FENMTTRKKNPEAHTGDLIACIFGNGANYGLHRIAAVSDRSIGVLRAVNDSYIRPEMTH
FT                   AANDVISNAIASLPIFKYYTINEKAPFGSIDGQKHGCRINTFKARFSAKYFRKGKGVSA
FT                   LSLVVNHVPVNTAVNAPNEFEGHFAFDLLYNNSSDIQPTAVSTDTHGINNVNFALLDIF
FT                   GYQFAPRYAKFKKIFEEMFDITLQEEELHISLKKPIKHKLIVDEWGRIQHIVCSLSRKA
FT                   TNQSTVVKKLSNGKRNTLTLTALREDDRLVKCIYLLEYVDNQILRQFVQQALNRGEAYH
FT                   QLRRAIASVNGNQFRGGNDYQVEQWNDCARLIANCIIYYNSVLLSGLIERYEKQGNIKA
FT                   IEILTNLSPVAWSHIQLAGNTDPRCPFSGVSGTKTPRRTM"
FT   regulatory      505133..505192
FT                   /regulatory_class="promoter"
FT   CDS_pept        505251..505805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0590"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88664"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJA8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88664.1"
FT                   /translation="MEMSSYENSTKKTASYQHGKWFEEGHGRAFVGFTESLVVLSHATL
FT                   ENIAFKVMPFSDNTERNTLFYADIVGVYPKKNRTDKELSKIKELANVMASKDYMVSISR
FT                   PVSGLLQGSESNPQYLMPVRKSIFAELGREYPIYNKMKMIVENSSPVLFTLNAQGKTWI
FT                   NKIHPDLLSAIRNDFSCEILP"
FT   regulatory      complement(505470..505529)
FT                   /regulatory_class="promoter"
FT   regulatory      505829..505870
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(505865..506050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0591"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0591"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88665"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJA9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88665.1"
FT                   /translation="MQQWLSEQNLSPPHISFYTDSINDLPMCLFANEVFTVNADEKLKS
FT                   EAEMRGWNQLNWNLTL"
FT   regulatory      506420..506479
FT                   /regulatory_class="promoter"
FT   CDS_pept        506708..506890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0592"
FT                   /product="transposase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0592"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88666"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJB0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88666.1"
FT                   /translation="MNGVTGHVYGNKGYLSQALCDELAAEGITLVTNIRNNMKAKALLL
FT                   WDRLMLRWCSHRDSG"
FT   regulatory      complement(507122..507166)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(507233..508615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0593"
FT                   /product="putative amidase amiD"
FT                   /EC_number="3.5.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0593"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88667"
FT                   /db_xref="GOA:D3VJB1"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJB1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88667.1"
FT                   /translation="MSEFHYQDLLTIGRRIQSREISSEEVTQELINRIEYLDSTLHSYF
FT                   IVMKKSALAEARIADEEIARGKFRGPLHGVPLAVKDLLWAKGVMTTNGMPLVNQFVPQE
FT                   NSTVVERLRAAGAVLLGKLIQTEGALFEHHSQLTPPTNPWLKQLWSGASSSGSGVATAA
FT                   GLCYGSIGTDTGGSIRFPSAINGITGIKPTWGRVSRYGAFELAASMDHIGPMARNVADA
FT                   TAILQAIAGRDPKDPTSSTHHVPDYLALMTRGVRNMRIGVDATWALDRVDESTRVALTK
FT                   TLDHFIELGAEVVDISMPDTVQIAHDWNPMCAIETAVAHEKTFPSMREQYGSGLAELLD
FT                   LGHNIDALDYQKLRLSRARLRGYINGIFESVDVIFSPVIALADLTHDVMKILGEGDDMA
FT                   CYTSVFNFTGNPAITLPCGRTKLGAPIAYQIIASHFEEVTMIQAGWAYQQVTHWHKLHP
FT                   QI"
FT   regulatory      complement(508677..508736)
FT                   /regulatory_class="promoter"
FT   operon          complement(508845..509816)
FT                   /operon="XNC1_operon0112"
FT   CDS_pept        complement(508845..509528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0112"
FT                   /locus_tag="XNC1_0594"
FT                   /product="transposase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0594"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88668"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJB2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88668.1"
FT                   /translation="MTKELHRQSFSYKKPKGVPHTFEADKQPHFIDNYKALKDEAGQHE
FT                   PLLFRDAVPPSPSTKLSAGGMKAGKNQVKVAETTGSRPRLNRLGALNLHRIEDTVLRED
FT                   PGINAENIVYFVGARRETDPLSQKIPIILDNAGYPRAECVKDIAYGRNIELHYLPPDSP
FT                   NLSPIERLWKYMNEPVRNNVYFPDAQTFRETLRHFFHVMLPEKATELTTRLTDHFQILK
FT                   PASSG"
FT   regulatory      509391..509450
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(509452..509604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0112"
FT                   /locus_tag="XNC1_0595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0595"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88669"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJB3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88669.1"
FT                   /translation="MIDYLTANLMHTPAQIGASVFPRRGNDERASPSEFQLQKAKRRSS
FT                   YIRGG"
FT   CDS_pept        complement(509601..509816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0112"
FT                   /locus_tag="XNC1_0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0596"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88670"
FT                   /db_xref="GOA:D3VJB4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJB4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88670.1"
FT                   /translation="MHNTTRDSRVCDRIKAGLLAHEGWTAQRIARALRIHDSTVSRHLK
FT                   DFLAQEKLPRKMAALKAISLPNAPLT"
FT   CDS_pept        509688..509951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0597"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88671"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJB5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88671.1"
FT                   /translation="MTADRTVMNTQGAGNPLSCPAFMSQKPGLDAVTDPTVTRCIVHQF
FT                   GGGGGAFLVWGQMNFQGGKHDLVWIRNQASSMAIGIYIYKRV"
FT   regulatory      complement(509928..509987)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(509971..510132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0598"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0598"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88672"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJB6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88672.1"
FT                   /translation="MLLLASLSLGCGLGFFAIDQIAKIGLSSLQVIYYFENLFSFNQNQ
FT                   TSILYNVQ"
FT   regulatory      509980..510039
FT                   /regulatory_class="promoter"
FT   CDS_pept        510117..511157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0599"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0599"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88673"
FT                   /db_xref="GOA:D3VJB7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJB7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88673.1"
FT                   /translation="MPIITSIPHDECQKMKKLIHKTRDKDYSRRLTALLLLNEGVTVTK
FT                   VAKILHAARSSVNRWVKGFRLYGLEGLNSLPAGRPAVWDLTPLDNILFFLLQQSPQELG
FT                   YLRSRWSLELINKTLNELFNISLTSSTLYRYFVQEDIVWRRASPTVKQPDPEYNEKMAK
FT                   ITEAKANISERHPVFYEDEVDIDLNPKIGADWCFKGQQKRIVTPGKNEKYYLAGCLNAQ
FT                   TKEITYVKGEKKNSDLFIKMLDELNARHPHAETITLILDNDCIHKSHKVKNWLTQHGRF
FT                   TLLFLPVYSPWLNKIERLWQSLHETVTRNHCCQFMWQLLNHVDVFLRSFSSQQKPGIQK
FT                   MSGALL"
FT   CDS_pept        complement(511290..512330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0600"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0600"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88674"
FT                   /db_xref="GOA:D3VJB8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJB8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88674.1"
FT                   /translation="MPIIAPIPRSERRQMKKFIHKTRDKDYARRLMALLMLHEGKTVSA
FT                   LSRTLHCSRSSVNRWINWFTLYGLEGLKSLPSGRPAIWNLAPLFSLLSFLLQHSPQDFG
FT                   CLRSRWSIELITRIINELFGLSLSQSTFYRYFCQVGIVWRRAAPTVKKPDPEYDEKMAK
FT                   ITEALSSVSEQHPVFYEDEVDIDLNPKIGADWCLKGQQKRVMTPGKNQKHYLAGCLDAQ
FT                   TGQVTYVSGIKKNSDLFINLLKELNGQYRHAKNITLILDNYGIHKSRKVRAWLQQNPKF
FT                   NLLFLPVYSPWINKIERLWQSLHETVTRNHCCQYMWQLLKCVEAFINSFSSGQQPGMRK
FT                   MGVSLL"
FT   CDS_pept        512324..512443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0601"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88675"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJB9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88675.1"
