(data stored in ACNUC7421 zone)

EMBL: FN667743

ID   FN667743; SV 1; circular; genomic DNA; STD; PRO; 155327 BP.
XX
AC   FN667743;
XX
PR   Project:PRJNA13400;
XX
DT   19-FEB-2010 (Rel. 103, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   Xenorhabdus nematophila ATCC 19061 plasmid XNC1_p, complete genome
XX
KW   complete genome.
XX
OS   Xenorhabdus nematophila ATCC 19061
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Morganellaceae; Xenorhabdus.
OG   Plasmid XNC1_p
XX
RN   [1]
RP   1-155327
RA   Gaudriault S.;
RT   ;
RL   Submitted (05-FEB-2010) to the INSDC.
RL   Gaudriault S., Laboratoire EMIP, UMR 1133, INRA, Universite Montpellier2,
RL   CC 54, Universite Montpellier 2, Place Eugene Bataillon, 34095 Montpellier
RL   CEDEX 05, FRANCE.
XX
RN   [2]
RX   PUBMED; 22125637.
RA   Chaston J.M., Suen G., Tucker S.L., Andersen A.W., Bhasin A., Bode E.,
RA   Bode H.B., Brachmann A.O., Cowles C.E., Cowles K.N., Darby C., de Leon L.,
RA   Drace K., Du Z., Givaudan A., Herbert Tran E.E., Jewell K.A., Knack J.J.,
RA   Krasomil-Osterfeld K.C., Kukor R., Lanois A., Latreille P.,
RA   Leimgruber N.K., Lipke C.M., Liu R., Lu X., Martens E.C., Marri P.R.,
RA   Medigue C., Menard M.L., Miller N.M., Morales-Soto N., Norton S.,
RA   Ogier J.C., Orchard S.S., Park D., Park Y., Qurollo B.A., Sugar D.R.,
RA   Richards G.R., Rouy Z., Slominski B., Slominski K., Snyder H., Tjaden B.C.,
RA   van der Hoeven R., Welch R.D., Wheeler C., Xiang B., Barbazuk B.,
RA   Gaudriault S., Goodner B., Slater S.C., Forst S., Goldman B.S.,
RA   Goodrich-Blair H.;
RT   "The entomopathogenic bacterial endosymbionts xenorhabdus and photorhabdus:
RT   convergent lifestyles from divergent genomes";
RL   PLoS One 6(11):e27909-e27909(2011).
XX
DR   MD5; 4dec2f4a53b31174dc3b62021f134fa4.
DR   BioSample; SAMEA3138407.
DR   EnsemblGenomes-Gn; EBG00001092182.
DR   EnsemblGenomes-Gn; XNC1_p0012.
DR   EnsemblGenomes-Gn; XNC1_p0013.
DR   EnsemblGenomes-Gn; XNC1_p0043.
DR   EnsemblGenomes-Gn; XNC1_p0044.
DR   EnsemblGenomes-Gn; XNC1_p0049.
DR   EnsemblGenomes-Gn; XNC1_p0050.
DR   EnsemblGenomes-Gn; XNC1_p0098.
DR   EnsemblGenomes-Gn; XNC1_p0099.
DR   EnsemblGenomes-Gn; XNC1_p0115.
DR   EnsemblGenomes-Gn; XNC1_p0116.
DR   EnsemblGenomes-Gn; XNC1_p0161.
DR   EnsemblGenomes-Gn; XNC1_p0162.
DR   EnsemblGenomes-Tr; EBT00001546373.
DR   EnsemblGenomes-Tr; XNC1_p0012.
DR   EnsemblGenomes-Tr; XNC1_p0013.
DR   EnsemblGenomes-Tr; XNC1_p0043.
DR   EnsemblGenomes-Tr; XNC1_p0044.
DR   EnsemblGenomes-Tr; XNC1_p0049.
DR   EnsemblGenomes-Tr; XNC1_p0050.
DR   EnsemblGenomes-Tr; XNC1_p0098.
DR   EnsemblGenomes-Tr; XNC1_p0099.
DR   EnsemblGenomes-Tr; XNC1_p0115.
DR   EnsemblGenomes-Tr; XNC1_p0116.
DR   EnsemblGenomes-Tr; XNC1_p0161.
DR   EnsemblGenomes-Tr; XNC1_p0162.
DR   EuropePMC; PMC3091717; 20950463.
DR   EuropePMC; PMC3220699; 22125637.
DR   EuropePMC; PMC3383451; 22754754.
DR   EuropePMC; PMC3535917; 23070174.
DR   EuropePMC; PMC3915882; 24567731.
DR   EuropePMC; PMC4036041; 22446310.
DR   EuropePMC; PMC4079199; 24904010.
DR   EuropePMC; PMC5545573; 28824587.
DR   StrainInfo; 27453; 1.
XX
CC   Annotation results relative to BLAST similarities, COG assignations,
CC   enzymatic function prediction (PRIAM software), TMHMM and SignalP
CC   predictions, and synteny conservation (Syntonizer software)
CC   are available in the MaGe annotation system
CC   http://www.genoscope.cns.fr/agc/mage.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..155327
FT                   /organism="Xenorhabdus nematophila ATCC 19061"
FT                   /plasmid="XNC1_p"
FT                   /strain="ATCC 19061"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:406817"
FT   CDS_pept        145..936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soj"
FT                   /locus_tag="XNC1_p0001"
FT                   /product="chromosome partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0001"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92869"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLR7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92869.1"
FT                   /translation="MGMAKVISFANQKGGVGKSTLCIQQAFYLALQKKKKVLVLDMDGQ
FT                   GNTSSRLAPRRELEDGDYEPILTGTKTAELFAYELDGIDVMHCPCGADLIHTPKNDPDL
FT                   FEMEAVPLDQAMNPARHLAALFENYDYVLIDCPPSLGRKLVAALVMSTHVACPVKLSGF
FT                   AVDGVEGLLNTIIGVREAYNSELNILGIIINDMDGSVNHAKSLHKLEKEIPDFLFKNKI
FT                   MHRPPLDTATTDGIPVWDLRYGHVAAREVEAVLEEILEKVG"
FT   CDS_pept        940..2115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0002"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0002"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92870"
FT                   /db_xref="GOA:D3VLR8"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR013741"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR042075"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLR8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92870.1"
FT                   /translation="MALNNLRGLSDLAKAAKGKKGKEVLTVPVDDVVSKVQVRKRFRNI
FT                   EELAATMLTEGQQSPIIVFPKNEEGKFVIQKGERRWRACKHAGIDTIDLVVNDKVQNNL
FT                   DETAGELIENIQRDDLTPVEIAEALNLFIEDGWKQKDIADRLGKNITFVSTHLSLLKLP
FT                   DCVRELYDNEVCSDTETLNNLRLLFDMNEERCRAVCAVAMSDGITRKQSRELLNDAKRI
FT                   KEEMEKGPLTGSGHNDEPGDGNTDDQTLNSNGNGTEEQLGNAEQNHNQNVLEDGSDRDG
FT                   LNDDDLDPLRDEEDKEPVQQPINSGKNKDDEGGDALPPLPKDKEWKNVRADSLVIAVNV
FT                   NLDGETKRGVIMTDRVALVPSTVWVKTLDSEGKEKHVHVPVSDIELLSVEG"
FT   CDS_pept        2158..2436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0003"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0003"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92871"
FT                   /db_xref="InterPro:IPR017162"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLR9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92871.1"
FT                   /translation="MNMKISQDMKRKFALVNALSKTEKPSLQDLHKATNIPESTIKRQL
FT                   AALRDEFGMNILFVRESTGERGATGYYMLTDWGILDRSSFLNRYGKL"
FT   CDS_pept        complement(2488..3156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0004"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0004"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92872"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLS0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92872.1"
FT                   /translation="MNVSSEQTGALMSPETQQLTSKALSLIEQSRYRMGTSQFVEAFID
FT                   QWAYLQTGLYPAKEEIPEELQPVAFELSHVLSAAMKRDPTSDVLGYVLSMSSFHKKGTN
FT                   YFPTPPEIGRLLSLIVGSQSSTDFYEPCCGSGINAIHWMENLIENKGPEALAEASIYLE
FT                   DIDPLMVKCCMLQLFHYFDSRDTTPKTLSIVGIDPLSRRTKNISYYAEKPPAPAATVAA
FT                   "
FT   CDS_pept        3214..3369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0005"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0005"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92873"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLS1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92873.1"
FT                   /translation="MPKQRRLDKVGTTGHFPVDEVLTFRQRPFHERRERDALIRVSIAL
FT                   QHNKAP"
FT   CDS_pept        3659..4051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0006"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0006"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92874"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLS2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92874.1"
FT                   /translation="MKVSDMPKTANHLRLKKPCANCPFRKEGAIELAPGRLEGIINDIV
FT                   ENDMTTFHCHKTVHSKYGGEWDEEGNYAPSGQESMCAGAAAYLMKMGRPTVAMRIAFAF
FT                   GDVKVPDWDEAQSLVIEPLVLGSGNE"
FT   CDS_pept        4017..4238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0007"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0007"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92875"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLS3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92875.1"
FT                   /translation="MNRWCLGAEMSKQYAVVPHPKLKREYKGRLVRTTRELKNGWGMIP
FT                   LGAVATVSHQSQKGSELTFEPCDCVSHV"
FT   CDS_pept        4207..4488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0008"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0008"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92876"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLS4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92876.1"
FT                   /translation="MNHATASPMSRVPIFVRAMQRGALSVYTKDKNNAYSLSAAGKAFV
FT                   SQLHKKTFDPDLPFRINDWLNRGDYDAMSRYIRTVFGRQIRFQRNLGN"
FT   CDS_pept        complement(4516..4920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0009"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0009"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92877"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLS5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92877.1"
FT                   /translation="MFGSIILATILTTSSAITEDTGEGISSGIMAASASYLAQNIMPLT
FT                   SGLKSNHSYRTTEAVDMAKALGGLKDLPEFIYVITDVNAHMADMCNRIWEPQSLALTPF
FT                   IVEMVELRKANENSAYENVLSELNCSHLED"
FT   CDS_pept        complement(4931..7120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0010"
FT                   /product="putative DNA topoisomerase III, type 1"
FT                   /EC_number="5.99.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0010"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92878"
FT                   /db_xref="GOA:D3VLS6"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLS6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92878.1"
FT                   /translation="MDLYICEKPSQAKDLAGVMKASQRGDGFIHDGGNRVITWAFGHLL
FT                   ELYMPDDYDERYKSWSLETLPIAPDAWRYNVRKSALKQYKIVEGLVKKASTIYISTDFD
FT                   REGEAIARSLLDQFRYSGPIRRVCLTALDESSIKKALNNVKDGKETVSLYYAALARQRA
FT                   DWLVGMNVSRLYTVLARDVGFNHTLHVGRVITPTVALVCQRDREIAGFTPSPYWTLGVN
FT                   VSVQNGQFAAQWIPPEECSDEQGRCINKAYAEQVSSQVNGANAVISKAETKPGKESAPL
FT                   PFDLTSLQQYASKRWGYTAQQVLDAAQALYETHKATTYPRTDSRYLPESQKEDIPDILQ
FT                   ALILSDQNVSGLVAGADPHRKARVFNDSKVTAHHAIIPTPARTDISAMSEIELNLYDAI
FT                   RRFYIAQFYSEFEFTKTSIEVQCGRHLFAASGKTPTKQGWKVLFASDSESSPKDEGEDT
FT                   DAPVEQEKLPRVSQGEPALLNGTELMNKMTRPAPHFTEATLLAAMENIARFVTEEKFKQ
FT                   ILKDTAGLGTPATRASIIQGTVDKGYFKRQKKVLLATDKAHALIAVLPPAIKSPGMTAA
FT                   WEQELEKVATGSGNMSVFMKQISTWICQMVDQLKVAAPVLTKEGSAMAKAFEGAKPPSH
FT                   ECFNCGGEMHRIKGKNGFFWGCQNEACKKTFPDNRGKPEKRIAAEDCPDCPDCGSPMRL
FT                   RKGKAPGKKRASKFWGCTAYPDCKGTMPFKKSDLE"
FT   CDS_pept        complement(7335..7970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0011"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0011"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92879"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLS7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92879.1"
FT                   /translation="MMRNDTMRQLIAILGVAILAGCASNAPEQKPQSQISPAENDKPAR
FT                   VNRELSIAWDNMGRGGAALRQPGYIHVLGDGNVSATINKAKDNSTDAVKTPVGIKQQGD
FT                   VGEAINTFKSMNKGKGYSLYELSRWERYCDSGKGMDEHDWRFIEGEGATNIPQDVVTGC
FT                   IPPTHNYQDYLNAWTHFCTSQAVTDADRRIVRESVRPYSVVNPCKALK"
FT   CDS_pept        8119..8886
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0012"
FT                   /product="Conjugative relaxase (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ92880.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        8732..9982
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0013"
FT                   /product="Conjugative relaxase (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ92881.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        9979..10509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0014"
FT                   /product="TraD (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0014"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92882"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGK5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92882.1"
FT                   /translation="MTMSYDPLAYEMPWRPNYEKNAVAGWLAASGAALAVEQVSTMPPE
FT                   PFYWMTGICGVMAMARLPKAIKLHLLQKHLRGRDLEFISITELQKYIKDTPEDMWLGSG
FT                   FLWENRHAQRVFEILKRDWTSIVGKESTVKKVVRKIQGKRKELPIGQPWIHGVEPKEEK
FT                   LMQPLKCTSRDLI"
FT   CDS_pept        complement(10543..11583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0015"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0015"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92883"
FT                   /db_xref="GOA:D3VA56"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:D3VA56"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92883.1"
FT                   /translation="MLYTSNPIIKHKAGLLNLAEELSNVSRACKVMGVSRDTFYRYQEL
FT                   VETGGIDALINQSRKTPNLKNRVDAETEHAVINSAIEFPAYGQARTSNELRKAGIFVSA
FT                   SGVRSIWLRHHLENFKKRLAALEKKVADEGIILTDEQVAALERKQHDDEACGEIETAHP
FT                   GYLGSQDTFYVGNLKGVGRLYQQTFVDTYSKVAFAKLYTSKTPITAADLLNDRVLPFFS
FT                   AHRLPMLRILTDRGTEYCGRVEHHDYQLYLAVNDIDHTRTKAMSPQTNGICERFHKTIL
FT                   NEFYQVTFRKKLYGSLDELQKDLDKWMDNYNNHRTHQGKMCCGRTPIETLQDGKSIWAE
FT                   KNLTQI"
FT   CDS_pept        11603..12382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0016"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0016"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92884"
FT                   /db_xref="GOA:D3VLT2"
FT                   /db_xref="InterPro:IPR019476"
FT                   /db_xref="InterPro:IPR022266"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLT2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92884.1"
FT                   /translation="MIMDSSPLIKVGNSLLFKLKCQIWSELIHLKHTEGHTLIVGTTGS
FT                   GKTRMFDILISQAILRGEAVIIIDPKGDKEMRDNARRACEAMGQPERFVSFHPAFPEES
FT                   VRIDPLRNFTRVTEIASRLAALIPSEEERQKSKGMQDMGKGWFAWVKGRMEAFVNVIYQ
FT                   FYTRLALLAAWAPYMLILFVPAVYDGMMTWRIKRTNFDYASPVLHRYSVRGTMYLMAGL
FT                   FIAFFIPIALDPVVIPLTMMTCCVLVGLTFGNLQKRV"
FT   CDS_pept        12847..13224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0017"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0017"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92885"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGK1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92885.1"
FT                   /translation="MNVTKKIHLLALGLFMTGTAIAAPDVLNDDAKLKNLEKVCPDCEM
FT                   VAKDVLNLRVQNCQLKDTSSAMMIGTMQNDPMFSFMLAVHTAAGSEAYKTVVGAAGNHV
FT                   DCENPLNWIKLTQQAIKGGKV"
FT   CDS_pept        13224..13886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0018"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0018"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92886"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGK0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92886.1"
FT                   /translation="MRKRDFFFGEVYEGSGVATLRLSDMESLARKVSAEFFTAQLNRML
FT                   KEHDGQLTLSDGTSYPSFWSFIDKVDTKQVGYVEIYARQDVNDNVEATLACDIVLVNGV
FT                   ITVKPHWCAYKDIRADEVISTLLVPLHLKALQDKAYIRWDDGETEPLLQNDYYQAELEN
FT                   VFSVSKYPSAMSWGDTADQKVKQYKMDLECATDVGRRGVSSEQAWDAYRELRHNRTM"
FT   CDS_pept        14222..14569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0019"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92887"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLT5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92887.1"
FT                   /translation="MNVNKQFFWFLMNVVLMCIQAQQIKNDRVTMRFEPRFVEYEPKSD
FT                   KVFVYGYSYVKGASSNEERSERSYEFAIKISNYAPVLDYIDTYVGKPRTKAVLEQLQRK
FT                   EENRRKNEEQR"
FT   CDS_pept        14553..15470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0020"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0020"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92888"
FT                   /db_xref="InterPro:IPR010563"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGJ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92888.1"
FT                   /translation="MKNNAKISLLALSLALGTSMAYASDDIPVVPASVMKKDVPAPVTS
FT                   GQNASEVVGHVNENPMLTMKPGVNQIIPIAIGHPNRVVTPFSNPEIVSTSLTGANENGQ
FT                   CGEVCIKENVVYVATDKQYPVTMFITEKGSEAQALSLTMVPRRIPPREVFLKLDGGVGI
FT                   SGAFANSKAEAWEQSQPYVETIRSVFRKIAIGEVPQGYTLNRIPAGAAVPSCSHPGIKV
FT                   DFGKGQYMMGHHLNVFIGVAQNVSEQPIEFKEALCGSWDVAAVTTWPLNVLESGQKTEL
FT                   YVAKKQKRGIAPTSKRPSLLGGGQ"
FT   CDS_pept        15467..16783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0021"
FT                   /product="Sex pilus assembly protein (Fragment) (modular
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0021"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92889"
FT                   /db_xref="GOA:D3VGJ7"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGJ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92889.1"
FT                   /translation="MIKRFWTELDPQKKRWVAIAGGLFVLFAVVTMFSGEPKKEEKRGR
FT                   QETIKHVLTDKNTREIGIDSLSADVKMVSRENSDLKKELEKVKRELEQTKDTAGKSSDV
FT                   GREISRLRQDLDRLTQKNMELSKKVETGEAGGKTASSTGDARADVNGTSDGEGQFMEKK
FT                   LDYKDPASFFRDAPLPDSKGGAPATGKGDGRDATKSGIQIVSYSQKAPEVEAKDDKDDE
FT                   SLYLPSGSILTGVLINGMDAPTSQGARRDPFPSTLRIQKEAILPNRFRADVRECFLIVS
FT                   GYGDLSSERAYLRGETFSCVREDGGIIEARLDSYAVGEDGKAGVRGRVVSKQGQIIAKS
FT                   LMAGFLGGVSEAFDVNPVPVVNTNPGSNTQYQSIFSGQMLQGAAVKGASNALNRIAQFY
FT                   IDMAEGIFPVIEVDAGRQVDIIVTKGTKLQIRSTGGNKK"
FT   CDS_pept        16780..17358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0022"
FT                   /product="Sex pilus assembly"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0022"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92890"
FT                   /db_xref="InterPro:IPR014118"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLT8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92890.1"
FT                   /translation="MKNLNILTRKGSSRGKAQKEQAVRSAKMLGVGAVLLVLSGCSSLN
FT                   IGSDEYSCPGMPSGVQCMSARDVYVATNDGNVPRPMKPEEVEAKAEADGGGSSDVSVNS
FT                   SNSGDSVIDNYVAPRLPDRPIPIRTPAQVMRIWVALWEDTNGDLIVTGYVYTEIEPRRW
FT                   VIGDGTPQSEPVLRPLQTVTHEPKSETTK"
FT   CDS_pept        17362..17754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0023"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0023"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92891"
FT                   /db_xref="GOA:D3VLT9"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLT9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92891.1"
FT                   /translation="MFLMNVNQLANASSKNNTLFLFLGLMVVAFLLVPDQAHAGTGGTA
FT                   FDDVWVTLKDWTQGTLGRIVAGAMILVGVVGGIARQSLMAFAMGIGGGMGLYNSPTVVE
FT                   SIMSATLEHAEKVVPAVVQLSNGLGL"
FT   CDS_pept        17874..18263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0024"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0024"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92892"
FT                   /db_xref="GOA:D3VLU0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLU0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92892.1"
FT                   /translation="MKSENKRTQRDYSLAFKLAVVDQVEKGEMTYKQAQNRYGIQGRST
FT                   VLVWLRKHGQLDWSLGCTPLHPQGVAVTSSSSLTPEQRIKELEQQLVEMEKKAEFFEAV
FT                   VDVLKRDYGVTVVKKPRGKSSKRKK"
FT   CDS_pept        18275..19045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0025"
FT                   /product="Integrase, catalytic domain (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0025"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92893"
FT                   /db_xref="GOA:D3VLU1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLU1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92893.1"
FT                   /translation="MAQCCRYLSITRQAYYQQCQRAAIKEKQEQEVLRRVQSIRLQQPR
FT                   IGTRKLQYLLNQSSPLKIGRDSLFDLLRTHRLLVKPRRAYHKTTQSHHRFHCHPNLLKA
FT                   GPNKITPTGPEQVWVADITYLPVKAGEAYLSLITDAWSRKIVGYHVHDNLSTGSVIQAY
FT                   KHALKSRKLIEQSLIHHSDRGLQYCSKHYQALHQHHEIICSMTDGYDCYQHALAERVNG
FT                   ILKTEFLLCKPADLKEAAKMVSESIDIYNRYRPH"
FT   CDS_pept        19229..24751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0026"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0026"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92894"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="InterPro:IPR025429"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLU2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92894.1"
FT                   /translation="MGSCNSKRMENAMINFKPKLPALLGALAVLTAGAAHAELLEYTFK
FT                   APDGTQRSLPPNTNYANPTGNVSFALSAGIDRKVKISVLRSDGTVVSTATSHLLGATDR
FT                   ITVGGKSYYGAELQLPAPVAGAYLVRAEILASDGSTVQTDEYPLTVDVTPPTYTSIAPV
FT                   YSNYGQVTSGDIWKLGLGGSEDNAFLLSGISDESPIKGVQAKLYRQDGSLYKDVSVNYD
FT                   DANGQARQSFQSGFFPGSDLDEVFTLQFEISDSAGNIYPSPRQKVMFDSITNAPSSPFG
FT                   VYDPSSTNNLGPGLSGFVAYTAGMAVKTNPIRLAWRVPRDNWHEYREGGIKMVNALGEM
FT                   TKVGEDGNYVYLVTTSPYGNTDGNYWRWVNFGQWGGGGIGYNLTLAPSAPQSPKLLGVD
FT                   YNYSDIGWSTMHRYWVNSSVLPVTVSSIRVKVEPRPYIQTAVHRGSCEIPVGQDNCVIE
FT                   NSFTMTKGTTGYIHDNATVYNSDRSLSSNPMWAEVNWNDQHYPQLSQQYDQSSKVFTLF
FT                   VNQPGRGAYFDRLRLRSAWIEDSKGNKLSPTGGLIANNWENYTYQWDLKTLPEGQYSLV
FT                   AAAEEMHGPLTRQPMFQITSDRTAPTLTISVADGAAIQTLDDVVITLADAVDPSPKLTS
FT                   IALVGGPADDKVQLSWREESKGRFRLEYPVMFPSLKEGESYSLTVAGEDAQGNAVQKAV
FT                   GFEYKPRQVMLADGMDGKVMIPAVTHEFVHADGKRIIETKPLTLSDGAVVTGSYDVFAT
FT                   LRSDAQVPLVVNGVRIEPGQTMGIMSQHDFGASGGRLSIPVKPAVPDEVGSSSLLVMTS
FT                   APNSPILVVDINTWKGAAKLSAESWTIRQVIDPVKIYALPELGVPCRFTTKADVAMAAD
FT                   PIRDPVCLLQWDRTPDEAEQTTQDNNGMKVAGLVGQAVSIGEQPVEYSLYLFSGDGSKV
FT                   KVGSGSQNLTVTTAYDSVGYSPIDDIAQVNRVIEDFDVNFKQSKGPDCSITLSADRAKN
FT                   EAANKGVGSTSRTCLFEWQQIPDGLVQDQLSESPSLSGSLAANGDHPVGWRVSIFTRNG
FT                   TRVTLNDQTFNIEAVDPPAPTVELSSKYNFKDNIYMVPMTGNYLGDAVINSERADLDIA
FT                   ISRNSDVLESETFTPGWGATNKVYRRINTDERALWEETTYKVNAAYNKVPDVKAEVVYR
FT                   AIAAPSDSIRPIVEVQGDTAIDTQALPVRVLIRDQYKPDGDYDANTMGVWKVRLIQQKA
FT                   YNETVALTDYAEASNGEAQFSVDLSGVDTTSVRISAEAVLESPVEGYNRTELSIRPAFL
FT                   TVLRGGAIGAGVDARKLSGEAPFTAVFKLSLDDRQDLRATGQVVWETSKDDGKTWEQFI
FT                   PEDRYKYQLVKTFDKGEYQVRAKVVNVNSGAEKYTEVVSVVAYDKPDIAVVGPTTLFVG
FT                   SEGKYTANLTLNDEPVSGGNAVVEWSTDGGKTYSQTGDSITLSSGEETRYRLWARVRSA
FT                   TAPADDGYAYEIAKTAVDFRAVKAPRPYVTGPRVIETGKKYVFKAETSLPYRGMDVKLN
FT                   GFFTLPNGSIVQGDTAEYEPSDADLNQATVETKYTTWIEGYRDQGAEASHSLRSRVWQY
FT                   VWPSFGMQIRKNADVAPATITASVRPIAFNGKLEEPTYDWELPEGAVIQDKRQDIVRSF
FT                   VINEPGEYNIKVTVRDARGHETVIEQPLKIGQAAPYAIDLQYSGSNKYEREPLDVLLRP
FT                   YISGGHPRDRISTRVYLIDGTPLDGSGYYGRATLGAGEHSIKLKITSEMGHEAEGEVNI
FT                   NVAENKLPACSLSSRETVGSWIVYANCEDTDGRMKSYEWTIAGELQSISSDRVTISKGT
FT                   YEAMPTISLVGVDDSGGKSEAVTMN"
FT   CDS_pept        24900..25607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0027"
FT                   /product="DsbC"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0027"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92895"
FT                   /db_xref="GOA:D3VLU3"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLU3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92895.1"
FT                   /translation="MRTKLLGALMVFGIITGTAHASSKLEITDPRAAKIEDIVKLPIKG
FT                   VRAVQSDGQIMFLSENGRFVISGQIYDLWSKKPLNTMSQMRDVAERIHFKNMGMDVDTL
FT                   NTLSMGHGDKEVVVFVDPRCAVCHKLMDESKSLADEYTFKIVVIPALGAESNRLAKNLY
FT                   CAEDKTHALDALMNNTLGTLSSKENCDPGQYDQTLLTAHFIGIEGVPFVVAPDGRVSKG
FT                   RPKNLKSWLESAE"
FT   CDS_pept        25604..28048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0028"
FT                   /product="Sex pilus assembly"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0028"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92896"
FT                   /db_xref="InterPro:IPR014117"
FT                   /db_xref="InterPro:IPR025955"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLU4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92896.1"
FT                   /translation="MIVTIKKKLQETLIPEHLRAAGIIPVLAYDEDDHVFLMDDHSVGF
FT                   GFMCEPLCGADEKVQERMNGFLNQEFPSKTTLQFVLFRSPDINQEMYRMMGLRDGFRHE
FT                   LLTSVIKERINFLQHHTTDRIFAKTNKGTYDNGLIQDLKLFVTCKVPINNNNPSESELQ
FT                   NLAQLRTKVESSLQTVGLRPRTMTAVNYIRIMSTILNWGPDASWRHDAVDWEMDKPICE
FT                   QIFDYGTDVEVSKNGLRLGDYHAKVMSAKKLPDVFYFGDALTYAGDLSGGNSSIKENYM
FT                   VVTNVFFPEAESTKNTLERKRQFTVNQAYGPMLKFVPVLADKKESFDTLYESMKEGAKP
FT                   VKISYSVVLFAPTKERVEAAAMAARNIWRESRFELMEDKFVALPMFLNCLPFCTDRDAV
FT                   RDLFRYKTMTTEQAAVVLPVFGEWKGTGTYHAALISRNGQLMSLSLHDSNTNKNLVIAA
FT                   ESGSGKSFLTNELIFSYLSEGAQVWVIDAGKSYQKLSEMLNGDFVHFEEGTHVCLNPFE
FT                   LIQNYEDEEDAIVSLVCAMASAKGLLDEWQISALKQVLSRLWDEKGKEMKVDDIAERCL
FT                   EGEDVRLRDIGQQLYAFTSQGSYGKYFSRKNNVSFQNQFTVLELDELQGRKHLRQVVLL
FT                   QLIYQIQQEVFLGERNRKKVVIVDEAWDLLKEGEVSTFMEHAYRKFRKYGGSVVIATQS
FT                   INDLYENAVGRAIAENSASMYLLGQTEETVESVKRSGRLTLSEGGFHTLKTVHTIQGVY
FT                   SEIFIKSKSGMGVGRLIVGDFQKLLYSTDPVDVNAIDQFVKQGMSIPEAIKAVMRNRKQ
FT                   AA"
FT   CDS_pept        28063..28380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0029"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0029"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92897"
FT                   /db_xref="GOA:D3VLU5"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLU5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92897.1"
FT                   /translation="MDIKSIVIAAVLGAAGGFGGSYFVMNEQTASIHERLNQTPPVVVV
FT                   DFAKVASAYPAGASQEELEKLMVNTNNAILKLKDAGYLVLDASTVVGAPNDLYLPEEVL
FT                   K"
FT   CDS_pept        28377..28907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0030"
FT                   /product="Conjugation signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0030"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92898"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLU6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92898.1"
FT                   /translation="MRFHLTKYFVKKESWKRFAVKAGVTLLILWTAGAAFASRYRIGID
FT                   PQQEKCLPGYTFFLIDLKDQSLEKGAVYAFSVKNMEPFYKDGTRMVKILTGMPGDKVEI
FT                   NDKWKITVNGDVVGEGLQLAGKLHLPESHFYGKSTLKDDNYWFMGKSSFSFDSRYWGTV
FT                   KNDQIIGRAYPLF"
FT   CDS_pept        28870..30135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0031"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0031"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92899"
FT                   /db_xref="InterPro:IPR019106"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLU7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92899.1"
FT                   /translation="MIKSLAAHIPCSKTVLTVLMLSVAGGGVAQESPLTEQDRELIEQG
FT                   KQIAERTQKMEMPSLLQNQHMDQAQAEAKTFFKQLQSTNQTLKEMQLKQAEKGIYTDHR
FT                   ILVFASLSLGEQGLDDVLTAVSGQPDAVVVFRGIPEGMNLGQGVKAIQALAAKKDPVPN
FT                   IIINPTLFKTYKITAVPTIVMIEDEPLPGEQPNVVAKVSGLSDPVWLAREVDNGEKGDL
FT                   GVRGPVEKIGEADLIDVAKKRLANIDWEDKKKQAAERFWTKQNFNELPRASKARTREID
FT                   PSVMITSDISTPDGTVFAHAGDVINPLCDPKEVCKPGTRTFTQAVVVFAPLDKKQMELL
FT                   AKKLPEIKREPGVQRITYIATSFDKDKGWDSYKSVTDNFDAPVYLLTPDLITRFELEHT
FT                   PSVITSRGKMFVVRELTEEGDE"
FT   CDS_pept        30132..30803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0032"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0032"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92900"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLU8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92900.1"
FT                   /translation="MIFAPAFQPIKDVGTGLFVAAEVLARWYDEGRVLTPSSLLSQPHW
FT                   GLVDMEVARFIHKNLHQCLDLYPTLFLNVSEHTLRSDVIFKAWTRVIHAIAKNHSGRFV
FT                   IEITEGIQDASLSSRWDALIETGVELALDDYGDKHSSMERLSGYPWRYCKFDARRLRSL
FT                   EDYPAIVHCRRKGIQLIAEQVETFPLGESAKLLGLSWQQGFFHGKPAVMDKHLNNVKAL
FT                   P"
FT   CDS_pept        30800..31807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0033"
FT                   /product="Tra U protein (modular protein)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0033"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92901"
FT                   /db_xref="InterPro:IPR009649"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLU9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92901.1"
FT                   /translation="MIKKILRIMTVSAVFWVNSVSADPGCQNAEVIGGKLITDICWSCI
FT                   FPIKVAGVPISGGGGSFPSEAVSNPLCMCEDNLGVPRPGVTTSMWEPARLVEFQRVPGC
FT                   SSVLNGVRFPFDRTNQGHHGMGDMDGGDGSFMHYHYYAFPLLVMLDLFIKQTCNADGYM
FT                   DFDIMYMSELDPTWNNDEFAFFTNPEAAAVANPIAAAACTADAISSTAGKPLKQLFWCA
FT                   GSWGTLYPFSGNQNGGKGVIRDSSLLSTRVLAALHRRGLAWKTMGSEAMCRGVISPTLP
FT                   KTQYKFTLLHPVPETNSSHVIGESTLTWGLARTIPAIGQDPIYTIWRWNDCCNN"
FT   CDS_pept        31911..34727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0034"
FT                   /product="putative mating pair stabilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0034"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92902"
FT                   /db_xref="InterPro:IPR014121"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLV0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92902.1"
FT                   /translation="MENTMRSHNYFMRAVASLLTVTMSALPIHSYANGSQDQDITAVGK
FT                   EAQAFGQNLSNSFKSSSGTVQDGTISMPTLKDGQFQMNGGSQINVNDLFPGTSGTNNKP
FT                   DSYYFPDANKPDVGGLQGIYESGDDMDSVGNNAKGSLWSDANSANPSISGAAYKVLLDA
FT                   SNRSRPDFSNDPVLNLSKKTYEDMDLIADGFGDCSAETTINQNTINAHIPEYERCQRVV
FT                   DQSADCEVVHDYDASVVKHYDGPYNLKSCGEGCTELWIGRVGDNYWSGNCTIYEEYTRV
FT                   QVSNPDAIVSATLEYAKWDDYMQVWVGKSGQETKVWSGPDGNFPPETAGRCELSTSWER
FT                   NPNVDVTPYFKNVKDGDVVTFKIRVSVSGEGEGFGRIKLRYDPSKAITKDEWAPQSCMD
FT                   SAKGVVDGFAEGEITCIDDPTDATGCTVINGIKVCESQLKPSPLPGIPKLCKKVRVKAD
FT                   YDFYKGQMDCWTDPQGETHCPVNTGGNLNSCQKYEENPQCGFISSKCVDGAKGSSGTCY
FT                   VHEDTYDCGTDVSVPTLEKEIEYQCGGPIRCMGDDCLDLTKTQSTDFARATALLNAAQF
FT                   MTQDMSCTGQDGDDNPTGEENVICSAFAGEAGECKIAVGGVSDCCEKPTNISLADYLNL
FT                   IMAVPKLDGAVMGLTDGNALKGAYQVLREPALQGWTEVTKPFTSYIENVSGAVDSFFQP
FT                   VEQFIDQLIDQLKEQVKEVMMDVMKSAGQDAATEQAAAAASEQAAEAMMETATTWLSTA
FT                   MTIYTVYVVAMVMIQMIYKCEEEEFTMNAKRALKNCSYVGSYCKSKVLGACIEKREAYC
FT                   CFNSPLSRIIQEQVRPQLGQNFGDPKNPQCEGIPLDKIAEIDWSKINLDEWLGILQQNG
FT                   KFPDPNAINLDSLTGAGNDFNVDGTRKNAQERALERLEGIDIDAKRKEATNSIDPQTGA
FT                   PTSGGGGG"
FT   CDS_pept        complement(34765..35628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0035"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0035"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92903"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLV1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92903.1"
FT                   /translation="MNKTLITTVALAVATLSGCASTSSNYEPSAYKANQSRAYNIAEAG
FT                   GLVTGIKDAPVPRDKLERLTDTKTFGAAYVLSGYTSPQLGMTNWQGGLVNFANWAIVPK
FT                   QHGARNSLVAWMPAHEADSPAKAQAKFLSHVKVSIESALTDLGADFTLLYDKDGRLTYQ
FT                   FYKNEWGCPTWVNGQSKAADMCSVKVKLVEPRIGVAPDFVSSVQGAAYAFTSGHETAYN
FT                   FVNVGNGTTSHAPQQAIYAAISKQLPAWTYLYLAPKSVELENGEKVAFPYLLEQGKAEL
FT                   FVYPEA"
FT   CDS_pept        complement(35750..36466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0036"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0036"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92904"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLV2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92904.1"
FT                   /translation="MSGYRLTAFILSSAFICTSNLGVSLMAEAQAAVDTNSDRSNHYSR
FT                   PIFKQALKVNSLQAQRVMERSFERVSNSLFSIDVILRIIGEQDEIDQVETVILEQISKV
FT                   SEDLDKATAQLNKLMEDNGIDMMPGYTNPNEYTIEINSPQVAQFAHLIRKLDKLMGIVD
FT                   TLWLNTVLTSKQRTDATYQWQQRLIKLAGRIIGIEKRARISAHTKGKEGEVAQAAPESE
FT                   TGDKEIADEAEKTKAA"
FT   CDS_pept        36684..37004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0037"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0037"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92905"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLV3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92905.1"
FT                   /translation="MHIITFIVVLLASLGALYVGAKVFAFSFIALAKVFQRIGLFLWNK
FT                   FAVPAMRSVQAVIKERAAKAEQAKVAVEPEVTQVQEAAKQEPDWDYLEIPTYLRKGKDL
FT                   VW"
FT   CDS_pept        complement(36967..37116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0038"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0038"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92906"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLV4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92906.1"
FT                   /translation="MIAISMMLLLSKKGATSPSGYDCPDGFESVEDYSATVITKQDPYP
FT                   YEGK"
FT   CDS_pept        37243..37494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0039"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0039"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92907"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLV5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92907.1"
FT                   /translation="MACPQSLLVSVCFDDKLQGGCRMQQNLHVYDDHAGIIYLADGREV
FT                   KFDPKLYSSAYLAHSEAVKWAKETGVIGQDDDVVMFVH"
FT   CDS_pept        37713..38681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0040"
FT                   /product="putative Aerobic cobaltochelatase cobS subunit
FT                   (Hydrogenobyrinic acid a,c-diamide cobaltochelatase cobS
FT                   subunit)"
FT                   /EC_number="6.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0040"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92908"
FT                   /db_xref="GOA:D3VLV6"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013615"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLV6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92908.1"
FT                   /translation="MSQYTQFLVSKVFGMPSIPEKVTAIGYADGSHPFIPATDTNYVFR
FT                   KEFLREVLAYLKEPGGDALFVTGPTGSGKTSGITEIAGRLNWPVQQITAHGRMELTDLI
FT                   GHHALVAEKPGQPPVMKFMYGPLAVAMREGHLLLINEVDLADPAELAGLNDVLEGRPLV
FT                   TAQNGGEIIKPHPMFRVVVTGNSTGSGDASGLYQGVMMQNLAAMDRYRFTKVGYADEEA
FT                   ELSILGRVTPKLPENVRKGMVRIANQVRKLFLGENGEDGQLSITMSTRTLVRWAKLSLA
FT                   FRGAPNALEYALDQALLIRAAKEEREAILRVAKDVFGDQWR"
FT   CDS_pept        38692..39597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0041"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0041"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92909"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLV7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92909.1"
FT                   /translation="MNKNHCLCRRYTFKDALTLETFEVFIGYKALREPSSSEPGQFTMV
FT                   KLNRTVTDGKAENWSEIKLEGPFEANGPDTIPMSYKDKESQYVSQFLSQGYTFLDEVLI
FT                   NAETQTVLEGGNVSAVQTTRLGSLNWLLSPPSELPPGDINLFKGFVAGIFAKGASLIGF
FT                   EVARNEGSNDLLPCVLMRTSSGYELGVSTGLGENTIHPATLEGAGELRPEHGHKPLLML
FT                   VYLQQRFADDFSNVDKPLVAFCDEQGVTFDYERFDSLNPLIERFGFSYDEVRADAERLG
FT                   LVSELIRLAEIDSEQEDHFF"
FT   CDS_pept        39715..40749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0042"
FT                   /product="Phage recombination protein Bet (modular
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0042"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92910"
FT                   /db_xref="GOA:D3VLV8"
FT                   /db_xref="InterPro:IPR010183"
FT                   /db_xref="InterPro:IPR018330"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLV8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92910.1"
FT                   /translation="MVSSNRSLVNRRNTMSDSKSLVTRIAERFGVDTRKFYDTLKATAF
FT                   KQRDGSAPTDEQMMTLLIVAEQYGLNPFTREIYAFPDKQNGIIPVVGVDGWSRIINDHP
FT                   QYDGVEFVYADKMIRMQGANVECPEWIECVIYRKDRSRPIRIKEFIDEVYREPVQKHGQ
FT                   HGPYVVTGPWQTHTKRQLRHKSLIQCSRVAFGFSGIYDQDEAERIREMEQASAINPAIA
FT                   NLPSPTQVHSQEPLAIEHKELDPILTKLANRAIAEKAWSAAHEYVKGRYEGSELQYATQ
FT                   FLREKELDQMEPPKPDYQETHEQEPIIAGGSANAKPGADEVPPLSDEDMIPVAEEEGAE
FT                   GHYY"
FT   CDS_pept        40773..41060
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0043"
FT                   /product="conserved hypothetical protein (fragment)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CBJ92911.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        41014..41847
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0044"
FT                   /product="conserved hypothetical protein (fragment)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CBJ92912.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        42016..43323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0045"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0045"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92913"
FT                   /db_xref="InterPro:IPR021496"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLW1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92913.1"
FT                   /translation="MVRPQLLECIMTKVNHLQSLCVIHVDFDIWSGQTRLSASDLKLGE
FT                   GGEIPPEKVAQLGSKKICDPAKLKGFHRLKTETRRLLLKFGMPFMNGFAVPVSRTDEIC
FT                   NKLNDINYQFNQLKQDFINGYNKAVDEWCQENPEYERAIRAGVLPKETVEERIGFEYQV
FT                   FMIQPVNEDEANAKRLNRKVERLGDDLVSEVVQEANKFYMERLAGRDQCAVTTRQTLRN
FT                   IRDKVDGLSFLNSAFNPLVKLLDQTLRGYEQHADGRNIVAPFFYQVVAAVLIMSERERI
FT                   EEYANGSITVEGMALNIGGSEAHMGDRSKNEKAGLESDKAGESTLVLKGDNTVQQQVGG
FT                   AGAVQSEQTNNGGDAVDLDEDIDSFFKNFAERGEGESEDDPNAGDAVQDEYVDVEDEPV
FT                   LPEETLVEPEPIQEEPATEPLNQEPPKTDDDGDFFF"
FT   CDS_pept        43409..45205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0046"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0046"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92914"
FT                   /db_xref="GOA:D3VLW2"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR006538"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLW2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92914.1"
FT                   /translation="MSKKRTIYSALPIVAAAYGEKLGVKVAIGNDDAYTDGKTIVVPNI
FT                   PDDYPNMDAVWGYLAHEAAHVRFTDFGVERRRGLHAELSNVLEDCRIERAMMDLFPGTS
FT                   QTLNEVARYMAQAGHYEHVTDKEAPASILTGFCLYWLQTKAVGQSVLQPYLDSATTVFE
FT                   RVFPQGVVVRLNALLRKAVNTKSTAEVVSLADQIIKMIEEEKEKEEQKPKNGQDGNNQQ
FT                   NAGGDQPQNNQGGSGNDQNQGPSAGGSDQQGKNQKQDEAGGKSDPKGQGDQAKSDADGG
FT                   SKAGQSQAGGNSDAAKQDAAKMLQQVLNAGAGDLRGDAHDALKAELNRVAQDKGDNSYM
FT                   TVRSAVDTQNNPAVGKSLVGDVKSTTSKIRTQLYGLVQASQRVAHRNQRSGKRVDARKL
FT                   HRVVTGDTRVFLKPEAKKRPNTAVHILVDMSSSMAYKAANGKERQDIAREASLAISMAL
FT                   EAIPGVNPAVTFFGGNRNQPVFSVVKHGDTVQNRAGRFGFKATGGTPMAEAMWYAAFEL
FT                   TKTREERKMLIVVTDGLPQSAPACRSVIDLCERSDVEVIGIGVETTAVSGLFQKNIVID
FT                   DAAALQRTLFKLMERSLTAFAA"
FT   CDS_pept        45870..46172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0047"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0047"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92915"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLW3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92915.1"
FT                   /translation="MSHLTNLKSVMVSLAAEHKLPEIYKDDITTDVESLERFDGLRLVW
FT                   LLRDCGSVLVPTEVGVNPIYITHWLWSNHGQQVVPFSVDTCTGLIEKIDFEQAAS"
FT   CDS_pept        46497..46997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0048"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0048"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92916"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLW4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92916.1"
FT                   /translation="MKKLSALESVLNHDKPSRRFLDGLNENQMKDLSGEIFAKLYWSKR
FT                   NPQWYEKDTKRLFARLRWIQRIIKKRLKTGKVKPELTEHGSVMERFNFPYGDTLDFFHR
FT                   YLRHPKWEVVYQESGCSAFWKNEATLELCTYCEGDVVMMKAPDKVAFFRDCNRLSWWYA
FT                   ENA"
FT   CDS_pept        47032..47352
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0049"
FT                   /product="putative DNA modification methylase (fragment)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CBJ92917.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        47371..47955
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0050"
FT                   /product="putative DNA modification methylase (fragment)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CBJ92918.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        48056..48244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0051"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0051"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92919"
FT                   /db_xref="GOA:D3VLW7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLW7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92919.1"
FT                   /translation="MEQIENKGLTVETHCRSGFCGMCRVRLLKGQVAYDETPVAFVKEG
FT                   EVLVCCAKAKTDVTLEI"
FT   CDS_pept        48306..48695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0052"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0052"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92920"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLW8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92920.1"
FT                   /translation="MSIKTKVEQIAYGHATAQVLSELGQQENWYKAYKYLSECVERGDE
FT                   PDDLIVWQPFEHWEWKDILEQIESEAESLLSTIKSVFALAHKGIIQSAIDCSLDSDMTQ
FT                   LDLIGMVELGNDIEESESAGGGYAA"
FT   CDS_pept        48628..49140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0053"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0053"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92921"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLW9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92921.1"
FT                   /translation="MEWSNLAMTSKKARVLEVVMQLNRYTARESDKSRILRIIGWCKRN
FT                   HLTLAGLPYDDNLSGSEGISLEIITPPGMSREMLEQAVKEGYSERDVIRHRILECPIRW
FT                   FIEADEKAFDHELFHDYVVAHGYDEPSSEVYELAETWLWQGKDYALIAAEEIVARDLCV
FT                   RDDENEG"
FT   CDS_pept        49097..49369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0054"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0054"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92922"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLX0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92922.1"
FT                   /translation="MLAIFVFVMTKMRAEPMTAVVHIIEADNLVSACGIVFPENNVESL
FT                   AEANAMLSAVLEDARKASNLEDKHDLESLQGWLEENINSQLVGAK"
FT   CDS_pept        49531..49791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0055"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0055"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92923"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLX1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92923.1"
FT                   /translation="MGLLLIKGVFMYYCHAFDVAFEAISQTASGGDVTPSMLRKALQVR
FT                   LDSMSDEEIVEACGVPFDTYEMTLEEKSSWEATRGIFNENQ"
FT   CDS_pept        49893..51620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0056"
FT                   /product="putative DNA (cytosine-5-)-methyltransferase"
FT                   /EC_number="2.1.1.37"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0056"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92924"
FT                   /db_xref="GOA:D3VLX2"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLX2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92924.1"
FT                   /translation="MSRRCCELRTTLNPSGSLLPDWDGSDSSTERRELMATIVNTKLGE
FT                   HRGKKRVWLEGQKLLREGYYPGMKYDLELKDTQVVLRVKEEGKFTVSKRERNGRVSPII
FT                   DLTAQELATVFDGVEMLRVFIRNGAIVISAHHQQERVIERVNRLISKLENGESLSVCSL
FT                   FHGGGVLDKAIHAGFHKAGIASAISVAVEMEGKYLDSSLANNPELWNEDSIVIESPIQA
FT                   VNLSKRPPQVDVLMGGIPCTGASKSGRSKNKLEFAESHEAAGAMFFNFLQFVEALNPAV
FT                   VLIENVPEYQNTASMEVIRSVLSSLGYSLQERILDGNEFGVIERRKRLCVVALSHGIDG
FT                   FELEKVQPVRTKESRIHEILEPVPLDSERWKSFDYLADKELRDKAAGKGFSRQLLTGDD
FT                   EYCGTIGKDYAKCRSTEPFIVHPEQPELSRIFTPIEHCRVKGIPEELIQGLSDTVAHQI
FT                   LGQSVVFPAFEALALALGSSLWSWVGMMPIMVEVVDESQPMIGGEDFHWATALVDAKGA
FT                   LKLSPAAKKQGMPFNIMDGQLAVYSPNGTQKSCGHEPCEYLPVMMSGDAIMVTSSLVH"
FT   CDS_pept        51636..52112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0057"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92925"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLX3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92925.1"
FT                   /translation="MPKGLCSGLSERRVIMKIETVVPLPPEDSGLQHCIARFHNRNMDS
FT                   KRKDKNRFFRREPVMIVNPETKAKVLRYAMGNPGNLSITKLAVALDYDAVDALGVRFKD
FT                   TVNLEVRRARRWEVWQWFWNHPDQSVQLSIKLGVVGAVLGVMGFLTGVAPYLLG"
FT   CDS_pept        52173..52739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0058"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0058"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92926"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLX4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92926.1"
FT                   /translation="MESQMNTLEQLVNQRVLEEGLKKAKPLAAQMGLESVPDEMLEMIC
FT                   PNLNYSGQFTPALYARFQSVKRLLKELSEQTSPKHGHIVKFTNQYGSYDESALLFKEGD
FT                   VRNQNLVACVGGKTLNLGELELRDYGLNMHIGCGGPFEPISEAQIQSLSEFDFYETTYR
FT                   FWGQNPCGNGMLDITVPMKRWFLTV"
FT   CDS_pept        52974..53267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0059"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0059"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92927"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLX5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92927.1"
FT                   /translation="MSNFDQIATVHKLTVVRKVDEHDSEFDVYLCEDQLGNEWALSKEG
FT                   EPEYAEWGVYNYIVRNDVFMITTPVSLPCMTWELVELPKDYKGELQVGMSLN"
FT   CDS_pept        53335..53721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0060"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0060"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92928"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLX6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92928.1"
FT                   /translation="MSKNVNDVFSNRTSLECTVNAALDRRIGLRVGFPHYREGANGVVC
FT                   EIEAEYPLLNTHSSVAWPLIDELNSYTIQKNQSLIDHIDNAVAELLKHKTRLQLDIQKL
FT                   QDGDINLVKQAKQQYDDNQMSSTS"
FT   CDS_pept        53756..56122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0061"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92929"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLX7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92929.1"
FT                   /translation="MGCFPGRDGHPANPGGPMQQALNFDLSEQPLPVLLRGDKWDSVWS
FT                   ELTDNEDLNFVDASRGTSLSSLITSSVEAIHTALIDGWTMMIGYSSGKDSETVLHLFLM
FT                   ALIRAVRSGATISQHHFILHTDTLIESPEVRWLADQKLAELERFIAKENLPLTIVLAKP
FT                   GISQSWTGRILTGRGLPTFSNSTARQCSQDLKITSAKRAKAAYMRELPKEVRQKVCLLL
FT                   GSRDAESTIRAASIAKQRGSSDRVIKTKDGGELYVVKNWLASDVWEFLLSAGMGSTYPL
FT                   PSYLESNVTTAELYKAATGECVWSATEKKASDACGARFGCWACQAVGLDKSMETLLATD
FT                   PERHGYMSGLNRIQRYLAKRRYAWEDRHPVGRTIYEGGYIKIQPDVYSPVFLERLLHVC
FT                   CSMDYMEQKRADELAYKLATGQTEDNDWNRRMAEPQFRIISEEALVHIDFMWAFHHFND
FT                   KPFHALEIYHRVWSMGDLDLLEDEPQCETVPQSPIPKPLWLKVGRWGDGSLSDGLADPL
FT                   AEMAYFDGGDDPLAAKVINTADGKRRVVCFAEDDEVKVDPDSAAFIIWNEYPRLRESVL
FT                   KGHYTPGSAAQFYLRFGAIQLAKGKGALYHRMMQRGQTYHQMGLTGLQTMEGIQQRKDV
FT                   KVLSDAKYKDLVRRKIKGRLATVRWWVNLHLTFKYHLHHRTPTGLFIEKQLNQEAMEEQ
FT                   KRHQARWFNYVTDAMLCYSSAFCMSVMEGREGSGNTNIRRYMIATRRKAYTALCELLNN
FT                   TDAPWVSDVLQGALGQYESIQAALTEGSALTIYTQ"
FT   CDS_pept        56566..56769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0062"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0062"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92930"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLX8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92930.1"
FT                   /translation="MSLKKLSRLVDQQRKTQDEINDEIILAVKEVLATNSVGLARELVG
FT                   GVPQDHPFHPFLLAIAKQLDPR"
FT   CDS_pept        56841..57446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0063"
FT                   /product="YbaA"
FT                   /EC_number="3.1.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0063"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92931"
FT                   /db_xref="GOA:D3VLX9"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLX9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92931.1"
FT                   /translation="MSNSNFGFLALALRQRLIKRWSLMHSVQPESVLEHSAVVTLLSYL
FT                   AGNIAIQQGKSVDLATMLAHASLHDAAEVLCSDVVTPVKKANAVLQREFERLEKAAEEK
FT                   LIQTLPVELQDAVAIAFAPGGYEQSLVKACDTYSAYIKCKLEVAAGNGIEFQDALSKME
FT                   LVVAQVKLDFPEIDALDKWFGNGLGHSVDKLLSGGNDD"
FT   CDS_pept        57439..57705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0064"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0064"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92932"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLY0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92932.1"
FT                   /translation="MTNLQPGDIKIKDFGRDRKFRSVDELQSTLSEQYKGQHVSIVYPG
FT                   KPNGLLRTVFVSVDDAGGVNQSYGDQSPVDFSAIKDDLFGEML"
FT   CDS_pept        57702..57914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0065"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0065"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92933"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLY1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92933.1"
FT                   /translation="MKASLKSLSKEQVNTLACKLGEIQRHLAEDTELLSDLSELGIDLS
FT                   SEIDGYDCVIEALFELQQFANQNLS"
FT   CDS_pept        57954..58541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0066"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0066"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92934"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLY2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92934.1"
FT                   /translation="MVRPNYKECTMSNFEQALERTDGKTLILSNGSKWAGQDPDNIQTL
FT                   LDVLGNNVLDPMFEQYHCYRSYPFEPLIKTGRNDKIFQPWLGAACFFGNFLTVSHVFNI
FT                   ITKDDSVVEALNEAIQKNIATEQYQQYAYERYAGWFYAETSEGFRLVSPSEAADIRAGA
FT                   VSKLRYPRNFEVMKTAVIKGPRFDAELSRKAS"
FT   CDS_pept        58584..59468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0067"
FT                   /product="NgrC"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0067"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92935"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLY3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92935.1"
FT                   /translation="MVSPSETKEIPMIKQHFQNELVKCGYPDDLKIEYSLGYCQGDGVA
FT                   FYGDLSIDDVKALMKRLFSTELGQVDAVSRVKNLMAQKDIENMLFVLREYGSCDLSITR
FT                   NSYGNHYSHWNCMNIDDNVDFTGIFPDDDTMLGTGIEAINQDMIERWQDIWDRFVLELA
FT                   DDVKSISKKLESDGYSLIEASPCEEEVVWERTTENYLVRVTELPERDFDMGHWDDEVRD
FT                   QTICSILEGKERVLGLRVEVLSRENEIVLGEDSLHGLTVASDDKSYAGYRRELLRGAIQ
FT                   QTRDFFSRHLKAA"
FT   CDS_pept        59675..59824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0068"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0068"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92936"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLY4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92936.1"
FT                   /translation="MNSKFQNFKLVYRQGGRRLERVFTDTLYVNVKRVADSFPPTVLWR
FT                   ILPA"
FT   CDS_pept        59931..60317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0069"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0069"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92937"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLY5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92937.1"
FT                   /translation="MNQLAKLDIAQIRQQAINDGLLVDQSSIGKQAGFLTNVAVTPAIV
FT                   DGVFGADGKHSVEDFLLMFLQLCVAQTKVAFTDNKNWGKIRLYYPMPTVEGFFKPTEVV
FT                   IKSDPVTADVTVMMASEEGTHLCL"
FT   CDS_pept        60398..62221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0070"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0070"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92938"
FT                   /db_xref="GOA:D3VLY6"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013237"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLY6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92938.1"
FT                   /translation="MAHPPSVGVSLKPWPRGVKEASMLGFTLRRKPMSYYKADTVREAA
FT                   NGNWLFILAALAPHLEPALRKPGRHVSCPIHGGKDGFRLFKDAHLTGGGVCNTCGANHD
FT                   GFELLMWLNNWDFKQCLSEVGDYLGVEKEQPQYQQSAAPSRAPAQAKAPVQQEPMKVNN
FT                   KVLDSKNRKKSIAGTLIAHGKAPYEHNEDNELSYFAFIRDKSGLERTVWGVDLERAIGE
FT                   SEAKYGDEIIMTNLGREPVTVVVEVKDDQGNVVREQPMQTHRNTWLVERRGATVTQFRA
FT                   RSNGGVEPVSHYVESAPVVNHTVDTPAPQAHAAATQPEAQSSEDKPKVVPMFREQPKPW
FT                   LLELQEEMEKRMERERAYSARLREKIEKVWNECLPFSSHVTEPMRLYFKNRELLFKVDE
FT                   VEKTDCLRFNPAMAYYDEDGNEVGKFPAIVCAIRDVEGNLVTLHRTYLTPNGKKAKVGN
FT                   AKKMMPIPEGLDVNGAAIRLGEPTEGILGVAEGLETALSAYRVTQIPVWSTVNATLMES
FT                   FEVPEGVHTVLIWADKDKSVTGEKSANVLKAKLEKRGIRVYILLPKLPIPPRAKGIDWN
FT                   DVLMSQGSLGFPNARYLRDFIARRRDEYARH"
FT   CDS_pept        62550..62801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0071"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0071"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92939"
FT                   /db_xref="GOA:D3VLY7"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLY7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92939.1"
FT                   /translation="MEVIMKKFLRIKTWFVRLFSPDKKTLGAIGEDLRKVAVTAIGVGI
FT                   VGLAVSGDTITVKEAGLVLFVGVILWIYGIILTKVSNS"
FT   CDS_pept        62811..62927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0072"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0072"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92940"
FT                   /db_xref="GOA:D3VLY8"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLY8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92940.1"
FT                   /translation="MDAFTLGMLGLLLFFTVVTGGSLYLYHEKQKEKKHHNA"
FT   CDS_pept        complement(63057..64457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0073"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0073"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92941"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLY9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92941.1"
FT                   /translation="MQLTIQIATVDKSGHRHTEKLLAIEKQTDSPNDIGLSLSESKQLL
FT                   NTVQQSVIQKQAAEFLDEHRPCPCCQRNRRIKGRQKIQYRTLFGIIPVEGFRVYRCICE
FT                   KNSPQTVNLLNDWCSEYTHPELKYIETKWASLMAYGLTASLLKDILPVGERCNAATIRN
FT                   HLCQTAKRQEAELDGLPDFLSGSPREWAKLPKPGKPMTVGIDGGYVRNRDDKKHHFEII
FT                   AGKSFSADVPAKRFGFVQCLENHPRRKLLAQLSSQGMQANQQITFLSDGADNLRELQFN
FT                   LYPESQHILDWFHITMRLTVLKQYSKGVSKNDPELGTELLDSLTRTKWYIWHGNVIKAL
FT                   EHLDDCAAMCDEDISHYGNNKSLLKHIDEMYTYIENNSMMIPNYGEMYRYGEAISSSFV
FT                   ESTINEVIAKRMVKKQQMQWSQQGAHYLLQTRTAVLNGDLKTQFEHWYPGIKLGDKTDH
FT                   YWTEAVAA"
FT   CDS_pept        complement(64586..65254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0074"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0074"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92942"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLZ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92942.1"
FT                   /translation="MQHIFIGHQFMQIYIVKVALRNVSPMVWRRFRLSGKTSLAAFHYI
FT                   IQIAQGWHDDHLHQFRIYGKDYGISYSGGIAFPDNPYKVTLDDLEFDAGDRFTYEYNFF
FT                   ENWLHDIRIETILDNSNLKSPFCLAGNRMPGATLADETTKTLALLNAIIHADETTTVGE
FT                   IRPLIEALDTVRFNRLKVNRQLSRLNLDSPELEPIVINCAENALADRLRISVNSLRLTR
FT                   "
FT   CDS_pept        complement(65263..65607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0075"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0075"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92943"
FT                   /db_xref="GOA:D3VLZ1"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLZ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92943.1"
FT                   /translation="MSAVWVIINYNPLHLEMLMKITGTVVITIGVILAIFALTMNVSVD
FT                   TAFGRVNNIGLMEDRHMYTIVSLFIVAAGLALLIAGSFMPNPATAKKQAEKTAQEGEHK
FT                   NPWGTLFSWR"
FT   CDS_pept        complement(65586..65789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0076"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0076"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92944"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLZ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92944.1"
FT                   /translation="MLRMPPPQTFPPETLSLDDLVPQNHLVRKVDAALDFEFIRNLVAP
FT                   LYCHNNAINLFENNGVCQRFGL"
FT   CDS_pept        complement(66062..66403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0077"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0077"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92945"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLZ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92945.1"
FT                   /translation="MKIITSMLFMLTMLIPTVTTAAVFNNCSSFLNKTGYVSSVSVGVD
FT                   NKEAPNISFSIMINNIYSGQISVKQTLNDNSGKGMLETLLKAFGSSSELTIERCYDNQV
FT                   AGVTISRKE"
FT   CDS_pept        complement(66596..66952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0078"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0078"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92946"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLZ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92946.1"
FT                   /translation="MKEIEMKFFIVPLVLAAISSSAIADERSLAMICKKPNNIASSQVG
FT                   KVTDINTDNVGNINYKISENDKWYYLKGNTDVITQIQYDFLKLAFITESTMSFCVSNEG
FT                   KTLALELTQNIIKK"
FT   CDS_pept        complement(66965..67303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0079"
FT                   /product="transposase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0079"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92947"
FT                   /db_xref="GOA:D3VLZ5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLZ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92947.1"
FT                   /translation="MMDTSLPAEIVIRVLERLKIERGLPQQIRVDNGPELIPAKLLNYC
FT                   DSNNIELCHIQPGKPQQNGFIECFNGSFRRKFLKTELFESLSQVKEIAWFWQQDYNKNR
FT                   PHVSSYFS"
FT   CDS_pept        complement(67351..69318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0080"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0080"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92948"
FT                   /db_xref="GOA:D3VLZ6"
FT                   /db_xref="InterPro:IPR005638"
FT                   /db_xref="InterPro:IPR005639"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR036716"
FT                   /db_xref="InterPro:IPR038979"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLZ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92948.1"
FT                   /translation="MNDDYAEKNISPISIETPEDLHIAITAITGIAVAITGPFFPLTSA
FT                   IIATSLAIFPVLFKPENKVDVFDTISNSINSLIDQKIDQAIYDNSKQHLIGIANLFEGF
FT                   SKELKEWEENKTIGTETIRREIYYLDNELTSSMPLFQHPKQRGSLLPLFANAAYRHITL
FT                   LYTAITYYDELNFNDNIEPSSRVTKNHFIEKIKKLIKEYSDYSCEVYNKELNKITYNDK
FT                   KTWIDLNEYRNICTSSVHAYIMMLDFFNPEIYPLDRLVDKRGYYRVIQNVVKDTDFDRS
FT                   LSTRQFDKDISNHYAVGKLYSIEFGKIDRLYIDPYTVRGLVYTLSTLKQFNDITISIGN
FT                   KLNNVHNSEKIYFYNKELTGVKGIYPLYKQHNSLITPTVCLQEMTFKDGDLPTTGNEIH
FT                   LLFVRDPKDYKLKFKEFKLGRYLNVSDYLDVKDELEYLKDIPQLLFMKTLTGGDGSIRN
FT                   KYNTINIFGWRFKYFIDFKPSTNAFNLNEMKTQIYYSITSSKYNKDNEIHPLDRDSIIS
FT                   NLGFSQGAVVRIRKDERIIFLLAKSDLEPNRWIFPGDYKIRLWHIKVKNAKVNISISQT
FT                   DGKGNVDCHSINMELNNHDMKDDIEDEYIYSDLCFKQTDNHHDFVIKDNIYQINILIKN
FT                   ISTNKVIIDRIELIPVFTSP"
FT   CDS_pept        complement(69646..70041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0081"
FT                   /product="Insertion element IS1 2/3 protein insB
FT                   (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0081"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92949"
FT                   /db_xref="GOA:D3VLZ7"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLZ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92949.1"
FT                   /translation="MIVCCEMDEQWSYVKSKKQPRWLFYAYDRIRRKVIAHVFGPRTKK
FT                   TLMRLLALLAPFNIIIYMTDGGKSYEKALAGKLHVASKRYTQRIERHNLNLRQHLARLT
FT                   RKTLAFSKSIEMHDRIIGYYLNIHHYQ"
FT   CDS_pept        70700..70930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0082"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0082"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92950"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLZ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92950.1"
FT                   /translation="MDAVVRLDIMEKTGLIVFPSDGGKHFLLNEECKLLTKLTTIKQRQ
FT                   DGRAWNKYQYRHFVPRGLGSNGTVNVVKQSF"
FT   CDS_pept        complement(70958..73936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0083"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0083"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92951"
FT                   /db_xref="GOA:D3VLZ9"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLZ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92951.1"
FT                   /translation="MPVNFLSEEQRTNYGNYSVELTKETLARYFHLDDFDRLNISEKRG
FT                   EHNRLGFAILLCTVRFIGKFPEISKVPDIIIVFLAQQLHTENINNAIDLYNSGKQRRQH
FT                   IDEIISIYGYTEFTDSRVAFSLTRWLYSLCWTGTNRPGVLFERCTGWLLSHKVLLPGYS
FT                   LIERYIARLRSRVENRLWHTLSSCIDETQTRCLLELLSVPPGSRYSLLDQLRTAPTKVN
FT                   SSSLRQAISRLHSIRNLGITLPAITPVSDTRIAALARYAATAKITVLQRLPEKRKLATL
FT                   VAFACCMEATAQDDVLELLEALLRDLFNGAVQADKKNRQRTIKDLDRAAEILAKACKML
FT                   LDDKLSNADVRDSIYNLIPESVLENAVNNITSLIRPVNNVYFNELDTKFRTVRLFLPEF
FT                   LSKIHFEGNASAEALINALYWIENNLKKKKTDNDAPREIINKSWQQHVIRNDGSIDFHA
FT                   YTFCTLKELQITLKKRDIYVSPSWRYADPRTGLIAGNEWEALRPIICRSLGLSLMPAAT
FT                   LTAIEVELITAYRDVLNRLPENPAVRFSDTDELILSPLDAMEETPSLIELRQCVTDMLP
FT                   RVDLSELILEIDALTQFSRAFTHISEQNSRVADLNISICAMLMAEACNTGPEPFIRNDI
FT                   AALKRDRLAWTDSNYIRDETIRDANAILVSAQTDISLSGLWGGGEVASADGMRFVVPVR
FT                   TVHAGPNPKYFGKGRGVTWYNLISDQYSGLNDIVVPGTLRDSLVILAVVLEQQTEQMPF
FT                   QIMTDTGAYSDIIFGLFRLLGYRFCPRLADTGGARFWRIDPKADYGPFNPISSHRLNFE
FT                   KKVVPHWDDILRLIVSLKLGRLNILSIMKTLQIGDRPTSLAQAIAEIGRADKTIHMLTY
FT                   LDDETKRRKTLQQLNRGEGRHAVARNVFHGKRGELRQAYREGQEDQLGSLGLVLNMIVL
FT                   WNTIYMDAAVQQLRREGYPVHDEDVKRLSPLLCGHINMQGRYTFTVPETVSRGELRPFN
FT                   EDI"
FT   CDS_pept        complement(73966..74589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0084"