FT                   /translation="MALLSPFWDFFDLAINQIAKTGLSSLQVIYYFESLFILD"
FT   regulatory      complement(512459..512518)
FT                   /regulatory_class="promoter"
FT   regulatory      512926..512985
FT                   /regulatory_class="promoter"
FT   operon          513181..521152
FT                   /operon="XNC1_operon0113"
FT   CDS_pept        513181..514314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0113"
FT                   /locus_tag="XNC1_0602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0602"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88676"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJC0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88676.1"
FT                   /translation="MNGYVITQAMEFSFLKEIAEIAHIPYVDVANFNYEFAGMGNALQW
FT                   LLSMKAYLPDIQKVNLARALITTARYHLAQDILSMVNPEKLQPEQEITYLITSFITRNR
FT                   LEPGVYCTELFEKIKQVIKRKKISEENILEASSLAIVWHLKTGTIDLQTYEWFKLCGKS
FT                   IAEKIIERKTFKAKLALSSFYRAYAMVPAAINDVSETRLLMLKSTHFADILEPGNDLET
FT                   VLAETAKKTVLESSIKEMMYVSQKWDEAEEYAMELVAFDPYWSVNYQELAEVYLKQNQY
FT                   SKALEQYQHSKQVGLPRITFTEYMIGVCYEHLGDHQEAINNFKNVLTMDKTNISAGLSG
FT                   YQISLKYDLESKEYFREFINHWDEQGFLTPKHKEMIL"
FT   CDS_pept        514311..514724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0113"
FT                   /locus_tag="XNC1_0603"
FT                   /product="putative Metallothiol transferase fosB
FT                   (Fosfomycin resistance protein)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0603"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88677"
FT                   /db_xref="GOA:D3VJC1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJC1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88677.1"
FT                   /translation="MNEITSINVTRFDHIQMEVADLDESVRFYEDVFGFKKKEAGLRRM
FT                   VRWVILGNENKLYLCLHEYADRAGIENAGLEITHVGFIVDDFDSVLQKLKSYKVKLPDG
FT                   DIIQYHSSRSIYFLDPNGYKIEISELDGGGIDP"
FT   CDS_pept        514790..515803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0113"
FT                   /locus_tag="XNC1_0604"
FT                   /product="putative Gamma-butyrobetaine dioxygenase"
FT                   /EC_number="1.14.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0604"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88678"
FT                   /db_xref="GOA:D3VJC2"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJC2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88678.1"
FT                   /translation="MLNKENKIFRLISEKSNNEIYSRCVIQIDNNKAKKIISELSNEEI
FT                   DHDSFDSELKKLATDIYKRIKNGSGIVVLKGMPISDVNETELGERFLRFCCLMGKPVSQ
FT                   SVMGDILGRVEDMTHIDPDARGYRNKEELFMHTDQPDMVCMLCVRSARQGGHSKFASAL
FT                   ALHEAIKQTRPDLLPALYTGYPYHRLNEHPPGANEITEHNVPVFSECNGDLSIRYLRFN
FT                   IFATAFARNEKIPELLREAIDYMDELATSSTFCWITSLEKGDMLFFNNYLFLHSRTAFE
FT                   DDEDPMKKRLMYRVWLECDNFRSIRPELAVHPEGTGGRGGITPQEGKRPRFDYDLK"
FT   CDS_pept        515816..516772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0113"
FT                   /locus_tag="XNC1_0605"
FT                   /product="Aldo/keto reductase"
FT                   /EC_number="1.1.1.91"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0605"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88679"
FT                   /db_xref="GOA:D3VJC3"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJC3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88679.1"
FT                   /translation="MEYKTLGNSGVYVSAICLGTQQFGRWVDETSACEILNVFTEHGGN
FT                   FIDTADCYPIYLPNGDNGGELSESFIGRWLKSYSRRDDLVIATKFSAPMSDRPNNEGIS
FT                   RKYIIKAVEQSLKRLKTDYIDLYQVHDDYFDVPMEETLRALDDLVKKGLVRYIGCSNFS
FT                   AWRLMKALGLSDKRGYVSYVTIQNKYNLLEKCEYESELMGLCQEEGIGMLPYIPLAKGF
FT                   LTGKYHQGSISNGFIREKDVRKLYDNKRNWDILHLVQTIADKNRINSTQVALAWLLQRP
FT                   GVVAPVVGINSVEQLKTILASVDVSLLSTDIAALNQL"
FT   CDS_pept        516798..517694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0113"
FT                   /locus_tag="XNC1_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0606"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88680"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJC4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88680.1"
FT                   /translation="MTIALIDHCYSILPEGKKQQAISLLNRSGFLVSTDCIQHDGGKES
FT                   IFIHFTGSYLELIEVVNLNQFESSCNATELRASKFGYPYAMVAATGNIKNCENKLKKFY
FT                   QNVTNIRYVVPNMTGWEKAAWAILDISELHTPGCYFQFIQYLLRKPSWAEINHGLNNIY
FT                   GICGFYFCTNTPFEDREYWYDFLSLMEDCSKLEKNSLSIGMQQLYWLYPDEFYDYFGVQ
FT                   LSLEESQGARLGAVKLLSSDIELSFNYLKGGGFVIEGCTGQDFYTKVDPNLGYALHIVK
FT                   GNGAFDYAMDINRRLLE"
FT   CDS_pept        517725..518600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0113"
FT                   /locus_tag="XNC1_0607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0607"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88681"
FT                   /db_xref="GOA:D3VJC5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJC5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88681.1"
FT                   /translation="MKDFEINLFDAHIHTEFEGTPDHFSGIIASLDFFKESINGINFVG
FT                   ALSDSATPSQNHGDLREHGIYHCAVIRDLNYDIDIIEKKIISGRVYAIKINVGFIHRYA
FT                   SDTHFQPLYALAEQLSVPVMFHSGDPGWPHAKVKYADPISFDEIAVDYPGVNFVLVHAG
FT                   NPWFQSAAVVAAKNNNIFLEGSSLIDGDIKVCSDERARRLISNPLSWIIDYLGSSEKLI
FT                   FGSGWPMVDLKSYIDIFRQGIPEQAWNNVFCDNALRLYGFVMEKESNGQLICVPKLQRK
FT                   NSNNVHYSSK"
FT   CDS_pept        518578..519576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0113"
FT                   /locus_tag="XNC1_0608"
FT                   /product="ABC transporter related"
FT                   /EC_number="3.6.3.40"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0608"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88682"
FT                   /db_xref="GOA:D3VJC6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJC6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88682.1"
FT                   /translation="MSIIQVNDLCKSYEVYTKNPGLLGSLKSFIKREYAIVEAVKSIGF
FT                   SIEKGEIVGFLGANGAGKTTTMKMLTGIIKPSSGHIRVLGYTPYERKNEYLKSISFVAG
FT                   QKQQLSWDLTPNDSFMLHKVIYSINEKDFLKYRGQLVEMLSLHSIIDRPVRHLSLGERM
FT                   KCELALSLLHKPSVLYLDEPTIGLDVSMQRSVREFITYYNQVNNATILLTSHYMADVEA
FT                   LAKRVIIINSGEIVYDGKLSHLIKKRSPKKILKAIISGPIMPELRSLINSSSDDGQNIE
FT                   LVVERDLLPSVVAKLMEKKIILDISIHDEPIEKVLERYLSSSYGENHVEAC"
FT   CDS_pept        519560..520366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0113"
FT                   /locus_tag="XNC1_0609"
FT                   /product="putative ABC-2 type transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0609"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88683"
FT                   /db_xref="GOA:D3VJC7"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJC7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88683.1"
FT                   /translation="MLKHVKRSLLLWQVLIGQSFSRVIAYRAQSIIWLLGGIMPIAMMF
FT                   VWLGLAKEGEVGSYTASDFAVYFLSIYLVRQLTAIWVMRRLDSDIRRGELSMLLLRPVS
FT                   PLYSYVSDHTGEMMVRGPIISLVFISGILLTGNFHRLDIGNLLTFIPALALAWIIIFHL
FT                   YYCLGLLAFWINNSMAFDPLLWALYTILGGVLIPLDLYPESIASWLKLLPFSSALDFPV
FT                   QIILGKLNNFLLLIGFGVQLFWVVFLTLIRILLWNAGLRRYSASGV"
FT   CDS_pept        520370..521152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0113"
FT                   /locus_tag="XNC1_0610"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0610"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88684"
FT                   /db_xref="GOA:D3VJC8"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJC8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88684.1"
FT                   /translation="MRYILLFLVLLRHSFLLEFEFRFNAIVNLINSSLSCLLALLVLTG
FT                   FFGQVSQVGGWTYYQMVALLGVTLIIESFIDSWLFPSVHSLSEYIRRGDLDLIIIRPVD
FT                   TQFFISFHRFNIWDGANFIVGYVVVLLAMYQQDALTIWNFLQFNIALLLGACVFYSLFM
FT                   CSNLIAFWFTKVSDVWVICYSLMDIGRFPVSAYPGALRFLLSFLLPVFFVSNVPAQAAL
FT                   GILSMKTLLLAFLYAMGAIILTRLFWLKAISKYSSASS"
FT   regulatory      521411..521470
FT                   /regulatory_class="promoter"
FT   operon          521508..524839
FT                   /operon="XNC1_operon0114"
FT   CDS_pept        521508..522179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0114"