FT                   /product="Resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0084"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92952"
FT                   /db_xref="GOA:D3VM00"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM00"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92952.1"
FT                   /translation="MKTARIYERVSTSEQDLTRQAGIEKMATDNGFYIAGIYREKASGA
FT                   RADRPELLRMIADLQPGDVVIAEKIDRISRLPIPEAEKLIASIRGKGARLAVPGIVDLS
FT                   ELAAEADDTPRIVLESVQELLLKVALQMAHDDYELRRERQRQGIQLAKASGKYSGRKAD
FT                   FSIHERIVTLRRSGLTIERTAALAGCSISQVKRVWAIYQSKKTG"
FT   CDS_pept        complement(74704..74970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0085"
FT                   /product="putative regulator with homeodomain-like DNA
FT                   binding domain (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0085"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92953"
FT                   /db_xref="GOA:D3VM01"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM01"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92953.1"
FT                   /translation="MLYTSNPIIKHKAGLLNLAEELSNVSRACKVMGVSRDTFYRYQEL
FT                   VETGGIDALINQSRKTPNLKNRVDAETEHAVMGFGEQRNSKHR"
FT   CDS_pept        complement(75119..75832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0086"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0086"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92954"
FT                   /db_xref="GOA:D3VM02"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM02"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92954.1"
FT                   /translation="MSESRVMSLIRKAFKRLHYPVDIIAQCVRGYLAYAVSLRNLEEMM
FT                   AERDIGVDHATIHRWVLRLVPLLGKAFRPRKKPVGSRWRMDETYIKVKGQWKYLYRAVD
FT                   TDGQTIDFLLTARRDATAARRFFRKAICQHGRPAVVTIDKSGANTAALTLLNAEGEPQQ
FT                   GIEIRQNKYLNNRIEQAHHNIKRRIRPMSGFKSFRRAQTILAGIELVSMLRKGQYSQSE
FT                   DKALSPAEMFYRLAA"
FT   CDS_pept        complement(75829..76347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0087"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0087"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92955"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM03"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92955.1"
FT                   /translation="MNSVNMIWCSLMINIYNLRNFYSRSLDLIIKHIGSISKEIILSPS
FT                   INIKIEVGLSLSGVLLVAKHLQERLSFLATPPIIDNVLGTPANTPNTIKEIIRYCEDII
FT                   SSKCVLLEHERITASYIIDNLSNSKTDCVLDTCPVFPPRRDLKLKKSNNRGYWGFCRIK
FT                   RSSGKLPCF"
FT   CDS_pept        complement(76307..77200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0088"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0088"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92956"
FT                   /db_xref="GOA:D3VM04"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM04"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92956.1"
FT                   /translation="MSCLISINKKLMKNGSNIDKVNRILSILLSEDIETFGYKPKCLLI
FT                   SGASGSGKTRLANILKQVSFRVMSTIDSKELSEVGYSGKDPYSIFEKLLYVSGGDCKVA
FT                   TKGIIHLDEFDKLSASFSVEKDVNGIGIQQSLLKPLDGVEIGITNPNPSRINPNPILNL
FT                   NTNNMIFVFTGSFNGKKMSCPKNLIDSGFIPELANRVDFFIHLKEPNENELFKMANDDE
FT                   LYEKAVRFAESKGMNISFDDSFKSLLAREAFKLGGHYRSVSYLFNNIVYDKIVEMIIIG
FT                   NSSHEFSKHDLVFSDD"
FT   CDS_pept        complement(77197..78393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0089"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0089"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92957"
FT                   /db_xref="GOA:D3VM05"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM05"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92957.1"
FT                   /translation="MNILAIIIIGCLTQFSSIGIISTAISKLELIDSMGIYSSSITIAN
FT                   SLGISFTGVLLGWVLSKYQGFRVGFFGPVISSSLIPILIFTNNIYVVLFAIFMLSIIIG
FT                   LDNPNNNSSLNKLIKLDKDKAHNFTKYTTAVQTSLIISPLLSAAIIVSFGHNLSFVFFM
FT                   IFYLVTCVPWILSPELRKMRTNKEVSSTDVWLGYKIISNNAPLKGLTINRILNNLIFTG
FT                   VIVLIPIMVAKSSVSNDQFTVIQNIILSFISAGFVVNGLISNEVLKNNPKIVSMFSKSS
FT                   TIFAIAAIVIASIFKFDKYSLYVMAAILGWGQFYFRIAGMTLGQAITPQEHLGEVILAS
FT                   DTIVRGITAMYSVVLLFLVNKFSSFIPFFLFVSIGSIAPFFLAKSAKIYIDKISKEDK"
FT   CDS_pept        78008..78205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0090"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0090"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92958"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM06"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92958.1"
FT                   /translation="MKLCALSLSNFINLFKDELLFGLSNPIIIESINIANKTTYILFVN
FT                   INIGIKEDEITGPKKPTLKP"
FT   CDS_pept        complement(78408..79619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0091"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0091"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92959"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM07"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92959.1"
FT                   /translation="MEFEMKSLKLVTPHGDFLLNYQSEDLFLKDILMVNGIPFNSVSAY
FT                   KVDYMGNYQVIPCLNKKVAELVDELEGDSLVFRADRNIDYASVINKHIDLYQDPNAEPT
FT                   AEYTFDNHDGENKKHILFSQKECHEFVKIEVDKFKEQFASAYSDEKIIVGISGGGDSNT
FT                   LLTSLIHSGIKKENITPVMIMGIADWDKGINRAYKVCQEVGLQLLVMEKEEVNKIIRGT
FT                   EGGHWAEDFEKFYPDSDLEVIGTLGIRLVLSHVARQNKTNIIVTGLNLEDILAEAIFSM
FT                   IKGENLSSFPIRKIDEIQIWYPLYRCPKRILDGCHPKFSLENYMDRYPSNLYWRALSYY
FT                   LAQSVSMVSSGIEFMLIDGLQKISYRNPIELEYYNELGFSAIPDIPENILSMWSEYINY
FT                   GKNI"
FT   CDS_pept        complement(79685..79864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0092"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0092"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92960"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM08"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92960.1"
FT                   /translation="MFIMQKHKLSTRKSAQSLGSQVNVKEKSNLASLTAIAKAHIGKNG
FT                   EGDICGGSTRVVSG"
FT   CDS_pept        81012..82031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0093"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0093"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92961"
FT                   /db_xref="GOA:D3VM09"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM09"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92961.1"
FT                   /translation="MKFTPVGVDIAKHLMQIHFVDEYTGELIDKQLKRNDFLTFFSNRE
FT                   PCLIGMEACGGAHYWARELRKLGHEVRLLKARFVRAFRMGNKNDVQDARAIWLAVQQPG
FT                   KSVAIKNEEQQAILSLHRMRYQLVKFRTAQINSLHGLLLEFGETVHKGRTLLDKAMPEV
FT                   LERLKEKLAPFLLNLLEKQYHRLNEIDEQIEQVEKQLTTWAKQNADCQRIMKIPGVGVL
FT                   IATAAIATMGDPRAFRSGREFSAYLGLVPKQTGTGGRVKLLGISKRGDTYLRTLFIHGA
FT                   RAATLLTKTPLPWVTELKKRRPVCVVIVGMANKLARTVWALVAHQQEYQKDYVSVRPY"
FT   CDS_pept        complement(82764..83783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0094"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0094"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92962"
FT                   /db_xref="GOA:D3VM09"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM09"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92962.1"
FT                   /translation="MKFTPVGVDIAKHLMQIHFVDEYTGELIDKQLKRNDFLTFFSNRE
FT                   PCLIGMEACGGAHYWARELRKLGHEVRLLKARFVRAFRMGNKNDVQDARAIWLAVQQPG
FT                   KSVAIKNEEQQAILSLHRMRYQLVKFRTAQINSLHGLLLEFGETVHKGRTLLDKAMPEV
FT                   LERLKEKLAPFLLNLLEKQYHRLNEIDEQIEQVEKQLTTWAKQNADCQRIMKIPGVGVL
FT                   IATAAIATMGDPRAFRSGREFSAYLGLVPKQTGTGGRVKLLGISKRGDTYLRTLFIHGA
FT                   RAATLLTKTPLPWVTELKKRRPVCVVIVGMANKLARTVWALVAHQQEYQKDYVSVRPY"
FT   CDS_pept        83904..84449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0095"
FT                   /product="Ycg4D (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0095"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92963"
FT                   /db_xref="GOA:D3VM11"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM11"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92963.1"
FT                   /translation="MGCAHYILRERDQVIELAVTDIWGDVLLNTRLWPTVKISPNAMDV
FT                   HGISEADLTNEPMWPQIAPALAQLLSGRHVVIFNSSFDSRLLRQTAGAFGDYMPWWEEK
FT                   NLLCAMTLASDAFGSTNRHGTISLADATYQAGVVWKGRAHSAATDAIATADLVTEIAKV
FT                   QRNLVVQLQELQSKGNLE"
FT   CDS_pept        84446..84937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0096"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0096"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92964"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM12"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92964.1"
FT                   /translation="MTEQSYGESLKFFSDWQKDPAKRTGINVQHTLTRGDYPTVSIEIA
FT                   PIRASGSSPDWKSKITVQLTRGELTAFCCVLFGLRSKAEGSYHGDSKNKSFAVYNNGKA
FT                   GVAIILSERGNQLQNFINDDDRMELAVFAVRQLSNAWKVTPSDSIALLRQSAWMDRNLS
FT                   "
FT   CDS_pept        85243..86118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0097"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92965"
FT                   /db_xref="GOA:D3VM13"
FT                   /db_xref="InterPro:IPR008865"
FT                   /db_xref="InterPro:IPR036381"
FT                   /db_xref="InterPro:IPR036384"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM13"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92965.1"
FT                   /translation="MAKNFISEQFSAMCRDLTNLSSIIKRLPPRYAKVAAIPPTRKGME
FT                   NERINNIVVTEQIGREALELAAHSYKDLHINPDYSQKSARRTVGVLWFSPSKVGLAAKI
FT                   AATVDRINAAKAGIEEFIISTYPSRQERFEALRVDCPGVMTLHLYRQIRCYSSGDIDSI
FT                   RFTWQRKDSLKKPVKEELLQRIREELERSGADYQLPLEQLIQRIVSTPEPYLRERREVK
FT                   VQPVANVMAAGVLKTVTAPMPLILLQDKDVELKMLRSFDASEQRKTRSDKSASEILGTF
FT                   GGVTIESTPE"
FT   CDS_pept        complement(86185..86874)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0098"
FT                   /product="transposase (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ92966.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        complement(86878..89085)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0099"
FT                   /product="transposase (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ92967.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        89439..89726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0100"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0100"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92968"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM16"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92968.1"
FT                   /translation="MIEEEVSVADINELTVRLDALSNILTIVMSSLSKSDPGLYADIIN
FT                   NIEEFAESMRSSLGEVDEEDISAYAHNVADSMEEFLPLTEDEINGIEFMK"
FT   CDS_pept        complement(89858..90325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0101"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0101"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92969"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM17"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92969.1"
FT                   /translation="MLKKRLTTIVNTSCAGARNNMYKSLEDLMAGIYEMAAPDGAIYNE
FT                   VSKFLAANQVKPEEINSGIWFFLWLKSAPIKAKPIQKKIPGFGVVLNITTHGGMLNEAI
FT                   TSLIEKECRQIQLAEEHESLEDWVESVLTSREDDEENEAAASIVDLLNGVF"
FT   CDS_pept        complement(90762..91790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0102"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0102"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92970"
FT                   /db_xref="GOA:D3VM18"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM18"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92970.1"
FT                   /translation="MTIATMGIDLAKNIFAVHGVDHNGKPLLVKPKVSRTALPELIANL
FT                   PPCLIGMEACSGAHYWARLFRQYGHDVRLMAPKFVSPYRLAGKVGKNDAADALAICEAV
FT                   QRPHMRFVPVKDEEQQSMQCLHRTRQGFIEERTASYNRLRGLLSEFGLVAPQRTEQLRY
FT                   LAAEHREALPYWVRQCVADLLGHIDAIDLKITEYDRILAKIAGQDSRSKNLMKLKGIGP
FT                   TTASALVASIGNAHGFRNGRQLAAWLGLTPSQYSSGGKSCLGKITKAGDSYLRTLLVQG
FT                   ARSVMIGVENKQDPFSRWVSSLINRRGYWCAAVAIAAKNARLCWASLNYGDDFKLYCAS
FT                   DT"
FT   CDS_pept        complement(91881..94466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0103"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0103"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92971"
FT                   /db_xref="GOA:D3VM19"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM19"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92971.1"
FT                   /translation="MEDLAWQTDKGSVLATALVGNLRRKHILLPAPGVIERICAEALTR
FT                   ANRRIYDTLTEPLSDAHNRSLDKLLKRCENSNMTWLAWLRQSPTKPNSRHILEHIERLK
FT                   VWQALKLPPGIELTVHQNRLLKLAREGAQMRPADLAKFEPRRRYATLVALTLEGIATVT
FT                   DEIIDLHDRILGKMFNNARKKHQQQFQASGKAINAKVRLLGQIGQVLLDARQTGSDPFA
FT                   AIETVISWDSFAESVTEAQKLTQPGDFDFLYRMGEGFTLLRRYTPEFLNILKLRAAPAA
FT                   KHVLDAIDVLRNMNRNNARKVPADATIEFIKPRWKKLVVTDTGLDRRYYELCALSELKN
FT                   TLRSGDIWVQGSRQFKDFEDYLVPPDKFARLRQASELPLAVATDCGQYLQDRLTQLEAQ
FT                   LATVNRMAQVNELPDAGITESGLKITPLDTVVPESAQTLIDQTAALLPHVKITELLLEV
FT                   DQWTDFTRHFTHLKSGDLARDKTLLLTTILADAINLGLTKMTECCPGTTYAKLAWLQAW
FT                   HIRDETYSMALAELVNAQLRHPFAEHWGDGTTSSSDGQNFRAGSKAESTGHINPKYGSS
FT                   PGRMFYTHISDQDAPFHTKVINVGLRDSTYVLDGLLYHESDLRIEEHYTDTAGFTDHVF
FT                   ALMHLLGFRFAPRIRDLKDTRLYIPKSDTPYETLKPMIGGTLNIRHVYAHWDEILRLAT
FT                   SIKQGTVTASLMLRKLSSYPRQNGLAVALRELGRIERTLFILDWLQSTELRRRVQAGLK
FT                   KGEARNALARAVFFNRLGEIRDRNFEQQRYRASGLNLVTAAIVLWNTVYLERAVKSLRE
FT                   HGYGIDESLLEYLSPLGWEHINLTGDYVWGSRTRIGNGKFRPLRQLKLA"
FT   CDS_pept        94470..94889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0104"
FT                   /product="Putative integrase protein (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0104"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92972"
FT                   /db_xref="GOA:D3VM20"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM20"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92972.1"
FT                   /translation="MNADITYLPVKAGEAYLSLITDAWSRKIVGYHVHDNLSTGSVIQA
FT                   YKHALKSRKLIEQSLIHHSDRGLQYCSKHYQALHQHHEIICSMTDGYDCYQHALAERVN
FT                   GILKTEFLLCKPADLKEAAKMVSESIDIYNRYRPH"
FT   CDS_pept        complement(94975..95742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0105"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0105"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92973"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM21"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92973.1"
FT                   /translation="MVTDLQLISLEDLAKIDKDSVRRRDLLMIRPEIISIDPTFNARGV
FT                   GMSSDEYWQQEHVKEHVLNLSYAYEAGEWVPPLVVVFDPNTQKAIIRDGHHRFKGLMLA
FT                   KERGAGIEFVYVTEFKGDEVKQNLLMLSSSSSLVLTPVEKAEIYHRFYAWGKNVQEIAD
FT                   MVKKTAAHVYMMLKVHDLPIEKKKLIQQGKLSVNAALADKSKPKKYTPPKKAVNEILDI
FT                   VASADIDGEFVKVQIPTHLYKQLFNPELVNFDN"
FT   CDS_pept        complement(95711..96091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0106"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0106"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92974"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM22"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92974.1"
FT                   /translation="MLGALNYTDNRLFYQIISSSVTRSNVIDFLEQVAQQGEHRLTFVV
FT                   LDNAPIHHGIDEKLKNRWLREHNLLLLYLPAYSPELNLIEIVWREAKYHWRRFITWTQE
FT                   TMEYEINTLLAGYGDRFAINFS"
FT   CDS_pept        complement(96273..96713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0107"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0107"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92975"
FT                   /db_xref="GOA:D3VM23"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM23"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92975.1"
FT                   /translation="MKSNITLSEPERITLQQLALNHIHRDIRTRGTGLLMLARGIKPRQ
FT                   IADEIGCSLRVIYDWVHAWHDSGIAGLLGGHVGGRYPAMTPDMIATAVESARAESLTLA
FT                   RIAQKVEDQHGPLPCTLETLANTLKRQGLTYKRARLSLKKTQ"
FT   CDS_pept        96960..97109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0108"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0108"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92976"
FT                   /db_xref="GOA:D3VM24"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM24"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92976.1"
FT                   /translation="MSDGISKYSPSRVGYARVSSISQNLDSQIDALKTAGCGKIFTDKM
FT                   TVHA"
FT   CDS_pept        97106..97576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0109"
FT                   /product="e14 prophage; inversion of adjacent DNA
FT                   (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0109"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92977"
FT                   /db_xref="GOA:D3VM25"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM25"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92977.1"
FT                   /translation="MNRPGWEQLLAYLRTGDSLVVTELSRMTRSLMDLLQTCQALEARH
FT                   ISLVSLRENIDTTTATGRGFLSMMGVIHQMERELKAERAAAGRAAAKARGKSGGRPRTH
FT                   IEKLENARILYENSDKTAAEVCEQTGVGRRTFFSYLLQCRKEISEQAKEEPY"
FT   CDS_pept        97747..98718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0110"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0110"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92978"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM26"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92978.1"
FT                   /translation="MYGINFILSIILFKWRLIMNIIQKNSSNIIWGDETDSGQLGHFYP
FT                   FLFPFTIGDHTFFYGQNIERSRYGRFIRELHPGGIVSWTTDETDINYGPSLSIRPVLYT
FT                   VGKRVFIRAQMIDHHKLWYIQEVLPGGTFGSIINQGYYNIEYSAQFPYLIDGKTFIFNQ
FT                   TFDEKKGNFYIVQEMMPDGNHGEITDEGTWNSFYPFQFAYTVGKRTFYYGQTRDNNYWF
FT                   IQELLPDGRIGSTTESGNWHSFYEVLFPFIFKGRTFYYGQTRDNNYWFIQELLADGKLA
FT                   SSYQSGYFEHFYEVQFPFTFGEHTYFFRHSNDKRWFIQELLL"
FT   CDS_pept        98995..99306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0111"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0111"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92979"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM27"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92979.1"
FT                   /translation="MSIIFSGHYCMKYRTLLLDALRLHFDEHLSRLDVGRRLGIPKSTL
FT                   CALFVRFKKLGMSWPLPDNMTADKLESQLYPARPHAVRLDIPAPVLGVLCPMHPKVPW"
FT   CDS_pept        complement(99341..99475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0112"
FT                   /product="Resolvease/recombinase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0112"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92980"
FT                   /db_xref="InterPro:IPR038116"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM28"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92980.1"
FT                   /translation="MDKKLHQKIEGLLREKKSYNAIVYLLGCSRHTISKVSKTIKNLE"
FT   CDS_pept        complement(99549..100118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pinE"
FT                   /locus_tag="XNC1_p0113"
FT                   /product="e14 prophage; inversion of adjacent DNA"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0113"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92981"
FT                   /db_xref="GOA:D3VM29"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM29"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92981.1"
FT                   /translation="MILGMTKMALLGYARVSTSQQKLDIQIASLKQAGVREDRIFTDKM
FT                   TGKTDDREGLKKLLARAERDDTIICTKMDRLGRNTADMIKIVDNCYKKGIPLRFLDNHL
FT                   STEGTMGKMVIQILAAVAEAERERILERTNEGRQFAKESGVKFGRKPHKSTAEANKMIA
FT                   QKISMKEVMEKTGISRATYFRLKKMI"
FT   CDS_pept        100229..103207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0114"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0114"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92982"
FT                   /db_xref="GOA:D3VM30"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM30"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92982.1"
FT                   /translation="MTTDCTKKNEKRLHILNPSEVRELYERPVFNQADREEYFSLDPYT
FT                   TNIVAELNKPETRIYFILLIGYFRAKPVIPKFNLNEVAEDAEYIRKTYFPDENPEWMTM
FT                   SKSTRSKLVNKALDILNFQRFTEAHYTVLITRLKDVVTICTEPRYIFDETLAFFGQKRI
FT                   ALPGYTRLQELVTEALIAEQQRIEAILSQQMSEATADKLKQLLSTKGLLNRLSAYKGTA
FT                   RDFSPSELDRELETHLTIKDIYPELKSLMGSLGLSQGNTLHYASIIKHTSVYQVRHYPH
FT                   WQGLLYLTCYLYFRYRETNDKLVIAFCYLTRKYHEAAKAFAKQKIADELELVREKLKYA
FT                   GDILHYFVDENVSDVVEFGEIRQQAFSLISKEEIHAISQHLGKNDFDLAGYEWEYLDKQ
FT                   SRKIANSLRKLFIAIDIECESDQKVLSDQIMLSKHELAGKRKIITTHQEMLKKSDRRYL
FT                   WINGEVHTKRFEFYLYQKISRQLDRGKAYVTESEKNKRLEDDLIPVKDWENDQINLIEK
FT                   TGLQRLSSPITQTLNEFEKRLELHMNQVAASISGDTNEFVKLQPRSNQLAWTLANQRWR
FT                   DDIDNPIYSQIRHMGIIEIMNHVNRKTGFLGAFKGIATRKRCTKAEADDLIACIFGNGT
FT                   NYGLHRIAAISDRSIGVLRGVNDAFVRPETISAANDLISNGIARLPVFRYYTLNESSPF
FT                   GSIDGQKYACRINTFKARFSAKYFRKGKGVSAMTLVSNHVPIKTTVISPNEYEGHYAFD
FT                   LLYNNSSDIQPKSLATDTHGINNVNFAILDLFGYQFSPRYARFKQAFAEQFEVNTGTDM
FT                   TISLKKPIKRKLIEQEWGNIQHIICSLSRKVTQQSTVVKKLSNNKRNNRTLLALHEYDR
FT                   LIKCLYLLEYVDNKTLGQFVQQALNRGEAYHQLRRAIASVNGNQFRGGNDYQIEQWNDC
FT                   ARLIANCIIYYNSALLSALIEKFQEEGVVSGKPPKFCGLDYDNVSPSIMASRSSSFPSL
FT                   IKV"
FT   CDS_pept        complement(103138..104865)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0115"
FT                   /product="transposase (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ92983.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        complement(104908..106179)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0116"
FT                   /product="transposase (fragment)"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ92984.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        106328..106903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pinE"
FT                   /locus_tag="XNC1_p0117"
FT                   /product="e14 prophage; inversion of adjacent DNA"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0117"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92985"
FT                   /db_xref="GOA:D3VM33"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM33"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92985.1"
FT                   /translation="MTEIRIGYARCSTDKQDLTAQQEALVKLGVSPDRIYIDKGLTGSN
FT                   RQRPGLDQALAAVRSGDTLVVPKLDRLARSVPDAREIADTLQSREVKLALGTNIYDPAD
FT                   PMGKMFFNVLATFAEFEGDLIRLRTREGMAIARAKGKLRGKQPKLSEKQQKELCRMHET
FT                   GQYSISDLAELFSVSRPTVYRTLSRGKK"
FT   CDS_pept        106900..107172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0118"
FT                   /product="putative arylsulfatase regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0118"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92986"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM34"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92986.1"
FT                   /translation="MIDLTAEQRQLAKIVHDYACRFPLTENDDTQLLQGCYDYMNAFKR
FT                   VMDSESKVQMDYICLQYPGYFRFAVWMERMAQGIADGVIEVPKDH"
FT   CDS_pept        107320..109104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0119"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0119"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92987"
FT                   /db_xref="InterPro:IPR011646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM35"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92987.1"
FT                   /translation="MWSDKESSEDYLNFGEVSQLAVDVLTTEGMLPVSIGIFGNWGAGK
FT                   SSLLKLIEQKLEKDDKDWIVINFDSWLYQGYDDARAALLEVIATSLTKAADGNASIVSK
FT                   AKKLLSRVDGFRAMGFLAEGAALFAGVPTGGFLARGLGALRNVSDGIQSQEEYEDLGNL
FT                   AKESKEKVGNLLKPEVKKSPPQQIEAFRKEYGEILEELGKPLIVIIDNLDRCLPANAIH
FT                   TLEAIRLFLFLTNTAFIIAADEDMIRSSVSDYFKGASQRHQIDYLDKLIQVPIRVPKAG
FT                   VREIRSYLFMLYAIEHGLKGEKLTNLRDGLERALQHSWKDEPISRQDVLKMTGESEDSN
FT                   LALAFARADRIAPVLANSPIIHGNPRIVKRLLNVVKMRSQIAKRRAMPLDEAIITKLVI
FT                   FERCVGVDGTADLYHLVDIEQGMPQLLKQLEDTNGQVPSEAPKTWTDNPTTKAFIAQWA
FT                   QLEPRLGGIDLRAAIYLSRETMPIGAYVVGLSPSGREVLNALIELKNTSSPTAEDLLKT
FT                   LPREEQVPVMEGLISQLRQVSDWARKPKGFSGACLLARHSADAASILIRFLQELQLGMK
FT                   RPAWMTAALKDEQWNKDA"
FT   CDS_pept        109104..109856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0120"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0120"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92988"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM36"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92988.1"
FT                   /translation="MGTSQSSTGPGGGSPLVPPWADDQPQQPLPPPQERRFAPFRESLG
FT                   NAVLNGNRADFRKAIGHYARKASGGSGSAARRLGSVTQAGGGLFGALAGMPAAPGEPSI
FT                   DLGSLAGLPCEMAISAIAQALTSQDGDSEKICAAMNHALVEALDGVAIFDPQKITDGVI
FT                   VDTMICYLAESIFLQMVMDSNKAWNKADTPSKAIHAETELRELIKVVVDKHMAPKLVGN
FT                   IRTFSKNQMINIERQVIIEAWQEWEAYQ"
FT   CDS_pept        109829..111157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0121"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0121"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92989"
FT                   /db_xref="GOA:D3VM37"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM37"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92989.1"
FT                   /translation="MARMGGLPMTQLVFHHDHRLLPSAGDSLLPVQLYGLSGQGRGDIS
FT                   IIGNPAIDRIKRLGVKIPAQVMDFLSIALAVTAADTFVQRESSEDGWTRQFSLRLPLHE
FT                   PSRWIALKKELESALHFLSGDIWDFEFCNGGYVPPEPYSQHSKFHLIKLKDLDCVSLFS
FT                   GGLDSAIGAIDLLAAGRAPLLVSHAYKGDKSRQDQIAEKLNGRYSRFEINADPHIYQGD
FT                   TEITMRTRSLNFLAFAAVGACAVQEVSQQEKVDLFVPENGFISLNAPLTPRRIGTLSTR
FT                   TTHPHFITSVQKLFDAAGIPCQIINPYQFKTKGQMASQCLNKQLLSEVVESTVSCSHWK
FT                   RRNQQCGVCVPCIIRRASLHAGGIDKDADYTFQSLAKVINEIDRRDDLMALRIAIAQKS
FT                   TLKIGTWIAKSGPLPTATFNNFKQVFIDGLDEVESYLLSESIV"
FT   CDS_pept        111154..111879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0122"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92990"
FT                   /db_xref="GOA:D3VM38"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM38"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92990.1"
FT                   /translation="MSIDMHCHLDLYSQPEQVAEECKRRGTYILSVTTTPRAWHGTSSL
FT                   AKGSQRIRTALGLHPQIAHQRSHELELFDSLLSETRYIGEIGLDGGKGFKEHWDIQLKV
FT                   FRHILNNVNRAGGKIMTIHSRGSASVVLDEIENIDGVAVLHWFTGTPKQLERAIDLGCW
FT                   FSVGPAMLDTIKGKSLALKIPKSRILTETDGPFGKFRNDPLMPWDSEIAEKQLTTLWDM
FT                   SQMEVKAQLFENFRELCKL"
FT   CDS_pept        complement(111905..112228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0123"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0123"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92991"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM39"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92991.1"
FT                   /translation="MFAMLKMQNSNSFFSLIVAIASAHVKQRPLSFSDNSTYDTNTNLY
FT                   TGHDITSNKAAVNEFVKTGLAVLKIDEFGNAGLELVARPVFLSDFGVVSRKPPKFCQRG
FT                   VPA"
FT   CDS_pept        complement(112263..113138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0124"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0124"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92992"
FT                   /db_xref="GOA:D3VM40"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM40"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92992.1"
FT                   /translation="MDKAMLDVFFKSIGQRVCIRRKEAGLSTHTLAQHTGISEAQLIMY
FT                   ETGLDDIPLSHLIQISAGLNTPTGWFFIDLYSDLYVSNASKLPHVSDGFIMDTLTTGAV
FT                   TKNIGLRIQIWRKTMMLTAAALGLSVGLSQQQISRNEHGKNRIHIDHLVNIALALGIPI
FT                   SWFFIDCHPDLEVNTSSHLPTTPTKIMDKPELEMMAKNIGQRIRVRRKKLNVTLQGLAK
FT                   QAGMNQQTLSRYETGKKRITSTDLVIIAIALNTPIDWFFIDYSSLDDDFPLTSLKSSDS
FT                   GLFMDSYSKI"
FT   CDS_pept        complement(113407..113595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0125"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0125"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92993"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM41"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92993.1"
FT                   /translation="MNSFSLTIFYHYYKILFRGLKVPVFYKIYLLVLVTWIHHRIRTTI
FT                   CIISYIFIREKISFNLL"
FT   CDS_pept        113563..113973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0126"
FT                   /product="putative DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0126"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92994"
FT                   /db_xref="GOA:D3VM42"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM42"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92994.1"
FT                   /translation="MIENSQAKTIQKNIYMNANRLIEARKFRGLSQRELGEALGITDSE
FT                   TAGQHISKYERGVRLPPYKTVREIAKILDMPPCYFYIDDDDLSAEEVQIFYEKCLSHKS
FT                   ERRFISDLIEKNQEYEKVINSIKKTVNSVKTS"
FT   CDS_pept        114160..114327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0127"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0127"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92995"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM43"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92995.1"
FT                   /translation="MSMQQMQWSQQGAHYLLQTRTAVLNDDLKTQFEHWYPGIKLGDET
FT                   EHSWTEKIAA"
FT   CDS_pept        complement(114343..114570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0128"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0128"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92996"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM44"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92996.1"
FT                   /translation="MNTNKKRLTILTQPEIQDYFGLPRFTLAEREYYFTLSDTEYQVTP
FT                   QGWSVNSRVNFILMGVISPPAGTDPICTRP"
FT   CDS_pept        114755..115585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0129"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0129"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92997"
FT                   /db_xref="InterPro:IPR017880"
FT                   /db_xref="InterPro:IPR018004"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM45"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92997.1"
FT                   /translation="MAQKIDVRGIKVSVFSDKQDDYISLSDIAKYKDGDRGDYILQNWM
FT                   RNRSTIEFIGLWEQLHNPDFNSIEFDGFKHEAGANSFSLTPKRWITTTHAIGIISKAGR
FT                   YGGTYAHRDIAFEFASWISAEFKLYLLKEFQRLKQAENEQKNLEWNVSRTLAKVNYHIH
FT                   TESIKTNIIPALELNPKARNFAYANEADILNLALFGKTASDWRKENPELKGNIRDYATL
FT                   EQLVVLSNLESFNAELIGQGLSANDRFQKLNRVAVSQMEILIENKSIEKLKQLK"
FT   CDS_pept        115593..116204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0130"
FT                   /product="Resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0130"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92998"
FT                   /db_xref="GOA:D3VM46"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM46"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92998.1"
FT                   /translation="MRIGYTRVSKSDGSQVQDLQLDALLAAGVNKENIYQDEISGKSDK
FT                   RPGLDACLKALRSGDVLMVWKLDRLGRSLKHLVNTIHDLADRKIGFKVLTGQGAEIDTT
FT                   TASGKLVFGIFAALAEFERELISERTKAGLAAARARGREGGRSFKLTKSQVRLAQASMK