FT                   /locus_tag="XNC1_0611"
FT                   /product="putative Arsenical resistance protein ArsH"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0611"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88685"
FT                   /db_xref="GOA:D3VJC9"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJC9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88685.1"
FT                   /translation="MTNILSNLTNELQDIFSLEKLYKQNKSSHKARILLLYGSNRMPSF
FT                   SRLLVQEATILLNFLGAETRIFDPYGLPLPDTAIDSHNKVAELQQLMQWSEGQVWCSPE
FT                   HHGSVSAVFKSQLDWITLETGLSCPIQGKTLAVLQVNGGAQSFNVVNQLRIIGRYMKMF
FT                   TIPNHLSVPQAFLEFEETGRMKASFYYDRLVDVMEELLKFTLILRDKRQYFLDRYSERH
FT                   K"
FT   CDS_pept        522232..523377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0114"
FT                   /locus_tag="XNC1_0612"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0612"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88686"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJD0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88686.1"
FT                   /translation="MTYNLTAFNLHLKNTWYKNKQSLRSIKKKWSAIRYNYTKPPKLCG
FT                   ELNFNERIWSIPGEIGNNKFIVSCYDGFIYCYHIKTLQQIWRLKTNGPIYSSPAVTKNG
FT                   NFIIGGEDSTLRMISTHGHCLWEFNAYDAFHSTPTIDEKNGIIYAGSYDHSMYAIKINN
FT                   GELIWKRDFEKGIIDDIYSSPALTHEGNIIFGTNKTLICLDKFGTTVWAVINEGRFEGS
FT                   AALDYSINTGIIGTEENGQIIIFDINTGEIRATHPTEGFIVSCPSIGYKHIATIGSDDK
FT                   NIYGINLLTTDVLWKCYVGTRFMYTPFSSLPNGDPIFVGTSDDPNHFTESLHCHNHKNG
FT                   KFRWKITAPTGIHSSPLLIEEGYLIIGSHWNKVYIYQWDEV"
FT   regulatory      523383..523442
FT                   /operon="XNC1_operon0114"
FT                   /regulatory_class="promoter"
FT   CDS_pept        523469..524839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0114"
FT                   /locus_tag="XNC1_0613"
FT                   /product="putative Thermostable carboxypeptidase 1
FT                   (Carboxypeptidase Taq)"
FT                   /EC_number="3.4.17.19"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0613"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88687"
FT                   /db_xref="GOA:D3VJD1"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJD1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88687.1"
FT                   /translation="MIPKRSHLLRSEQISLLSTMQHEILASNEIIELLSYIDMSMLNDW
FT                   QQSNIREICRLHTMATKIPKNLINRFAKATTRCEKLWHVRTNQVDQKYFEESFEEVVIL
FT                   TREMAYLLADGLGLSVYDTLLEQQQPGLRDHFITPIFNQIELFTSNFVSIRNSLPEEEN
FT                   NWPRIPKDQQIKFVKKLMSEMKFDFRTGRLDESAHPFTGGIPGDIRVCSYFKPDNIILS
FT                   ISAIMHEIGHASYESRLPKKFRGQPVGDSRGMCIHEGIALLFEKQIGHSKEYLEYLSKK
FT                   LNKQFGYLNYFNKENLLHHFNTIRRSGIRVSADDFTYSAHILIRYKIEKELIAGELSVK
FT                   NLNNRWCDLYNLYLGITPSLYEDPWQDIHWAIGLFGYFPCYLIGNVISSQLFNKAQEEI
FT                   SIKQEINQGKFNKLQKWLDEKIYKKSSYFEFEDLIISSCGKALSANDFIDNLKARLS"
FT   CDS_pept        complement(525237..525899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0614"
FT                   /product="putative hydrolase, haloacid dehalogenase-like
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0614"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88688"
FT                   /db_xref="GOA:D3VJD2"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88688.1"
FT                   /translation="MSQRIAVFDLDETLIDGDSGRLWTQYLWEKNIITDPRFLQADQEM
FT                   MADYRAGKLDMPKYLAFSLQALNQIPHKQVDIWLTDFVETKIKPLIYPTAQKQLETYRQ
FT                   QDIPIIIISATVSFVVKKIAAAFGVQTAMGIDMVMQEGCYTGIIQGVPTFREGKVTRLQ
FT                   QWLSEQNLSPPHISFYTDSINDLPMCLFANEVFTVNADEKLKSEAEMRGWTQLNWAL"
FT   regulatory      525913..525972
FT                   /regulatory_class="promoter"
FT   regulatory      complement(525931..525990)
FT                   /regulatory_class="promoter"
FT   CDS_pept        526035..526808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0615"
FT                   /product="NADH pyrophosphatase"
FT                   /EC_number="3.6.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0615"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88689"
FT                   /db_xref="GOA:D3VJD3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR022925"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJD3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88689.1"
FT                   /translation="MQQKLTGIERGWWIVSLENRVWLPQGELPLGAASQWSLQGHMAQS
FT                   IGEWQGETVWLVRQKMVSEMSSPRLIADRDAKLFQLVGRGVQLAEFYRSHSYCGYCGCE
FT                   MQHSQHEWACLCDHCKERYYPQIAPSIIVGIRRDDHILLAQHQRHRSCIHTVLAGFVEV
FT                   GETLEEAVHREVMEESGIKIRNLRYVASQPWPFPNSMMVGFLADYDSGEIIVDPVELVS
FT                   ADWYHYDNLPLIPSPDTIARRLIEDTVALCRQQSC"
FT   regulatory      complement(526821..526859)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(526896..529091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcp"
FT                   /locus_tag="XNC1_0616"
FT                   /product="dipeptidyl carboxypeptidase II"
FT                   /EC_number="3.4.15.1"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0616"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88690"
FT                   /db_xref="GOA:D3VJD4"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJD4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88690.1"
FT                   /translation="MRLSTLVLAISLALSAQAQAEENKLGSDNTNISSDQIKEANVTDG
FT                   TDQQQYKHKNPFFYPSALPFQAPPFDKIKEADYAPAIAAGIKQKLAEVAKIANNPAPPN
FT                   FKNTFVALEKSGAMLTRVMNVFGAMTSANTTDQLQKLDEEMSPKLAAMEDEIMLNSQLF
FT                   SRIKTIYQQRETLKLAPESRRLVEVTYQRFELAGANLSDQDKAKLKALNQEAATLSTQF
FT                   TNKLLTATKNGALAIQDKAKLNGLSDGEIAAAAQAASERKLDKQWLLVLQNTTQQPGLQ
FT                   DLKDRDTRQALFDASWSRAEKGDDNDTRQTLTRLAKVRAEQAALLGFPDYASWKLQNQM
FT                   AKTPEAALKFLRDIVPAATARAEREAKDIQAVIDQQQGNFKLEAWDWPFYAEQVRKAKY
FT                   DLDESQIKPYFELNNVLNNGVFYSANLLYGITFKERKDIPVYQADVRVYEVFDKNRKPL
FT                   ALFYTDYFKRDNKGGGAWMSNFVDQSKLFGTKPVIYNVTNFTKPAPGQPALLSYDDVIT
FT                   LFHEFGHALHGMFAAQEYPTLSGTNTARDFVEFPSQFNEYWARDPKVFAHYAKHYQTGE
FT                   AMPQALVDKINKADKFNKGYLMTELLSAALLDMHWHMLAADQPQQDVDTFEANALKQDN
FT                   INLSYVPPRYRSSYFKHIWGGGYAAGYYAYLWTEMLADDAFAWFTEHGGLTPENGQRFH
FT                   DKVLSRGNSKDLEKLYIDWRGKPPSIEHMLKNRGLKE"
FT   CDS_pept        complement(529183..529350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0617"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88691"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJD5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88691.1"
FT                   /translation="MKKFMFIVTKSGTGTMHTRSPFSLCYFYVVNMLLEEKSIFYVAIT
FT                   FRCSRCAVNC"
FT   regulatory      529222..529281
FT                   /regulatory_class="promoter"
FT   regulatory      complement(529335..529394)
FT                   /regulatory_class="promoter"
FT   operon          529473..531886
FT                   /operon="XNC1_operon0115"
FT   CDS_pept        529473..530537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0115"
FT                   /gene="hemE"
FT                   /locus_tag="XNC1_0618"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0618"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88692"
FT                   /db_xref="GOA:D3VJD6"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJD6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88692.1"
FT                   /translation="MNELKNDRYLRALLRQPVDITPVWMMRQAGRYLPEYKATRQEAGD
FT                   FISLCKNTELACEVTLQPLRRFPLDAAILFSDILTIPDAMGLGLYFEAGEGPRFHAPVM
FT                   NHADVEKLPVPDPEQELGYVMAAVRAIRKALAGQVPLIGFSGSPWTLATYMVEGGSSKA
FT                   FTKIKAMMYAEPATLHLLLDKLANSVILYLNAQIKAGAQSVMIFDTWGGVLSHRDYLEF
FT                   SLHYMHKIVDGLIREHEGRRVPVTLFTKGGGQWLEAMAATGCDALGLDWITNIADARRR
FT                   VGDKVALQGNMDPSMLYAAPARIEEEVSTILHDFGAGAGHVFNLGHGIHQDVPPEHAGA
FT                   FVEAVHRLSVKYHQ"
FT   CDS_pept        530542..531219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0115"
FT                   /gene="nfi"
FT                   /locus_tag="XNC1_0619"
FT                   /product="endonuclease V (deoxyinosine 3'endoduclease)"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0619"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88693"
FT                   /db_xref="GOA:D3VJD7"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJD7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88693.1"