FT                   SRDCSVSELCEELGISRQALYKYVGPDGELREHGKRVLKS"
FT   CDS_pept        complement(116607..117017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0131"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0131"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92999"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM47"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92999.1"
FT                   /translation="MLSDFITFSSMDEEKCQPYLGRDRVSKNAPELGAELLDSLTSTKW
FT                   YIWHGNVIKALEHLDDCAAMCDEDISHYGNNKSLLKHIDEMYTYIENNSMMIPNYGEMY
FT                   RYGEAISSSFVESTINEVIAKRMVKKQQMQWS"
FT   CDS_pept        117001..117390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0132"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0132"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93000"
FT                   /db_xref="GOA:D3VM48"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM48"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93000.1"
FT                   /translation="MKSESKRTQRDYSLAFKLAVVDQVEKGEMTYKQAQSRYGIQGRST
FT                   VLVWLRKHGQLDWSLGWTPLHPQGAAMTSSSSLTPEQHIKELEQQLTEMEKKAEFFEAV
FT                   VEVLKRDYGVTIVKKPRGKSFRRKK"
FT   CDS_pept        117402..118250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0133"
FT                   /product="Integrase, catalytic domain (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0133"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93001"
FT                   /db_xref="GOA:D3VM49"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM49"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93001.1"
FT                   /translation="MTQCCRYLGITRQAYYQQCQRTAIKEQQEQDTLRQVQSIRLKQPR
FT                   IGTRKLQYLLNQSSPLKIGRDSLFDLLRTHHLLVRPKRAYHKTTQSHHRFYCHPNLLKA
FT                   GSNKITPTGPEQVWVADITYLPVKMGEAYLSLITDAWSRKIVGHHVHDNLKTDAVIKAY
FT                   KQALKNRKLAEKSRIHHSDRGLQYCSKRYQALHKHHEVICSMTDGHDCYQNALAERVNG
FT                   ILKTEFLLSKPSDLEEAIKMVSESIEIYNRYRPHLALKYKTPDEVHHQALSKNSVNVYQ
FT                   D"
FT   CDS_pept        complement(118231..118770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0134"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0134"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93002"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM50"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93002.1"
FT                   /translation="MSYELTANLLKDILPVGEHYNAATVRNHLCQTAKRQEAELEGLSD
FT                   FLPGDPRKWEKLPKPGKPMTVGIDGGYVRNRDDRKHHFEVIAGKSFAANVPTKRFGFVQ
FT                   CLENHPRRKLIAQLSSQGMQANQQITFLSDGADNIRDLQFNLYPESQHVLDWFHITMRL
FT                   TVLKQYARGVSSPDIR"
FT   CDS_pept        complement(118933..121974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0135"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0135"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93003"
FT                   /db_xref="GOA:D3VM51"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM51"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93003.1"
FT                   /translation="MTTDCTKKNEKRLHILSPCEVKELYERPVFNQADREDYFSLDPHT
FT                   ANIVSALNKPETRIYFILLMGYFRAKPVIPKFNLDEVAEDAEYIHKTYFPDENPEWITL
FT                   SKSTRSKLVNKALDILNFQRFTEAHYSALITRLKDVATICTDPRYIFDEILAFLGQKRI
FT                   ALPGYTRLQEMITEALMAEQQRIEATLSQQMSKETADRLKQILSTNGLLNRLSAYKGSA
FT                   RDFSPSKLDRELETHRAIKGIYPELKSLIGSLELSQGNIIHYASIIKQTSVYKVRRYPH
FT                   WQGLLYLTCYLYFRYRETNDKLVTAFCYLTRKYHEAAKAFAKQKIADELELIREKLKYV
FT                   GNILHYFVDESVSNVVEFGEIRQQAFGLIPKEGIHAISQHLGKRDFDLAGYEWEYIDKQ
FT                   SRKIANSLRKLFIAIDIECEADQKILSAQITLSKQELTEKRKIITVHQEGIKKSDNRYL
FT                   WINGEVHTKRFEFYLYRMISRQLDRGKAYVTESEKNKRLEDDLIPIKDWENDRLNLIQK
FT                   TGLQRLSSPITQTLDEFEKRLERRMDQVAASISGDTNEFVKLQPRSSQLAWMLANRRWR
FT                   DDVDNPIYSQIRHMGIIEIMNYVNRKTGFLEVFKGITTRKRCTKAEEDDLIACIFGNGT
FT                   NYGLHRIAAISDRSIGVLRGVNDAFVRPETISAANDLISNGTARLPVFRHYTLNGSSPF
FT                   GSINGQKYACRINTFKARFSAKYFRKGKGVSAMTRVSNHVPIKTTVISPNEYEGHYAFD
FT                   LLYNNSSDIQPKSLATDTHGINNVNFAILDLFGYQFSPRYARFKQAFAEQFEVNSGTNV
FT                   EIRLKKPINRKLIGQEWENIQHIICSLSRKATQQSTVIKKLSNDKRNNRTLLALHEYDR
FT                   LIKCLYLLEYIDNKTLRQFVQQALNRGEAYHQLRRAIASVNGNQFRGGSDYQIEQWNDC
FT                   ARLIANCIIYYNSALLSALIEKCQDEDNQKAVNQIAGFSPVAWRHIQLSGNYVFGNRDG
FT                   LLNLYNMLERVDPLVNIETEELAA"
FT   CDS_pept        122085..122654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pinE"
FT                   /locus_tag="XNC1_p0136"
FT                   /product="e14 prophage; inversion of adjacent DNA"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0136"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93004"
FT                   /db_xref="GOA:D3VM29"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM29"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93004.1"
FT                   /translation="MILGMTKMALLGYARVSTSQQKLDIQIASLKQAGVREDRIFTDKM
FT                   TGKTDDREGLKKLLARAERDDTIICTKMDRLGRNTADMIKIVDNCYKKGIPLRFLDNHL
FT                   STEGTMGKMVIQILAAVAEAERERILERTNEGRQFAKESGVKFGRKPHKSTAEANKMIA
FT                   QKISMKEVMEKTGISRATYFRLKKMI"
FT   CDS_pept        complement(122842..123279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0137"
FT                   /product="transposase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0137"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93005"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM53"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93005.1"
FT                   /translation="MIDEIGVVTGLTLTPANVSEREATGDVIGSIKDCLLGDKGYLGVE
FT                   FKQEMKAEGIEMITPVRANMADPIPRKTRRVINAKRRLIETVIGQLAGQFAIEKCWARD
FT                   LWHLSNRIARKLLSHTLGIFANFKQGKSQRDWLQQANVIGC"
FT   CDS_pept        complement(123340..123741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0138"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0138"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93006"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM54"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93006.1"
FT                   /translation="MSQQDFIIWVFCWVDDNLTQLQQGVRFRSRGLPPKLSDAEVITME
FT                   VIGEFLGFSTDKGIWTYFCHHWRDWFPGLGSRANFAKQAANLWVVKQKLQEKLAILLGA
FT                   FDRPVHIIDGFPLPVCGFKRAKGCANFKG"
FT   CDS_pept        complement(123919..124230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0139"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0139"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93007"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM27"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93007.1"
FT                   /translation="MSIIFSGHYCMKYRTLLLDALRLHFDEHLSRLDVGRRLGIPKSTL
FT                   CALFVRFKKLGMSWPLPDNMTADKLESQLYPARPHAVRLDIPAPVLGVLCPMHPKVPW"
FT   CDS_pept        complement(124507..125478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0140"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0140"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93008"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM26"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93008.1"
FT                   /translation="MYGINFILSIILFKWRLIMNIIQKNSSNIIWGDETDSGQLGHFYP
FT                   FLFPFTIGDHTFFYGQNIERSRYGRFIRELHPGGIVSWTTDETDINYGPSLSIRPVLYT
FT                   VGKRVFIRAQMIDHHKLWYIQEVLPGGTFGSIINQGYYNIEYSAQFPYLIDGKTFIFNQ
FT                   TFDEKKGNFYIVQEMMPDGNHGEITDEGTWNSFYPFQFAYTVGKRTFYYGQTRDNNYWF
FT                   IQELLPDGRIGSTTESGNWHSFYEVLFPFIFKGRTFYYGQTRDNNYWFIQELLADGKLA
FT                   SSYQSGYFEHFYEVQFPFTFGEHTYFFRHSNDKRWFIQELLL"
FT   CDS_pept        complement(125649..126119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0141"
FT                   /product="e14 prophage; inversion of adjacent DNA
FT                   (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0141"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93009"
FT                   /db_xref="GOA:D3VM25"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM25"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93009.1"
FT                   /translation="MNRPGWEQLLAYLRTGDSLVVTELSRMTRSLMDLLQTCQALEARH
FT                   ISLVSLRENIDTTTATGRGFLSMMGVIHQMERELKAERAAAGRAAAKARGKSGGRPRTH
FT                   IEKLENARILYENSDKTAAEVCEQTGVGRRTFFSYLLQCRKEISEQAKEEPY"
FT   CDS_pept        complement(126116..126265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0142"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0142"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93010"
FT                   /db_xref="GOA:D3VM24"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM24"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93010.1"
FT                   /translation="MSDGISKYSPSRVGYARVSSISQNLDSQIDALKTAGCGKIFTDKM
FT                   TVHA"
FT   CDS_pept        126532..127059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0143"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0143"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93011"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM59"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93011.1"
FT                   /translation="MFNLEYKMTDQKISQQSSNVFAPPSAEESSAHQIIARRALENIAA
FT                   LAGQAQYSTFRAASANALSETISTSQFSLASALIHTWVYSNPTINYSSGKKVKFKGEAW
FT                   GIAIGAGVIWLSGWMAPPDQVIGDVDFTLITSPTTTEIWLRKNGDTIGVLIGGGINVQA
FT                   GAVNGSGKIESA"
FT   CDS_pept        127178..127321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0144"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0144"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93012"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM60"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93012.1"
FT                   /translation="MCDHATLEQLVVLSNLENVMSASQSLSPVLELRGEAWILSDFRSY
FT                   SA"
FT   CDS_pept        127399..128067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0145"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93013"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLZ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93013.1"
FT                   /translation="MQHIFIGHQFMQIYIVKVALRNVSPMVWRRFRLSGKTSLAAFHYI
FT                   IQIAQGWHDDHLHQFRIYGKDYGISYSGGIAFPDNPYKVTLDDLEFDAGDRFTYEYNFF
FT                   ENWLHDIRIETILDNSNLKSPFCLAGNRMPGATLADETTKTLALLNAIIHADETTTVGE
FT                   IRPLIEALDTVRFNRLKVNRQLSRLNLDSPELEPIVINCAENALADRLRISVNSLRLTR
FT                   "
FT   CDS_pept        128196..129596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0146"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0146"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93014"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLY9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93014.1"
FT                   /translation="MQLTIQIATVDKSGHRHTEKLLAIEKQTDSPNDIGLSLSESKQLL
FT                   NTVQQSVIQKQAAEFLDEHRPCPCCQRNRRIKGRQKIQYRTLFGIIPVEGFRVYRCICE
FT                   KNSPQTVNLLNDWCSEYTHPELKYIETKWASLMAYGLTASLLKDILPVGERCNAATIRN
FT                   HLCQTAKRQEAELDGLPDFLSGSPREWAKLPKPGKPMTVGIDGGYVRNRDDKKHHFEII
FT                   AGKSFSADVPAKRFGFVQCLENHPRRKLLAQLSSQGMQANQQITFLSDGADNLRELQFN
FT                   LYPESQHILDWFHITMRLTVLKQYSKGVSKNDPELGTELLDSLTRTKWYIWHGNVIKAL
FT                   EHLDDCAAMCDEDISHYGNNKSLLKHIDEMYTYIENNSMMIPNYGEMYRYGEAISSSFV
FT                   ESTINEVIAKRMVKKQQMQWSQQGAHYLLQTRTAVLNGDLKTQFEHWYPGIKLGDKTDH
FT                   YWTEAVAA"
FT   CDS_pept        129745..130785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0147"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0147"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93015"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM63"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93015.1"
FT                   /translation="MARKLVEYDDVAAAAQRLKDAGKRPTLIAVRDLIGKGSYTTISTF
FT                   LKQWSEEHSLDDEPVEVILPESVMSDAQLFLQKIYTVAKASADDQLERERELLRQKEIE
FT                   FQEDMQQAVDMANDATEKSELLEEQLEAITNKKAESDAALAKTESSLSLKSAELERSLT
FT                   DIEKLEKRIMDLEGKLEAKSTELTRAQDHLEQAESENLSLSQKLATTEGELSAQKGKSI
FT                   EQTEKLRAAHEQNKALKEQLENTQAKLAQSQDSLATAKAHGESLERECQRLSGDVQKLE
FT                   SKLSSAEAEARSLVQDKGVIAGQLQEKDQQTKNLELRLNEALTKISGLELELVKTGKGG
FT                   KKKEEN"
FT   CDS_pept        130785..131063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0148"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0148"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93016"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM64"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93016.1"
FT                   /translation="MARKAKYSEEWRSRAAALQANIEEAMKLASASIGNDDWLHRLHVW
FT                   VAEVVQGNASDWWTDLDCEVSLPREEKRVSTFISTQRKRITFQMCLA"
FT   CDS_pept        131051..131416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0149"
FT                   /product="Putative DNA helicase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0149"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93017"
FT                   /db_xref="GOA:D3VM65"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM65"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93017.1"
FT                   /translation="MFGVGGFMKQLPPDTPEQSLITQYKGPRLVVKAYAGTGKTTTLVK
FT                   YAHNNLNSRILYLAYNRAIRDEAREKFPANVDCKTSHQLAYATIGRSYQHKLTGNLRLT
FT                   DIAQAVNTKNWTFAKVY"
FT   CDS_pept        complement(131351..131494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0150"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0150"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93018"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM66"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93018.1"
FT                   /translation="MIMDSSPLIKVGNSLLFKLKCQIWSELIHFSKGPVLRIYRLRYIG
FT                   KS"
FT   CDS_pept        131514..132554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0151"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0151"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93019"
FT                   /db_xref="GOA:D3VA56"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:D3VA56"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93019.1"
FT                   /translation="MLYTSNPIIKHKAGLLNLAEELSNVSRACKVMGVSRDTFYRYQEL
FT                   VETGGIDALINQSRKTPNLKNRVDAETEHAVINSAIEFPAYGQARTSNELRKAGIFVSA
FT                   SGVRSIWLRHHLENFKKRLAALEKKVADEGIILTDEQVAALERKQHDDEACGEIETAHP
FT                   GYLGSQDTFYVGNLKGVGRLYQQTFVDTYSKVAFAKLYTSKTPITAADLLNDRVLPFFS
FT                   AHRLPMLRILTDRGTEYCGRVEHHDYQLYLAVNDIDHTRTKAMSPQTNGICERFHKTIL
FT                   NEFYQVTFRKKLYGSLDELQKDLDKWMDNYNNHRTHQGKMCCGRTPIETLQDGKSIWAE
FT                   KNLTQI"
FT   CDS_pept        132652..133908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0152"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0152"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93020"
FT                   /db_xref="GOA:D3VM68"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM68"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93020.1"
FT                   /translation="MPVFGMFNLSTKTGEKMDEKKLQILATELAKDLKTPEDLSQLSRF
FT                   LKKLTVETALKAELAAHLGHEKHQPKSGSNTRNGYSPKTLLTEDGDLALQIPRDRESTF
FT                   EPQIVRKNQTRITGMDSQILALYARGMTTRDIAGTFKELYDADVSPSLIAKVTDAVKAE
FT                   VIEWQSRPLDSLYPIVYLDCLMVKVRQDNQIINKSVFIALGINTEGHKELLGLWLAENE
FT                   GAKFWLSVLTELYNRGLKDIFIACVDGLKGFPEAINTVYPQTRVQLCIVHMIRNNLRYV
FT                   SWKDAKAVVKDLKQIYQAPTEEVAQQALKAFAEQWDERYPQIGRSWRENWGNLSTFFAY
FT                   PAEIRKVIYTTNAIESLNSVIRHAIKKRKIFPSDDSTKKVIWLAIQAASKKWTMPIQDW
FT                   RLAMSRFMIEFGDRLNGHI"
FT   CDS_pept        complement(133976..134395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0153"
FT                   /product="putative transcriptional regulator, DNA-binding
FT                   protein HLP-II (HU, BH2, HD, NS), increases DNA thermal
FT                   stability"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0153"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93021"
FT                   /db_xref="GOA:D3VM69"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR027454"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM69"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93021.1"
FT                   /translation="MKDHEEFSTLSAAERRELIIAELKRKSRIRTLLRGLPLDEVREII
FT                   DRMKGVLNELEEEYKKREEEEKEKRAQAERIMSDMESCGVDINLLNEMYTSKSEPDNAK
FT                   YSKDGVSWSGQGRRPDAFKGLGHVELERFRIPQKK"
FT   CDS_pept        complement(134397..134690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0154"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0154"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93022"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM70"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93022.1"
FT                   /translation="MAGSKWDGKISNLNISEQGFPELYRELSQMQHKARSDRLRALALL
FT                   GLYSLRFSGNIGSFGQPSSEHQIAKSQPEQLQVDDKLDSKRDQLKGKLMGSV"
FT   CDS_pept        complement(134707..135795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0155"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0155"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93023"
FT                   /db_xref="InterPro:IPR040607"
FT                   /db_xref="InterPro:IPR042051"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM71"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93023.1"
FT                   /translation="MGNYRGYTGRSQAVFSLQQEENNRKAIKKQSLEDFMNQFVMGLDI
FT                   GYSNLKMAMGHKGEEARTVVMPVGAGPLELMPQQLTGGAGTCIQVVIDGEKWVAGVEPD
FT                   RLQGWERELHGDYPSTKPYKALFYAALLMSEQKEIDVLVTGLPVSQYMEAELREALKAR
FT                   LEGEHQITPKRTVTVKSVVVVPQPAGAYMDIVSSTKDDDLLEIIQGGKTVVIDPGFFSV
FT                   DWVALEEGEVRYHSSGTSLKAMSMLLQETNRLIQEDHGGAPGIEKIEKAIRAGKTEIFL
FT                   YGEKVSIKDYFKKASAKVAQNALVPMRKSMREDGMDADVVLLAGGGAEAYQDAAKELFP
FT                   KSRIVLPKESVASNARGFWYCG"
FT   CDS_pept        complement(135805..136074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0156"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0156"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93024"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM72"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93024.1"
FT                   /translation="MEFVKYPSIYLESYSLNSDSHNPDVNALGKIPNILDKYCKIPNIY
FT                   EITMEAGKGELDVWWGAIVINLSIRAAYPHVWLALKPKSHPKAI"
FT   CDS_pept        136161..136727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0157"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0157"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93025"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM73"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93025.1"
FT                   /translation="MDRNWEGFEVSLPKERWLDLLDPKLEEERSEITEDLLEAEGREFV
FT                   TELRSKLDHAIAVLAVEAQQEADMYWNAHRSAREEASEDEQGRVGTRVRILGVSLVAEW
FT                   YRNRFVEQVPGQKKRVLSTHIKKGRGHAYSMSHFKKEPAWAQELIQQVESRYAALRQRA
FT                   TALAKIRRALNEYERLLNKTHNDEV"
FT   CDS_pept        136717..137019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0158"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0158"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93026"
FT                   /db_xref="GOA:D3VM74"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM74"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93026.1"
FT                   /translation="MRCNNMTVSVAATELAKLGKCETMIKRFAKHPRPAPAKRPQSPQG
FT                   TDNTLRGEFAHFRYEAAALRFMNSAAGAKRRIYQLVFAATVAAGVLTLLAAWTTS"
FT   CDS_pept        137004..138104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0159"
FT                   /product="RepA protein (modular protein)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0159"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93027"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM75"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93027.1"
FT                   /translation="MDHQLDSIDGTIMSKRTKDKDVEKLDVIKDSPQMSLFEIIESPAK
FT                   KDDYSNTIEIYDALPKYIWDQKREHKDLSNAVVTRQCSIRGQQFTVKVKPAIIEKDDGR
FT                   TVLIYAGQREEILEDALRKLAVNGKGHMIEGKAGVMFTLYELQKELSKMGHGYNLNEIK
FT                   EAIQVCRGATLECISNDGEAFISSSFFPMVGLTTRGEFRKKGGNARCYVQFNPLVNESI
FT                   MNLSFRQYNYKIGMQIRSPLARYIYKRMSHYWTQASPDSPYTPSLISFLTQSPRELSPR
FT                   MPENVRAMKLALEALIKQEVISDYDANQIKDGRKVIDVRYVIRPHENFVKQVMASNKRK
FT                   QQTELRAIKQGMIDHDIIDERQRKGR"
FT   CDS_pept        complement(138799..138984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0160"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0160"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93028"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM76"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93028.1"
FT                   /translation="MQCSHMPLDLIHCYPHGTPFFSTKFLKNRPFVQRTHIFVLAFVQR
FT                   THMFVLKRAVAPYTFY"
FT   CDS_pept        complement(139639..140004)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0161"
FT                   /product="conserved hypothetical protein (fragment)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CBJ93029.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        complement(140397..140882)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0162"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CBJ93030.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        141149..141757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0163"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0163"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93031"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM79"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93031.1"
FT                   /translation="MKAIKRFIIWVNYGLEGWSIFGSSDDWDEAVSIRSEAIDECSIDE
FT                   DDIILAENKNELVVKPAAKQMTEWHRELEAVLMTLDDCQMECDGMTWAVSHLLNEAGVP
FT                   HDCMYGFVRNEQTKDIVTPHFWVVLDDGWLVDLRLRMWLGDHDNIPHGVFHTDNEPGFF
FT                   YKGDPVQNHKGMRLGKAVLDIMTDGKLSHVKVPERQDGE"
FT   CDS_pept        141762..142283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0164"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0164"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93032"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM80"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93032.1"
FT                   /translation="MEFDYDKSVSNAHLEAAGWGMDAFNHSNPFESHVIYVRDYRNDHI
FT                   RLFTIKQADFDTIKLPLHLTSDMLASVIAEFVSKAAKGKLNAKESDTLAPALVGYAKST
FT                   ETYRSWRRVSGTAERLHMVINIYAGSGLLRPFIARAPETVLTSQEVLAFSSQVKGMDVT
FT                   NHPEWFRGRR"
FT   CDS_pept        142286..142807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0165"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0165"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93033"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM81"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93033.1"
FT                   /translation="MKAVLWIFVLIIAPFVIAKVDQWRKRSIGDTWAWWKSENMPPELR
FT                   SATLFLSEQDVSTTLPVPMHGRVDQVYQTKRGILIPLDTKLRQINHIYESDIIQLSVYQ
FT                   VILSHKYKVPVAKYGYVRTVVETADGDKVRYIKTTLLSEKEVVKLWHRYQSIRSGQVKP
FT                   SCSCGGKFHM"
FT   CDS_pept        142732..142851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0166"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0166"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93034"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM82"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93034.1"
FT                   /translation="MAPLPIDPFWSGKTLLFLWRKVSHVKVFFVKNRLPELGS"
FT   CDS_pept        142906..143379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0167"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0167"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93035"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM83"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93035.1"
FT                   /translation="MAQLKHNRLVMLGSLMATVVAAANGLSFITLMAGGITLLQFLAWK
FT                   QQDAVQSRFKAAKNAFETLNVIAFDKHWVGSTATVAKVSNMLTPAERLDKPWAVQVLAV
FT                   AEGGTWFAVDLQVTGTNKVQMLSLHQLSEKAAKTMLAFDLEVYEKFFGKPDVA"
FT   CDS_pept        143300..143683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0168"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0168"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93036"
FT                   /db_xref="GOA:D3VM84"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM84"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93036.1"
FT                   /translation="MKRQQRLCWPLTSKCMRNFSENLMLHEENVMEKIKNVDAVEFTVE
FT                   DKKAMTHAAYAQCIFILAQALAFPSLGMAGAMVAALCGMMPWLTKFAKEAPSKAFGMVM
FT                   ASLCIAPVYGKLCELVIHAIQGA"
FT   CDS_pept        143688..144539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0169"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0169"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93037"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM85"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93037.1"
FT                   /translation="MGLVRVPYLLAELKERGGDESALAKIMQPGCRIGEEDLRALASKL
FT                   GIEISSLAPAPENAANTRFKAKLRGGLASFLFEYDGCFRHAEGSSHAEMLGIEQEDDIG
FT                   LPSRAADAMLLEKTLYQVIARAKYMLSKIDSKFVRSEQAIEFREQLAPGIFKPGYRGFR
FT                   FKEAASGDLPTVMIDGRKFNCIASIARAHGLDPVTVRRRIADTGKTAEKLTNDEWKLIL
FT                   SKKKGKGKPFTYQDRTYSNIAQFCREYQLNSNLVYQKVKDRADSTDEEFWGQIIETCKR
FT                   ND"
FT   CDS_pept        144521..145498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0170"
FT                   /product="Peptidase S49, SppA"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0170"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93038"
FT                   /db_xref="GOA:D3VM86"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM86"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93038.1"
FT                   /translation="MQKERLMAENKEIPWERELIEKYMFTLHKEQVKDRRWRTMLRVLR
FT                   ASGFVLLMVGFIILASNPGGMPWQSAKAAAPHTAYINIRGEIAAGTLADADHLIPSIQA
FT                   AFDNPNSQAVVLRINSPGGSPVQAGRIYEEVKAQRALHPEKKVYAIIDDIGASGGYYIA
FT                   SSADEIYADRASLVGSIGVISSGFGFTGLMDKLGIERRAITSGEHKALLDPFSPLTADM
FT                   KTFWEGVLSKTHQQFIERVKAGRGERLKDDQKVFSGLLWNGEQAKEIGLIDGLGGLNSV
FT                   ARDVIHQTSLVDYTPTEDIIRRLTQRAKLEASSFVQELSAVKVY"
FT   CDS_pept        145514..146350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0171"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0171"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93039"
FT                   /db_xref="GOA:D3VM87"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM87"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93039.1"
FT                   /translation="MTEQSTKTLRLGVIAAVFLGLVGTGFGIYQFVKEKELAQEIASVK
FT                   STVNQVKDAEGVTFKSKAEFDAAVAASINKFVEQKQQSDIDQKYAQFEGAPEKVEDGKH
FT                   IYGDLGARFTLVEFSDLECPYCKQFHDTPKQIVDASKGNVNWQWKHMPLDFHNPAAHKE
FT                   ALAAECIAEQKGNRGFWVFINDVFQRSQGNGRGVEDLASVVTGVGADLDAFRECLSSGK
FT                   YEDKVQADIQKAKSYGVNGTPATFVVDNQTGKSQLLGGAQPAQAIMAVMRKMMIES"
FT   CDS_pept        146407..146835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0172"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0172"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93040"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM88"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93040.1"
FT                   /translation="MIKTTTKLGCLLGGLLVLSACSSAPQPSNEYKMALDDTKQLCEAC
FT                   ALVGNDLLVALNKSCNTPMTPESFTGVMNSNPMFAAMMAINSIGGTDLYQVYRDAAIDT
FT                   LRCNEMDTWPERTKIRFQQPDMQKVLALKVSARQQKAN"
FT   CDS_pept        146892..147257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0173"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0173"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93041"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM89"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93041.1"
FT                   /translation="MELQEAKEALDSLHPHKASAPLRLVIHQPGGIGGTPTVGVKAIHA
FT                   GFDWDSNTILIYPEEQLTRLTPDEVAAITKSVSKGQSWHSYQQLKKYREQLAEATEEIS
FT                   RLKAELERYQKNGGVEC"
FT   CDS_pept        147251..147697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0174"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0174"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93042"
FT                   /db_xref="GOA:D3VM90"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM90"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93042.1"
FT                   /translation="MLKRGIINLAASYIIVDALLRNAAIWIFGLSFSVGGAYVVGEASS
FT                   WVIYLATSGAVTLCSVVTAYLLVTYHRWGLMAARVWLLLSACLNGYAAYLSGHNIQLMV
FT                   ALFASLFIALWMLKTLEQPAVKGTYKVIADLHSQLWGMLKGQAR"
FT   CDS_pept        147667..147954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0175"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0175"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93043"
FT                   /db_xref="GOA:D3VM91"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM91"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93043.1"
FT                   /translation="MGNVKGASQMTTNTQNANTNQVKSLRDMLVPALLFYVVMTSMFVG
FT                   LDAFMEKPTSMNLPFMPFLVSMVSFTSDARRAWDWRNAIKVVAVLTAKVV"
FT   CDS_pept        147947..148945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0176"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0176"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93044"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM92"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93044.1"
FT                   /translation="MFDAFGDAQEVTREMLLEQAELIHTISDKCQSTGLFLDSQARFNQ
FT                   FVQEIEADDKVEDRLLHAWCWVIDRIVKAPTSFHMDGAVILTMPLVAKYLPPVEREPET
FT                   IVVNLDEDYKAPVGNQTLCELIMERRHWPQGATCATQEADGGVLYWDAPVDVVEEGRKV
FT                   AGKHGMMAEVGLKHQVDAWYADMDDIRLATDWNSSVITPHCLLLAYLDVLQKNKVPFDE
FT                   GVRLAAEWVTQLGGESREDTEEEPEAEATVLSLGRATAHCFKPYRRNNMRYQVFKTKEG
FT                   GQPVFTAPWYWLASTIANWSSLKWDVCRIVDSKVNETRFCWAKALPAEKNN"
FT   CDS_pept        148955..149488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0177"
FT                   /product="Micrococcal nuclease (SNase-like) precursor"
FT                   /EC_number="3.1.31.1"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0177"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93045"
FT                   /db_xref="GOA:D3VM93"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM93"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93045.1"
FT                   /translation="MTMTMGFVKKTGISAFLSAMLVLAPHVWAETFTAKVVGVSDGDTV
FT                   KVLTEQSCDTGKDCRSGKVQYRVRLAEIDTPEKKQPYGSKAKQALSDLVFGRMIKVEQI
FT                   DKDRYGRLVANLYVDGKWVNAEMVRSGSAWVYRQYAKTPELFKLEAEAKADKLGLWALP
FT                   ESERTPPWEWRRKH"
FT   CDS_pept        149546..149818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupB"
FT                   /locus_tag="XNC1_p0178"
FT                   /product="DNA-binding protein HU-beta, NS1 (HU-1), plays a
FT                   role in DNA replication and in rpo translation"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0178"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93046"
FT                   /db_xref="GOA:D3VM94"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM94"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93046.1"
FT                   /translation="MNKSELIMKVAEDADISKAKAEAAVNALINSVTEELKAGGTVALT
FT                   GFGTFQVKERAARTGRNPQTGENIQIAAAKIPGFKAGKGLKDSVN"
FT   CDS_pept        149904..150200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0179"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0179"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93047"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM95"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93047.1"