FT                   /translation="MIDTKALRQEQIEKSRRVIRHDVFATSFTPTFIAGADVGFENDGT
FT                   VTRAAIAVLQYPSLELVEYQIARIATVLPYIPGLLSFREYPALLAAWQKIKQRPDLLMV
FT                   DGQGIAHPRRFGIASHFGLLVDVPTIGVAKSRLCGEHAPVGDTPGSRQPLMDHGEQIGV
FT                   VLRSKKRCNPLYISIGHQISIHSAIFWVEQCMKGYRLPEPTRWADGIASNRPFFKQTMQ
FT                   KNL"
FT   CDS_pept        531296..531886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0115"
FT                   /locus_tag="XNC1_0620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0620"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88694"
FT                   /db_xref="InterPro:IPR007338"
FT                   /db_xref="InterPro:IPR023381"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJD8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88694.1"
FT                   /translation="MLRNPIHLRLEKLESWQHLTFMASLCERMYPNYQVFCRQSGFTDP
FT                   AQYRRILDIVWEILVVKDAKVNFDNQLEKLEAIIPSSESYDIYGVYPAIDACIALGEVI
FT                   HSRLSGSTLKHAIAVSEISIRTVAMLEMTQAGREMTEDELKVLPAIEEEWDIQWEIYRL
FT                   LANCEERDIELIKGLKADLREMGVSNIGINLEQ"
FT   regulatory      531908..531967
FT                   /regulatory_class="promoter"
FT   operon          532072..533063
FT                   /operon="XNC1_operon0116"
FT   CDS_pept        532072..532344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0116"
FT                   /gene="hupA"
FT                   /locus_tag="XNC1_0621"
FT                   /product="DNA-binding protein HU-alpha (HU-2), plays a role
FT                   in DNA replication and in rpo translation"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0621"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88695"
FT                   /db_xref="GOA:D3VJD9"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJD9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88695.1"
FT                   /translation="MNKTELVDAIAAGADLTKTQAKAALESTLNAITESLKNGDAVQLV
FT                   GFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFSAGKALKDAVK"
FT   CDS_pept        532362..533063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0116"
FT                   /locus_tag="XNC1_0622"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0622"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88696"
FT                   /db_xref="InterPro:IPR010858"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJE0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88696.1"
FT                   /translation="MRGGYSKPLLLILQGLLALGFISLLSACSIQPKSSPFSASGFVAD
FT                   NGIIRLWRLNDQNSKPQVIMSVYSPYHNKNTTVTFYEYRHGNLWQIRRNVLGHSLNDKM
FT                   PIAETLRIDQNNVVIFKLRQLKDRNELLSDNDVKSLQLDAKQILETSDALIAKNIMLLQ
FT                   GHWQNSRVTTCAGKQLFIEFNPDAQRWLKERQSNSSGPLTIAWLDSSEGKQLLLVANDD
FT                   FCRWEPTKDKL"
FT   operon          complement(533093..535996)
FT                   /operon="XNC1_operon0117"
FT   CDS_pept        complement(533093..534376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0117"
FT                   /gene="purD"
FT                   /locus_tag="XNC1_0623"
FT                   /product="phosphoribosylglycinamide synthetase (GAR
FT                   synthetase)"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0623"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88697"
FT                   /db_xref="GOA:D3VJE1"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJE1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88697.1"
FT                   /translation="MNILIIGNGGREHALAWKAAQSPLASKVFVAPGNAGTALETNLEN
FT                   VDIAATDIEGLLAFAQSHDIGLTIVGPEVPLVIGVVDAFQQAGLTIFGPTKAAAQLEGS
FT                   KAFTKDFLARHHIPTATYQNFTEIDPALAYLEKTGVPIVIKADGLAAGKGVVVAMTMEE
FT                   AQGAVKDMLAGNAFGDAGHRIVIEEFLAGEEASFIVMVDGKNVVPMATSQDHKRVGDGD
FT                   TGPNTGGMGAYSPAPVVTDEIHQRVMEKIIYPTVEGMAAEGHTYTGFLYAGLMIDQQGE
FT                   PKVIEFNCRFGDPETQPIMMRLRSDLVELCLAGAKGKLGGKTSSWDSRPALGIVLAAGG
FT                   YPANYAKGDVISGLAEDTNIDEKIFHAGTAIKDETVVTAGGRVLCVTALGNNIAEAQRK
FT                   AYQRAEHISWEKCFYRKDIGYRAIARLK"
FT   CDS_pept        complement(534407..535996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0117"
FT                   /gene="purH"
FT                   /locus_tag="XNC1_0624"
FT                   /product="bifunctional: IMP cyclohydrolase (N-terminal);
FT                   phosphoribosylaminoimidazolecarboxamide formyltransferase
FT                   (C-terminal)"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0624"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88698"
FT                   /db_xref="GOA:D3VJE2"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJE2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88698.1"
FT                   /translation="MQQLRPIRRALLSVSDKAGVVEFAKALSSRGVKLLSTGGTAHLLS
FT                   EAGLNVTEVSDHTGFPEMMDGRVKTLHPKIHGGILGRRGLDDEVMVQHQIAPIDMVVVN
FT                   LYPFAQTVAKPDCSLEDAIENIDIGGPTMVRSAAKNHKDVTIVVNSQDYNKIIEEMDSH
FT                   QNSLTHATRFDLAIKAFEHTTAYDSMIANYFGKLVAPYHGETDQPSGRFPRTLNLNLIK
FT                   KQDMRYGENSHQDAAFYIEEQIAEASIATAAQLQGKALSYNNIADTDAALECVKAFSEP
FT                   ACVIVKHANPCGVAVSTDIHTAYDQAFKTDPTSAFGGIIAFNRALDADTAKSIIERQFV
FT                   EVIIAPSINETALPILATKQNVRVLACGEWRSPVAGLDFKRVNGGLLVQDRDLGMVTED
FT                   DLRVVSKRQPTKQEMQDALFCWKVAKFVKSNAIVYAKDNMTVGIGAGQMSRVYSAKIAG
FT                   IKAADEGLDVQGCAMASDAFFPFRDGIDAAAAVGVSCVIQPGGSIRDDEVIAAADEQGI
FT                   AMIFTGMRHFRH"
FT   regulatory      536017..536076
FT                   /regulatory_class="promoter"
FT   regulatory      complement(536058..536117)
FT                   /regulatory_class="promoter"
FT   CDS_pept        536225..536506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0625"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88699"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJE3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88699.1"
FT                   /translation="MQQMIIFSKKNYCQRRKTPYNAPPLTDAELRHAAEDSRRDSENKR
FT                   LTPEAKSVRYAASQPGRRFPVAPLFNKLIRQSVWALTRHYRTPKGEKD"
FT   CDS_pept        536454..536585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0626"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88700"
FT                   /db_xref="UniProtKB/TrEMBL:D3V9W7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88700.1"
FT                   /translation="MCGHSQDTIARRKAKKIKQVLKSEQQLIHYELTTVEFFEHQTL"
FT   rRNA            536608..538103
FT                   /locus_tag="XNC1_rRNA0014"
FT                   /product="16S ribosomal RNA"
FT   tRNA            538195..538271
FT                   /gene="IleGAT"
FT                   /locus_tag="XNC1_tRNA0020"
FT                   /product="tRNA-Ile"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   tRNA            538375..538450
FT                   /gene="AlaTGC"
FT                   /locus_tag="XNC1_tRNA0021"
FT                   /product="tRNA-Ala"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   rRNA            538620..539159
FT                   /locus_tag="XNC1_rRNA0015"
FT                   /product="23S ribosomal RNA"
FT   rRNA            539174..541181
FT                   /gene="LSU_RRNA"
FT                   /locus_tag="XNC1_rRNA0016"
FT                   /product="23S ribosomal RNA"
FT   rRNA            541630..541742
FT                   /locus_tag="XNC1_rRNA0017"
FT                   /product="5S ribosomal RNA protein"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT   CDS_pept        complement(541862..542533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0630"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88701"
FT                   /db_xref="GOA:D3VJE5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJE5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88701.1"
FT                   /translation="MTMKKDHTPQILSKKIAETIRNKLVTGELLPGQQLSEAALSKQLE
FT                   ISRNTLREVFRLLTQEGLLKHEPNRGVFVATPDIGSILDIYRVRQLIECQALIQAYSMH
FT                   PSVAKMTEAIEIAQQCRDKKDWVGAGTANMCFHAAIVELTDSERLIAFYRNISAELRLA
FT                   FGILNNPELLYAPYIDKNAHILELINSGQNELAAKKMKSYLELSERTILAAYARKNNQE
FT                   L"
FT   regulatory      complement(542718..542777)
FT                   /regulatory_class="promoter"
FT   regulatory      542774..542833
FT                   /regulatory_class="promoter"
FT   operon          542853..547027
FT                   /operon="XNC1_operon0118"
FT   CDS_pept        542853..543620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0118"
FT                   /gene="ybgL"
FT                   /locus_tag="XNC1_0631"