FT                   /translation="MVRLSSTQNDVLFILYAIEAGGKAQPVPGVKILEMINSSRHSGIH
FT                   GTNFRTSCHTLVENGLLSKYRNPSLKLAFKLTEDGRERAGEIYRKRLEEDQEK"
FT   CDS_pept        complement(150229..150540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0180"
FT                   /product="Helix-turn-helix motif"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0180"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93048"
FT                   /db_xref="GOA:D3VM96"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM96"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93048.1"
FT                   /translation="MNVMARTLDQMLATEKPDVVAKAQKAATEMLLNIHLAELRSRMKI
FT                   TQGEIAASLGVKQPTVSDMEKPGRDLKLSSIKRYVEASGGKLRLDVELPDGTHYGFSV"
FT   CDS_pept        complement(150537..150887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0181"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0181"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93049"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM97"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93049.1"
FT                   /translation="MWAIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYAD
FT                   TVNGSSYSNMKELRVQSKGDPLRAFFAFDPKRKGILLCAGNKTGDEKRFYEVMIPIADR
FT                   EFAAHLDKLKKE"
FT   CDS_pept        151327..151521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0182"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0182"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93050"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM98"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93050.1"
FT                   /translation="MDEKITYEEMIEQLDQKGIRVTNGARRLYVALNNGVKAEVLGNCG
FT                   PATISLVDGIIVVEEQTLH"
FT   CDS_pept        151493..151903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0183"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0183"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93051"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM99"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93051.1"
FT                   /translation="MLWKSKLSTKGSSMGKKVHIICGKCGSDEMNFVINEHCPDDPQNV
FT                   ASMSCSNCCELTGIAEWSEFNGRELKGEAVALSASASVNALLGLLRQAMDSVEYRLYGG
FT                   DMSLSGYDAAELIDLQERAEKALSALRSDQHE"
FT   CDS_pept        151887..152366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0184"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0184"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93052"
FT                   /db_xref="UniProtKB/TrEMBL:D3VMA0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93052.1"
FT                   /translation="MISMSDLYEPLEFVFCGFRKGDAGLFISVATLRDGVLGREMYFSK
FT                   AKSKRRWVVGGIYSGASFSDSGAKGLDDARYVKAWEVQGDKIEWQAKSEQAEALARSEK
FT                   LEADDRKRNELEEVMLPIRKQYGALTKRRDRAGAAALEEAVLRALRAPIRKAEEK"
FT   CDS_pept        152595..153149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0185"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0185"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93053"
FT                   /db_xref="GOA:D3VMA1"
FT                   /db_xref="UniProtKB/TrEMBL:D3VMA1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93053.1"
FT                   /translation="MLCHRSRTHLCRYIWDRCTFGLHPDGTIFCYRLRCAGRCVSAKGK
FT                   LVLLCAGRERHLWVEKTMIVKSVFVWLKAGAILAFLFIGIIGAANRVYWVNSEGLSQGA
FT                   MSSALVIEKFGLDLGEMCRYDKPQHVEFKVLYDQTIQFRCSWFEGGGLTLWPFYTEHNV
FT                   NSAEATSVFNGIFQSMEGHDE"
FT   CDS_pept        152653..152784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0186"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0186"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93054"
FT                   /db_xref="UniProtKB/TrEMBL:D3VMA2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93054.1"
FT                   /translation="MGFILMAPFFVIALGVLVDAFLPKVSWFFCVRDVRDIFGWRKR"
FT   CDS_pept        153088..154392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0187"
FT                   /product="putative DNA methyltransferase"
FT                   /EC_number="2.1.1.113"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0187"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93055"
FT                   /db_xref="GOA:D3VMA3"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR017985"
FT                   /db_xref="InterPro:IPR025745"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3VMA3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93055.1"
FT                   /translation="MPKQPLCSMVSSRVWRDMMSNQLELFHVQEAYAKADKPLSNDELY
FT                   DSVAELAGIPKSALNEQSEIGKAKVKRSKLKRQIRWYQQTLKSMNLLQKVDGERGVWEL
FT                   SSKTKKGLHEALGGVRLVAYSTNLGLAVWSNNKSFFSDLDEPVHLCVTSPPFPLRIQRG
FT                   YGNVDEAKWVDFITQALEPIVKNLVPSGSVVLNVSNDIFEAKSPSRSLYVERMVLALHD
FT                   RLGLSLMDRWPWINLSKPPSPTQWACVNRYQLCSGWEPVYWFTNDPDRVRSDNRRVLIP
FT                   HTEKHQKLMAQGGDSRVVSYGDGAYRLRGNAFSNVTEGRIPKNVIQRGHRCADTLELRR
FT                   IAKELGLPPHPAMFPTDIPEMAIRFLTEEGDLIVDPFSGSNKSGLAAERNNRRWIACDI
FT                   ILEYIRTQAEMFTGFDGFWMNPAIGMVGTGVGQYS"
FT   CDS_pept        154338..154589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0188"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0188"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93056"
FT                   /db_xref="UniProtKB/TrEMBL:D3VMA4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93056.1"
FT                   /translation="MDEPSNRNGRNWSRAIFMKRDLLESIGLDASPLELAAKAVLREEL
FT                   DRVEVHPCDEGDDVVAARHLTQEMKILLSALTGYKLSN"
FT   CDS_pept        complement(154605..154760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0189"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0189"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93057"
FT                   /db_xref="UniProtKB/TrEMBL:D3VMA5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93057.1"
FT                   /translation="MTLAITKKTIGIYQPLIVKPPATQSVSNADTEAINAMRRTFVTFI
FT                   QTSFCY"
FT   CDS_pept        154847..154951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0190"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0190"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93058"
FT                   /db_xref="UniProtKB/TrEMBL:D3VMA6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93058.1"
FT                   /translation="MSAQQLAALLDQPLWKIERALAALRAKGLIETNK"
FT   CDS_pept        154964..155182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0191"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0191"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93059"
FT                   /db_xref="UniProtKB/TrEMBL:D3VMA7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93059.1"
FT                   /translation="MILSFLDFLMIALIVRGPELLRLFVEVSQFGCRFDKAQYALACDD
FT                   HANFHYKEKPCVWFRAKLAVKAFVLNK"
XX
SQ   Sequence 155327 BP; 42778 A; 34386 C; 37027 G; 41136 T; 0 other;
     cggcctttat ggccgttttt tgtttcaagt ttgttttaac agaaccataa ttagatattg        60
     cagtatcatt ttatggtatg tacaatcttt cacatgtgaa agtttggggg tggtataaat       120
     cacctgaaag aaaccaaaaa tgaggtgggt atggcaaaag taatcagctt cgccaaccag       180
     aaaggcgggg tggggaagag taccctctgt atccaacagg ccttttatct ggcgttacag       240
     aagaaaaaga aagtgctggt cttggatatg gatggtcagg ggaatacatc ctctcgattg       300
     gcccccagac gagagctgga ggatggagac tatgagccta tcctcactgg aacaaaaacc       360
     gctgagctgt tcgcttacga gctggacggc attgatgtta tgcactgccc ttgtggtgct       420
     gaccttattc atacaccgaa aaacgatcct gatttgtttg aaatggaggc tgtgcctctc       480
     gatcaagcaa tgaacccggc tcgccatttg gctgctcttt ttgagaacta tgactacgtg       540
     ctgattgatt gtccgcctag cctcggcaga aagctggtgg ctgcgttggt catgtccacc       600
     catgtggcat gtccagtgaa gctatcaggt tttgctgttg acggtgttga aggtctttta       660
     aatacaataa ttggtgttcg agaagcgtat aactctgagt tgaacattct tggaattatt       720
     ataaatgata tggatggatc agttaatcac gctaagtctt tgcataagtt ggaaaaagaa       780
     ataccagatt ttttatttaa aaataaaatt atgcaccgtc caccattaga tacagcaacc       840
     acggatggga tacctgtttg ggatctgcgt tacggacatg tcgcggccag agaggttgag       900
     gcggtgttag aagaaatttt agagaaggtg ggctaaacga tggcattaaa taatttgaga       960
     ggcctgtcgg atcttgctaa agctgccaaa ggcaagaaag gtaaagaagt tcttactgtg      1020
     ccagttgacg acgttgtttc caaagtccag gtgcgtaagc gcttccgtaa cattgaagag      1080
     ttggcagcga ctatgctgac cgaggggcag cagtctccta tcatcgtgtt tcctaagaat      1140
     gaggaaggaa agttcgtcat tcagaagggg gagcgacgtt ggagagcatg taaacatgca      1200
     ggtattgata ctatcgatct ggttgtcaat gataaggtcc agaataatct ggacgaaact      1260
     gctggcgagt tgatcgaaaa catccaaaga gatgacctaa cgccggtaga aatagccgag      1320
     gcattgaatc tgtttattga agatggttgg aagcaaaaag acattgctga tcgcctcggg      1380
     aaaaacatca ctttcgtatc tacgcatttg tcattgctaa agctacctga ctgtgtgcgc      1440
     gagttgtatg ataatgaagt ttgttctgat acagaaaccc tgaataatct tcgtcttttg      1500
     ttcgatatga acgaagaacg ctgccgtgct gtctgtgctg tggctatgtc tgacgggatc      1560
     acccggaaac aaagtcgtga gcttctgaac gatgccaagc gcatcaaaga agaaatggaa      1620
     aaaggccctc tgactggctc cggccacaat gatgaacctg gtgatggaaa taccgatgac      1680
     caaaccctaa actcaaatgg gaatggtacg gaggaacaac tgggtaatgc cgagcagaac      1740
     cataaccaga atgtgttgga agacggttca gaccgtgatg gtctgaatga cgatgatttg      1800
     gaccctttgc gcgatgaaga ggacaaagag cctgtccagc agcctattaa cagcggaaag      1860
     aacaaagatg atgaaggtgg tgatgctctt cctcctctgc cgaaggacaa agagtggaag      1920
     aatgtccgag ccgacagttt ggttattgct gtcaacgtta acctggatgg tgaaactaaa      1980
     cgcggagtca tcatgacaga ccgtgtggct ctggttccat ctactgtctg ggtcaaaacg      2040
     ctcgatagtg aaggaaagga aaagcatgtt catgtgcctg tgtcagacat tgaactcctt      2100
     agtgtcgaag gctaacaaag gaggcccagc caaaaagggt gggcctgtca agaacaggtg      2160
     aatatgaaga tctcacagga catgaagaga aaatttgctt tggtgaatgc cctgtctaaa      2220
     acggagaagc caagtctcca ggaccttcac aaggcgacaa atattcctga atcaacaatc      2280
     aagaggcagt tggctgcttt gcgtgatgag ttcggaatga atatcttgtt cgtcagggaa      2340
     tcaaccggcg aacgtggtgc caccggctac tacatgttga cagattgggg gatcttagac      2400
     aggtcttcgt tcttgaaccg gtacggaaag ctgtaaggtg ctatcgcgca gcgcattgaa      2460
     tggaaaaccc gccagtagcg gtttttttta tgcggccacg gtggcggcgg gtgctggagg      2520
     tttctctgcg tagtaggaga tattcttggt tcgtctgctg agggggtcta tgccgacgat      2580
     actcagcgtt tttggcgtgg tgtcacggga atcgaaataa tggaagagct ggagcataca      2640
     gcacttcacc attaatggat cgatgtcttc caggtagatt gaggcttcgg ccaaggcctc      2700
     agggcctttg ttctcgatca ggttttccat ccagtgaatg gcgttgatgc cggagccaca      2760
     gcagggctca tagaagtctg tcgaagactg tgagccaaca atgagtgaca gcaagcggcc      2820
     aatctctgga ggggtgggga agtagttggt gcctttcttg tggaagctag acatgctcag      2880
     gacgtagcca agaacatcgc tggtgggatc acgcttcatt gccgcagaca ggacatggga      2940
     aagctcgaag gcgaccggct gtagttcctc cgggatctcc tccttggctg ggtataggcc      3000
     agtctgcaaa taagcccatt ggtcgataaa ggcctcaaca aactgagaag tgcccattct      3060
     gtaacgggac tgctcaatga gagataaagc cttggatgta agttgctgtg tttctggtga      3120
     cataagcgct ccagtttgtt ctgacgaaac attcaagagg tagaaacgaa gaaccccgcc      3180
     gaagcgaggt tcttagcttt cctgattgcc ttagtgccga agcaaagacg tcttgataaa      3240
     gtcgggacaa ccggacattt cccggtcgat gaagtcctga cgtttcgcca gcggccattt      3300
     catgaacgcc gcgagcggga tgcgcttatt cgtgttagta ttgccttgca gcataacaaa      3360
     gctccttaat agcttgattg tgttgtaagg gctgcaacga aggtagaaga gcgatgcggc      3420
     ccttatttat gattattaca gcatcataaa ataatatcaa gagtcaataa aacgatacta      3480
     agaataataa actttcacat gtgaaagtat tctaatcccc aatctagtgt gatccccacc      3540
     tccaaataac ttgttcttct tcccaaaatg ggcgtgtcag cgtcccattt aaagtaattg      3600
     ttagtgagat attgactaca cgaaatatgc ccatatcata aggtcataaa atgatgctat      3660
     gaaagtgagc gatatgccaa agacagcaaa tcatctccgt ttgaagaaac cttgcgccaa      3720
     ctgccctttc cgaaaggaag gggctatcga acttgcccct ggtaggttgg aaggcatcat      3780
     caacgacata gttgaaaacg atatgacgac gttccactgc cacaaaaccg tgcattcaaa      3840
     gtacggtggt gaatgggatg aagagggcaa ctatgcacct tcgggacaag agtcgatgtg      3900
     tgccggtgcg gctgcttatt tgatgaaaat gggcaggcca acagtagcta tgcggatagc      3960
     gtttgctttt ggtgacgtaa aggtgcccga ctgggacgag gctcaatcgc tggttattga      4020
     accgttggtg cttgggagcg gaaatgagta agcaatacgc ggtagtgccg catccaaaac      4080
     tgaaacgaga gtacaaaggg agactggtca gaactacgcg ggaactgaaa aatggttggg      4140
     gaatgattcc tctaggggca gtagcaactg tctcgcacca gtctcagaag ggatcagaac      4200
     tgacctttga accatgcgac tgcgtctccc atgtctagag ttcctatatt cgtgagagca      4260
     atgcagcgcg gagcattgtc tgtgtatacc aaagataaaa ataatgcgta ttctctgtct      4320
     gctgccggga aagcgtttgt ttctcagctc cacaaaaaga cgtttgatcc agacttgcca      4380
     ttccgaatta atgactggtt aaatagaggt gattatgatg cgatgtctcg atatataaga      4440
     acggtatttg gcaggcaaat taggtttcaa agaaatttag gcaattgaaa gcaggggcca      4500
     taaggcccct tttttttaat cttctaaatg cgagcagttg agttcggata gcacattttc      4560
     gtaggcgcta ttttcatttg ctttccgcag ttctaccatc tctacaatga atggggttag      4620
     agccaaagat tgtggctccc agatgcgatt acacatatcg gccatgtggg catttacatc      4680
     agtaatgacg taaataaatt caggaagatc ttttagacct cccaaagcct ttgccatatc      4740
     aactgcttcc gtggtccggt agctatgatt acttttaagt ccagaagtga gaggcattat      4800
     gttttgtgct aaatagcttg ctgacgccgc cattattcca gatgaaatac cttcacctgt      4860
     atcttcggta atggctgaac ttgtggttag tatggtagct aggatgattg atccgaacat      4920
     agttaattcc tcattctaag tctgattttt tgaaaggcat tgtgcctttg cagtctggat      4980
     aagcggtgca accccaaaac ttagaggctc gttttttacc tggtgctttc ccttttctaa      5040
     ggcgcatcgg gctaccgcaa tctgggcagt ctgggcaatc ctccgcagcg atgcgcttct      5100
     ctggtttacc tctattatca gggaatgtct ttttacaagc ctcgttctga caaccccaga      5160
     agaagccgtt tttacctttg attcggtgca tctctccacc acagttaaag cattcgtgtg      5220
     agggaggttt cgcgccttca aatgccttag ccatcgcact gccttctttg gtcagaaccg      5280
     gtgcggccac tttgagctga tcgaccatct ggcaaatcca ggtggaaatc tgtttcatga      5340
     agacagacat gtttccggag ccagtggcga ctttttcaag ctcttgttcc caggccgcag      5400
     tcatgccagg tgacttgatt gctggtggaa gcacagcgat aagtgcatga gctttatctg      5460
     ttgcaagcag tacctttttc tgacgcttga aatagccttt atctacagtt ccctggatga      5520
     tgctggcgcg tgttgctgga gtgcccagac cggcggtgtc tttgaggatc tgcttaaact      5580
     tctcctcagt cacaaaccgg gcaatgttct ccatcgcggc aagtaatgtg gcttctgtaa      5640
     agtgtggtgc tggccgcgtc attttgttca tcagctcagt accattgagc aaggcaggtt      5700
     cgccctgact aaccctgggg agcttctcct gttcaaccgg cgcgtcggta tcttctcctt      5760
     catccttggg gctgctttcg ctgtcagaag caaacaaaac cttccagcct tgtttggtcg      5820
     gagtcttacc ggaagctgca aagaggtgac gtccacactg cacctcgatg gaggttttgg      5880
     tgaactcgaa ctcactgtag aactgcgcga tgtagaaacg acgtatggcg tcgtagagat      5940
     ttaactcgat ctcagacatg gcactgatgt ctgttcttgc tggggttgga atgatcgcgt      6000
     ggtgcgcggt cactttagag tcattgaata ctctggcttt gcggtgagga tctgcgccag      6060
     ctaccagccc tgagacgttc tgatcggaca aaataagcgc ctgtaggatg tcaggaatgt      6120
     cttccttttg gctctctggc aggtagcgac tgtcggtacg agggtaggtt gttgctttgt      6180
     gtgtttcata cagagcttgg gctgcatcaa gcacctgctg agcagtatat ccccatcgtt      6240
     tacttgcgta ttgctgcaat gaagtcagat cgaagggaag gggagcagac tctttgcctg      6300
     gttttgtctc tgccttgctg ataactgcat tggcaccgtt gacctgagag gatacctgct      6360
     cggcataggc cttattgata catcggcctt gttcgtcact acactcctct ggcggtatcc      6420
     actgagcggc aaactgacca ttctgcacgg atacgttcac gcccagagtc cagtatgggg      6480
     atggtgtgaa acccgcgatc tctcgatctc gttgacacac gagagcgacg gtaggtgtaa      6540
     tgacccgacc tacgtggagg gtatgattga aacctacatc tcgcgccaat actgtataga      6600
     gtcggcttac gttcattccc accagccagt ctgcgcgttg ccttgctagt gcagcgtagt      6660
     atagcgagac agtttctttg ccgtccttaa cgttatttag cgctttctta atgctcgact      6720
     catcgagtgc agtcaagcaa acacgacgaa taggacctga gtagcggaat tgatccaaaa      6780
     gcgaacgagc gatagcttca ccttcgcggt cgaagtcggt agagatgtag atggtacttg      6840
     cttttttgac taggccttca acgattttgt actgctttag cgcactcttg cgaacgttgt      6900
     accgccaggc gtcaggagca atgggaagag tctctagtga ccatgactta tatcgttcgt      6960
     catagtcatc tggcatatac aattccagaa ggtggccgaa ggcccaggta ataactctgt      7020
     ttcctccatc atggataaat ccatctcccc tttgggaggc tttcattact cctgccaagt      7080
     ctttggcctg agaaggcttt tcgcagatat aaaggtccat taagcagctc ccttcatctt      7140
     tgattccaga ttcgccagct cggtccagtt ttgggcaaga acttttattt cgggatagtc      7200
     tctggaaagg ttttcgagga ctccagaaat gacataggcc gcttcgtggg tattacccct      7260
     cgaaccagcc tcctggagca tgattgataa agcgtcgaag agctctgcct tacggcccgg      7320
     ctctatgtgg tttattattt cagagctttg catgggttca ccactgaata gggacgcacg      7380
     gattcgcgca caatgcggcg gtctgcgtcg gttacagcct gactggtaca aaagtgcgtc      7440
     caggcattca ggtaatcttg gtagttatga gtgggcggta tgcagccagt cacaacgtcc      7500
     tggggaatgt tcgtggcacc ttcaccctca ataaagcgcc aatcgtgctc atccatgccc      7560
     ttgccgctgt cgcaatagcg ttcccagcgt gacagctcat acagcgagta gcctttacct      7620
     ttgttcatgg acttgaaggt attgatggcc tcgcctacat ctccctgttg ctttattcca      7680
     accggagttt taacggcatc agtggaatta tctttggctt tgttgatcgt tgcgctgaca      7740
     ttaccgtcgc ccaatacatg gatataaccc ggttggcgta atgccgcacc accgcgcccc      7800
     atattgtccc atgcgataga aagttcacgg ttaactcggg ccggtttgtc attctccgca      7860
     ggggatatct gggattgggg tttttgttca ggggcgttag aggcacaccc ggccaaaatt      7920
     gctaccccca gaattgctat cagttgtctc atcgtgtcat tcctcatcaa aaattgtcga      7980
     tgaacccatt ctaaaagggg gagatggaaa gctggtttct caaactgccc aaattggaca      8040
     gataggcgtg tgtgcgatct aaacgtgttt tgagagcatg tactgacgaa aaatacgata      8100
     ggaatatggt caacctacat gctgaaagcc ctgaacaagt tatttggtgg gcgaagtgga      8160
     gtgatcgaga ccgcgccaag cgccagagtg ttgccgctta aagacgtgga agatgaagaa      8220
     atccctcgat acccgccttt tgccaagggc ctgccagtgg ccccactaga caagatactg      8280
     gcaacccaag ctgaactaat tgagaaagtg cggaactctc tcggtttcac tgtggacgac      8340
     ttcaaccggc ttgttttgcc ggtgatccaa cggtatgccg cgtttgttca cttgctgccc      8400
     gcttccgaat ctcaccatca ccgaggagct ggtgggttgt tccggcatgg gcttgaagta      8460
     gccttttggg caactcaggc atctgagtcg gttatttttt caatcgaggg aacgcctcgg      8520
     gaacgccgcg acaatgaacc gcgttggcga ctggcgagtt gcttctccgg gctcctgcat      8580
     gatgtgggca aaccgttgtc agatgtatct attacagata aagacggatc gatcacatgg      8640
     aatccttatt cagagtcact tcatgactgg gcgcaccgtc acggaataga gcgttacttt      8700
     atccggtggc gcgataagag acacaaaagg catgagcaat tctcgctgct ggcttggcat      8760
     cgaattattc cggctgagac gcaggagttt ctttccaaat cagggccttc cattatcgag      8820
     gcgatgcttg aagctatttt gggaaccact gtcaatcagc ctgttattgc ctatgttggc      8880
     cgttgagcca gaagagactt ctgccacaac agaaatgtca caagcgaaca aacctaatca      8940
     acaggaaaag gacgctaaga cattactgtc tgagatgctt gctggctatg gcgaagcatc      9000
     tgctctgctt gagcaggcga tcatgcctgt tctggaaggg aaaaagacgc tgggagaggt      9060
     tctatgtctg atgaagggcc aggccgtcat cctataccca gaaggtgctc ggtcattagg      9120
     tgcgccgtca gaagttctct caaagctatc ccatgccgat gcgattgttc cagaccctat      9180
     tatgcctggt cgtaaagtgc gagatttcag cggtgtgaaa gcaattgtgc tggcgcaaca      9240
     actttcagat gcagtcgtag cggccatcaa ggaagtagaa gcgtcaatgg gtggatacca      9300
     ggatgtcttt gagcttgtgt ctcctcctga ttctgatatc agaaagagca agtctgctcc      9360
     gaaacaacaa agccaaccga tgcagaaaaa aaaccaacaa cagaagtctg atgctggatc      9420
     aggtcaagct gcaccggcaa aagacacgaa aggaaaagct gatcagaaac ctcaaaagga      9480
     gaaaaaaggt gacacctcct ctgtggttga ggggcatgaa atcaagccga ttgaagaaaa      9540
     acagaacgtg gctcgccttc ccaagagaga ggctcaaccc gaagctgttg tagttaccaa      9600
     agttgagcgt gaaaaggaac tgggtcacat cgaggtccga gaaagggaag agcaagaggt      9660
     gagggagttt gaaccaccaa aggctaaaac aaacccgaaa gacatcaaag acgaagactt      9720
     cttgccgcct ggtgttaccc ctgagaaagc gattttgatc ctcaaggaca tgatccagaa      9780
     acgctcgggc agatggctag ttacacctgt tttggaagaa gacggctgct tagtaaccag      9840
     cgataaagcg ttcgacatga ttgccgggga aaacatcggc atcaacaaac acatcctctg      9900
     cgggatgttg agccgggcac aaaaacgccc tttgctcaaa aaacgtcaag gaaaattgta      9960
     tttagaggta gatgaaacat gacaatgagt tatgacccgc tcgcctacga gatgccgtgg     10020
     cggcctaact atgaaaaaaa tgctgtggca ggctggcttg cagcctccgg tgctgctttg     10080
     gccgtggagc aggtcagcac tatgcctcca gagccctttt attggatgac ggggatctgt     10140
     ggtgtgatgg caatggctcg tttgcctaag gctatcaagc tccatttgct gcaaaagcat     10200
     ttgaggggcc gagacttaga gtttatctcc attacggagc tccagaagta catcaaagat     10260
     acgccggaag atatgtggct tggtagtggg ttcctgtggg aaaaccgtca tgcccagcgc     10320
     gtgtttgaga tcctgaaacg agattggacc tctatcgtcg gaaaagaatc gacggttaaa     10380
     aaagttgttc ggaaaataca gggtaagaga aaagagttgc caatcggcca gccctggatt     10440
     cacggggttg agccaaaaga agaaaaactg atgcagcctc taaagtgtac tagtcgcgac     10500
     ttgatctgac agttacccac tttgttatcg gcgactgtca gattatattt gggtcaaatt     10560
     tttttctgcc caaatggatt tcccatcctg aagggtttct attggtgtcc ggccgcaaca     10620
     catttttcct tgatgagtgc ggtgattgtt gtaattgtcc atccatttgt ccagatcttt     10680
     ttgtaactca tccaatgagc catacaattt ctttctgaac gtcacttgat aaaattcatt     10740
     caggatggtt ttgtgaaacc gttcacagat gccattggtt tgcggtgaca tcgcctttgt     10800
     cctggtatgg tcgatatcat tgacagccag atacagttgg taatcatggt gctcaacacg     10860
     cccgcaatat tcggtgcctc tgtctgtcag aatacgtaac atcggcaatc tatgagcgct     10920
     gaagaacggc agcacacggt cattcagtaa atccgccgcc gtaatgggcg ttttactcgt     10980
     atagagtttc gcgaaagcca ctttactgta agtatcgacg aaagtttgtt ggtacaagcg     11040
     tcccacgcct ttaagattac cgacataaaa ggtatcttgc gaccctaaat agccaggatg     11100
     agcggtttca atttcgccac aagcttcgtc atcatgctgc ttacgttcaa gggcggcgac     11160
     ctgctcgtca gtcaggataa tgccttcgtc agccactttc ttttcaaggg ctgccaggcg     11220
     ctttttgaag ttctcaagat gatgtctgag ccagatagaa cggacaccac tggcagacac     11280
     aaagatgcct gcttttctga gctcattact cgttctggcc tgcccatagg ccgggaattc     11340
     gatggccgag ttgataacgg cgtgttcggt ctccgcatcc acacggttct tcagattagg     11400
     ggtttttctg ctttggttga ttaatgcatc aatcccgccc gtttcaacga gttcctgata     11460
     acgataaaac gtatctctgg atacgcccat cactttacag gctctcgaga cattactgag     11520
     ttcttcagcg agattaagca gacccgcctt gtgtttgatg atgggattgc tagtataaag     11580
     catgagagtg acctcttagt ctttgattat ggattcatca cctttaatca aagtcggtaa     11640
     ctctcttctt ttcaaactga agtgtcagat ctggtctgaa ctaatacatc taaagcatac     11700
     agaggggcac actctaattg tagggaccac cggttcgggc aagacccgta tgttcgacat     11760
     cctgatctct caggccatcc tgcgcggtga agctgtgatt atcatagacc cgaaaggtga     11820
     taaggagatg cgagacaatg ccagacgggc ctgtgaagct atgggacaac cggaaaggtt     11880
     cgtctcattc caccctgcat tcccagaaga atcagtgcgt atcgatcccc tgcgaaattt     11940
     cacccgtgta acggaaatcg caagtcgatt ggctgcattg atcccctcag aagaagagcg     12000
     ccagaaatcc aaaggtatgc aggacatggg gaagggctgg ttcgcgtggg ttaagggccg     12060
     catggaggcc tttgttaacg tcatttacca gttctatacc agactggcgc tgttggccgc     12120
     gtgggctccc tatatgctca tcctgtttgt accggctgtg tacgacggga tgatgacctg     12180
     gcgcatcaaa cggaccaact tcgactacgc aagcccagtt ttgcatcgct atagcgttcg     12240
     cggaacaatg tacctgatgg ctggtttgtt catcgcattc ttcatcccta tagcgctcga     12300
     tccggttgtc attccactga caatgatgac ctgttgcgtt ctggtaggtc tgacgttcgg     12360
     caacctacaa aaacgggtat aggaggggta atgagctact ccgttttaaa tcaagatggg     12420
     gtgcatctgt gtgacattcc acggaatgtc tatcagttga tacgtcgcca gtccctgtca     12480
     gagttgtggc tttactgggt gcagattttg aatttggtta aggtgttaat tgcttgcgtc     12540
     gggaagatgg tctttgtgat gccggtagca tggttctggg tgctgttttt gtgcagcctg     12600
     gttgcaccag aacgaatttc tgacgtatca ggacttttct atccagatgt gatcgggtgg     12660
     gctgctggcg cggctatcac catcatcatt tactctgcat tcacacgacc agcaatgtac     12720
     ggataccaca acgtattcaa gcagcatatc tgctcaagag taaagcaaat aacgcccgag     12780
     gtcagaaccg tctcggggcc actgttcttc tacagaaacg aaattggaac gatatagaga     12840
     gaaaccatga acgtaaccaa gaaaattcat ctgctggcgc tgggattgtt tatgaccggt     12900
     actgccatcg ctgcacctga tgtactcaat gacgatgcaa agctcaaaaa ccttgagaag     12960
     gtgtgccctg actgtgaaat ggtggcaaaa gatgtgctca atcttcgggt tcaaaactgc     13020
     cagctaaaag atacctccag tgcaatgatg ataggaacta tgcaaaatga ccctatgttt     13080
     tcgtttatgc tggcggtaca cactgcggca ggctcggagg catacaaaac agtagttggt     13140
     gccgctggca accatgttga ctgtgaaaac ccgttgaact ggatcaagct gacccagcaa     13200
     gcaattaaag gaggcaaagt ctaatgcgta agagagattt cttttttgga gaagtgtatg     13260
     aggggagtgg agtagccact ctacgactga gtgatatgga gtcattggca aggaaagtgt     13320
     cagcagagtt cttcaccgca caactgaacc gtatgttgaa agagcatgac ggtcagttga     13380
     cgctcagcga tggaacgtcg taccccagct tttggagttt catcgacaag gttgatacca     13440
     aacaggttgg ctatgtggaa atctatgctc gtcaagatgt caacgataat gtggaagcaa     13500
     cgctggcttg tgacatcgtt ttggttaatg gcgtgatcac cgtgaagccg cactggtgtg     13560
     cttacaagga catccgggct gacgaagtga tttccacctt actggtgcct ttgcacttga     13620
     aagctctcca ggataaggct tacattcgct gggatgatgg tgaaaccgaa cctctgttac     13680
     aaaacgacta ctatcaggct gaacttgaaa atgtgtttag tgtttccaag tacccatcag     13740
     ccatgagctg gggcgataca gcagaccaga aggttaagca gtacaagatg gaccttgagt     13800
     gcgccacaga tgttggtcgt cgaggtgtct catcagagca agcatgggat gcttatcgag     13860
     aactccggca caatagaaca atgtgaaaca agcggccatt ggccgctttg aactttcaca     13920
     tgtgaaagtt tttcgcctcc cgctcttatc atctcctcga ataaacctcc ataaagtgcc     13980
     caaaatgggc cgtaacagca ctgtgcctgg attgctcaat taagagacga ttactccgtg     14040
     atgacgacaa gttatttgga gggtctatgt ccgcacaagc tcacgtcaga gaaagcgaaa     14100
     gctcatctgg ttcattcgtc tcctggcagt tccttgtatg gcaggtgatg ttcgttatag     14160
     gtgttgttgc agggatgaac ctggaacacg catttaattt tcttggttaa ggggagaggt     14220
     cgtgaacgtt aataaacagt ttttctggtt tctgatgaac gtggtgctta tgtgcattca     14280
     agctcagcag atcaaaaacg accgagtaac catgaggttc gagccgagat ttgttgagta     14340
     tgagcccaag agcgacaagg tttttgtcta cggatattcc tatgtcaaag gggcttcttc     14400
     taacgaggaa cgtagcgaac gctcctacga gttcgctatc aaaatttcaa actacgcgcc     14460
     cgtgctggac tacatcgaca cctatgtagg aaagccacgc accaaagctg ttttggagca     14520
     actccagcgc aaagaagaga accggagaaa gaatgaagaa caacgctaaa atttcgcttc     14580
     tggcgctgtc cttggcgctt ggaacatcaa tggcctatgc ctcggatgat attcctgttg     14640
     tcccggcaag cgttatgaaa aaagacgttc cagcccctgt gacgtcggga caaaacgcca     14700
     gtgaagtagt gggtcatgta aatgaaaacc ccatgctgac gatgaaaccc ggcgtaaacc     14760
     aaataatccc tattgccatt ggtcatccca atcgtgttgt aacacctttc agtaatccgg     14820
     agattgtctc cacttccctg actggagcaa acgaaaacgg tcaatgcggt gaggtttgta     14880
     tcaaagagaa cgtggtctat gtcgctacgg ataaacaata ccctgtgact atgttcatta     14940
     cggaaaaagg ctcagaagcc caagcattaa gcctgactat ggttcctcgc cgtattccgc     15000
     ctagagaagt atttctcaaa ctcgatggtg gtgtagggat cagtggggca tttgctaatt     15060
     ccaaggctga ggcttgggaa cagagccagc cttacgtcga aactatccgc tctgtgttca     15120
     ggaaaattgc catcggggaa gttccacagg gttacacgtt gaaccgtatc cctgccggag     15180
     ctgctgtacc tagttgctca caccctggga ttaaggtgga tttcggcaaa gggcaataca     15240
     tgatggggca tcacctgaat gtattcatcg gtgtagcaca gaacgtttct gaacagccta     15300
     tcgagttcaa agaggctctt tgtggaagct gggatgtcgc tgctgttact acgtggccgc     15360
     tcaacgtgct tgagtccggc cagaaaacgg aactctatgt agcgaagaaa caaaagcggg     15420
     gaattgctcc aacgtctaag cgtccttcgc tattgggagg tggtcaatga tcaaacgatt     15480
     ctggactgag ctagaccccc aaaagaaacg ctgggtagca attgctggtg gtctattcgt     15540
     tctttttgca gtagtgacga tgttctctgg tgagccgaag aaggaagaaa aacgtggtag     15600
     gcaagaaacc atcaagcatg ttcttacaga caaaaatacc cgtgagatcg ggatagattc     15660
     gctgtctgcc gatgtgaaga tggtgtctcg tgagaactca gacctgaaaa aggagctgga     15720
     gaaagtcaaa agagagctgg agcaaacaaa ggatactgcc ggtaaatcca gcgatgttgg     15780
     cagagagatt tctcgtctac gccaagacct tgaccgccta acccagaaaa atatggagct     15840
     gtctaagaag gttgaaactg gtgaggctgg tggaaaaaca gcttcttcaa caggggatgc     15900
     cagagccgat gttaatggca catcagacgg tgaaggtcag ttcatggaga aaaagctgga     15960
     ctacaaagat ccggcatcat ttttccgtga cgcaccactc ccggactcga agggtggagc     16020
     tcctgcaaca ggcaaaggtg atggccgtga tgccaccaaa tctggtattc aaattgtgag     16080
     ctactcacag aaggcaccag aagttgaagc gaaagacgac aaggatgatg agtccctcta     16140
     tctgccgtct ggctccatcc tgacaggtgt gcttatcaac ggtatggatg cacctacttc     16200
     ccagggtgcc cgacgagatc cattcccttc aacgcttcgg attcagaaag aagccatatt     16260
     gcctaatcgt ttccgtgcgg atgtcagaga gtgcttcctg attgtttcag gctatggcga     16320
     ccttagttct gaacgagcct acctacgtgg tgagacattc tcttgtgtcc gggaagacgg     16380
     ggggataatc gaagcgaggc ttgactctta tgcggtaggc gaggatggca aggctggtgt     16440
     tcgaggccgc gttgtatcga agcaagggca gattattgcc aagagcctga tggcaggatt     16500
     cctcggtggc gtgtctgagg cctttgatgt taatcctgtg cctgttgtta acactaaccc     16560
     tggctcaaat acccagtatc agtctatttt ctctggccag atgttgcagg gggccgctgt     16620
     gaagggagcc agtaatgccc tgaatcgtat cgctcaattc tatatcgaca tggccgaagg     16680
     catctttccg gtcatcgaag tcgatgctgg ccgccaagta gacatcattg tgaccaaagg     16740
     caccaagcta caaattcgtt ccactggggg caataagaaa tgaaaaattt gaacattttg     16800
     accagaaagg gcagttccag aggaaaggct caaaaggaac aggcagtaag atcagcaaag     16860
     atgttggggg tgggagcagt tcttctagtt ctgtcgggct gttcctcgct caacatcggt     16920
     agcgatgagt atagctgtcc gggaatgccg agtggtgttc agtgtatgtc agcgagagac     16980
     gtttacgtcg caactaatga cggaaatgtc cctcgcccca tgaagcctga ggaagtcgag     17040
     gccaaagcgg aagcggatgg cggaggttcc tctgacgttt cagtgaactc atctaactcc     17100
     ggggattcgg ttatcgacaa ttatgtcgcg ccacgtcttc cggatcgccc aattccaatt     17160
     cgcacaccgg cgcaggttat gcggatttgg gtagctctct gggaggacac caatggtgat     17220
     ctcatcgtga cagggtatgt ctacaccgaa atcgaaccgc gcaggtgggt aattggggat     17280
     ggcacaccgc aaagtgagcc agttttgaga ccgctgcaaa cggtaacaca cgaaccgaag     17340
     tctgaaacaa ctaaatagga gatgttctta atgaacgtaa atcagttggc gaatgcctca     17400
     agtaaaaaca acacactctt cctcttcttg gggttgatgg tcgtagcctt cctgcttgtg     17460
     cctgatcagg cacatgctgg tactggtggt acagcgtttg acgacgtgtg ggtaactctc     17520
     aaggattgga cccaaggtac tctgggtcga atcgttgcgg gtgcgatgat cctggtcggc     17580
     gttgttggcg gtatcgctcg ccagagcctc atggcgttcg ctatggggat cggtggcggt     17640
     atgggcctgt acaattcccc gaccgtggtg gaatctatca tgtctgccac tctggaacat     17700
     gcagagaagg tcgtcccggc tgttgtgcaa ctcagcaatg gtctgggtct gtaaaagaca     17760
     cttcgccgtt aatgatagag tgatatgggc agcctaaaag ctgcccttat ttttttggta     17820
     tgtcccgtcc taaataaggt tgacactttt cttcatctgt tgaggagagt gttatgaaat     17880
     cagaaaataa acgcactcag cgtgattatt cactggcttt taaattagcc gttgttgatc     17940
     aagttgaaaa aggcgagatg acctacaaac aagcccaaaa ccggtacggt attcaggggc     18000
     gttcaaccgt tttagtttgg cttaggaagc atggtcagtt agattggagt ctgggttgta     18060
     cccctttaca tcctcaagga gttgccgtga cttcatcctc ctcactcacg cccgagcagc     18120
     ggataaaaga acttgaacaa caattggttg aaatggaaaa gaaagccgag ttttttgagg     18180
     cggtcgttga tgtgttgaag cgggattatg gagtgactgt cgtaaaaaag ccacgaggca     18240
     agtcatccaa gagaaaaaaa taatcggctt caatgtggct caatgctgcc gttatctgag     18300
     tattacacga caagcttatt accagcaatg tcagcgggca gctataaaag aaaaacagga     18360
     acaggaggtg cttaggcgag tacagtccat tcgcctgcag cagccccgta ttggcacaag     18420
     aaagcttcag tatctgctga atcaatcaag cccattaaaa ataggcagag acagcctatt     18480
     cgatttactc agaacccatc gcttactggt caaacccaga cgggcttacc acaaaacgac     18540
     gcagagccat catcgttttc actgtcaccc caatttactc aaagccggtc ccaataagat     18600
     aaccccaacg gggccggagc aagtctgggt ggcagatatt acgtatctgc ccgtgaaagc     18660
     aggagaagcg tatttaagtc tgattacgga tgcctggtca cgtaaaatcg tggggtatca     18720
     tgttcacgat aacttaagca caggctcggt cattcaggct tataaacacg ccttaaaaag     18780
     tcgaaaattg attgaacaat cgcttattca ccattcagat aggggattgc aatattgttc     18840
     aaaacactat caagcgctac atcagcacca tgagattatc tgttcaatga cagacggtta     18900
     tgattgctat cagcatgccc tggcagagcg agttaatggt atcctgaaaa ctgaattttt     18960
     actctgtaaa cccgcagacc tgaaagaagc ggcgaaaatg gtaagtgagt cgatagatat     19020
     ttataatcgg tataggcctc actgagcctt acactataaa acgcccgatg aagtccatca     19080
     tcaggcgtta agcaaaataa gtgtcaacgt atatcaggac tagacagtaa aaagtctagt     19140
     tataacaaat ctcaactctt tcctcatttg ctcaaaaagg gcactttcac agcccatgtt     19200
     tatgcacacc atcccgtaat ctccgatatt gggttcctgt aactcaaaac gaatggagaa     19260
     tgcgatgatc aattttaagc ctaaacttcc ggcgttgctt ggagctctgg cggttcttac     19320
     cgctggtgct gctcatgcag agttgctgga atataccttt aaggctccag atggtactca     19380
     acggtctctg cctccgaata ccaactacgc caacccgacg ggcaacgttt cgtttgcctt     19440
     gagtgccggt atcgaccgca aggtcaagat ttcggtactt cggtcggatg gaacagtggt     19500
     ttcgacagcg accagtcacc ttcttggggc tacagatcgc attacagtag gtggaaaatc     19560
     ctactatggt gcggaacttc aactaccagc tccggttgct ggtgcatatc tggtcagggc     19620
     ggaaattctt gcctctgatg gatctacagt ccagacagat gaataccctc tgactgtcga     19680
     tgttacccct ccaacctaca cttcgattgc acctgtttac agtaactatg gacaggtcac     19740
     tagcggtgat atttggaagc tgggtctagg tggctctgag gataatgcct ttttgctgtc     19800
     tggaatttct gatgagtcac ccatcaaagg cgtccaagca aagttgtatc gtcaagacgg     19860
     ttcactctac aaagatgtat cagtgaacta cgatgacgct aacggacaag ctagacagtc     19920
     tttccaatca ggctttttcc ccggctctga cttggatgaa gtgtttacac ttcagtttga     19980
     gataagcgat agtgctggga atatctatcc ttcgcctcgt caaaaagtga tgtttgatag     20040
     cataaccaat gctccgtcat caccttttgg tgtttatgac ccctccagca caaataattt     20100
     gggtccagga ttgtcgggat tcgttgctta tacggctgga atggctgtta aaaccaaccc     20160
     tatcaggttg gcttggcgag tgccgcgaga caactggcat gagtaccgag aaggcggaat     20220
     taagatggtc aacgccttag gtgaaatgac caaagttggt gaggatggta actatgttta     20280
     tctcgtcaca acatcgcctt atggaaatac tgacggcaac tattggcgtt gggtgaactt     20340
     cggccagtgg ggtggaggag gcattggtta taacctcact ctagctccat cagcgcccca     20400
     aagtcccaaa ctcttggggg tggattacaa ctacagcgac atcgggtggt caactatgca     20460
     ccgctactgg gtgaacagtt ctgttcttcc agtcactgtt agcagtatcc gagtcaaagt     20520
     tgagcctcgg ccttacattc aaactgctgt tcatcgggga agttgtgaga taccagttgg     20580
     tcaagataac tgtgtgattg aaaacagctt cactatgact aaaggaacaa ctgggtatat     20640
     ccatgacaat gctacggtct acaactctga cagatctctg tcttcaaatc ctatgtgggc     20700
     agaagttaac tggaacgacc agcactaccc tcagctaagt cagcaatacg atcaaagcag     20760
     caaggtattt accttgttcg ttaaccagcc aggacgaggc gcttactttg ataggctgcg     20820
     tctgcgaagt gcttggatcg aagatagtaa aggcaacaag ctgtccccaa ccggtgggtt     20880
     aatagccaac aactgggaga actacaccta ccagtgggat ctaaaaactc tccccgaggg     20940
     gcaatacagt ctcgttgccg cagcagagga aatgcacggg cctttaactc ggcaacccat     21000
     gtttcagatc acgtccgata gaactgcacc aacactgacg atcagtgtgg cagatggagc     21060
     tgctattcag actctggacg atgtggtcat tactttggct gatgctgttg atccttctcc     21120
     taagctgacc tctattgccc tcgtcggagg ccctgccgat gacaaggttc agttgtcttg     21180
     gcgcgaagag tcgaaagggc gattccgcct tgagtacccg gtaatgttcc cgtctttgaa     21240
     ggaaggggaa tcttactcgc tgactgtggc gggagaggac gcccaaggca acgcggtaca     21300
     aaaggctgtt ggcttcgagt acaagcctcg tcaggtgatg ttggcggatg gtatggatgg     21360
     gaaggtcatg attcctgctg tcacccatga atttgttcat gcggatggca aacggatcat     21420
     tgagactaaa ccgctgacgc tcagtgatgg tgctgtcgtg acaggttcat atgacgtgtt     21480
     tgcgactctc cgctctgatg cacaagtgcc gctggttgtt aatggtgttc gcatcgagcc     21540
     gggccagaca atgggaatca tgagccaaca tgattttggt gcatcaggtg gacgcttgag     21600
     tatccctgtt aaacctgctg tacctgatga ggtaggctct tccagccttc ttgtcatgac     21660
     ttctgcgccg aactcaccca tcctggttgt agacatcaat acttggaaag gtgcagctaa     21720
     actctctgct gagtcatgga caattcgcca ggttattgat ccggtgaaaa tctatgcctt     21780
     accagaactg ggagttcctt gccggttcac cacgaaagca gatgttgcta tggctgcaga     21840
     cccgattcgt gatccggtat gtttgctcca gtgggacaga actcctgatg aggcggaaca     21900
     aacgacacag gacaacaacg gcatgaaggt tgccggactg gtcgggcagg cggtgagcat     21960
     tggtgagcaa cctgtcgaat acagcctgta cctgttcagt ggtgatggct ccaaggtgaa     22020
     agttggttca ggctctcaga acctgacggt aactacagcc tatgattctg tcggctactc     22080
     acctattgat gatattgctc aggtgaatcg cgtcattgaa gattttgatg tgaacttcaa     22140
     gcagagcaaa ggtcctgatt gttctatcac tctaagcgct gaccgagcga aaaacgaggc     22200
     tgcgaacaaa ggggtgggga gtacaagccg aacctgtttg tttgagtggc agcagatccc     22260
     tgatggattg gtccaagacc agttatcgga gtcgccttcg ttgtctggct cattggctgc     22320
     gaacggagat cacccagtgg gctggcgggt aagtatattc acccgtaatg gcactcgggt     22380
     gacattgaac gaccagacgt tcaatatcga agctgttgat ccaccagctc cgaccgtgga     22440
     actgtcctct aagtacaact tcaaagacaa catttacatg gtgccgatga caggtaacta     22500
     cctgggtgat gccgttatca actctgaacg agctgatctg gatattgcca tctcgcgcaa     22560
     ctctgatgtt ttggagtctg aaacattcac tcctgggtgg ggtgccacca acaaggtgta     22620
     tcgtcgcatc aacaccgatg agcgagcttt gtgggaggag actacttaca aggtgaatgc     22680
     tgcgtacaac aaggtgcctg atgtaaaagc ggaggttgtc taccgagcta tagctgcacc     22740
     ttctgatagc atccggccta tcgttgaggt tcaaggtgac acggcgattg atactcaggc     22800
     cttgcctgtc cgggtactta tccgtgatca gtacaaacct gacggagact atgacgccaa     22860
     cacgatgggc gtatggaaag tacgtctgat ccagcaaaag gcctataacg agacagtagc     22920
     tctcactgat tatgcggaag catcaaatgg tgaagctcag ttctcggtgg acctatctgg     22980
     agtggataca acctctgtcc gtatttcggc tgaggctgtt ctggaaagcc ctgttgaggg     23040
     gtacaaccga actgagttgt ccattagacc cgctttcctg accgtactgc gtggtggtgc     23100
     catcggtgct ggagtagatg cgcgtaagct gtctggtgaa gctccattca cagcggtgtt     23160
     caagttatct cttgacgacc gtcaggacct tcgggctacc ggccaagttg tctgggaaac     23220
     cagtaaggat gatggcaaaa cttgggagca gttcatccca gaagatcggt acaagtacca     23280
     gcttgtgaag accttcgaca agggtgagta ccaggtacga gctaaggtgg tgaacgttaa     23340
     ctcgggagct gagaagtaca ccgaagtagt cagtgtagtc gcttatgaca aacctgatat     23400
     tgctgttgtc ggcccgacca cgttgttcgt ggggagtgag ggtaagtaca cagcaaacct     23460
     gacgttgaac gatgagccgg tctctggcgg caatgccgtt gttgagtggt ctactgacgg     23520
     tggcaaaact tactcgcaga cgggtgatag catcacgctc tcaagtggtg aagaaacccg     23580
     ataccgcttg tgggctaggg tgcgctccgc cacggcaccg gctgatgacg gctatgccta     23640
     tgagatagcg aagacggctg ttgacttccg agctgttaaa gcccctcgtc cttatgtgac     23700
     tgggccgcga gtcattgaga caggcaagaa gtacgtgttc aaagctgaaa ccagcctgcc     23760
     ttaccgtggg atggacgtga agctgaacgg gttctttaca ctgcctaatg gctcgattgt     23820
     tcaaggtgat accgccgagt acgaaccttc ggacgcggac ctcaaccagg ccactgtaga     23880
     aacgaagtac accacctgga tcgaaggata ccgagatcag ggtgcagaag cctcacacag     23940
     cctgcgctcc cgcgtgtggc agtatgtgtg gccgagcttc ggtatgcaga tcaggaagaa     24000
     cgctgacgtg gctcctgcaa cgatcacagc gtcagtgcga ccaattgcct tcaacggcaa     24060
     gctggaagag ccgacctatg actgggagtt gccggaaggc gcagttattc aggacaagcg     24120
     tcaggatata gtcaggtcct ttgttatcaa tgagccgggt gaatacaaca tcaaggtgac     24180
     tgtccgtgat gctcgcggcc atgagaccgt gatcgagcaa ccgctcaaga taggccaggc     24240
     agctccttac gctatcgacc tgcaatactc tggctcgaac aaatacgagc gtgagcctct     24300
     ggatgtgctg ttgcgaccgt acatttctgg cggccaccca cgcgaccgta tttcaactcg     24360
     tgtctactta atcgacggaa cgccgttgga tggcagcggt tactacggga gagcgactct     24420
     gggcgctggt gagcacagca tcaagctgaa aataacctct gagatggggc atgaagctga     24480
     gggcgaggtg aacatcaatg tggcagagaa taagttacct gcatgtagcc tgagctcaag     24540
     ggagactgtt gggtcgtgga tcgtctatgc gaactgcgaa gataccgatg gtcgaatgaa     24600
     gtcctacgag tggaccattg ccggtgagtt gcaaagcata agctctgatc gcgtcactat     24660
     cagcaagggc acctatgaag cgatgccgac catctctctg gtcggagtcg atgattctgg     24720
     tggcaaatcc gaagctgtca cgatgaacta aggttcattc ctcacaaagc ccggcttaga     24780
     ccgggctttt ttttgtatct cgctggagtt gtccaaattg ggctattaca gaggcgagtc     24840
     tgttcccatc ccccagatac actgcccagc atccagtaat ccaatcttag gggatagaca     24900
     tgcgaacaaa attacttggg gcgctgatgg tgttcgggat tattaccggc actgctcatg     24960
     cgtcatcgaa attggaaatc accgatccaa gagctgcaaa gatagaggac atcgtgaagc     25020
     tgcccattaa gggggttcga gctgttcaga gtgacggaca aataatgttc ctttccgaaa     25080
     acgggcgttt tgttatttca ggacaaatct atgacctgtg gagcaaaaag ccactcaaca     25140
     cgatgtccca gatgcgcgat gtggcagagc gtattcactt caagaacatg ggcatggacg     25200
     tggacacgct gaacaccctc tcgatggggc atggtgacaa agaagtcgtg gtatttgtcg     25260
     atccccgatg cgctgtttgc cacaagctca tggacgagtc caagtcgctg gcagatgagt     25320
     acaccttcaa aatcgtcgta atccccgctc tgggagctga gtctaatcga ctcgccaaga     25380
     acttgtactg cgcggaagac aagactcatg cgctcgatgc gctgatgaat aacaccttgg     25440
     gcacactttc ttcaaaagaa aattgcgacc ccggtcagta tgaccaaacg ctgttgacag     25500
     cccacttcat tgggattgaa ggagttccgt tcgttgttgc tcccgatggc cgcgttagta     25560
     aaggacgccc aaagaacctg aaatcatggt tggagagtgc tgaatgatcg taaccatcaa     25620
     aaagaaactt caagaaacat tgatcccgga gcatttgcga gctgccggga ttattcctgt     25680
     tttagcttat gacgaagacg atcacgtctt ccttatggac gaccacagcg ttggctttgg     25740
     tttcatgtgt gagcctctat gtggtgccga tgaaaaagtt caagagcgga tgaacggttt     25800
     cctgaaccaa gaatttccat ctaaaaccac gctccagttt gttctgttcc gctcgccgga     25860
     catcaaccag gagatgtatc ggatgatggg gttgcgtgac ggcttccgtc acgagcttct     25920
     gacatcagta attaaggaaa gaatcaactt cctacagcac cacactactg accgcatatt     25980
     tgccaagacc aacaaaggca cctacgacaa cggcctgatt caagatctca agctgtttgt     26040
     tacatgcaaa gttccaatca ataacaacaa cccgagtgaa agcgagctcc aaaacctcgc     26100
     ccagcttcgc acgaaggtcg aatcgtcact tcaaaccgtt ggccttcgcc ctcgcaccat     26160
     gactgctgtg aactacatcc ggatcatgag cacaatcctg aactgggggc ctgatgcgtc     26220
     gtggaggcat gatgctgttg actgggaaat ggataagcct atctgcgagc aaatattcga     26280
     ttacggcacc gatgtagaag tcagtaagaa cggcctcaga ctgggtgatt accacgcaaa     26340
     agtcatgtca gcgaagaaac tgcctgatgt tttttacttc ggtgatgcgt tgacctatgc     26400
     aggtgatctg agtggtggta actccagcat caaagaaaac tacatggtcg tgaccaatgt     26460
     gtttttcccc gaggcagaga gtacgaaaaa tactctggag cgaaagcgcc aattcacagt     26520
     aaaccaagcc tacggaccca tgctcaagtt cgtgccggtg cttgctgata aaaaggagag     26580
     tttcgacact ctctatgagt ccatgaaaga gggagctaag cccgtcaaga tctcttactc     26640
     ggtggtcttg tttgctccga ccaaagagcg tgttgaagct gcggcgatgg ccgcacgaaa     26700
     catttggcgt gaatctcgat tcgagctgat ggaggataag ttcgttgctc tgccgatgtt     26760
     cctcaactgc ctgccattct gcaccgaccg tgacgcggta agagacctat ttcgctataa     26820
     gaccatgaca accgagcagg ccgctgtagt gttgccggta tttggggagt ggaagggaac     26880
     agggacctac catgctgcgc tgatttcgcg caacggccag ctcatgagtt tgtctcttca     26940
     cgacagtaac acgaacaaaa acctggttat cgctgctgaa tctggctcgg gtaaatcgtt     27000
     ccttaccaac gaactaatat tctcctacct gtccgaggga gcccaggttt gggttattga     27060
     tgccggtaag tcttaccaga aactttcgga aatgctcaat ggtgactttg ttcactttga     27120
     agaagggacg cacgtttgtc ttaatccgtt cgagctcata caaaactatg aagacgaaga     27180
     ggacgcgatt gtcagcctcg tttgtgcgat ggcctcagcg aaaggcctat tggatgagtg     27240
     gcagatctca gcgttgaagc aggttctttc tcgtctttgg gatgagaaag gcaaagagat     27300
     gaaggttgac gacatcgctg agcgctgtct cgaaggtgaa gatgtgcgac taagagacat     27360
     tggtcagcag ctctacgcct ttacgtctca gggcagctac ggcaagtatt tctctcgtaa     27420
     gaacaacgtc agcttccaga atcaattcac tgtactggag ctcgatgaac tgcaagggcg     27480
     taaacacctc cgtcaggttg tgctactcca gcttatctat cagatccaac aggaagtatt     27540
     ccttggtgaa cgtaatcgca agaaagtcgt catcgtggat gaagcatggg atctgctcaa     27600
     agaaggggaa gtgtctacct ttatggaaca cgcctaccgg aaattccgta agtatggcgg     27660
     ttcagttgtt attgcaaccc agtctatcaa cgacctttat gaaaacgctg ttggccgcgc     27720
     cattgcagaa aactcggcca gcatgtacct gctcggccaa accgaagaaa ccgtggaatc     27780
     cgttaagcgt agcggtcgtc tgaccctttc tgagggcggg ttccacaccc tcaagacggt     27840
     acacaccatt cagggcgtgt actcagaaat ctttattaaa tcgaagagtg gtatgggggt     27900
     aggacgcttg atagtgggcg acttccagaa gctgctgtat tcgacagatc cggtggacgt     27960
     taacgccatc gaccagtttg tgaaacaagg catgagcatc cctgaggcta ttaaagccgt     28020
     gatgcgaaac cgtaaacagg ctgcataacc agggagacat taatggacat taaatcaatc     28080
     gtaatcgctg ccgttcttgg tgccgctggt ggctttggcg gtagttactt cgtaatgaac     28140
     gaacaaacgg caagtatcca tgagcgctta aatcaaactc cgcctgtagt cgtggtcgat     28200
     tttgccaagg ttgcgtctgc atatcctgct ggagcctctc aagaggagtt ggagaaactg     28260
     atggttaata ccaataacgc gattttgaag ctgaaagacg cagggtattt ggtgcttgat     28320
     gccagcactg ttgtcggtgc gccaaacgat ttgtatctcc cagaggaggt gctgaaatga     28380
     gatttcatct cactaaatat ttcgtcaaaa aggagtcttg gaagcgcttc gctgttaagg     28440
     ccggagtgac tcttcttatt ttgtggactg ctggtgcagc ttttgccagt cgttaccgaa     28500
     tcggcattga tccacagcaa gagaaatgcc tgcctggtta taccttcttc ctcattgatc     28560
     tcaaagatca gtcattggag aaaggggctg tgtacgcctt tagtgtgaag aacatggagc     28620
     ctttttacaa ggacgggacc cgcatggtca aaatcctaac agggatgcca ggggataagg     28680
     tggagatcaa cgataaatgg aagatcaccg tcaacggtga tgtcgttggg gaagggctcc     28740
     agcttgcagg aaaactgcat ttgccggaga gccattttta cggcaaatcc acgttgaaag     28800
     atgacaacta ctggtttatg ggcaaaagct cattcagttt cgactcacgc tattggggga     28860
     ctgtgaaaaa tgatcaaatc attggccgcg catatcccct gttctaagac cgttctaacg     28920
     gtattgatgc tttctgtagc tggtggggga gtcgctcaag aatccccgct tacagagcag     28980
     gacagggagc ttattgagca aggaaaacag atagccgaaa gaactcagaa gatggaaatg     29040
     ccgtctttgt tgcaaaacca acacatggac caggctcagg ccgaagccaa gacgtttttc     29100
     aagcagctcc agtctaccaa tcagacacta aaggaaatgc agctcaagca ggccgagaaa     29160
     ggtatttata ccgaccatcg gatactggtt ttcgcctcac tttctcttgg cgagcagggg     29220
     ctagatgatg tcttaacggc agtgtcaggt cagcctgatg ctgtggttgt gttccgtggc     29280
     attccggaag ggatgaactt ggggcagggt gtaaaggcta ttcaggcgct ggcggccaag     29340
     aaagaccctg tgccgaacat catcatcaac cctacattgt tcaaaacata caaaattaca     29400
     gccgtcccga cgattgtgat gatcgaagat gaaccgttgc cgggagagca gccaaatgtt     29460
     gttgccaaag tgtctggttt gtccgatccg gtatggcttg ctcgtgaagt tgataatggc     29520
     gagaagggtg atcttggtgt cagggggcca gtagagaaga ttggtgaagc tgatcttatt     29580
     gatgttgcca agaaacgcct tgccaacatt gactgggaag ataagaagaa acaggctgct     29640
     gagcgatttt ggaccaaaca gaacttcaat gagctgccca gagcgtctaa agctcgaacc     29700
     agagagattg accccagtgt gatgatcacc agtgacatca gcactcctga tggcaccgtg     29760
     tttgctcatg ccggtgatgt gatcaaccca ctgtgcgacc cgaaagaagt ttgcaagcca     29820
     ggaactcgta cattcaccca ggctgttgtg gttttcgccc cattagataa aaagcaaatg     29880
     gagctgctcg ccaaaaaact gcctgaaatt aagcgggagc ctggtgtaca gaggatcacc     29940
     tacatcgcta cttcgttcga taaagacaaa ggctgggatt cttacaagag tgtcaccgac     30000
     aactttgatg caccggtata tctactaact cctgatctga ttactcgttt cgagctggag     30060
     catactccga gcgtgattac ctccagaggc aagatgttcg tagtccgcga gctgacagag     30120
     gagggcgatg aatgattttt gccccggctt tccaaccaat aaaagatgtc ggcactggtt     30180
     tgtttgtcgc tgctgaggta ttggctcgct ggtacgacga aggccgggtt cttacgccat     30240
     ccagtctgtt atctcaacct cattgggggc tggtggacat ggaagtggca aggttcatcc     30300
     acaaaaacct gcatcaatgc ttggatttat atccaacgct ttttcttaac gtctcagagc     30360
     acactttgcg ctctgatgtc attttcaaag catggacaag ggttattcat gccatagcga     30420
     aaaatcactc tggccgtttt gtgattgaga ttacagaggg cattcaggat gcgtcactct     30480
     catccagatg ggatgcgttg atcgaaactg gagttgaatt agcccttgat gattatggag     30540
     ataaacactc atctatggag cgtttgagtg gttatccctg gcgttactgt aagtttgacg     30600
     cgagaagact tcgctctctc gaagattacc cagctattgt ccattgccga aggaaaggta     30660
     ttcagttaat tgctgaacaa gtagaaacct ttcctttagg agagagcgcc aaattacttg     30720
     gattgtcatg gcagcaaggt ttctttcatg gaaagcctgc tgttatggat aaacatttga     30780
     ataacgtaaa ggccttacca tgataaaaaa aatactacga atcatgaccg taagcgcggt     30840
     cttttgggtt aactcggtgt cggctgaccc tgggtgccag aatgcagaag ttatcggcgg     30900
     taagctgatc acagacattt gctggagctg tattttcccc atcaaagtag ctggggttcc     30960
     tattagtgga ggtggcggct cgttcccaag tgaggccgtt agcaaccccc tgtgcatgtg     31020
     cgaggataat ctcggagttc ctcggccagg tgttaccact tcaatgtggg agccagcccg     31080
     gctcgttgag tttcagcgag tgccaggatg ctcatctgtc ttgaatggtg tcaggttccc     31140
     ttttgatagg actaaccaag gacaccacgg catgggcgac atggatggtg gtgatggttc     31200
     ttttatgcac tatcactact atgcgtttcc tttgttagtg atgctcgatt tgttcattaa     31260
     gcaaacctgt aatgctgatg ggtatatgga cttcgacatc atgtacatgt ctgagcttga     31320
     cccaacttgg aacaatgacg agttcgcctt tttcaccaac ccagaagctg cggcagtggc     31380
     aaacccaatt gcggctgctg cgtgtactgc ggatgctatc tcatcaaccg caggaaagcc     31440
     tttaaaacag cttttctggt gtgctggctc atggggaact ctatacccgt ttagtggcaa     31500
     tcagaacggt gggaaaggtg ttatccgtga tagcagtctt cttagcacca gggttttggc     31560
     cgcattgcat cgccgtggtt tggcatggaa aacaatgggg tctgaggcaa tgtgcagagg     31620
     tgttatcagt ccaacacttc ccaaaacgca gtacaaattc acgctattgc atccggttcc     31680
     agagaccaat tcatctcatg tcattggtga atccactctt acttgggggt tggcgcggac     31740
     tataccggca attgggcaag accccatcta cacgatctgg cgatggaatg attgctgcaa     31800
     caattaatca gcaccaaacg aatctgaatg ggcgttttcg attatgcccc aaaagggcca     31860
     ctacacgtac aggtggccct tctcttctca gatagcatgg gaaggttaaa atggagaaca     31920
     caatgcgaag tcataattac tttatgagag ctgtggcctc gctgttgaca gtaaccatgt     31980
     ctgcgctgcc gatacattcc tatgctaacg gtagccaaga ccaggacatc acagcggtag     32040
     gtaaagaggc ccaggctttc ggacaaaacc tctcaaactc attcaagtcg agctcgggga     32100
     cagtgcaaga tggcactatc tctatgccga cgctgaaaga tgggcagttc caaatgaatg     32160
     gggggagtca gattaatgtc aatgatctat tcccaggaac aagcgggact aacaataaac     32220
     cggacagtta ttatttccct gacgccaaca aacctgacgt gggaggcctg caaggcattt     32280
     acgagtcagg cgatgacatg gacagcgtgg ggaataatgc caaggggtca ctctggagtg     32340
     atgccaatag tgcaaaccca tcaatctcag gggcagcata taaggttctt ctcgatgcct     32400
     ctaatcgatc acgccctgat tttagtaatg acccggtact gaacctaagc aaaaagacct     32460
     atgaggacat ggacctcatt gccgatggct ttggtgattg ttctgccgaa acaactatta     32520
     atcagaatac catcaacgcg catattccag agtatgagcg atgccagcgt gttgtagatc     32580
     aaagcgcgga ctgtgaggtt gtccatgact acgacgcctc agttgtgaag cactatgatg     32640
     gcccatataa cctcaaatct tgtggagaag gctgtactga gttgtggatt ggccgagtgg     32700
     gtgacaacta ctggagtggt aactgtacga tatatgagga gtacacgcgg gtacaagtca     32760
     gtaatccaga cgccatagtg tctgcaacgc ttgagtacgc caagtgggat gactacatgc     32820
     aagtttgggt aggtaaatcc ggtcaggaaa ctaaagtgtg gtcaggccct gacggcaact     32880
     tccctccaga aactgctggt cggtgcgaat tgtcaacaag ttgggagcgt aaccctaatg     32940
     tcgatgtcac cccctatttc aagaatgtga aagatggtga tgttgttacg tttaagatcc     33000
     gcgtttcagt aagtggcgaa ggtgagggtt ttggccgcat aaagctacgc tatgacccat     33060
     caaaagccat taccaaggat gagtgggctc cacagagctg catggattca gccaaagggg     33120
     ttgtagatgg ttttgcggaa ggagagatca cttgtataga tgacccgact gatgctacgg     33180
     gctgcacagt catcaacggg atcaaagttt gcgaatccca actcaaacca tcacctttgc     33240
     ctggtattcc aaagctatgc aaaaaggttc gagttaaagc cgactatgac ttctataagg     33300
     gtcaaatgga ctgctggact gaccctcaag gtgaaacaca ctgtccggta aacacgggcg     33360
     ggaaccttaa tagttgtcag aagtatgaag aaaaccctca gtgcggcttt atcagttcca     33420
     aatgtgttga tggagctaag gggagctctg gaacctgcta cgtccacgag gatacctatg     33480
     actgcggaac ggatgtttct gttccaacct tagaaaagga aatagagtat caatgtggtg     33540
     ggcctatacg ttgtatgggc gacgactgtc ttgatttgac aaaaacacaa agtacagatt     33600
     tcgctcgtgc tactgcattg cttaatgctg cccagtttat gactcaggat atgagctgca     33660
     caggtcaaga cggtgatgac aatccaaccg gggaagaaaa cgttatttgt tcagcttttg     33720
     cgggagaggc tggcgaatgc aaaatagctg ttggaggtgt ttcagattgc tgtgaaaagc     33780
     caaccaatat atctcttgcc gattacttga acctaataat ggctgttcca aaacttgatg     33840
     gggcagtaat gggtttaact gatggtaatg cgcttaaagg ggcttatcag gttcttaggg     33900
     agccagccct tcaagggtgg acagaagtaa caaaaccgtt cacaagttac attgagaacg     33960
     tctctggcgc tgttgattcg ttctttcagc ctgtagagca gtttattgat cagctcattg     34020
     atcagctcaa agagcaagtc aaagaagtga tgatggatgt catgaaatca gcaggtcagg     34080
     atgcagcaac tgagcaagct gctgctgccg cgtccgaaca ggcagccgaa gcgatgatgg     34140
     agacggcaac gacatggctt agtaccgcta tgacgatata taccgtctat gttgttgcaa     34200
     tggtcatgat ccagatgatt tataagtgcg aggaggaaga gttcaccatg aacgccaaaa     34260
     gagcgctaaa aaactgctct tatgtgggtt cttactgtaa atctaaggtg ttgggcgctt     34320
     gtattgaaaa gagagaagca tattgctgct tcaattctcc actctctcgt attatacaag     34380
     aacaagttcg tccgcaattg ggccaaaact ttggggaccc gaaaaacccg cagtgtgaag     34440
     gtattccact agataaaatt gccgaaattg attggagcaa aattaatttg gatgagtggc     34500
     ttgggatatt gcagcagaac ggtaagttcc cagatccaaa cgcaatcaat ctcgattcgc     34560
     tgacaggcgc tggaaacgac tttaatgttg acggtacgcg aaagaatgct caggaaaggg     34620
     cgttagagcg tttagagggg atcgatattg atgcgaagcg taaagaggcg acaaatagta     34680
     tagaccctca aactggagct ccgacaagtg gcggaggagg gggataaaaa aggggccttt     34740
     cggccccttt tttatgtcga ttgattacgc ttccgggtaa acaaataact ctgcttttcc     34800
     ctgttcaagg aggtaaggga atgcaacttt ttcgccattc tccagctcca ctgatttcgg     34860
     agcaaggtag aggtaggtcc aagccggtag ctgcttgctg atggctgcat agatcgcttg     34920
     ttgaggggcg tggctggtgg ttccattacc gacatttaca aagttgtacg cggtctcatg     34980
     acctgatgta aacgcataag ccgcaccttg gacactagag acaaaatcag gagctacacc     35040
     gatgcgaggc tccacgagct tcaccttgac tgaacacatg tcagccgctt tgctttgtcc     35100
     gttcacccac gtagggcaac cccattcatt tttgtagaac tgataggtga ggcggccatc     35160
     tttgtcatac agaagcgtga aatcggcacc caagtcggtc agcgctgact cgatggaaac     35220
     tttcacatgt gaaagaaatt tagcttgagc ttttgctggt gaatctgctt cgtgtgctgg     35280
     catccatgca accaaactgt tacgtgcgcc atgctgtttg gggacaattg cccaattcgc     35340
     aaagttcact aagccacctt gccagtttgt cattccaagc tgaggtgagg tgtaaccaga     35400
     tagcacgtaa gccgccccaa acgtctttgt gtctgtcagg cgctccagtt tgtcacgagg     35460
     aacaggagcg tccttgatac cagtgaccag accaccagcc tctgcaatgt tgtaggcgcg     35520
     actttggttg gctttataag ctgagggttc gtagttgctg ctggtagatg cacagccaga     35580
     cagagttgct acagccaaag ctacggttgt gattaatgtt ttgttcatgt tgttctccgt     35640
     ttttgcctga gttgaatctg atttacttcg ataatatcac ggcatcataa aatgcaacca     35700
     taaaagacaa aaaaagcccc tcaggtgagg ggcaaaggtt tgggctgggt tatgctgctt     35760
     tcgttttttc ggcttcgtct gcgatttctt tgtcgccagt ttcagattca ggagctgctt     35820
     gtgccacttc accttcttta cctttggtgt gtgcggaaat acgagctcgt ttctcgatgc     35880
     cgatgatgcg acctgccagt ttgatgaggc gctgttgcca ttgataggtc gcgtcagtgc     35940
     gctgcttgct ggtcagaacg gtgtttaacc agagtgtgtc aacgatcccc atcagtttgt     36000
     ccagcttacg gatcaggtgc gcgaactggg caacttgggg agagttaatc tcgatggtgt     36060
     attcgttcgg gttggtatag cccggcatca tgtcgatgcc gttatcttcc atcagtttgt     36120
     tgagttgggc ggtggctttg tccagatctt cggagacctt ggaaatttgt tccaggatga     36180
     cggtttcaac ctggtcgatt tcatcctgct caccgatgat acgaaggata acgtcgatgg     36240
     agaacagaga gttggaaact cgctcaaagc tccgctccat gactcgctga gcctggaggc     36300
     tattcacttt caatgcttgt ttgaaaatag ggcgagagta gtggttgcta cggtcgctgt     36360
     ttgtgtccac tgctgcttgt gcttctgcca ttagagatac tcctagattt gaggtacaga     36420
     taaacgcact ggaaaggata aatgcggtca atctgtaacc tgacatcccg aagtgcccaa     36480
     aatggacagt tacagcgttt tctcttgagc aaaggtgagc tatatttgaa ccatcttagt     36540
     cgccctgcgg ctataggtga gatagctggt ctccaaaaac aaacagcatc tagctttatg     36600
     ccgtatggca ttacttaacc ccaaaccggg ggcttctccc ggtttccggg tgttgcccct     36660
     gattattcta taggagcaac accatgcaca tcatcacttt cattgtagtt ctgcttgcat     36720
     ctctgggcgc actgtacgtt ggcgcgaagg tatttgcatt ttccttcatc gctctcgcta     36780
     aagtgttcca gcgtatcggt ttgttccttt ggaacaaatt cgcagtccct gcaatgcggt     36840
     ctgtacaggc cgtcataaaa gaacgtgctg ctaaggctga gcaagccaaa gtagccgttg     36900
     agcctgaggt aactcaagtt caagaagccg ctaaacaaga acctgattgg gattatctcg     36960
     aaatccctac ttaccttcgt aagggtaagg atcttgtttg gtaattactg tcgctgagta     37020
     atcttcgaca ctttcaaacc catcggggca atcatacccc gacggggatg ttgccccttt     37080
     tttgcttagg agcaacatca tggaaatcgc tatcatcgct atgtgtatcc ctactggttg     37140
     ggcaatctct cgtcctttcg tgagaatcgc tgaatcgttt ggttactgct gatagtcaac     37200
     gaaaagagag ggggaaaccc ctctctttct ggtcaagcct ctgtggcttg tcctcaaagt     37260
     cttctggttt cagtttgctt tgacgacaag ctacaggggg gatgtcgaat gcaacagaat     37320
     cttcatgttt acgacgatca cgcaggcatc atctatctag ctgatggacg cgaggtgaaa     37380
     tttgatccga aactgtattc cagcgcctat ctggcgcaca gcgaagcagt gaaatgggcc     37440
     aaagaaactg gggtcattgg tcaagacgac gatgtggtga tgttcgtcca ttgagggagt     37500
     agcctctcct ggaggctact cttctcgctc aaagaagtct tcttactcat ggtaaaacca     37560
     tcagtaagca gattttgttc tctccggaga gcgaaaacgt gtgatagctg gtcgccaaaa     37620
     acaaacagca aattaacgtt aatttactag cccaaccggg cgcatcctcc cggttcggga     37680
     cgtggtgcgc ctgtcaattt aggagcgcac ctatgtctca atatactcaa ttcttagtaa     37740
     gcaaggtttt cggtatgcct agcattccgg agaaggtaac tgccatcggc tatgctgacg     37800
     gctcgcaccc ttttatccct gccactgata ccaactacgt tttccgcaaa gagtttctgc     37860
     gagaggtttt ggcctatctt aaagaacctg gcggtgacgc actgttcgta accggcccta     37920
     ccgggtctgg taaaacctct ggtatcaccg agatcgctgg tcgtctcaac tggcctgttc     37980
     agcaaatcac tgcccacggg cggatggagc tgacagatct gattggacat cacgctctgg     38040
     tcgcggaaaa accaggtcaa ccacctgtca tgaagttcat gtatggacct ctggcagttg     38100
     ctatgcgtga aggtcatcta ctcctcatca acgaggtgga tttggccgac cctgccgagc     38160
     tggctggtct caacgatgtc cttgaaggac gtcctcttgt gaccgctcag aatggtggcg     38220
     aaatcatcaa accacaccca atgtttcgtg tggtcgttac tggtaactct acgggttccg     38280
     gtgatgcttc tggtttgtac cagggggtga tgatgcagaa cctcgcagct atggatcgct     38340
     atcgtttcac caaagtaggg tatgcggatg aggaagctga actcagcatt cttggccgtg     38400
     ttactccgaa acttccggaa aatgtacgga agggaatggt tcggattgct aatcaggtcc     38460
     gcaaactgtt tcttggtgaa aacggtgaag atggtcagct cagcatcacc atgtccaccc     38520
     ggacgttggt gcgttgggcg aaactgtctc ttgcgttccg aggtgcccca aatgctcttg     38580
     aatacgccct ggatcaagct ttgcttatcc gtgcggccaa agaggagcgt gaagccatcc     38640
     tgcgtgttgc gaaggatgtg tttggggacc aatggcgcta aggggtgacg catgaataaa     38700
     aatcactgtt tgtgccgtcg ttacacattc aaagatgcgt taacgttgga aacattcgag     38760
     gtatttattg gctacaaagc tctccgggag cccagctcct cggagccagg tcaattcacg     38820
     atggttaagc taaaccgaac cgtcactgat gggaaagctg aaaactggtc tgagataaag     38880
     ctcgaaggac cttttgaagc caacggacca gacacgatcc caatgtccta caaggacaaa     38940
     gaaagccagt atgtgtcaca gtttctcagc cagggataca cctttctgga tgaggtgctg     39000
     ataaacgcag agacacagac tgtgctggaa gggggaaatg tttcagccgt acaaacaacc     39060
     agattaggat ctctaaactg gctgttgtct ccgccctctg agttacctcc tggcgacata     39120
     aacctcttca agggttttgt agctgggata tttgccaaag gagccagttt aatcggcttt     39180
     gaggttgctc ggaatgaagg ctctaacgac ttgctgccct gtgtgctaat gcgtacaagc     39240
     agcggttatg agcttggggt gagcactggt cttggcgaga acactatcca tccagcaacg     39300
     ctggaaggcg ctggtgaact ccgccctgaa catggtcaca aacccctgct gatgttggtt     39360
     tacctacaac agcgtttcgc ggatgacttt tcaaacgtag ataagccgct ggtggcattc     39420
     tgtgatgaac agggtgttac cttcgactac gagcgttttg attcactaaa ccccctcatt     39480
     gaacggtttg gtttcagcta cgacgaagta agagcggatg cagaaaggct tggccttgta     39540
     tctgagctga ttcggctggc agagatcgac tccgaacaag aggatcactt tttttaaccc     39600
     taacggaggc tactccctgt taggaaagtt ggccctgtcc aaataacttg gctggcgggt     39660
     aacaccgcta gttcttacta aaccctacgg gggcaccgat gccccgatgg ggtcatggtg     39720
     tcctcaaacc gttcattagt gaataggaga aacaccatgt ctgatagcaa atctcttgta     39780
     acccgtatcg ctgaacgttt tggtgttgac acccgaaagt tctatgacac gttgaaggct     39840
     acagcgttca aacagcgaga tggtagcgca ccgaccgatg agcagatgat gacgctcttg     39900
     atcgtggctg aacaatacgg cttgaaccct ttcactcggg aaatctatgc gtttcctgat     39960
     aagcaaaatg ggattattcc ggttgtaggc gttgatggtt ggagccgtat catcaacgat     40020
     catccccagt atgatggcgt cgagttcgtt tacgcggaca agatgatcag aatgcaaggc     40080
     gcgaacgttg agtgtcctga gtggatagaa tgcgtgattt accgtaagga cagatctcgc     40140
     cctatccgga tcaaggagtt cattgacgaa gtttaccgag agccagtgca gaaacatggg     40200
     caacacggcc cttatgttgt cactggtcct tggcaaacac acaccaagcg tcaactccgg     40260
     cacaagtcac tgatccagtg ttctcgtgtc gcttttggct tctccggtat ttacgaccaa     40320
     gatgaagctg aacgtattcg tgaaatggaa caagcatcag ccattaaccc ggctattgcc     40380
     aacctccctt caccgacgca agttcatagc caagagcctt tggctatcga gcataaagag     40440
     cttgatccga tcctgaccaa actcgcaaat cgcgctattg ctgaaaaagc atggtctgcg     40500
     gcgcatgagt atgtgaaggg acggtatgaa ggttcggaat tgcaatatgc gactcaattt     40560
     cttcgtgaga aggaattgga tcaaatggag ccaccgaagc ctgactacca ggaaacgcat     40620
     gagcaagagc ccatcatcgc tggtggctca gctaatgcaa agcctggtgc cgatgaagtg     40680
     ccgcctttga gtgacgagga catgatcccc gtagcagaag aggagggcgc agaagggcat     40740
     tactactaac cccaacgggg gggactcccc cgttggggga gatctccctc ctaaccactg     40800
     gagagaggtc catgaaaata gtcaacctat cgcaacgcga ggaagattgg cttgattggc     40860
     ggcgtcaagg tgtaacagcc actgacgccg ctatcctgct caaccggtct ccctacaaaa     40920
     cacgatggag actgtgggcc gagaagactg ggtatgcgcg tgaagtcgat ctgagtctta     40980
     atccgctggt tcgccggggg atagaaaacg aagatgccgc aagacgtgct tttgagggat     41040
     gccgcaagac gtgcttttga ggagaagtat gatgacatgc tcctccctgc ctgtgttcaa     41100
     tcggttcaat acccgctcat gagggcctcc ctggatggcc tgagagataa cggggaaccc     41160
     gtcgagctga aaagcccgag tgctactgta tgggaagatg tttgtgctga gaaagcaaac     41220
     agcaaggcat accagcttta ttacccgcag gtgcaacacc aactcctggt tacgggtgct     41280
     aagcaaggtt ggttagtctt ctactttgaa ggacagataa aggagtttcc aatactccga     41340
     gatgaagcca tgattaaaga aatcttggct gaggctaaaa agttctggca acaggtagta     41400
     gacaagaagg aacctgataa agatccagag agagacttat acataccgca aggtggtgag     41460
     gtcaattgtt ggattgctgc tgctgaggaa taccgcctct atgatgctga gattcaggag     41520
     cttaaacagc gactgactga gcttcaagaa aggcaaaaac ctcatctcga aaccatgaag     41580
     tccctcatgg gggaatactt ccatgccgac tactgcggcg tgatggtgac gagatacaaa     41640
     gcggctggtc gggtagacta caaaaaactg cttgctgaca aagcatcagg tgttaagcct     41700
     gaggatattg accagtacag agagaagtca tccgaacggt gccgtgtaac ggttactggt     41760
     tcggtgaaac cacggtacat tgttgatgag gacgtacttg ctcctcttga tgatctgccg     41820
     gaagaagtag ttacatgcta ctggtaagtg ggggattttc ccccgctttc ccttggagat     41880
     tctgagagtc ttcaacggaa aggagatttt gttctcttcg gagagcgaaa atgtgcgata     41940
     gctggtcgcc aaaaacaaac agcaaattaa cgttaattta ctggccctac cgggcgcatc     42000
     cgcccggttc gggacgtggt gcgcccccaa cttttggagt gcatcatgac taaagtgaac     42060
     catctacaaa gcctttgtgt tatccacgtt gactttgaca tttggagcgg acaaacacgt     42120
     ttgtctgcat ctgacctaaa gctgggtgag ggtggtgaaa taccacctga gaaagtcgct     42180
     caactaggaa gtaaaaaaat ctgtgatccg gcgaagctga aaggctttca tcgcctgaaa     42240
     acagaaactc gtcgtctcct gctgaaattc ggtatgccgt ttatgaacgg atttgccgtc     42300
     cctgtcagca ggaccgatga aatctgtaac aagctgaatg acatcaacta ccagttcaac     42360
     caattgaaac aggatttcat caacggttat aacaaagctg tggatgaatg gtgtcaggaa     42420
     aaccctgaat acgaacgagc catacgcgct ggagtccttc caaaggaaac ggtcgaagag     42480
     cggattggtt ttgaatatca ggtgttcatg attcagccgg tgaacgagga tgaggctaac     42540
     gctaagcgcc ttaaccgcaa ggttgagcgt ctgggtgacg atcttgtctc cgaagtagtt     42600
     caggaagcaa ataagttcta tatggaacgt ttggcaggtc gagaccaatg tgcggttacg     42660
     acacgacaaa ccctccgtaa tatccgcgat aaagtggatg ggcttagctt cttgaacagc     42720
     gcttttaacc ctttggtcaa gctgctcgat cagacccttc gtggctacga gcaacatgct     42780
     gatggtcgta acatcgttgc acctttcttt tatcaggtcg tggccgcagt gctgatcatg     42840
     agcgaaaggg aacgcatcga agagtatgcc aacggttcga tcactgtaga gggaatggct     42900