FT                   /product="putative lactam utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0631"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88702"
FT                   /db_xref="GOA:D3VJE6"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJE6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88702.1"
FT                   /translation="MIKTIDLNSDLGEGFGQWRMGNDKAMLEIVSSANIACGFHAGDPA
FT                   GILQTLNSAKKNNVVIGAHVSYPDLVGFGRRKMDIASHELTADVIYQIAALQGLAKTVN
FT                   TKVSYIKPHGALYNTIANDEYQAMAVIDGILAIDPCLTLVGLAGSNILRLAQEKGLKTI
FT                   AEAFADRAYTSKGELVSRRESGSVLHNADLVARRMLQLVTEGGVESIDGKFTPIQADSI
FT                   CVHGDSPGSVEMAREVKTVLEQSGITIRSFICP"
FT   CDS_pept        543669..545267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0118"
FT                   /locus_tag="XNC1_0632"
FT                   /product="putative allophanate hydrolase subunit 1 and 2"
FT                   /EC_number="3.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0632"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88703"
FT                   /db_xref="GOA:D3VJE7"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJE7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88703.1"
FT                   /translation="MRFLPINFNTIMVDLKGLSATLALLDSLNMAPIPGIEEIIPAART
FT                   LMIRFRPIKISAQQLAEEICHRDLQERSYAAGKKIEIPVHYNGEDLAIVAEILGMTIQE
FT                   VIRQHTENEHTVAFTGFAPGFAYMVSDTSSWDIPRKKIPRTYIPAGAVALAGEFSSVYP
FT                   QASPGGWQIIGITTERMWDLSRLSPALLQPGYRVNFRNAGRLRTTVGLPEVPSRNTASC
FT                   PGTSCHLEILSVGLQTLFQDLGRIGQSGLGISESGALDKSALRGANRIVGNVSDQACLE
FT                   IAQGGFKAIAHGQIVIAITGAPCPIEIKTPEGETLYVNTYQPIDLNDGDEISLGTPAAG
FT                   MRSYLAVRGGFAVPAILSSHSFDTLSNIGPSPLNVRDKLAVREISHCAAVSFSETPAFV
FT                   MPNKEDVVILDIILGPRTDWFTQEALNLLSQQIWQVTPQSNRIGLRLNGKHSLSRTKQQ
FT                   ELPSEGTCTGAIQIPASGQPVLFLADHPLTGGYPVIASVADYHLDLAGQVPINARIRFN
FT                   PISQFQEIQGSKDFS"
FT   CDS_pept        545264..547027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0118"
FT                   /gene="accA"
FT                   /locus_tag="XNC1_0633"
FT                   /product="bifunctional protein [Includes: biotin
FT                   carboxylase; biotin carboxyl carrier protein]"
FT                   /EC_number="6.3.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0633"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88704"
FT                   /db_xref="GOA:D3VJE8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJE8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88704.1"
FT                   /translation="MNTLYNKSKKVLIANRGEIAVRIIRACRDYGIQTIAVYADVDVNA
FT                   LPVQLADEAYRLGGNTPAETYLHIPRLLEIAQQSGATMVHPGYGFLSERAEFARAVIDA
FT                   GLIWIGPHPETIDELGDKIKARRIAQKVGAPLVIGTAEPVKDVQEVVAFAETHGLPIAI
FT                   KAAFGGGGRGLKVAWRLDEVAELYHSAVREATAAFGRGECFIEQFLNNPRHIEAQVIAD
FT                   KQGNVVVLGTRDCSLQRRNQKLVEEAPAPFLTQEQRERIHQSAKAICVEANYVGAGTVE
FT                   FLLSADGALSFLEVNTRLQVEHPVTEETTGIDLVIEQLRVAEGYPLSIQETPVPKGHSF
FT                   EFRINAEDAGKGFLPTSGIISEFIAPSGPGIRLDSGVLSGSIIPATFDSLMAKLIVTGA
FT                   NREQAISRARRALREFEISGVASVLPFHQAVMEHPDFVSSDNFHVHTRWIETDFVNALE
FT                   RSPRQAVKEDKGITRTFIEIDGCRHELGLPSDLLSGLTQLVPVSERPFFKPLAKEKVAE
FT                   DPHQVKAPISGVLHSWLVTEGEEVRDGDVIAVMEAMKMEVQISAHRSGKITFCVRAGDY
FT                   HDAESILATID"
FT   regulatory      547092..547151
FT                   /regulatory_class="promoter"
FT   CDS_pept        547178..549238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0634"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0634"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88705"
FT                   /db_xref="GOA:D3VJE9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR011276"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJE9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88705.1"
FT                   /translation="MAKLTKISASLAKNGLCVPLMSASMLTALISSNALATTENKIQKS
FT                   NTTGDTIVVIASNNAEQESGKVGRNEIKVKQAQSVGEILKNVPGVQAGHPSALGQRFKI
FT                   RGMDDQFINVTVDGARQEGYHFHHAGNYSIDPEMLKQIDINVGTNSITYDTGALAGALK
FT                   FETVDAGDLLEPGQLFGAKGKLSYVSNGSEFQQSLATYGRLGAVDLLGYFNHRNMGDAK
FT                   TGRDNLGRESIPTDGKLVNYLLKAKFNLTDEQYIRVAKEHYKNDADTNFRLNFGPDINK
FT                   GKKAKYASERDGYNIVYRYVPVDNDLIDLKISAYHTEQNFNHMREVDGPGKGFDSIVET
FT                   QGIRARNVSSFDTQKLSHVLTYGYEYFDTRMAYTDEEENIHKKVVETGKSSSVYLEDDI
FT                   QLANFHVIPGVRWDHYQYNTINKNNEPFERTYAHFSKALGLKYELGASTTLFANYTELF
FT                   RGPLGKEIGLGPSNHNANLKATTGYNLETGAAGTYSDVFAENDSFTVIGKVFQTNFKNL
FT                   ATTLAERSLNNIPKSRLEGFELSTKYQLDNLSLRATYAKANNKILTGSALFDTRREFTP
FT                   TIGDVFTIGGSYLFDKTDIELGWNSRFVRATDAKGTDNGEIVNVHKSGYGVSDVYISWA
FT                   PKSGSWKNTEIQLGIDNIFDKRYNEQSYYLNVYKGQEEKGRAYKATLSYKF"
FT   regulatory      complement(549254..549286)
FT                   /regulatory_class="terminator"
FT   regulatory      549266..549300
FT                   /regulatory_class="terminator"
FT   operon          complement(549341..552644)
FT                   /operon="XNC1_operon0119"
FT   CDS_pept        complement(549341..549694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0119"
FT                   /gene="frdD"
FT                   /locus_tag="XNC1_0635"
FT                   /product="fumarate reductase, anaerobic, membrane anchor
FT                   polypeptide"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0635"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88706"
FT                   /db_xref="GOA:D3VJF0"
FT                   /db_xref="InterPro:IPR003418"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJF0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88706.1"
FT                   /translation="MNQVPKRSDEPIFWGLFGAGGMWSAIVGPAIILLLGILLPLGLAP
FT                   EALSYERILTFCQSFIGRLFLLLMISLPLWCGLHRIHHGMHDLQLHIPASKWVFYGAAA
FT                   ILSIVALIGVFTL"
FT   CDS_pept        complement(549711..550106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0119"
FT                   /gene="frdC"
FT                   /locus_tag="XNC1_0636"
FT                   /product="fumarate reductase, anaerobic, membrane anchor
FT                   polypeptide"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0636"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88707"
FT                   /db_xref="GOA:D3VJF1"
FT                   /db_xref="InterPro:IPR003510"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJF1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88707.1"
FT                   /translation="MTTKRKPYVRGMRPNWWHKLGFYRFYMLREGTSVPAVWFSLLVLY
FT                   GLFALKNGPESWAGFVAFLQNPIVLLINIITLLAALLHTKTWFELAPKALNIIVKNEKM
FT                   APGPVIKLLWAMTMIATAAILGIALLF"
FT   CDS_pept        complement(550121..550855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0119"
FT                   /gene="frdB"
FT                   /locus_tag="XNC1_0637"
FT                   /product="fumarate reductase, anaerobic, Fe-S subunit"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0637"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88708"
FT                   /db_xref="GOA:D3VJF2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJF2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88708.1"
FT                   /translation="MTEMKNLTMEVMRYNPETDSKPHFVTYEVPYDEQTSLLDALGYIK
FT                   DNLAPDLSYRWSCRMAICGSCGMMVNRVPKLACKIFLRDYAQGMKVEALGNFPIERDLV
FT                   VDMTHFIESLEAIKPYIIGNDRKPADGPNVQTPAQMAKYHQFSGCINCGLCYAACPQFG
FT                   LNPEFIGPAAVTLAHRYNLDNRDNGKKERMPHINSDNGVWSCTFVGYCSEVCPKHVDPA
FT                   GAIQQSKAESAKDFLISMLKPQ"
FT   CDS_pept        complement(550848..552644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0119"
FT                   /gene="frdA"
FT                   /locus_tag="XNC1_0638"
FT                   /product="fumarate reductase, anaerobic, catalytic and
FT                   NAD/flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0638"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88709"
FT                   /db_xref="GOA:D3VJF3"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005884"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJF3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88709.1"
FT                   /translation="MQTVNVDLAIIGAGGAGLRAAIAAAEANPQLKIALISKVYPMRSH
FT                   TVAAEGGSAAVTQSHDSHDFHFNDTVSGGDWLCEQDVVEYFVKHCPTEMIQLEQWGCPW
FT                   SRKEDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLKYSQIQRFDEHFVLDILV
FT                   DEGHARGLVALNMMEGTKVQIRANAVIMATGGAGRVYRYNTNGGIVTGDGMGMAFRHGV
FT                   PLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKDGYRYLQDYGLGPETPLGHPENK
FT                   YMELGPRDKVSQAFWHEWRAGRTVATPRGNVVYLDLRHLGEKKLLERLPFICELAKAYV
FT                   GVDPVKEPIPVRPTAHYTMGGIETNQRCETRIKGLFAIGECSSVGLHGANRLGSNSLAE
FT                   LVVFGRLAAEEAVKHIQAVKPANESALNAQFRDVEDKLNQLLNQKGNESQAKIRDDLGT
FT                   SMEEGCGIYRTPELMQKTIDKIAELKERFKRIEINDRSSVFNTDLLYTIELGFGLDVAE
FT                   CMAHSAISRKESRGAHQRLDEGCTGRDDENFLKHTLAFYNPEGAPRLEYSDVKITKSQP
FT                   AKRVYGGEAAAQEKKQKEQVND"
FT   regulatory      complement(552680..552739)
FT                   /regulatory_class="promoter"
FT   CDS_pept        552883..552999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0639"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0639"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88710"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJF4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88710.1"
FT                   /translation="MINGSAAIGINNQINMECKVIIKLSKLIIFYTFVICST"
FT   CDS_pept        553490..554008
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0640"
FT                   /product="Transposase (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ88711.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        554140..554556
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0641"
FT                   /product="Transposase (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ88712.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   regulatory      554608..554667
FT                   /regulatory_class="promoter"
FT   CDS_pept        554694..555671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="poxA"
FT                   /locus_tag="XNC1_0642"
FT                   /product="putative lysyl-tRNA synthetase with Class II aaRS
FT                   and biotin synthetase domains"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0642"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88713"
FT                   /db_xref="GOA:D3VJF7"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJF7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88713.1"
FT                   /translation="MNEIANWQPSAPIANLLKRAKILAEIRRFFADRGVLEVETPAMSQ
FT                   ATVTDIHLVPFQTRFVGPGAADGLTLYLMTSPEYHMKRLLAAGSGSIYQIGKSFRNEEA
FT                   GRQHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQILECESAESLSYQQAFIRYLNIDPLT
FT                   ASKEKLREVAAKLDLSNIADQEEDRDTLLQLLFVMSVETQIGIEKPTFVYHFPASQASL
FT                   AEISKEDHRVAERFEVYFKGMELANGFRELTDSDEQCLRFEQDNRKREEMGLPVQPIDD
FT                   HLLAALAHGMPECAGVALGVDRLIMLALGADRMSDVIAFPVGIS"
FT   CDS_pept        complement(555717..556793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpQ"
FT                   /locus_tag="XNC1_0643"
FT                   /product="glycerophosphodiester phosphodiesterase,
FT                   periplasmic"
FT                   /EC_number="3.1.4.46"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0643"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88714"
FT                   /db_xref="GOA:D3VJF8"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJF8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88714.1"
FT                   /translation="MQTPIKTIMAGILLASSMSGIAHAADKIVIAHRGASGYLPEHTLP
FT                   AKAMAYTQGADYLEQDLVMTKDDQLIVLHDHYLDRVTDVAERFPNRARADGRYYAIDFT
FT                   LPEIKSLKFTEGFNIKDGKKIQSYPGRFPMGKSDFRIHTFQEELEFIQGLNKSTGKDIG
FT                   IYPEIKAPWFHRQEGKDITTKVLDVLKQYGYTKKSDKVYLQCFDANELKRIKNELEPKL
FT                   GMDLKLVQLIAYTDWNETYEQKTDGTWQNYSYDWMFKPGAMKEVATYADGIGPDYHMLI
FT                   ASDSTPDNIKFTGMVKEAHANHMVVHPYTIRIDQLPKYATSGNQLFDIVFDKANVDGAF
FT                   TDFPDLAVKFLKKHHEHK"
FT   regulatory      complement(556814..556873)
FT                   /regulatory_class="promoter"
FT   CDS_pept        557183..557353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0644"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88715"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJF9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88715.1"
FT                   /translation="MSHLNAQSIEMEGDGISYFHGRNRGVLLVFSVLHFMIDEGWNSVG
FT                   FLGLKIGRVKK"
FT   regulatory      complement(557502..557546)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(557576..558928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpT"
FT                   /locus_tag="XNC1_0645"
FT                   /product="sn-glycerol-3-phosphate transport protein (MFS
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0645"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88716"
FT                   /db_xref="GOA:D3VJG0"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJG0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88716.1"
FT                   /translation="MLSIFKPATHKARLPAQEIDPLYRRLRWQIFMGIFFGYAAYYLVR
FT                   KNFTLAMPYLVEQGFSKGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAA
FT                   AVMLFMGFVPWATSSIAIMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSIWNC
FT                   AHNVGGGLPPLLFLLGMAWFNDWKAALYMPAFAAILVALIVFALMRDTPQSCGLPAIEE
FT                   YKNDYPPDYTDKDEKELTAKEIFMQYILPNKLLWMIAIANVFVYLLRYGILDWSPTYLK
FT                   EVKHFALDKSSWAYFLYEYAGIPGTLLCGWMSDKVFRGNRGATGVFFMILVTIATTVFW
FT                   MNPAGNPTVDMICMLVIGFLIYGPVMLIGLHALELAPKKAAGTAAGFTGLFGYLGGSVA
FT                   ASAIVGYTVDYMGWDGGFMVMIGGSALSVILLLLVMLSENKHKQEMARLSQ"
FT   regulatory      complement(559166..559225)
FT                   /regulatory_class="promoter"
FT   regulatory      559695..559754
FT                   /regulatory_class="promoter"
FT   operon          559887..563230
FT                   /operon="XNC1_operon0120"
FT   CDS_pept        559887..563051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0120"
FT                   /locus_tag="XNC1_0646"
FT                   /product="Putative non-ribosomal peptide synthetase
FT                   (fragment)"
FT                   /EC_number="5.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0646"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88717"
FT                   /db_xref="GOA:D3VJG1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJG1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88717.1"
FT                   /translation="MNTHTHKAILHTAFTGQKLSPATDMKMNSNISQMTAELDPWFKNV
FT                   PSRLAELADVLPNDIAVSDPYEMLTFGELHLRIENAAHLLRHYGVKMGSNVAIAAQRGI
FT                   AWFVTMQAIWRLGAVYIPLNTMMPEKRLNDILASLPESILVSDNTVSSGLKASTLIPMD
FT                   KVLGKINKTSGAETVEDIEIPELGDHPAYVMFTSGSTGLPKSVQVQHENLAACLCAFGK
FT                   LLSISQRDHMLALTTFSFDISVLELLLTVVHGGSIYITSIDTQRDAMALSETLSNSQFT
FT                   YAQATPVTWSMALNAGWKPRPEMSMLCGGEALSQDLADQLTATGGILWNLYGPTETTIW
FT                   STAFRMEKGDKVQLGGPIPGTTITIVDKYLRPVPKGTVGEILIGGMGVTAGYRNNPTET
FT                   AKRYVPDIAQKGKRAYLTGDMARMLEEGSFIYMGRQDDQVKVRGYRIELGEIEIALRKQ
FT                   DGVQDAIIRVAGSGDLAKIQAFVLFHQNMIVAEDWVSETQLALREVLHEAWIPTEYYRI
FT                   PYIPLTSSGKRDKKRLEEVAERLNASYDAVQPQTETEKRVYAIWRDLLATDVFGITDDF
FT                   FQIGGHSILVARMVENIEKAFSLRVPISGIYIEPTVARIAAILDEMTAERQMNPARIAG
FT                   IYHSEALIRQHAETLRNDVYLKEGVRPDGLPHANWYQPDTVLLTGATGYLGLHLLEQLL
FT                   KQTSARIICLCRASDEEHARDRIRAGFTNYQINVGHGLDRVDFVIGDLGQPRFGLLPET
FT                   WAQLAEHVDVIYHNGALVNFTYPYSALKSINVDGTRTALELACTSRLKHFHYVSSVNAL
FT                   FATESPRPYMEDDRAMSESVRDPSGYSGSKWVSEGIINIARKRGVPVSIYRPGLILGHT
FT                   RTGAAQGNDYLIASLKGYLAMGFYPDHALLLDITPVDYVAASLVHISRKPESNGKFFNL
FT                   FNPEQVSIRQFFDWVQEFGYILNPVPFNEGKEKILALDDTHPLYPLIPLIRDMTERPYR
FT                   ALDPAYIDEIHPELELKNTLSGLAGSNIRCPVITAAYVHQVLRYLIGTGFLPALLPESF
FT                   KQEAVA"
FT   CDS_pept        563048..563230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0120"
FT                   /locus_tag="XNC1_0647"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0647"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88718"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJG2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88718.1"
FT                   /translation="MKQLTGNDAMNWMVVLNGKKQYSVWPTEYDIPVGWMATGRTGSKD
FT                   DCLNHIAAIWPEPTK"
FT   regulatory      563244..563303
FT                   /regulatory_class="promoter"
FT   regulatory      563286..563323
FT                   /regulatory_class="terminator"