     cttaacattg gcggttcgga agcccatatg ggggaccgtt ctaaaaatga aaaagccgga     42960
     ctggaaagcg ataaagctgg tgagtctacc ctcgtactaa agggtgacaa cactgtgcag     43020
     caacaggtag gtggtgctgg cgctgttcaa tctgaacaga ccaacaacgg tggtgacgcc     43080
     gttgacctgg atgaagacat tgacagcttc ttcaagaatt ttgcagaacg aggtgagggc     43140
     gagtcggaag atgaccccaa tgccggtgat gctgttcaag atgaatacgt tgatgttgag     43200
     gatgagcctg ttttacctga ggaaactctg gtagaacccg aacccatcca agaggagcct     43260
     gctacggagc ctctcaacca ggaaccgcct aaaactgacg atgatggtga ctttttcttt     43320
     taatagtcac ttcaactaaa ccgacccgga ggggatagcc atcccctcta gggggtggac     43380
     tgtctccttc tcaatcagga gaaaagatat gtccaaaaaa cgcaccattt acagcgctct     43440
     acctatcgtg gccgcagcct atggtgaaaa actcggtgtt aaagtggcaa tcggcaacga     43500
     tgacgcttac accgacggta aaaccatcgt ggttccgaat atccccgacg actatccaaa     43560
     tatggatgct gtctgggggt atttggccca tgaagccgcc cacgtccgtt ttacggattt     43620
     tggtgtcgaa cgccgaagag gccttcatgc tgagctgtcc aacgttttgg aggactgccg     43680
     tattgaacgc gccatgatgg atctcttccc aggcacttca caaaccctga atgaagtcgc     43740
     tcgttatatg gctcaagctg gccattacga gcatgtcaca gataaagagg ctccagcctc     43800
     cattctgaca gggttctgtt tgtactggct gcaaactaag gctgttgggc aatctgtcct     43860
     gcaaccctat ctcgattcgg ctactaccgt attcgagcga gtgtttcctc aaggtgttgt     43920
     ggttcggttg aacgctttgc tgcgtaaagc tgtgaacacg aaatccaccg cagaggtagt     43980
     atccttggcc gaccaaatca tcaagatgat cgaagaggaa aaggaaaaag aagagcagaa     44040
     acccaagaat ggtcaggacg gtaacaacca acaaaatgct ggtggagacc aacctcagaa     44100
     caatcagggt ggaagtggta atgatcagaa ccaagggcct agtgctggag gcagtgatca     44160
     gcaaggcaaa aatcagaagc aagatgaagc tggcgggaag tctgatccga aaggacaggg     44220
     cgaccaagct aagtcagatg ctgatggtgg cagtaaggca ggacaaagcc aggctggtgg     44280
     taattctgac gcggcgaaac aagacgcggc caaaatgcta cagcaggttc tgaatgctgg     44340
     tgccggtgac ttgcgtggtg acgcgcatga cgcactaaaa gccgagctta accgggtggc     44400
     tcaggataaa ggggataaca gctatatgac tgttcgctcc gctgtagata cccaaaacaa     44460
     tcctgctgtt ggcaaaagcc ttgtggggga tgtgaagagc accacttcaa agataagaac     44520
     gcagctttac ggattggttc aggccagcca gcgagttgct caccgtaacc aacgttcagg     44580
     gaagcgtgtg gatgctcgga aactacatcg tgtagtgacg ggtgatactc gcgtattcct     44640
     caagccggaa gccaagaagc gccctaacac ggcggttcac atcctggttg atatgagctc     44700
     ctcgatggcc tacaaggccg ccaatggaaa ggagcgtcaa gacattgcgc gggaagcgtc     44760
     tttggctatt tcgatggccc tagaagcgat ccccggcgta aacccggctg ttaccttttt     44820
     tggtggcaat cggaatcaac cagtgtttag cgtcgttaag catggagaca ctgttcaaaa     44880
     tcgggccggt cgatttgggt tcaaagcaac aggcggcact cctatggcgg aagccatgtg     44940
     gtatgcagcc tttgaactca ccaagacccg tgaagagcgg aaaatgttga tcgtggtgac     45000
     tgacgggctg cctcaaagcg ctccggcatg tcgctctgtg attgacctct gtgaacgaag     45060
     tgatgttgag gtgatcggta taggggtaga gactaccgca gtatcaggac tgttccaaaa     45120
     gaacattgtc attgatgacg cggcagcttt acaacgcaca ctgtttaagt tgatggagcg     45180
     gtcattgact gcttttgcgg cctaacagga agtgaaacga taaacggcta tcccttcggg     45240
     ggtggccgtt tttatttgga gagtctatga atcaattcca tccatccttg gatttgtatc     45300
     atcggaacaa aggcaaaagg gccatagtgc ctgatacgcc tttcatactg cttgccaagc     45360
     gcattcctcc aatgtactgg agacttttcc agggcgttac cttggatagt cgtatgggat     45420
     acacaggcag gcggcagttc cacaatcttg ggcaagcaat tgactgggca aagtcatcag     45480
     ttggtgattc ctggtcaaac aagagctttc gtaagccagt tggcctcgat accttacttg     45540
     tatgtactgc gagcaaggtg cctgaacatc tggtcgaaga actgaaaagg cgtgttagtt     45600
     gatatgtctt tgagctttgc accctaaaag ggcagtttga gcgttcctgt tcacactgct     45660
     ctcgtggaac aatcaaagtg aggagggaat accctcccac tttctcagat gccttcgctg     45720
     agggttgctg agaaagtgaa ttttgtcctc tctgagggcg aaaacgtgcg gtagctggtc     45780
     gccaaaaaca aacagcatta aacctcagcc taagggcgca ctgcgcctgt caggctctgt     45840
     gtgccccaaa attactttaa ggagcgcaca tgtctcattt aaccaatctg aaatccgtaa     45900
     tggtctctct tgccgccgaa cataagctgc ctgaaatcta caaggatgac atcactaccg     45960
     atgtggagtc tctggaaaga ttcgatggtt tgcgtttggt atggctgttg cgagattgcg     46020
     gcagcgtttt ggtgccaacg gaagttggtg tcaatccgat ctatatcacc cattggctgt     46080
     ggtctaacca cggtcagcag gtggttccgt tctctgtaga cacctgcacg gggttgattg     46140
     aaaaaatcga ctttgagcaa gcagcaagct gaaaagctga tcatgcagat gccttgcaat     46200
     ctatcgtcat tgcagaacaa ggaatatttg gttgaccaag taaaccgagt tttgaaacgt     46260
     ggttgtgaaa tgcgtatctg gggtatcttc gagtctccaa gttcggtcga gtctgtaggt     46320
     ggttggaaag agtggcagag ctatttcagc tctactggga atcggctgat ggctgatttc     46380
     attggtaaag ccattcgatt tacgaaccca cattaatacg ccgttcaatt aataacccta     46440
     tggggcctca atagccctga ggggcagggg ctctgcaatc gcaataagga gcccttatga     46500
     aaaaattatc agctttggaa tcagttctta accacgacaa accttctcga cgttttcttg     46560
     atggactcaa cgaaaaccag atgaaggacc tgtcagggga gatattcgcc aagctctatt     46620
     ggagcaagcg taatccccag tggtacgaga aagacaccaa gcggctgttt gcacgacttc     46680
     gttggattca gcgcatcatc aagaagcgtt taaaaaccgg caaagttaaa cctgaactga     46740
     ctgaacatgg atcagtgatg gaacgcttta actttcccta cggtgacact ctcgatttct     46800
     tccatcggta cttgcgccat cccaaatggg aggttgtgta tcaagaatcg ggttgcagtg     46860
     ccttttggaa aaatgaagca acgcttgagc tatgcaccta ctgcgaaggt gatgttgtca     46920
     tgatgaaggc tcccgataag gttgctttct tccgtgattg caatcgcctt agctggtggt     46980
     atgcagaaaa cgcttgatct taatccctaa ccaagggcga acctgcccct gatgggagca     47040
     tggtgcgccc catctatgat ggaggacgcc atgttcaaat catcagtatg ctcctacgaa     47100
     aatagggagc cttacggaaa caacaagtac cgaggtaact gctcaggttt tattgtgaag     47160
     gactttattg agtcctacat gagaaagccg aatggtctgg tggccgatcc cagcgttggg     47220
     ggaggttcca gtatcgacgt tgccaatgaa cttggtatcc gtttcaaagg aacagacttg     47280
     catcagggat tcaatctgct gcgggatgac ttcctttcgt tcctgggaga gcctgcccac     47340
     cttatctggt agcatcctcc ctactgggac atgattcagt attccggtat gcagtggggc     47400
     gatcccaaca aatgggacat gagtcgcatg aacttgccgg agttcgttga agctctggag     47460
     ctggctgtta tgaacattca tgacgcctgc gagcgagggg gacactacgg aatacttatg     47520
     ggaaacctga ggcgagatgg ggactattac aacctgtcta gccttgtaga acgtatagcg     47580
     cctgggaagc tggtggatga gatcatcaaa acgcagcaca actgtgtaag tgatcgaact     47640
     cagtattctg ggaagctggt gcgtatcgcc catgagaaac tgttggtgtt tcgtcgtcac     47700
     gacgttgcct catcgctcag tcttcttgct gctgttcacc gtcgagcaac caatatggtt     47760
     tcgacaacat ggaaagctgc aatacggcgt gtcctacaag ggaagacgtt gaagctggag     47820
     cagatttatc aagagattga accttatgca aagtatcgag agaacaacca ctggcaagca     47880
     aaggtcaggc aggttctcca agatgccagg ttctttattc gcatcgaggt aggtgtctat     47940
     gcacttgctg agtagcccaa ccggggcgtg acatcccgga aggggtggtc gcgctcatca     48000
     ataactaagg agcgtgacca tgaacgtaca actgtaagcc agcaacaatg ttctgttgga     48060
     acaaatcgag aacaaaggcc tcactgttga aacgcattgt cgcagtggct tttgtggcat     48120
     gtgccgggtt cgtcttctca aaggtcaagt ggcctatgac gagacccccg tcgcatttgt     48180
     caaagaaggg gaagtgttgg tttgctgcgc taaagcaaaa actgatgtga ccttggaaat     48240
     ttaatccatc cggaggggcc tttcctgcgg gtgggactcc tctatccatt acgaggagaa     48300
     acactatgtc tatcaaaacc aaagttgaac aaatcgcata cggtcatgct actgctcaag     48360
     tgctcagtga actgggtcaa caagagaatt ggtacaaggc ttataagtat ttgtctgagt     48420
     gcgtagagcg gggagatgag cctgatgatt tgatcgtttg gcaaccgttt gagcactggg     48480
     agtggaaaga cattctggaa caaatcgaaa gcgaagccga gtctctgctt tcgacaatca     48540
     agtcggtttt cgcattggcc cacaaaggca tcatacagtc agcgattgat tgttctctgg     48600
     attcggacat gacccagcta gacctgattg gaatggtcga acttggcaat gacatcgaag     48660
     aaagcgagag tgctggaggt ggttatgcag cttaaccgat atacggccag ggaatctgat     48720
     aaaagtcgga ttcttcggat cataggttgg tgcaaacgca accaccttac acttgccggt     48780
     cttccatacg acgataacct ttccggtagc gaagggatca gcctagagat aatcactcca     48840
     cctggcatgt cgagggagat gctggagcaa gctgtcaaag aagggtactc agagcgagac     48900
     gtcataaggc atcgtatcct ggagtgccct atccgctggt tcattgaagc agatgagaag     48960
     gcgtttgatc atgagttatt ccacgattac gtggttgctc atggttatga cgagccttcc     49020
     agtgaagtct atgagctggc agagacgtgg ttatggcagg gcaaagatta tgcattgata     49080
     gcggcggaag aaatagttgc tcgcgatctt tgtgttcgtg atgacgaaaa tgagggctga     49140
     gcctatgacc gctgtagtgc atataataga agcagataac cttgtatcgg cctgtgggat     49200
     tgtgttccct gagaacaatg tcgaatcact tgctgaggct aacgccatgc tgagcgcagt     49260
     gttggaagat gcacgtaagg ccagcaatct ggaagacaag catgaccttg agtcacttca     49320
     aggctggctg gaagagaaca tcaattctca actggtaggc gcgaagtaaa ggtgtgaagt     49380
     ctatcttccc agtggcatcg actttcacat gtgaaaattt tgtgtccctc ggaaagcaag     49440
     tttttgttct ctgatgagag taaacagtga ggtagctggc ctccccaaac aaacagcaac     49500
     ttactcaacc caacagggag ctagtcccgg ttggggctac tccttattaa aggagtcttt     49560
     atgtattact gtcatgcctt tgatgtggcc tttgaggcta tatctcagac cgcctccggt     49620
     ggagatgtaa ccccatccat gcttcggaag gctctccaag tcaggttaga ttcgatgtca     49680
     gatgaagaga tcgttgaagc ctgtggagtg ccatttgata cgtatgagat gacactggaa     49740
     gaaaaaagca gttgggaggc cactagagga attttcaacg agaatcagta aatccaagcc     49800
     gggtgcattt gcccagtcca ggacgtggtg cgcccccata ctatttggag tgcatcacct     49860
     gaacagatgg ctggctttgc caacgccatt cagtgtcacg gcgttgctgt gaactgagaa     49920
     ccactttaaa cccatcgggg tcattacttc ccgattggga cggtagtgac tcctcaaccg     49980
     aaaggagaga gcttatggct actatcgtaa acacaaaatt aggggagcat cgaggcaaaa     50040
     agcgcgtttg gttggaaggt caaaagctac tgcgtgaagg ttactatcct ggcatgaagt     50100
     acgatctgga gttgaaagat acccaggttg tgcttcgcgt caaagaggag ggtaagttca     50160
     cagtcagtaa gcgtgagcgc aatggccggg tgtctccaat catcgatctg accgcgcagg     50220
     aacttgctac cgtttttgac ggtgtagaga tgctccgcgt gttcattcgt aacggcgcaa     50280
     ttgtgatctc cgctcaccat caacaagagc gagtgatcga gcgcgtcaac cggcttatca     50340
     gtaagctgga aaatggagaa tcgctttctg tatgcagcct ctttcatggg ggtggtgtgc     50400
     ttgataaagc tattcacgcc ggttttcaca aagcgggaat tgccagtgcc atatctgtgg     50460
     ccgtggagat ggaagggaaa tatctcgatt cgtctttggc aaataacccc gagctctgga     50520
     atgaagattc aatagttatc gaatcaccaa tccaggctgt gaatctcagc aagcgcccac     50580
     cgcaggtgga tgttttgatg gggggaatac cttgtaccgg cgcatcgaag tcaggtcgta     50640
     gtaagaacaa gctggagttt gccgaatcgc atgaggcggc aggtgctatg ttctttaatt     50700
     tcctgcaatt cgtagaagcg ctaaacccag ccgttgtgct gattgagaac gtgcccgagt     50760
     accagaacac tgcttcgatg gaagtgatcc gttctgtact ctcttcgttg ggctactccc     50820
     tacaagagcg cattctcgac ggcaatgagt ttggggttat tgaacgccgc aagcgtcttt     50880
     gtgtcgttgc actttcccac gggatcgacg gttttgagct tgagaaggtt cagcctgttc     50940
     gtaccaagga aagccgtatc cacgaaatcc ttgagccggt gcctcttgat tctgaacgtt     51000
     ggaagtcatt tgactatctg gctgataagg aattgagaga caaagccgct ggcaagggat     51060
     tctctcgcca gctcctgact ggagatgatg agtattgcgg caccataggt aaggactatg     51120
     caaaatgcag aagtaccgag cctttcattg ttcatccgga acagcctgag ttgtctcgca     51180
     tctttacacc gatagaacat tgtcgagtga aggggatacc agaggagctt atccaaggtc     51240
     tgtcggacac tgttgcccac cagattctcg ggcaatcggt agtctttccc gcgttcgagg     51300
     ctttagccct cgcattaggg agcagccttt ggagctgggt tggaatgatg ccaatcatgg     51360
     tcgaagtcgt ggatgaatca cagccgatga tcggtggtga agacttccat tgggcaacgg     51420
     cattggttga cgcaaagggc gcactcaagc tgtcaccggc agcaaaaaaa caggggatgc     51480
     ccttcaatat tatggacggt caattggctg tctattcacc taacggaacc caaaagagct     51540
     gcggccatga gccttgcgaa tatcttccgg taatgatgtc cggagacgca atcatggtca     51600
     cttcatcttt ggttcattag taacacaccg gggcaatgcc gaaaggtctt tgctccggcc     51660
     tatccgaaag gagagtgatc atgaaaatcg aaactgttgt gcctttgcct cccgaggatt     51720
     caggcctgca acactgcatt gccaggttcc ataaccgcaa catggattcc aaacgaaaag     51780
     acaaaaaccg ttttttcagg agggagccgg ttatgatcgt aaacccagag accaaagcaa     51840
     aggttctccg gtatgcgatg ggcaaccctg ggaatttatc catcaccaag ctggcggtcg     51900
     cgctggatta cgatgcggta gatgctctgg gtgttcgttt taaagacact gtaaatcttg     51960
     aggttcgcag agccaggcgc tgggaagtct ggcagtggtt ctggaatcat ccggatcaaa     52020
     gtgtccaact gtcaatcaaa ctgggcgtgg ttggcgctgt gttgggagtc atgggcttcc     52080
     tgaccggcgt agctccgtac ctcttgggat aaaccaataa gccgttaacg ggcaatgtaa     52140
     gtccggagac ggcttgcatt gctctctcga aagtggagag tcaaatgaat acattagaac     52200
     aacttgtaaa tcagagggtg cttgaggaag gtctgaaaaa ggcgaagcca ttggccgcgc     52260
     aaatggggct tgaatcagta cctgatgaga tgcttgaaat gatctgccca aacttgaact     52320
     actctgggca atttacgcca gctctgtacg caagatttca aagcgtaaag cgattgctga     52380
     aagaattgtc ggaacaaacc tcacctaagc acgggcatat tgtgaagttt accaaccaat     52440
     atgggagcta cgatgagtca gctttgcttt tcaaagaagg cgacgtcaga aaccagaacc     52500
     tggttgcttg tgtgggcggg aaaacgctaa acctcggaga gttagagctt cgagattatg     52560
     ggctcaatat gcacatcggt tgcggtgggc catttgagcc gatctcagaa gcgcagattc     52620
     agtctttgtc tgagtttgac ttctatgaga cgacctacag attctggggc cagaatccat     52680
     gtggaaacgg gatgttagac atcaccgttc cgatgaaacg ttggttcttg actgtgtagg     52740
     ttcaacctga gtgcgccgag aaatcggcgt acctttccct taaaatgggt aataagcgca     52800
     ggggggaacc cctcgctttc ccaagcatct cgctctacct ggatgtttcg gaaagtgcct     52860
     taggcgctca agtgcggtag ctggctgcca aaaacaaaca gcaaattatc aaccctgccg     52920
     gggatagctc tccggtagga gactatctcc aaaaaactta tggagatata gatatgtcaa     52980
     atttcgatca aatagcaacc gtacacaaac ttacggttgt gagaaaagtt gatgagcatg     53040
     attcagaatt cgatgtttac ttatgtgaag accagctcgg taacgaatgg gctttatcaa     53100
     aagaagggga gcctgagtat gctgagtggg gtgtttacaa ttatatcgtt cgtaacgatg     53160
     tttttatgat caccactcct gtatcactac cttgtatgac atgggagctt gtagagcttc     53220
     ccaaagatta taaaggtgag ctacaagtcg gtatgtcact taactagatt attaaccctg     53280
     acgggagatc ctcctgtcag gggatctccg tcataaactg aatggagata tagcatgtct     53340
     aaaaacgtca acgatgtttt ttcaaaccga acttctttgg aatgtactgt gaatgcagcg     53400
     ctggatcgtc gtatcggtct gcgtgtcggg ttccctcatt accgagaagg agcaaacggt     53460
     gtggtttgtg agattgaagc agagtatcca ttgctgaaca ctcattcgag tgttgcatgg     53520
     cctctgatcg atgagctcaa cagttacacc attcaaaaaa accaatcgct cattgatcac     53580
     attgataatg cggtcgctga actgttgaaa cacaagactc gtctacagct tgatattcaa     53640
     aagctgcaag acggtgacat taatctggtg aaacaggcca agcagcaata cgacgacaat     53700
     caaatgtcga gtaccagcta gtaaggtctg atagccagat tcaattttaa ccctattggg     53760
     gtgctttccc ggaagggatg ggcaccctgc taatccagga ggccctatgc aacaagcatt     53820
     aaactttgat ctttcagaac aacccctccc agtgcttttg cgcggggata agtgggattc     53880
     tgtttggtca gaactgactg acaacgagga tttgaacttc gttgatgcca gtagaggaac     53940
     cagtttgtca tcgttgatca cgtcatcggt tgaagccatt cacacggcct tgattgatgg     54000
     gtggaccatg atgatcggct attccagtgg taaagattct gaaacggtct tgcatctgtt     54060
     cctgatggcc ctgatccggg ctgttaggag tggagcgacc atcagccagc accacttcat     54120
     cttgcacact gacacactga tcgaaagccc agaggtaagg tggctggcgg atcagaaact     54180
     ggccgagctg gagcgtttca ttgcgaagga aaaccttcct ctgaccatcg ttctggcaaa     54240
     gcctgggatc tcgcagagtt ggacgggccg aatccttact gggagggggt tgcctacgtt     54300
     ttccaactcc acggcccgtc agtgtagcca ggatctaaaa atcacctcgg ccaaaagagc     54360
     gaaggcagct tatatgcgag agcttcccaa agaggttcgg cagaaagtgt gccttttgct     54420
     gggtagtcgt gatgctgaaa gcactattcg tgcagccagc attgcaaaac agcgaggaag     54480
     ctcagatcgc gtcattaaga cgaaagatgg gggtgagctg tatgtggtga aaaactggtt     54540
     ggcgagtgat gtatgggagt tcttgttatc cgctggcatg ggttcaacat atcctctgcc     54600
     aagttacttg gagagcaatg tcactacggc agagctctac aaggcggcaa caggagagtg     54660
     cgtgtggtcg gcaacagaga aaaaggccag tgacgcctgt ggcgctcgct tcggttgctg     54720
     ggcttgccag gctgttgggt tggataagtc aatggagaca ttgcttgcca cggaccctga     54780
     aaggcatggc tacatgtcag ggctgaaccg catccagcgc tacttggcta agcgccggta     54840
     cgcatgggaa gaccgccatc ccgtaggtcg aacgatttat gagggtggtt acatcaaaat     54900
     acagccggac gtttacagtc ctgttttcct tgagcgattg cttcatgtct gttgcagcat     54960
     ggactacatg gagcaaaaga gagctgatga gctggcttat aagctggcta ctgggcaaac     55020
     agaggataac gactggaacc gtcgaatggc agagccacaa ttccggatca tatcggaaga     55080
     ggctttagtc catatcgact tcatgtgggc cttccatcat ttcaatgata agcctttcca     55140
     tgctctggag atttaccaca gggtttggtc gatgggtgat ctggacttgt tggaagacga     55200
     gccgcagtgt gaaaccgttc ctcagtcacc aattccgaag ccattgtggt tgaaggttgg     55260
     ccgctggggc gatggttcgc tttctgatgg cttggccgat ccgttagctg aaatggctta     55320
     ctttgacggc ggggatgacc cgttggcagc gaaagtgatc aataccgcag acggaaagag     55380
     aagggtggtt tgtttcgcag aagatgatga ggtgaaagtc gatcctgact ccgctgcgtt     55440
     catcatctgg aacgaatacc cgagactaag ggagtcagtt ctaaaggggc attacacccc     55500
     cggcagcgct gctcagtttt accttaggtt tggagcaatc cagcttgcga aaggaaaagg     55560
     cgctttgtat caccgcatga tgcaaagagg tcaaacctac caccagatgg gccttacagg     55620
     gctacagacg atggaaggaa tccaacaacg caaggatgtc aaagtgctta gcgatgccaa     55680
     gtacaaagat ctggtgaggc gaaagatcaa aggaagactg gcaactgtac gctggtgggt     55740
     aaacttgcac ttaacgttca agtaccacct gcatcaccgg actccgacag gtttgttcat     55800
     cgagaagcaa ctcaaccagg aagcaatgga agaacagaag cggcatcagg cacgatggtt     55860
     taactacgtg accgatgcaa tgctatgtta ctccagtgca ttctgtatga gcgtcatgga     55920
     agggcgagaa ggaagcggaa acactaacat ccgccgttac atgatagcga ccagaagaaa     55980
     ggcttatacg gcgctctgtg agctcctaaa caatactgat gcaccttggg tgtctgatgt     56040
     attgcagggg gcattggggc agtatgagtc gatacaggca gccttaaccg aaggttcagc     56100
     gctgactatt tatacgcaat aaacttgaag atgcatgaga gggtatagct catgccattg     56160
     atttttaatt attaatttaa aaatcaaacc agcatcttga agttaaatga gtatatctgg     56220
     attggatcaa cctactatca aaacgtcacc cagcctcttt ggaacgacat gtcagaacga     56280
     tgatcaaggc ggttcaacgc aaacatcgtc gcaacggcac agagttgcaa agaggacaac     56340
     aaggcttgtc cttggccgca taaaaggccc tccttcggga gggctttttc tcttgcaccc     56400
     caaaagggca attacagcgt tttacccttg tacatgcctg tcatactctt tgcttattgt     56460
     cagcgtttgc tggctataac ggtagctggc ctaaaacagc aataaactta cccctcggga     56520
     ggaaacccct cctggggttc tctcccataa ccaaaggaga gaagcatgag cctaaaaaag     56580
     ttaagtcggc tggtggacca acaacgaaag acccaagatg aaatcaatga tgaaatcatt     56640
     ctggccgtca aagaggtgtt ggctaccaat tcagtcggtt tagcccgtga gcttgttggg     56700
     ggtgtcccgc aagatcatcc attccatccg tttttactcg ctatagctaa gcagcttgac     56760
     ccgagataac tcattaaccc aaccgggtac accaaggccc ggtcggcttt ggtgtacctc     56820
     caactaattt tggaggcact atgtctaatt caaatttcgg ctttttagct ctggccttgc     56880
     gccaacgcct gatcaaacgc tggtcactga tgcactctgt tcaaccagag tctgtgttgg     56940
     agcacagcgc tgttgttacc ttactttcct atctggctgg caatatcgct attcagcaag     57000
     gtaagtcggt ggatctggca actatgctgg ctcatgcttc tttgcatgat gctgccgagg     57060
     ttctctgttc tgatgttgta acaccggtca agaaagcaaa tgctgttttg cagcgtgagt     57120
     ttgaaagatt ggagaaagcc gcagaggaaa aactcatcca gactcttccc gtagagctcc     57180
     aggatgcagt cgccatagcc ttcgctcccg gtggctatga acaatcactg gttaaggcct     57240
     gtgataccta ctccgcttac atcaagtgca aacttgaggt ggccgcaggt aatggtattg     57300
     agttccagga tgcgcttagc aaaatggagc tggttgttgc tcaggtgaaa ttggattttc     57360
     cggaaatcga cgctctggat aaatggtttg gtaacggact cggccattca gtagataagc     57420
     tactgtcagg gggtaacgat gactaaccta caacctggcg acatcaagat taaagacttt     57480
     ggccgcgacc ggaaattccg ttcggttgat gagcttcaaa gcactttgtc tgaacagtac     57540
     aaaggtcagc atgtcagtat cgtttaccca ggaaagccta acgggttgct ccgaacggtc     57600
     tttgtcagtg ttgatgatgc tggtggcgta aatcagtcct atggagacca atctccagtc     57660
     gatttttctg ccatcaaaga tgaccttttt ggtgaaatgc tatgaaagca tcactaaaat     57720
     ctttatcaaa agagcaagtt aatacactgg catgtaagct aggggaaatt caaaggcatt     57780
     tggccgaaga tactgaatta ctctctgatt taagtgaact aggtattgat ttgtcgtctg     57840
     agattgatgg ctacgattgt gtgatagaag ctctatttga gttgcaacag ttcgccaatc     57900
     aaaatctgtc ttaataagtt aaccctcact cgggcgcatc atcccgagag ggtgtggtgc     57960
     gtcctaacta taaggaatgc actatgtcta actttgaaca agctctggaa cgtactgacg     58020
     gcaagacact gattctcagc aacgggagta agtgggcagg ccaagatccg gataacattc     58080
     agactttgct ggatgttctc ggcaacaacg ttcttgatcc aatgtttgag cagtatcact     58140
     gctaccgttc ttatccgttt gaacccctga ttaagacagg gcgcaatgat aagatattcc     58200
     agccttggct gggagcagct tgtttctttg ggaactttct tacggtctct catgttttca     58260
     acatcatcac gaaagatgac agtgttgttg aggcgttaaa tgaggcgatc cagaagaaca     58320
     tagcgactga acaataccag cagtatgcct atgagcgtta cgccggttgg ttctacgctg     58380
     aaactagcga agggtttagg cttgtatctc caagtgaggc tgccgacatc cgtgcaggcg     58440
     cagtttcaaa gctgcgttac ccaagaaact tcgaggttat gaaaactgcg gttatcaaag     58500
     gccctcgatt cgatgctgaa ttaagccgca aggcttctta aacccaaata ttaaccccac     58560
     gggggacatt agtccctgag ggggtggtgt ctccctctga aactaaggag ataccaatga     58620
     ttaaacagca ttttcaaaac gaactggtca agtgcggata cccggatgat ctgaaaattg     58680
     agtacagtct cggatactgt cagggggatg gcgtagcatt ctacggtgat ttgagcattg     58740
     atgacgtcaa agcactcatg aagcgcctat tcagcactga gctcggccaa gtagatgctg     58800
     tcagtcgcgt gaagaacctg atggcacaga aagacattga gaatatgctt tttgtcctcc     58860
     gtgagtatgg ttcctgtgac ttgtccatta cccggaacag ttatgggaat cactacagcc     58920
     actggaactg catgaacatc gacgacaacg tggactttac agggatcttc cctgatgatg     58980
     acaccatgct aggaaccggc attgaagcga ttaaccagga tatgatcgag cgttggcaag     59040
     acatctggga tcgttttgtg ttggagctgg cggatgatgt gaaaagcatt tccaagaagc     59100
     tcgaatccga cggatactcg ctgatagagg catctccatg tgaagaagag gtggtttggg     59160
     aacgaaccac tgaaaattac ctggtgcgtg tgacggaact tcctgagcgg gatttcgata     59220
     tgggccactg ggatgacgaa gtacgagacc aaacaatttg ctccatcctg gaagggaaag     59280
     agcgagttct tggcctacga gttgaggtac tctctcgtga aaacgagata gttctgggtg     59340
     aagatagtct gcacggttta accgttgcca gcgatgacaa aagctacgct ggttacagac     59400
     gagaacttct ccggggagct atccagcaaa ccagggactt tttctctcgc cacctcaaag     59460
     cggcataacc aaggcagggg gaaacccctg ctttactttc aaagtcttct tactcatggt     59520
     aaagccatca gtaagcagat tttgttctct tcggagagcg aaaacgtgcg atagctggtc     59580
     gccaaaaaca aacagcaaat taacgttaat ttactaatcc ctgcgggagt ttatctcctg     59640
     ctggagatac ctcccgtttt ttctggaggt atccatgaat agcaaattcc aaaattttaa     59700
     gctggtttat cgtcaaggtg gtcgtcgctt agagcgtgtc tttacagaca ctctttacgt     59760
     gaatgtgaag cgtgtcgctg actcgtttcc cccgaccgtt ctttggcgca tcttgccagc     59820
     gtaaaactcg gaaccttaaa gctcggcttt ggccgtgacc tttcaataac ccatgcgggt     59880
     acacttcccc gcacggggtt ggtgtaccca ttaactttgg agtacacctt atgaaccaat     59940
     tagctaaatt ggacatcgcc caaatccgtc aacaagccat caatgatgga ctgctggtgg     60000
     accaatcttc catcggtaag caagctggtt ttctgacgaa tgtggcagtg accccggcaa     60060
     ttgtcgatgg tgtatttggt gcagatggta aacactcagt agaagacttc cttctcatgt     60120
     ttttgcagct ttgtgttgct caaacaaagg tcgcttttac tgacaacaag aactggggaa     60180
     agattcgtct ttactacccc atgcctactg tagaaggctt tttcaaaccc actgaggttg     60240
     tgattaagtc agatcctgta accgcagatg tcacagtcat gatggcctcg gaagagggta     60300
     ctcatttgtg cttgtgatat tcacaaaatt cgcctccgtt tcgggggcga tcttttaaac     60360
     cccttgccgg ggagttctcc ccggctgggg agcctccttg gcacatcctc ccagtgtcgg     60420
     ggtttcctta aaaccctggc cacggggggt taaggaagcc tcgatgctgg ggttcacgct     60480
     aaggagaaaa cctatgtctt actacaaagc tgacaccgtt cgtgaagcgg ctaacggaaa     60540
     ctggctattc atcctggcgg ccctagcgcc ccatcttgaa ccagctctcc gtaaaccagg     60600
     tcgtcatgtt tcttgcccta tccacggcgg gaaagatggc ttccgactgt tcaaagatgc     60660
     ccacctgact ggtggcggcg tatgcaacac atgcggtgct aatcatgatg gttttgagtt     60720
     gctcatgtgg ctcaacaact gggactttaa gcagtgccta agcgaggttg gtgattacct     60780
     gggagttgag aaagagcagc cccagtatca acaatctgct gcaccgtcac gagctcctgc     60840
     tcaggccaaa gcgcctgttc agcaagagcc catgaaggtg aacaacaagg ttctcgattc     60900
     caagaatcgt aagaaatcca ttgccggtac tctgatcgcc cacggaaaag ctccctacga     60960
     gcataatgaa gacaatgagc ttagctactt tgccttcatc cgtgacaaga gtggcttgga     61020
     acgcaccgtt tggggcgtgg atcttgaaag agccattggt gaaagcgaag ccaagtatgg     61080
     ggatgagatc atcatgacaa acctcgggcg cgaacctgta actgtcgtcg ttgaagttaa     61140
     agacgatcag gggaatgttg tgagagaaca acctatgcaa acgcaccgca acacttggtt     61200
     ggtcgaacgt cgtggcgcta cggtaacgca gttccgcgct cgttcaaacg gtggtgttga     61260
     accggtgagt cactatgttg agtcggcccc tgtggtcaac cacacggtag acactccggc     61320
     accgcaagca cacgctgcgg ccacacaacc ggaagcgcaa agcagcgaag acaagccgaa     61380
     agttgttccg atgtttcgtg aacaacccaa gccttggctg cttgagctcc aagaggaaat     61440
     ggagaagaga atggagcgcg aacgcgctta cagtgctcgt ctccgtgaga aaatcgagaa     61500
     ggtatggaac gagtgtttac cgttctccag tcatgtgact gagccaatgc gtctgtactt     61560
     caaaaaccgt gaacttctgt tcaaggtcga tgaagtagaa aaaacagact gtctgcggtt     61620
     caatccggct atggcctact acgacgaaga tggcaatgaa gttgggaaat tcccggctat     61680
     cgtctgcgct atccgagatg tggaaggcaa cctggtaacg ctccaccgca cctatctcac     61740
     cccaaacggt aagaaagcta aggtcggcaa cgccaagaaa atgatgccca ttccggaagg     61800
     tttggatgtc aatggcgcgg ccatccgcct tggtgaaccg actgagggta tcctgggtgt     61860
     tgcagaaggg ttggaaacag ctctatccgc ttatcgagtc actcaaatcc cggtttggtc     61920
     aacggttaat gcgaccctga tggagtcctt tgaggttccg gaaggtgttc acaccgtact     61980
     gatctgggct gacaaagata agtctgtgac tggtgagaag tcagcgaatg tgctgaaagc     62040
     caagctggag aagcgcggca ttcgtgtgta catcctgctg cctaagctcc ctatcccgcc     62100
     cagagcgaaa gggattgact ggaacgatgt cctgatgagt cagggaagcc ttggtttccc     62160
     gaatgctcgc tacctgcgcg attttattgc gagaaggaga gatgagtatg cccgtcattg     62220
     atgtctcaaa agttgatacc acgcctggta acgacgaagt gtgctccttc tcaccccctg     62280
     aggggtggga gggtgactct gcggcttaca ttgagcttat gcggtctcgg tatcgtaatc     62340
     tgatgcactg ccagagaatg atggtgacgg cttctttcgc aagaagggag tctatccaag     62400
     ttactggtcc ttttgctgac gaagcgacga agatcattaa ctcaatgaaa atgaacaagg     62460
     caaagccgac atcggctttg tctgcttaaa actttaaccc tgagggggtg ttcatgccct     62520
     ctcgggcatg attcgcctcc tcttcaactg tggaggtaat tatgaaaaag tttttgcgta     62580
     ttaagacgtg gtttgtgcgt cttttttctc ctgacaagaa gactctggga gctatcggtg     62640
     aagacctgcg taaggtcgcc gtaacagcca tcggtgttgg tattgtagga ttggctgtat     62700
     ctggggacac tattaccgtc aaagaagccg gtttagtgtt gtttgttggg gttatcctgt     62760
     ggatctatgg tataatctta accaaggtca gcaattccta agggggacaa atggacgctt     62820
     tcacattagg tatgttaggg ttgcttttat ttttcactgt cgtcactggc ggcagtctgt     62880
     atctctacca tgagaaacag aaagaaaaaa agcatcacaa cgcctaaaga ataactgcga     62940
     aaatgaacga aaaggccagc aatagctggc ctttttttat acttgccgtt tgggttgtta     63000
     catgtcacga taaggctagt gtgacatgta ggagaccata aaaatctgtg gggcacttat     63060
     gcagcaactg cctctgtcca ataatgatcc gttttgtcac ctaattttat acccggatac     63120
     cagtgctcaa attgggtttt taaatcacca ttgagtaccg ctgtgcgtgt ctggagtaag     63180
     taatgtgcac cttgctggct ccattgcatc tgctgctttt tcaccatccg tttagcgata     63240
     acttcattga tcgtcgattc aacaaatgaa gaggaaattg cttcaccata tcggtacatt     63300
     tcaccgtaat tcgggatcat catgctgtta ttttcaatat aggtatacat ttcatctata     63360
     tgttttaaca atgatttatt attaccataa tgcgatatgt cctcatcaca cattgccgca     63420
     caatcatcca ggtgttctaa tgccttaatc acatttccat gccagatata ccattttgta     63480
     cgggttaaag aatctaataa ttctgtacca agctccggat catttttaga tacccctttg     63540
     gaatattgtt ttagtacggt cagacgcatt gtaatatgaa accaatcaag tatgtgctgg     63600
     gattcggggt acaggttaaa ttgcagttcc cgaagattat cggctccatc agataaaaag     63660
     gtaatttgtt gattagcctg cattccctgt gaagataatt gagcaagcag ttttcttctg     63720
     gggtgatttt ccagacattg cacaaatccg aaacgtttag cggggacatc agcagagaaa     63780
     gattttccgg cgatgatttc gaaatgatgt tttttatcgt cccgatttct gacataacct     63840
     ccatcaatac ccactgtcat cggtttcccc ggtttgggta attttgccca ttctctgggg     63900
     gagccagaga gaaaatcagg cagcccatct aactctgcct cttgtctttt ggcggtttga     63960
     caaaggtgat ttcggatggt ggcggcatta cagcgttctc ccaccggcag aatatcttta     64020
     agcagactgg cggtcagtcc ataggccatc aatgatgccc atttggtttc tatatacttg     64080
     agttcgggat gagtatattc actacaccag tcattgagca gattcactgt ttggggtgaa     64140
     ttcttctcac aaatacaccg gtaaacccga aatccctcga caggaataat gccaaataag     64200
     gttcgatact ggattttttg tcttcctttt atccggcggt ttcgctgaca gcaagggcag     64260
     ggacgatgtt catccagaaa ttcagccgcc tgtttctgga tcactgattg ctggactgtg     64320
     ttcaaaagct gtttagattc agacagggaa aggcctatgt cattgggaga atcagtctgt     64380
     ttttctatcg cgagtaattt ctccgtatga cgatgacctg atttatcaac cgtcgcgatt     64440
     tggatcgtga gttgcatgat gctgtcctcc cggggctatc gctgtggtat acccctattt     64500
     tttaactggt gacgcaattt ataatacgta gaaacaccta atcccacatt atcacaggct     64560
     agctttaact taatgccttt cgctctcagc gcgtcaatct gagggagttt actgatatcc     64620
     gcaggcggtc ggccagtgcg ttctccgcgc agtttatcac gatgggttca agttccggtg     64680
     aatcaagatt gagccgactt aattggcggt taacctttag acgattgaat ctgacggtat     64740
     caagagcctc aatcaaggga cggatttctc cgaccgtggt cgtttcatca gcatgaataa     64800
     tcgcgttgag caatgccagt gttttagtcg tttcatcggc taacgtcgcc ccgggcattc     64860
     ggtttccggc cagacaaaaa ggtgatttca ggttagaatt atcgagaata gtttcaatac     64920
     ggatatcgtg aagccagttt tcgaaaaaat tgtattcgta agtaaaacga tcaccggcat     64980
     caaattcaag gtcatcgagc gtgactttgt aagggttatc aggaaacgca attccgccag     65040
     aataggaaat accataatct ttgccataaa tacggaattg gtgaagatgg tcgtcatgcc     65100
     atccttgagc aatctgaatg atatagtgaa aagccgctaa agaggtcttt cctgagagtc     65160
     tgaaccgccg ccaaaccata gggctaacgt tccgaagagc cactttcaca atatagattt     65220
     gcatgaattg atgcccgata aaaatatgtt gcatggctca ttttatcgcc aactgaacag     65280
     agtgccccaa ggatttttat gctctccttc ttgtgcagtt ttttctgcct gttttttagc     65340
     tgttgccgga ttaggcataa aacttccagc aatcagtagc gcaaggccag cggcaacaat     65400
     gaacaatgaa acgatagtgt acatgtgcct atcttccatt agacctatgt tgttgactcg     65460
     tccaaatgcg gtatcaacag acacgttcat tgttagcgca aaaatggcta aaatcacccc     65520
     tatagtaatt accacagtcc ctgttatttt cataagcatc tccaaatgta aagggttata     65580
     atttattata acccaaaccg ctgacaaacc ccgttatttt caaagaggtt tatcgcatta     65640
     ttgtggcaat acaacggggc gactaagtta cggataaatt cgaaatccaa ggcagcatcg     65700
     actttgcgaa ccagatgatt ttggggcaca aggtcatcaa gtgagagcgt ttcgggcgga     65760
     aaagtttggg gagggggcat tcttaacatg gcggtaatct ccgtcgagta aacggaactt     65820
     gattaaagca aagtgccgga taaaaaaacc agcactttgc caataatctg aaacgtagga     65880
     ggtattaaac ttcctatttt ttgtgctctt gagtcgctat tgagggaaga agtcaaaaaa     65940
     ggggcagtat tacggctatt ttgagtaaaa tgcaacataa ttcatctctg caaggtagct     66000
     acaccatgat accgcctcgt tctactttaa aaaagataag ctgacatccg aatcttttcc     66060
     tttattcttt acgtgaaatt gtcacaccgg caacttggtt atcataacaa cgttcaatag     66120
     tcagttcact agatgaaccg aaagccttta agagtgtttc caacatacct ttcccgctat     66180
     tatcatttag tgtttgtttc accgaaatct ggccagaata aatattatta atcataatag     66240
     aaaatgatat attaggagct tctttattat caactccgac cgaaactgag cttacataac     66300
     cagttttatt tagaaaacta gagcaattat taaatactgc tgctgttgta actgtaggga     66360
     tcaacatagt tagcataaaa agcattgaag taataatttt catggataaa ctcctgttaa     66420
     tttttcataa aagtttttaa taattctata ggaattaatt tattgataaa taattactta     66480
     tttatcaata aattaatctg acaagaagta attaaagaac atcaatattt aaataattaa     66540
     atagtgttta atatcatttt taaacatggg tattaattta aaacattaat agtagttatt     66600
     ttttaataat attttgagta agttctaatg ctagagtttt tccttcattt gatacacaaa     66660
     aactcatggt ggattctgtt ataaatgcaa gtttaagaaa atcatattgt atctgtgtga     66720
     ttacgtctgt attccctttt aaataatacc atttatcatt ttctgaaatt ttataattta     66780
     tatttcctac attatcagta tttatatctg taacttttcc tacttgagat gaagcgatat     66840
     tatttggttt tttacaaatc attgctaatg aacgttcatc agcgatggca gaacttgaaa     66900