FT   CDS_pept        563335..563511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0648"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88719"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJG3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88719.1"
FT                   /translation="MIRRIPGIELITDCETCKSQIEMSTSKKLGIQSVCWRGRWIQGGK
FT                   VGLMSRIGMLFDY"
FT   operon          563531..564614
FT                   /operon="XNC1_operon0121"
FT   CDS_pept        563531..564244
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0121"
FT                   /locus_tag="XNC1_0649"
FT                   /product="Conserved hypothetical protein (fragment)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CBJ88720.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        564210..564614
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0121"
FT                   /locus_tag="XNC1_0650"
FT                   /product="Conserved hypothetical protein (fragment)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CBJ88721.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        complement(564672..565772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gldA"
FT                   /locus_tag="XNC1_0651"
FT                   /product="glycerol dehydrogenase, NAD"
FT                   /EC_number="1.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0651"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88722"
FT                   /db_xref="GOA:D3VJG6"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJG6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88722.1"
FT                   /translation="MLKVIQSPSKYIQGPGALSHIGRYTKLLADHVFVIADNFVMSLIG
FT                   DSVSKSLEEHEVTNHFEIFNGECSSSEIERLTAILVSHQCQAVIGLGGGKTLDTAKAIA
FT                   YESKIPVIISPTIASTDAPTSALSVLYTELGKFDRYLLYPQNPNIVLMDTNIIAKAPVR
FT                   LFVAGMGDALATYFEARACSAAHKPTMAGGLTSTTGLALAKLCYDTLLAEGYRAKLAVE
FT                   AGVSTPAVENIVEANTYLSGIGFESAGLSAAHAIHNGFTVLEECHHLYHGEKVAFGTLT
FT                   QLMLENSPNEELETVLDFCVQVGLPVTLEQLGLRDNEKLHQKIMRVATASCAEGETIHN
FT                   MPFAVTPEQVYAAILAADRMGQDWLY"
FT   CDS_pept        565711..565929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0652"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0652"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88723"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJG7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88723.1"
FT                   /translation="MWDNAPGPWIYLDGDWITFSIRNIPSSLETSSLRTGYGVSPYRGI
FT                   AGYELHHIEVCVYLLTKHYTAKYPEKL"
FT   regulatory      complement(565901..565960)
FT                   /regulatory_class="promoter"
FT   regulatory      566027..566071
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(566074..567822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0653"
FT                   /product="putative Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0653"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88724"
FT                   /db_xref="GOA:D3VJG8"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR012258"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJG8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88724.1"
FT                   /translation="MNRSAPSSPLKISNYLGIGNIKLPDGITKILKTNSNTYQASVKKF
FT                   IKLLCYIKNNNIDITSFDKLAELHEFVAIHDSAVASMLSIHFNLTIGTIANLNKQTPYI
FT                   EELYQKLCSGNAIGVYLATELAYGNNLISLETQATYLPEKGIFILNSPNPNAYKFMPNT
FT                   VSCELPKIAVVYAQLNVANRKYGIFPFVLPLSINGKLTKGVKITPLSDKPGFYLDNAIT
FT                   SFDNVEIPFEGLLAGNLMTLDRNGQISLHVKKLKERFALITNRIHTGKICMSICSVGAA
FT                   KSALYITSTYGSKRQTFGYSGAMPALNYCHFKESIAWDTLTTIAHTLYLRKLTKKISIL
FT                   LSESTNNFKISDELLVEIISIKSLFTWRTQEILINCRERCGAHGLFSINKIPQYLISNF
FT                   GSITAEGDNLVLSLKAGEMILTNGLKKSGANIEHDLLSILTDYANHLLDKLKKLTGHDN
FT                   KKITFDIINKNSNDFLTLSQTYAILAVVTTITDSYNTDDIGMILEGYLLDWIHRSMRDL
FT                   LISEIINIQESKKLNERHITYIRDHAEIINGYIYDFEMDKSGIETPISSNDYIGWYAGN
FT                   HDQLKN"
FT   regulatory      567863..567922
FT                   /regulatory_class="promoter"
FT   regulatory      complement(567940..567999)
FT                   /regulatory_class="promoter"
FT   CDS_pept        568142..568294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0654"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0654"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88725"
FT                   /db_xref="GOA:D3VJG9"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJG9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88725.1"
FT                   /translation="MHLKVWRVYWKNIFNDIFKILWGDSINIIVAIYPIGFFIIEEENN
FT                   HIYTL"
FT   regulatory      complement(568503..568532)
FT                   /regulatory_class="terminator"
FT   regulatory      568508..568552
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(568758..569423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhhQ"
FT                   /locus_tag="XNC1_0655"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0655"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88726"
FT                   /db_xref="GOA:D3VJH0"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJH0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88726.1"
FT                   /translation="MFQLTPQQRITALIWLSLFHILIITSSNYLVQLPISIFGFHTTWG
FT                   AFTFPFIFLATDLTVRIYGAPLARRIIISVMLPALLISYLISALFFQGTWQGFEALGTF
FT                   NLFVARIAAASFMAYVLGQILDVSVFNRLRRQSRWWIAPATAMFFGNMLDTLAFFFIAF
FT                   YRSTDAFMATHWVEIALVDYAFKLFICMLFFLPAYGFMLNLIIKYFFSGTEKNILPQA"
FT   regulatory      569414..569473
FT                   /regulatory_class="promoter"
FT   CDS_pept        569626..569982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0656"
FT                   /product="small ubiquitous RNA-binding protein required for
FT                   normal growth, cytoplasmic (modular protein)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0656"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88727"
FT                   /db_xref="GOA:D3VJH1"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJH1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88727.1"
FT                   /translation="MTGVSERSQQRGSLKDEVYNIIHRHRLFEPTEIVMSDIFSHPDKM
FT                   LDTSGLRCPEPVMMVRKTIRHMAVGQTLLIIADDPATTRDIPGFCRFMEHVLIAQETAQ
FT                   TPYRYLLRKNENMG"
FT   regulatory      complement(569921..569956)
FT                   /regulatory_class="terminator"
FT   regulatory      570125..570163
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(570191..572536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zntA"
FT                   /locus_tag="XNC1_0657"
FT                   /product="Pb/Cd/Zn/Hg transporting ATPase (P-type ATPase
FT                   family)"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0657"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88728"
FT                   /db_xref="GOA:D3VJH2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJH2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88728.1"
FT                   /translation="MFSTTKKHKQSEHHPLSSQKKAHRHTHNTAENISEHSHAPHNTNH
FT                   DHSHKKAHTHEHSHDHNHDGAHCSHDHAHAIQDTTPLELSANQRFNWIIHGMDCPSCAG
FT                   KIENAVKKLPEVKQVKVLFTTEKLVVDSDVDIRAAVEQAVKQAGFEIKATDAVSKLPPA
FT                   TSHWKTFSPILILTALMLISSGISQVNAPAGQIAFIITTLIGLYPVATKAIKLIRSGTP
FT                   FAIETLMSVAAIGALFIDATAEAVMVILLFKLGEILESYAAGRARRGVSALMALVPNQA
FT                   WLVKDGKKKTIPAADLRPGDIIEIAPGARLPTDAELLSPFASFDESALTGESIPVERQR
FT                   GEKVAAGCLSVDSAVQMKVISEPGHNAIDRILQLIEEAEERRAPIERFIDRFSRIYTPL
FT                   IILFSALVVFIPPLFFAGSWEVWIYRGLTLLLIGCPCALVISTPAAITSALAAATRRGS
FT                   LIKGGAALEQLGAVTTIALDKTGTLTEGKPQVTEIEPISSINAETLLALASAVESGSHH
FT                   PLAKAILNVTEYKGVTIIEAEHRKALAGIGVEGQLSGKKVLVAAPGRLPENTLSDEWKQ
FT                   RVIELENGGKTAVAVMQDEQFMGLIAMQDTLRQDAIDAIQILKKQGVDAVMLTGDNPRA
FT                   AAAIAGKLGIDYRAGLLPEDKVKAVTELNKKHKTMMVGDGINDAPAMKAASIGVAMGSG
FT                   TDVALETADAALTHNRLTGLPELIALSRTTHYNIRQNITIALGLKAIFLVTSLLGITGL
FT                   WMAVLADSGATALVTANAVRLLRAKSQK"
FT   CDS_pept        572329..572529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0658"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0658"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88729"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJH3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88729.1"
FT                   /translation="MNNVPHHGYGHGNVHEYELSCGNDRGLCYEGHVNAHLYSQQYCEY
FT                   GDALFSEKIKGGALIAYVFWL"
FT   regulatory      complement(572574..572633)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(572732..573358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0659"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0659"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88730"
FT                   /db_xref="GOA:D3VJH4"
FT                   /db_xref="InterPro:IPR012506"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJH4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88730.1"
FT                   /translation="MSWPFLAVFFSGWLYIDAAYRGTNWQQWVFRPVTMLLLLFWACQA
FT                   PNLETSGYLIITGLLTALLSDALRMLPSKYLLFSFITLFLSYLLYAISFALPMSFSFFF
FT                   PLPLILLAIGIVVILIVWTRLDNMRWRVIDSSMMALLMVWVAGEQYFSLSNESRFSVIA
FT                   GASLLLVAHCINIIDRYRFSFKLSKALVAASSFIGHFLIIRSLFL"
FT   regulatory      complement(573472..573531)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(573489..573535)
FT                   /regulatory_class="terminator"
FT   operon          complement(573585..574474)
FT                   /operon="XNC1_operon0122"
FT   CDS_pept        complement(573585..573854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0122"
FT                   /locus_tag="XNC1_0660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0660"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88731"
FT                   /db_xref="GOA:D3VJH5"
FT                   /db_xref="InterPro:IPR009525"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJH5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88731.1"
FT                   /translation="MFIQLGRVIMVFVWGIMIFNLFHPFPKPLKYFMDIAMVFTVIMHA
FT                   FQLLLLKHSQPKDQKLSAILQTKIFFFGVFELLEWQKKQRREKK"
FT   CDS_pept        complement(573884..574474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0122"
FT                   /gene="yhhF"
FT                   /locus_tag="XNC1_0661"
FT                   /product="putative methyltransferase with SAM-dependent
FT                   methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0661"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88732"
FT                   /db_xref="GOA:D3VJH6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJH6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88732.1"
FT                   /translation="MTKKPQRASLGQIRIIGGKWRGRKLPVPDSDGLRPTTDRVRETLF
FT                   NWLMPIIQEARCLDCFSGSGALGFEALSRYASHATLIEYDRNVAKQLSANLALLNAENA
FT                   DVVQENALQYLNNPGTPFDVVFLDPPFRKGMLTETIHLLENNGWLAEESWIYVEAESES
FT                   AATQVPAHWQLHREKIAGQVAYRLYIRHQESAV"
FT   regulatory      574558..574617
FT                   /regulatory_class="promoter"
FT   regulatory      complement(574687..574746)
FT                   /regulatory_class="promoter"
FT   operon          574707..577743
FT                   /operon="XNC1_operon0123"
FT   CDS_pept        574707..576104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0123"
FT                   /gene="ftsY"
FT                   /locus_tag="XNC1_0662"
FT                   /product="cell division protein: membrane binding
FT                   (N-terminal); GTPase domain (C-terminal)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0662"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88733"
FT                   /db_xref="GOA:D3VJH7"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJH7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88733.1"
FT                   /translation="MAKEKKKGFFSWFGLGRQDKKQQEEQTEQERLAAEEAARRAAAEA
FT                   EQQRLAEETARRAAAEAEQQRLAEEAARRAAAEAEQQRLVEEAARRAAAAEAEQQRLAE
FT                   EAARRAAAAEAEQQRLAEEAARRAAAEAEQQRLAEEAARQAEEQVALSKEQERPSKEGF
FT                   FTRLKRSLVKTRQNLGSGFLSLFRGKKIDDELFEELEEQLLIADVGVETTSKIITSLTA
FT                   HASRKELKDAEALYSKLKEEMSDILVKVDKPLEIEGKSPYVILMVGVNGVGKTTTIGKL
FT                   ARQYQSQGKSVMLAAGDTFRAAAVEQLQVWGDRNKIPVVAQHTGADPASVIFDAIQSAK
FT                   AKGVDILIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEIMLTLDASTGQNAVSQA
FT                   KLFHEAVGLTGISLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIEDLRPFKADDFIE
FT                   ALFARED"
FT   CDS_pept        576111..576776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0123"
FT                   /gene="ftsE"
FT                   /locus_tag="XNC1_0663"
FT                   /product="putative transport protein (ABC superfamily,
FT                   atp_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0663"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88734"
FT                   /db_xref="GOA:D3VJH8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJH8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88734.1"
FT                   /translation="MIRFEQVSKAYLGGRQALQGVDFHLLPGEMAFLTGHSGAGKSTLL
FT                   KLICGIERPSAGNIWFAGHDVSRLTSREIPFLRRQIGMIFQDHHLLLDRTVYENIAMPL
FT                   IISGASAEDIRRRVSAALDKVGLLDKAKNFPIQLSGGEQQRVGIARAVVNKPTVLLADE
FT                   PTGNLDGELSEGIMRLFEAFNRVGVTVLMATHDIALIERRNNRILTLNQGRMQGGQHG"
FT   CDS_pept        576769..577743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0123"
FT                   /gene="ftsX"
FT                   /locus_tag="XNC1_0664"
FT                   /product="integral membrane cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0664"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88735"
FT                   /db_xref="GOA:D3VJH9"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJH9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88735.1"
FT                   /translation="MVKPVRHSAKKTLPPKSKSLKGGWRVQRRYAWKSTLSDMLRQPLA
FT                   TLLTIMVIAISLTLPSVFYIVWKNVNQAVVQWYPIPQLTVYLDKSLNDNSAKGVIDQLK
FT                   SMEGVQSVNYLSREEAVNEFRAWSGFASALNLLEENPLPAVAIVSPKLNFQDSQAITAL
FT                   RDQVAQIKGIEEVRMDDSWFARLTALTSLIGRIAAVIGILMVVALLLVIGNSVRLSIFS
FT                   RRETINVMKLIGATDGFILRPFLNGGALLGILGAVFSLILSSLLVWKLSNVVMEVAGVF
FT                   GTSFKLHGLGWDESLLLVLIAGMIGWIAAWFATIQHLRRFRPE"
FT   regulatory      577802..577861
FT                   /regulatory_class="promoter"
FT   CDS_pept        577944..578801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="XNC1_0665"
FT                   /product="sigma H (sigma 32) factor of RNA polymerase;
FT                   transcription of heat shock and stress proteins"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0665"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88736"
FT                   /db_xref="GOA:D3VJI0"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJI0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88736.1"
FT                   /translation="MTKEMQTLALVPQGSLEGYIRASNTYPMLSAEEERELAERLHYQG
FT                   DLDAAKKLILSHLRFVVHVARSYAGYGLPQADLIQEGNIGLMKAVRRFNPEVGVRLVSF
FT                   AVHWIKAEIHEYVLRNWRIVKVATTKAQRKLFFNLRKAKQRLGWFNQDEIELVAKELGV
FT                   TSKDVREMESRMSAQDMAFDMSADDDNHDSQPVAPVLYLQDKASDFADGIEEDNWENHA
FT                   ADKLSVAMEGLDERSQDIIRARWLDDENKTTLQELADKYGVSAERVRQLEKNAMKKLRL
FT                   AIEA"
FT   regulatory      578814..578873
FT                   /regulatory_class="promoter"
FT   regulatory      578826..578866
FT                   /regulatory_class="terminator"
FT   CDS_pept        578940..579737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0666"
FT                   /product="conserved hypothetical protein; Putative
FT                   permease"
FT                   /note="Evidence 6 : Doubtful CDS; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0666"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88737"
FT                   /db_xref="GOA:D3VJI1"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJI1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88737.1"
FT                   /translation="MTTVSALGAIIALVVAIVLILRKVPPVYGMMIGALLGGLIGGADV
FT                   AQTVSLMITGAQGMTNAVLRILAAGVLAGVLIESGAANTIAETIVRKAGEKRALLALAI
FT                   ATMLLTAVGVFIDVAVITVAPIALAIAHRADLSKMAILLAMIGGGKAGNVMSPNPNTIA
FT                   ASEGFHVPLTSLMAAGIVPGLFGLVTAYYLSRRLITKGYKVRNEELTLTEQETLPSFMA
FT                   AISAPVIAILLLALRPIANISCRAGGATIETLKADVQSQSTPE"
FT   regulatory      579760..579817
FT                   /regulatory_class="terminator"
FT   CDS_pept        579888..581021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="garK"
FT                   /locus_tag="XNC1_0667"
FT                   /product="glycerate kinase I"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0667"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88738"
FT                   /db_xref="GOA:D3VJI2"
FT                   /db_xref="InterPro:IPR004381"
FT