     tagcagccag tacaagtggt acgataaaaa atttcatttc aatctccttc attaagttac     66960
     cttactaaga aaaataacta ctcacatggg gtcgattttt attgtaatct tgctgccaaa     67020
     accacgctat ttctttgacc tgactgagtg attcaaataa ttcagttttc aaaaacttcc     67080
     gacgaaatga accattaaaa cattcgataa aaccgttttg ttgtggcttt ccgggctgaa     67140
     tatgacataa ctcaatattg ttactatcac aataatttaa tagttttgcg ggtatcaatt     67200
     cagggccatt atcaacccga atttgttgag gcaaccctcg ttctattttt aaacgctcaa     67260
     gtactcgaat gactatttct gccggcagtg aagtgtccat cacatcacta caaatactag     67320
     ggcagaaaat ctaattataa ttgtttcatt ttagggcgaa gtgaacacag ggattaactc     67380
     tatacgatct ataataactt tgttagttga tatgtttttt attaatatat tgatttgata     67440
     aatattatct ttaataacaa aatcgtgatg attgtctgtt tgtttaaaac atagatcaga     67500
     atagatatat tcatcttcaa tatcatcttt catatcatgg ttatttaatt ccatgttgat     67560
     actgtggcaa tctacattac cttttccatc tgtttgagaa atagaaatat taactttagc     67620
     attttttact tttatgtgcc aaagtctaat tttatagtct ccaggaaaaa tccacctatt     67680
     aggttctaag tcggatttag ctagtaaaaa aatgattctt tcatctttac gaatgcgtac     67740
     aacagcacct tgagagaaac caagattaga aatgatagaa tctctatcta gaggatgaat     67800
     ttcattatct ttgttatact ttgagctggt tattgaatag tatatttgcg tcttcatttc     67860
     atttaaattg aatgcatttg tactaggttt aaaatcgata aaatatttaa atctccagcc     67920
     gaaaatgttt atagtattat acttatttct tatactccca tctccacccg taagggtttt     67980
     cataaaaagt aactgtggta tatcctttaa atattccaat tcatctttga catctaaata     68040
     atcactaaca tttaaatacc taccaagttt aaactctttg aattttaatt tgtaatcctt     68100
     gggatctctt acgaaaagca aatgaatttc attacctgtt gtggggagat caccatcttt     68160
     aaaagtcatt tcctgcaagc aaacagtagg tgttattaat gaattatgtt gtttatataa     68220
     tggataaatt ccttttaccc cagttaactc tttattataa aaatatattt tttctgagtt     68280
     atgtacatta ttcaatttat ttccaatgga tattgttatg tcattaaact gtttcaaggt     68340
     gctaagtgta taaactaacc ctcttactgt ataagggtca atgtataaac gatcgatttt     68400
     accaaattca atagaatata atttaccaac agcataatga ttgctaatat ccttgtcaaa     68460
     ctgcctagtt gataatgaac gatcaaagtc agtatcttta acaacattct gaattacacg     68520
     ataatatcct cttttatcaa ccagtctatc taaaggatat atttcaggat taaagaaatc     68580
     taacatcata atatatgcat gtacggatga ggtacaaata tttctatatt cgtttaaatc     68640
     aatccaagtt tttttatcat tataagtgat tttgtttaat tctttattat atacttcaca     68700
     agaataatca gaatattctt ttataagttt ttttattttt tctataaagt gatttttagt     68760
     tactctggaa cttggttcaa tgttatcatt gaaattcaat tcatcataat aagtgatagc     68820
     agtatataat aatgttatat gtctataagc ggcgttagca aataaaggga gtaaagatcc     68880
     tcgttgttta ggatgttgga atagtggcat tgatgaagtt aattcattat ctaaataata     68940
     aatttcacgt ctgattgttt cagtgcctat tgttttattt tcttcccatt cttttaattc     69000
     tttagagaaa ccttcaaaaa ggttagctat tcctatcaaa tgttgtttgg agttatcata     69060
     tatagcctga tcaatttttt gatcaattaa agaattaatg ctattagata tggtatcaaa     69120
     cacatcaact ttattttccg gtttaaataa tactggaaaa atagctagtg aagttgcaat     69180
     gattgctgat gttaaaggaa aaaaaggacc tgtaatcgcc acggctattc cagtaatagc     69240
     cgttattgct atatgcaaat cttcaggtgt ttcaatggaa ataggagaga tgtttttctc     69300
     tgcataatca tcattcataa tgagatcctt actaaaattt agtggtgttg attgtatatc     69360
     attattattt tctgatgaat agattaatct atataaaatt cttttacgga taattaaata     69420
     attctttttt aaacatatcc tagttcatca gaaaataaaa caaaaagacc acttaatttt     69480
     tatggtatta tcatttatta ttaattggat ttgtctaatg atttcatttt ttaaaccaga     69540
     gtattttaaa taaaaaaaca ctcgacaacc ccttcctcca gtaatccaaa aatattatta     69600
     cagctttttg ttatcataag taagagtttt ggtcgtgact ctaatttatt gatagtgatg     69660
     aatgttcaga taatatccta taattctgtc atgcatttct atggattttg aaaaagccaa     69720
     tgttttgcga gtcagtcttg ccaaatgttg acgaagattc aggttatgcc tctctatgcg     69780
     ttgggtataa cgcttgctgg ccacatggag tttccctgcg agtgcttttt cataactttt     69840
     cccgccatct gtcatataaa taataatgtt gaaaggagcc agtaaagcca acaggcgcat     69900
     taatgtcttt ttggttcttg ggccaaaaac atgggcgatc acttttcgtc ttatcctgtc     69960
     gtaggcataa aagagccaac ggggctgctt ctttgacttc acgtaagacc attgttcatc     70020
     catttcgcag cagacaatca cttcggtgcc gggtttaatg gcttctgtta ccgatttggg     70080
     tttgagtttt ttaaatgccg aagtacggta ttcaggccaa tccccatcac gcgtgctgtc     70140
     gcccgacagc ccatcccatt catggccata tcgacgattt gcttatgggt accgggacga     70200
     caagcggcat aagtgaactc ccgttgccag gagtgacggc aggattggca aagataacgt     70260
     tggtgaccag aacgcgagcg cccattgcga tggatccctt tcactgccga acaagcgggg     70320
     caagtcacat caatctttgc catttgaata tattccaaat agacagatta tacatgattc     70380
     aacaaattga tgtcacgacc agagttttta tatggtttta tccatgaata ataaaatttt     70440
     tccgtggatt tcaacgaata aattttaata aaaataacac attacgataa tcagactctt     70500
     caagggtaac tttcactacg agcaaacttt atttcctaac acaaccttta ttaatcaata     70560
     taatagatgt agatactttt taagggctta acactaccgc cgtaatttac attacgcaat     70620
     aattatgcaa tggtattatc ttacataaga ttgaagaaca gagtagaaag ctcttgtatt     70680
     ttgctcaccg tcgtttgcat tggatgctgt agttaggttg gatataatgg aaaaaacagg     70740
     attaattgtt ttcccgtcag atggtggaaa acacttttta ttaaatgaag aatgcaagtt     70800
     attaactaaa ttaacaacaa ttaaacaaag acaagacgga agagcatgga ataaatatca     70860
     atatcgacat tttgtaccta ggggtttagg gagcaacgga acagtaaacg ttgttaagca     70920
     gtcattttaa atagccattt aaatacaaat caacatatta gatatcttca ttgaatggtc     70980
     tcaattcacc tctgctgaca gtttccggaa ccgtaaaggt gtagcgtccc tgcatgttaa     71040
     tatgcccgca tagcaatgga gacaacctct ttacatcttc gtcatgcacc gggtatcctt     71100
     ctcgcctgag ttgttgcact gcggcgtcca tgtaaatcgt attccacagg acgatcatat     71160
     ttaacactaa acctaatgaa cccaactgat cttcctggcc ttcgcgatat gcctgtctca     71220
     gttcacctcg ttttccatga aacacatttc tggctaccgc gtgtcgtcct tctccacgat     71280
     taagctgctg caatgtttta cgccgtttgg tttcatcatc aaggtaggtc agcatgtgga     71340
     tggttttatc tgcacgaccg atttccgcta tagcctgagc taggctggtt ggtctatcgc     71400
     caatttgcaa ggttttcatg atcgacagga tattcagacg tcccagtttg agtgagacta     71460
     tcagtcgcag aatatcatcc cagtgcggta cgactttttt ctcaaaattc aggcgatgtg     71520
     aggagatggg attaaatgga ccataatccg ctttaggatc aatgcgccag aatctggctc     71580
     cacctgtatc ggctaatcgt gggcagaatc tataccccag caaacgaaaa agtccgaaaa     71640
     taatatcact gtaggctccc gtatcagtca tgatttgaaa cggcatttgt tccgtttgtt     71700
     gctccagtac gacagccaga atgaccaaac tatccctgag tgtccccgga acaacaatgt     71760
     cgtttaaccc agaatattgg tcagatatta gattgtacca agtcacgcca cgtcctttac     71820
     cgaaatattt agggttaggt ccggcatgaa cagtacgaac aggaacaacg aatctcatgc     71880
     catccgctga cgcaacttca ccccctcccc aaagacccga caatgaaata tccgtctgtg     71940
     ccgaaaccag aatggcattg gcatctcgga tggtttcatc cctgatataa ttactgtccg     72000
     tccaagccag tcggtcacgt ttcagggctg caatatcatt gcgaataaaa ggttctggtc     72060
     cggtattaca ggcttcagcc attagcatgg cacatatact gatattcagg tcagcaaccc     72120
     gggagttctg ttctgatata tgggtgaagg cacggctaaa ctgcgtcagg gcatcaattt     72180
     caagtatgag ttccgataaa tccacgcgcg gtagcatatc agtcacgcac tggcgcaact     72240
     caatcagtga aggggtttct tccattgcgt ccaaaggact caggatgagt tcgtctgtat     72300
     cggaaaatct gacggccggg ttttcaggaa gccggttcag tacgtcacga taggctgtaa     72360
     tcagctctac ttctattgct gtcaatgtgg cagcaggcat tagtgacagt cccaaagagc     72420
     ggcagataat aggacgtaaa gcttcccatt catttcctgc tataagtcca gttcgtggat     72480
     cagcatagcg ccagctggga gaaacataaa tatctctttt tttcagcgta atctgaagtt     72540
     ctttcagggt acaaaatgta taagcatgaa aatcaatact gccatcattt cttataacat     72600
     gttgttgcca tgatttatta atgatttctc ggggagcatc gttatctgtt tttttcttct     72660
     taagattgtt ctcaatccag taaagcgcat taattagtgc ttcggctgaa gcattacctt     72720
     caaaatgaat ctttgaaaga aattcaggta aaaatagacg gacagtgcgg aatttagtat     72780
     ccagctcatt gaaataaaca ttattaaccg gccgaataag cgaagtgata ttgtttacag     72840
     cattctccag cacactctca gggatcaaat tatatatgct atcacgaaca tccgcgtttg     72900
     atagtttatc atcaagcagc atcttacagg cttttgccaa tatctccgct gcccgatcca     72960
     aatctttaat tgtacgttgc cgattctttt tatctgcctg aaccgcacca ttgaagagat     73020
     cccggagtaa tgcttccagt aattcaagta catcatcctg tgcggtggct tccatacaac     73080
     aggcaaatgc gacaagggtt gccagttttc ttttttctgg caggcgttga agaactgtta     73140
     ttttggctgt tgcggcataa cgagccaacg ctgctatccg ggtatcggaa acaggcgtta     73200
     ttgctggcaa tgtaatgccc agattgcgta tagagtgtaa gcgtgaaata gcctggcgta     73260
     gtgatgatga gttaactttt gttggcgctg tccgtaactg gtcaagtaac gaataccgac     73320
     ttccgggtgg tacagacaga agctcaagaa ggcatcgggt ttgtgtttca tcaatacaag     73380
     atgacagtgt atgccacaac ctgttttcca ctctgcttcg taaccgggct atatatcgct     73440
     caatcagaga ataaccgggt aataatactt tatgtgacag tagccatccg gtacatcttt     73500
     cgaaaagaac tcccggccga tttgttcctg tccagcataa tgaatataac cagcgagtca     73560
     gagaaaaagc gactcgtgag tctgtaaact ctgtgtatcc ataaatactt ataatttcat     73620
     caatatgctg cctacgttgc tttcctgagt tataaaggtc aatagcatta tttatgtttt     73680
     cggtatgtaa ttgttgtgcc agaaatacaa taataatatc gggaaccttg gaaatttctg     73740
     gaaactttcc gataaaacgt acagtacaca acaagatagc gaagcctaaa cggttatgct     73800
     cacctcgttt ttctgaaata tttagacgat caaaatcatc aagatggaaa tatcttgcca     73860
     gtgtttcttt tgtcagctca acagaataat taccataatt tgtccgctgc tcttctgaca     73920
     ggaaattaac aggcatagta aactatcctt aataaatgac tctggtcatc ccgttttttt     73980
     agactgataa atagcccaga ctcgtttaac ctgactgata ctacaccctg ccagtgcagc     74040
     ggtacgttca atcgtcaagc ctgaccggcg aagagtgaca atacgttcgt gaattgagaa     74100
     atccgctttc ctgccagaat acttaccgga tgctttggcg agttggatgc cctgacgttg     74160
     cctctcacgg cggagttcat aatcatcatg tgccatttga agagccactt tcaataacag     74220
     ttcctgaaca gactcgagga caatacgggg tgtatcatca gcttcagcag ccagctctga     74280
     taagtccacg ataccgggaa cggccagtcg tgcgcctttt cctctgatag aggcaataag     74340
     tttttctgct tcaggaatgg gaaggcggct aatgcggtca attttttcag cgatcaccac     74400
     atcgccgggc tgaagatccg caatcattct gagtaactcg ggcctatctg cccgggcacc     74460
     tgatgctttt tcccggtaaa tgcctgcaat atagaaacca ttatctgtcg ccattttttc     74520
     gataccagct tggcgagtca gatcctgctc tgatgtgctg actctttcat agatacgcgc     74580
     cgttttcatt tgagagtagc caaaataagt atagttaatt tggctatcgt aaaagaggtg     74640
     gctaaaaatg gcaatcggcg atgtaaattg gctggttgat ttttggctat ttaaaatgac     74700
     cgcttaacgg tgtttactgt tccgttgctc cccaaacccc ataacggcgt gttcggtctc     74760
     cgcatccaca cggttcttca gattaggggt ttttctgctt tggttgatta atgcatcaat     74820
     cccgcccgtt tcaacgagtt cctgataacg ataaaacgta tctctggata cgcccatcac     74880
     tttacaggct ctcgagacat tactgagttc ttcagcgaga ttaagcagac ccgccttgtg     74940
     tttgatgatg ggattgctag tataaagcat gagagtgacc tcttagtctt tgattatgga     75000
     ttcatcacct ttaatcaaag tcggtaactc tcttcttttc aaactgaagt gtcagatctg     75060
     gtctgaacta atacacatta acagagaaaa tctgagtcaa tgtggggttg gttgtatttt     75120
     atgcagctaa tcggtaaaac atttctgccg gtgacaatgc cttatcttct gattgtgagt     75180
     attgtccttt acgtagcatc gaaacgagct ctatccccgc taaaatcgtt tgggcccggc     75240
     gaaacgattt aaagcctgac atcggccgta tccgacgttt gatattgtgg tgagcttgct     75300
     caatgcggtt attcaggtat ttattttgcc ggatttcaat cccctgctga ggctcacctt     75360
     ccgcattgag gagggtgagc gcggcggtat tggccccact tttatcgata gtcacgacgg     75420
     cgggtctgcc gtgctggcat atcgctttac ggaaaaaacg ccgggctgcc gttgcatcgc     75480
     ggcgagcggt cagcaggaag tcaatcgtct gaccgtcggt atcgaccgcc cggtaaaggt     75540
     atttccactg acctttcact ttgatgtacg tttcatccat tcgccaccgg gagccaacgg     75600
     gctttttgcg aggtcggaaa gccttgccga gcaggggcac caaacgtaac acccagcgat     75660
     gtatcgtggc atggtcgacc ccaatgtcac gctctgccat catctcttcg agattgcgca     75720
     gactcacggc ataagcgagg tacccacgaa cacattgggc aatgatatcg acaggataat     75780
     gcagacgttt gaacgctttt cggataaggg acatcactct ggactcgctc aaaaacaggg     75840
     aagcttacct gatgaccgct taatgcgaca gaacccccaa taacccctat tattagattt     75900
     tttcagtttt agatctctgc gaggaggaaa aacaggacaa gtatctaata cacaatctgt     75960
     tttactgtta ctcaaattat cgattatata actggctgta atgcgttcat gttctaataa     76020
     cacacatttt gaagaaataa tatcctcgca atatctgatt atttccttaa tagtgttagg     76080
     agtattagca ggagtaccaa ggacattatc aattattggt ggtgtagcca aaaaacttaa     76140
     tcgttcttgt aaatgttttg ctactaataa tacaccagaa agtgataatc caacctcaat     76200
     tttaatattg attgaaggtg acaatattat ttctttagat atagatccta tatgcttgat     76260
     aatcagatcc aatgacctac tataaaaatt acgtagatta taaatattaa tcatcagaga     76320
     acaccaaatc atgtttactg aattcatggg aactattccc gataattatc atttccacaa     76380
     ttttatcata aacaatatta ttgaataggt agctaactga acggtaatgc cctcctagtt     76440
     taaacgcttc acgtgcaagt aaagatttaa atgaatcatc gaaagatata ttcatccctt     76500
     tagattctgc aaacctaact gctttctcat agagttcatc atcattcgcc atcttaaata     76560
     gctcattttc atttggttct tttaagtgta taaaaaaatc cactctattc gctagttcag     76620
     gaataaatcc tgaatcgatc aaattctttg ggcaagacat tttttttccg ttaaaacttc     76680
     ctgtaaatac aaatatcata ttattagtat ttaaattcag tataggattt ggatttattc     76740
     tggaaggatt cggatttgta ataccaatct caactccatc cagaggttta agtaatgact     76800
     gttgaatacc aattccattg acatcttttt caactgaaaa agatgcactt aacttatcaa     76860
     actcatctaa atgaatgatt cctttcgtag caactttaca atcgcctcct gaaacatata     76920
     gtaatttctc aaatatacta tagggatctt ttccactata accaacttca gataattctt     76980
     tggaatctat agttgacatt accctaaaac ttacttgctt taagatattc gccagacgag     77040
     tttttcctga acctgatgcg ccagagatta atagacactt aggtttataa ccgaatgttt     77100
     caatatcttc acttaataaa atagaaagta tacgatttac tttatctata ttactaccat     77160
     ttttcattag ttttttattt atgctaatta agcaactcat ttatcctcct tacttatttt     77220
     atctatatat attttagcgc ttttagctag aaaaaatgga gcaattgaac cgatagaaac     77280
     aaataaaaaa aatggaataa atgagctaaa tttattaacc aaaaacaaca gcactactga     77340
     atacattgct gtaattcctc ttacgatagt atcactggct aaaatcactt ctcccaagtg     77400
     ttcttgtggt gtaatggctt gtcctaaagt cattcctgct atcctaaaat agaattgtcc     77460
     ccaacctaat attgcagcca ttacatataa agaatattta tcaaatttaa atatagaggc     77520
     aatcacgata gccgcaatcg caaatatcgt ggacgattta gaaaacattg acacaatttt     77580
     agggttgttt tttaaaactt catttgaaat caagccattt actacaaatc ccgcactaat     77640
     aaaagagagg ataatatttt gaattacagt aaattgatca ttgcttactg atgatttagc     77700
     aaccataata ggaataagca caatcacacc tgtaaatatt aagttattta aaattctgtt     77760
     tattgtaagc ccttttagcg gagcattatt ggaaataatt ttatacccaa gccaaacatc     77820
     tgtactactg acttctttat ttgttctcat ctttcgcaat tctggactaa gtatccacgg     77880
     aacacaagtt actaaataaa aaatcatgaa aaaaacaaaa gacaaattat gcccaaaact     77940
     aacaataatt gcagccgata gcaacggaga aataattaga gatgtttgaa ctgctgtagt     78000
     atacttagtg aaattatgtg ctttatcctt atccaacttt attaacttgt ttaaagatga     78060
     attgttattc ggattatcta accctataat tatagaaagc ataaatatcg caaataaaac     78120
     cacatatata ttgtttgtga atatcaatat aggtatcaaa gaggacgaaa ttacaggccc     78180
     aaaaaaaccg actctaaagc cttgatattt acttaaaacc catcccaaaa gaactccggt     78240
     gaaactaata cctaaagaat tagctatggt tattgaggat gaataaattc ccatactatc     78300
     aattaattct agtttagata tagctgtaga tataatacca atgctagaaa actgagttag     78360
     acaaccaata attattatcg ccaatatatt cataaatcac atatacgtta gatattttta     78420
     ccatagttga tatattcact ccacattgac aatatattct ctggtatatc aggaatagca     78480
     ctaaatccta attcattata atattctaat tcaatcggat tgcgataact tatcttttgc     78540
     aatccatcaa tgagcatgaa ttcaatacca gaagatacca tagaaaccga ttgagccaaa     78600
     tagtaactta atgctctcca gtataaatta ctaggatatc tatccatata attctctaat     78660
     gaaaacttag ggtgacagcc gtctaaaata cgtttaggac aacgatagag tggataccat     78720
     atttggattt catctatttt cctgatagga aatgatgaaa ggttctctcc ttttatcata     78780
     gaaaaaattg cctcggctaa aatatcttcg agatttaatc cggtaacaat aatatttgtt     78840
     ttattttgtc gagcaacatg acttaaaact aaacggatac ctaatgttcc gataacttcc     78900
     aagtcagagt caggataaaa tttctcgaaa tcttctgccc aatgccctcc ttctgtacca     78960
     cgaataattt tgtttacttc ttctttttcc atcacaagaa gttgcaaacc gacttcctga     79020
     caaactttat atgctcgatt aatcccttta tcccaatcag caattcccat aatcataaca     79080
     ggagtgatat tttccttctt tataccagaa tgaataaggc tagttaataa agtatttgaa     79140
     tcaccaccgc cactaatacc aacaatgatt ttttcatcag aatatgctga cgcaaactgt     79200
     tctttgaatt tatcaacttc aattttgaca aactcatgac attctttttg actaaacaat     79260
     atatgttttt tattttcgcc atcatggtta tcaaaagtat actctgcggt tggttcagca     79320
     tttggatctt ggtaaaggtc aatgtgttta ttaataacgg acgcataatc gatattacga     79380
     tctgctctaa ataccagact atctccttcc agttcatcca ctaactcagc tactttttta     79440
     tttaaacacg gaataacttg ataatttccc atgtaatcta ctttataggc agagactgag     79500
     ttgaatggaa ttccattaac cattaggata tcttttaaaa ataaatcttc tgattgataa     79560
     ttaagaagaa aatcaccatg cggggtaaca agttttaatg atttcatttc aaattccact     79620
     gtgctgaata agaaatggga gagtttcctc ccccataatt aatgaaaatt tttctcgtag     79680
     aaattcaacc actcacaact cgagttgaac caccacaaat atcaccttca ccattcttac     79740
     caatgtgtgc tttagcaatt gcagtaagtg atgctaggtt cgatttttct tttacattta     79800
     cttgagaacc aagagattga gctgatttac gtgtagacag tttatgtttt tgcattataa     79860
     acacccttta tttaacaatt ggtgatgctg ccaacttact gatttagtgt atgatggtgt     79920
     ttttgaggtg ctccagtggc ttctgtttct atcagctgtc cctcctgttc agctactgac     79980
     ggggtggtgc gtaacggcaa aagcaccgcc ggacatcagc gctatctctg ctctcactgc     80040
     cgtaaaacat ggcaactgca gttcacttac accgcttctc aacccggtac gcaccagaaa     80100
     atcattgata tggccatgaa tggcgttgga tgccgggcaa cagcccgcat tatgggcgtt     80160
     ggcctcaaca cgattttacg tcacttaaaa aactcaggcc gcagtcggta acctcgcgca     80220
     tacagccggg cagtgacgtc atcgtctgcg cggaaatgga cgaacagtgg ggctatgtcg     80280
     gggctaaatc gcgccagcgc tggctgtttt acgcgtatga cagtctccgg aagacggttg     80340
     ttgcgcacgt attcggtgaa cgcactatgg cgacgctggg gcgtcttatg agcctgctgt     80400
     caccctttga cgtggtgata tggatgacgg atggctggcc gctgtatgaa tcccgcctga     80460
     agggaaagct gcacgtaatc agcaagcgat atacgcagcg aattgagcgg cataacctga     80520
     atctgaggca gcacctggca cggctgggac ggaagtcgct gtcgttctca aaatcggtgg     80580
     agctgcatga caaagtcatc gggcattatc tgaacataaa acactatcaa taagttggag     80640
     tcattacctt aacaattaat taaatattta acatcttaat tataacaaca tatatttaaa     80700
     caaaaactca acaaccacct actaaagttg gtggattagg gggcgtttgg cgaaagggaa     80760
     attaaagtac gctaagactt agggaacggc aataacgggc aggggttacg catgaaaata     80820
     tttagtggat aattctctca tttttagagg gaattcagtt tattaaggag aatgtaatga     80880
     gcgcatccca atcacttagc cctcggcacc gtgctgaaat tgagaggtga agcatggatc     80940
     ctctcagatt tccggcctta tagtgcctaa gcgggaagcc tgttgctccc tgatgactgg     81000
     aggatccacc catgaaattt actcctgttg gcgtcgatat tgcaaaacat ttgatgcaaa     81060
     ttcattttgt tgatgaatac accggcgaac tcattgacaa gcaactaaaa cgaaatgatt     81120
     ttttaacttt ctttagtaac cgtgagcctt gcttgattgg tatggaagcg tgcggtggcg     81180
     ctcactattg ggcacgggaa ctgagaaagc tgggacatga agtgcgtttg cttaaggctc     81240
     ggtttgtcag ggcatttcgg atgggaaata aaaacgatgt tcaggatgcc cgggcgattt     81300
     ggctggccgt tcagcaaccc ggtaaatccg ttgctatcaa aaatgaagaa cagcaggcca     81360
     ttctgtcatt acaccggatg cgctatcaac tcgtcaaatt cagaaccgcg cagatcaatt     81420
     cgttacatgg tttactgctg gaatttggtg aaaccgtaca taagggcaga accttgctgg     81480
     ataaagccat gcctgaagtc cttgagcgac taaaggaaaa actggcacca ttcctactca     81540
     atctgcttga aaagcaatac caccgtttga acgaaatcga tgaacaaatt gaacaggtgg     81600
     aaaaacaact gacgacgtgg gcaaagcaga atgctgattg tcagcgaatt atgaaaattc     81660
     ccggcgtcgg tgtcttaatt gcgacagccg ccatcgcaac gatgggcgat cccagagcgt     81720
     ttcggtcggg cagggaattt tcggcctatt tgggcctggt gccgaaacaa acgggaacgg     81780
     gaggccgggt caaattactg ggcatcagta aacggggaga tacctatctg agaaccctgt     81840
     ttattcacgg tgcaagagcg gccaccttac tgacaaaaac cccgctgccg tgggtgacgg     81900
     agctgaaaaa acgccgtccg gtctgtgtag tgatagtggg gatggccaat aagctggctc     81960
     gtaccgtttg ggcattggtc gcccatcagc aggaatatca aaaagattac gtcagtgtca     82020
     gaccttactg aggtgtttca ctgatcaact ttcactttta acgacaagga tgaatgtaga     82080
     aagattgcta aggcaatgat aatgatggca aagacaggta agaccgtgac ttgctaaacc     82140
     tgatttatgc tctgagcgtc aagctcgtta ggagagtgag gagtcagtca gcggattaca     82200
     tcgaggcccg cagctctggc tgtaataagg ccggatatag agctgcaacc taccgtcgat     82260
     gtcagagtaa tttttgtctt gcaaacggga tgcgttcata tagagcataa aaatccttgg     82320
     ggcaatcttt taatgttccc ctcagatgac cgttctgaat ggcaagctaa aggcacaact     82380
     tgagcgttgg tatcccggca tcaaaattat gagctagcgg agtacggttg atagttctat     82440
     attagctatc gtggcataat accaatgtag tgacccacgc ttttttatgc tctatatgaa     82500
     cgcatcccgt ttgcaagaca aaaattactc tgacatcgac ggtaggttgc agctctatat     82560
     ccggccttat tacagccaga gctgcgggcc tcgatgtaat ccgctgactg actcctcact     82620
     ctcctaacga gcttgacgct cagagcataa atcaggttta gcaagtcacg gtcttacctg     82680
     tctttgccat cattatcatt gccttagcaa tctttctaca ttcatccttg tcgttaaaag     82740
     tgaaagttga tcagtgaaac acctcagtaa ggtctgacac tgacgtaatc tttttgatat     82800
     tcctgctgat gggcgaccaa tgcccaaacg gtacgagcca gcttattggc catccccact     82860
     atcactacac agaccggacg gcgttttttc agctccgtca cccacggcag cggggttttt     82920
     gtcagtaagg tggccgctct tgcaccgtga ataaacaggg ttctcagata ggtatctccc     82980
     cgtttactga tgcccagtaa tttgacccgg cctcccgttc ccgtttgttt cggcaccagg     83040
     cccaaatagg ccgaaaattc cctgcccgac cgaaacgctc tgggatcgcc catcgttgcg     83100
     atggcggctg tcgcaattaa gacaccgacg ccgggaattt tcataattcg ctgacaatca     83160
     gcattctgct ttgcccacgt cgtcagttgt ttttccacct gttcaatttg ttcatcgatt     83220
     tcgttcaaac ggtggtattg cttttcaagc agattgagta ggaatggtgc cagtttttcc     83280
     tttagtcgct caaggacttc aggcatggct ttatccagca aggttctgcc cttatgtacg     83340
     gtttcaccaa attccagcag taaaccatgt aacgaattga tctgcgcggt tctgaatttg     83400
     acgagttgat agcgcatccg gtgtaatgac agaatggcct gctgttcttc atttttgata     83460
     gcaacggatt taccgggttg ctgaacggcc agccaaatcg cccgggcatc ctgaacatcg     83520
     tttttatttc ccatccgaaa tgccctgaca aaccgagcct taagcaaacg cacttcatgt     83580
     cccagctttc tcagttcccg tgcccaatag tgagcgccac cgcacgcttc cataccaatc     83640
     aagcaaggct cacggttact aaagaaagtt aaaaaatcat ttcgttttag ttgcttgtca     83700
     atgagttcgc cggtgtattc atcaacaaaa tgaatttgca tcaaatgttt tgcaatatcg     83760
     acgccaacag gagtaaattt catgggtgga tcctccagtc atcagggagc aacaggcttc     83820
     ccgcttaggc actataaggc cggaaatctg agaggatcca tgcttcacct ctcaatttca     83880
     gcacggtgcc gagggctaag tgattgggat gcgctcatta cattctccgt gaaagagacc     83940
     aggtgataga gttggctgtc acagacatct ggggcgatgt tctactgaat accaggttgt     84000
     ggccaaccgt gaaaatttcc cctaatgcaa tggatgttca tggaatcagc gaggcggatc     84060
     tgacgaatga gcctatgtgg cctcaaattg cgccagctct tgcccagctt ctctctggcc     84120
     gacatgtagt gatatttaac tccagtttcg atagcaggct gttgaggcag actgccggtg     84180
     catttggaga ttatatgcct tggtgggaag agaaaaattt gctgtgtgcg atgacgctgg     84240
     cgtctgatgc ctttggttca accaaccggc acggcactat ctcgcttgcg gatgcaacct     84300
     accaagcagg cgtcgtttgg aaaggtcggg ctcattcagc agcgaccgac gccattgcca     84360
     ccgccgatct ggtgacagag atagcaaaag tccaacgtaa tctcgtggtt cagctccagg     84420
     agcttcaaag caaaggtaat ttggaatgac agaacaatcc tacggcgaaa gcctgaaatt     84480
     tttctcagac tggcagaaag acccggcgaa acgtaccggc attaatgtac aacacacgct     84540
     aaccagaggt gattatccta ctgtcagcat cgagattgca ccgatcaggg cgtcggggtc     84600
     cagcccagac tggaaaagca agatcacggt gcagctcact cgtggcgagc tgactgcgtt     84660
     ttgctgtgtt ctctttggct tgcgtagcaa ggctgagggt tcctatcacg gtgactcgaa     84720
     gaacaagagc tttgcggttt acaacaacgg caaagccggt gttgcaatca tcctcagcga     84780
     gcgaggcaac cagctccaga atttcatcaa tgatgacgac cggatggaac ttgcagtttt     84840
     cgcagttcgc cagctttcca acgcatggaa agtcacccct tctgattcca tcgcgctgct     84900
     acgccaatca gcgtggatgg accgaaattt gtcctaatcg cgcaaatcta ggcaccctaa     84960
     aagtcgtcct acaactacaa agttagacca tcatgcaaag tggggtataa tgggtgcagc     85020
     cccacccccg cagtcccact cagccacatt tctggcctga cccgcgcttt tcttctttct     85080
     ctctctttct caatctaatc tcacacacga aggtcaaaca ggacacccgc cgaagcgaag     85140
     cggaggctta ttcttgccct tccccctcat tgcatgatgg tctaatactg tctactatgt     85200
     aaccaatgat ctgttagaac aaacccacac acaggcggca acatggctaa aaacttcatt     85260
     tcagaacaat tctcggccat gtgccgggac ttaacgaacc tgtcttccat tatcaaacga     85320
     ctaccaccac ggtacgcaaa agttgcggcc atccccccta ccagaaaggg aatggagaat     85380
     gagcgtatca acaatattgt cgtgacggaa caaataggac gcgaagctct tgagctcgca     85440
     gcgcatagct acaaagatct gcacatcaat ccagactatt cgcaaaagtc tgccagacgc     85500
     acagtggggg tcctatggtt ttccccttcc aaagtcgggc tggctgctaa aattgctgcg     85560
     acagttgatc gtatcaatgc ggccaaagcc ggtatagaag agttcattat ctctacatac     85620
     ccctccaggc aagagcggtt tgaagcactt cgagtagatt gccctggagt aatgacactt     85680
     cacctttaca ggcaaatccg atgctattcc agtggcgaca tcgactctat ccgcttcacc     85740
     tggcaacgga aggactcttt aaagaagcca gtgaaagaag aactcttgca acgaataaga     85800
     gaggagcttg aacgttctgg tgctgactat cagcttcccc ttgaacaact gatccagagg     85860
     atagtcagca ctccagagcc ttacctccgg gagcgaaggg aggtaaaagt gcagccggta     85920
     gcaaacgtca tggccgcagg cgtactcaaa accgttaccg cgcccatgcc cctgatcctg     85980
     ctgcaagaca aggatgttga gctcaaaatg cttcgcagct tcgacgcatc agaacagcgc     86040
     aaaacacgct cggataagtc ggcttcggaa atccttggca cctttggcgg cgtcaccatt     86100
     gaatctaccc ctgagtaaac gtgaccatgt aggggtgttt tgacttaaag aacggtttgt     86160
     ccgacgcctc cttgcaatcc cttgtcactc aaggctttga cccaaaaaat cgatttcaaa     86220
     atcggcaatg agtttatcta taacattttg aatattaata actttatcct ttcgataaaa     86280
     ttcataattt ccgattaagt tcacaaaccg ccatgcgact ggtgaccaat gaataatttc     86340
     aagacttttt tctggatctt tttccgcata atattcgtaa agggcggata aaattgtcgc     86400
     attgtgataa ataatcatgt tagcaattaa tcgaatacac tcagcattga taattaagtt     86460
     acgttctttt tttccactca gctgctttcc tccattcact ttagcaatgc tggctgtcaa     86520
     ctgatggtaa gactcgcctc gatttaaact tcgttggacg gcaatgcgtt ggtcttgatc     86580
     gtctatatag cccaataaat aatccgtcat gatgatttca tcgagagcaa ttaacgcttt     86640
     taatgttgag tttgacgatt ttgtcgtgga caatttacga acaatcgtag cttgtgtggt     86700
     cttttttaag gctaaagaaa ccagtattcg taaaacttta tcccaatcac tgattatttg     86760
     gtgtttctgt acttttttac tggggcggat aatggactca tcataatcag ctaaagcgcc     86820
     aaagcatact aattgttgag atgttgtatt ggctaattgt gtaaatcgag gcatgaatca     86880
     atacccaaac atatacatta aggcaaaatt aactctattg atgctgtgca tatcaccaga     86940
     aactgccgta atattcactt ctgagcgatt actttcgact aaatccagca aataatggct     87000
     ttcgtgttca tttgctccga tcacttttaa gcaaatgggt aacatattcg cattcaatgt     87060
     catcacgact acgcctttct ttaaaccaaa atattttttt gcgtaccttg attttatcgt     87120
     attaaaacgt gtcgtaaatt tttgcccatc cacactcgca tgaacaccgt aatcagcgag     87180
     gttatactcc ttaaatatag gcaattgttc cgtatgatta atgataatat cactggcttt     87240
     gctgagtgtt tgcggacgaa tgaaattttg ctgtgtgttt tttaatgatt gaccatcaac     87300
     gtcactgata tccatcattt ttttcatctc agtgcctgtc gcatttgcta tcacacaagc     87360
     attaatcagt tccatttcag gcgcttcttt tgcatagttc ggttgtaaat gcgtgaaggc     87420
     ttttccatat cctgtcgcgt catgaacaaa tcgggcaata tcactgatat tgagtgtgga     87480
     taatttttta aaaaaaggat tatctgtacc atcatctaac ggcgtataag gaagagtcca     87540
     agaaactaca tgacgacgag cgctatgttt tagtttgata caggcatttt ccccagacat     87600
     aattcgacga tttacttctt ggtattttgt ttctatgctg tcttctagcg aagtcagaat     87660
     atcgacaata ttgcgagaaa aaagtggcat attaagctct ttaataagct gatttttatg     87720
     cgtttcccaa tattctatat caattaattc atcttcaagt gctcgatggg aataactgtc     87780
     cttgatgtgc acagagatat cacttatccc cttttggagt tgccaataaa ccataaattc     87840
     atagcgatct acatcgatta ttcttttgtg gtcaattggt gatttagtca taataaagcg     87900
     ttttaaggtc ttaggaaaaa aatcgagcgg gatctcatca atagaatact cataaaatga     87960
     cttatttcca tcaatgtatt gttgtagaaa tttaagtgcc ttatctaatc cctcaatttc     88020
     acatgaaacc ctaagaacac gaaataaggg gcgaagatta cgtttcattt tttgagctag     88080
     ttgtccataa tattcccaac gataaaaatc tcgggcaaaa ttcggttttt taaagtcaga     88140
     caaaaaacgc cgatattcaa atttaggtac aatttcaaac gctttttctc tcacttgaga     88200
     atcaggtatt ttttcattca cattaatcaa catgatttta tgtgcctgat ttcgcagttt     88260
     tttatctgca gactcaaccg cttcaatttg tttttgttga taatcatccc cgagcttctg     88320
     atacatcaac atcttttgga gaaaacttgc tatcagttga tcattgattt gacgaaaacg     88380
     atgactgaca taacaaagca aataaaggcg tgcttgattt tttaccctga agcttttcaa     88440
     tttctggatg gtataaaatt gggcgagttc ggaataatag ataatgtttt gctctgaaat     88500
     gcccagcgtt ttcactagtt gttgagattc aatgtataca tcggcaattg atttttgttt     88560
     ctcaatagtt tgctttattt ctgttgtact aaaattcagc tgttcttttt tcaataacgt     88620
     cagtgagtaa atgaaatctt ctttattcaa taagttatcc aattgatcac gtaattcttt     88680
     ttcgatagag gtgtagagtt tgttgcttag acgatttttt tcagccttta tagccagaga     88740
     aatgatgcct tgaaatgttg aataggcggg tttaataaaa catttttgct gacaaaaagt     88800
     gagtaaccca gttaatacaa atttaggtag catatggatg gctgctaatc gtttcgcttc     88860
     tctttctagc tgcaataaga acgttttcgt aggttctttt attgtgagcc tttggcaaat     88920
     ttggagcctg tttttataat gaatatgctt tgatatgcct tttttaggaa atccgaacat     88980
     cggaaagtaa tgatgcagta taaattgcac gtcatcttta acttgttgga aagtaaaacg     89040
     aaaaaagtaa ctcaccgcac ggtaattctc gattttaatc gtcatgattt gaactctaaa     89100
     gtgatcgtga cattattttc attgtttgga gaacttgagc gtgatttcat cagtttaagg     89160
     acaaaagaag cactggcgtc aaaaaaagcc aaaggccaca cattaggtaa gccaaaagga     89220
     accattcaaa aaagccaatt tgatgaagat cgcgatagaa ttgtggaatt attgagctta     89280
     ggtctttcgg tcagaaaaat tgccaactta ttaagttata aaaatcatat ttcattgaac     89340
     acatatataa ataaacgcaa cttaaaaatt gggttgaata acgaaaaata atgatattca     89400
     ttgctaacca aataaatcaa tagagcggaa acagtctgat gattgaagaa gaagtctccg     89460
     ttgcggatat taacgagtta accgttcgcc tcgatgcgct gtcaaatatt ttaacgattg     89520
     taatgagttc tttaagtaaa agtgaccctg gcttatatgc tgatattatt aataacattg     89580
     aagaatttgc tgagagcatg cgtagtagtt taggtgaggt cgatgaagag gatattagtg     89640
     cttatgctca caatgtagcc gacagcatgg aggagtttct tcccttaaca gaagatgaaa     89700
     tcaacggcat tgaatttatg aaataagaaa ataaaaaata agattaatat tcaattggtt     89760
     aatgtattaa atgttaagct ttaaaattta atcaatcgct gtaattcatt gtttaaaaaa     89820
     gaattattag acaaaatcgg acaaaccgtt ctttaagtca aaacacccca ttaagcagat     89880
     caacgatact ggccgcagcc tcattttcct catcgtcttc ccgactggtt aacactgact     89940
     ctacccaatc ctcaaggctt tcatgttcct cagccagttg tatttgtcgg cattcctttt     90000
     caattaggct agtaatcgct tcattgagca ttccgccatg cgtcgtaata ttaagaacaa     90060
     caccaaaccc cgggatcttc ttttgaatgg gttttgcttt tattggggct gatttaagcc     90120
     aaaggaaaaa ccaaattcct gagtttattt cttccggctt aacctgattg gccgcaagga     90180
     acttggaaac ttcgttatag attgcgccgt ctggcgcggc catctcgtaa ataccggcca     90240
     tcagatcttc aaggctctta tacatattat ttctcgcacc tgcacatgat gtgttcacta     90300
     tcgttgttaa gcgttttttc agcaagtatg ttccagcgca acatcttata ccattccgtt     90360
     taaatctgta aaattatcgt attaccgtaa ttatgataat tacggtaaat aaattagaat     90420
     ttccctattg ttgttctact tattaaaata tccctttgag aaagtagggg tcgtctcaga     90480
     aaacggaatt taaagcacta taagggcttc cccgaacagt caacgtcggt tttttaattt     90540
     tctgtctgcc cctctctgaa ataaaggata agactgcggt actataaacg gtcatgatga     90600
     atcatctatt aattcggacc ctgatgaaag acgctcgtaa ggttctcgct cgttaagcgg     90660
     ataccaatat ccagtgcttt gtacagatat gccttacggg gtctaaccct ttaacatcaa     90720
     cgcttgcagc cagaaaaggt aattttttct acagacttgt ttcaggtatc tgatgcgcaa     90780
     tacagtttaa agtcatcacc atagttcagt gatgcccagc ataaacgggc attttttgcc     90840
     gcaatagcca ccgctgcgca ccagtaacct cgtcgattga tcagtgagct aacccaacga     90900
     ctgaagggat cttgtttatt ttccacacca atcatcacag aacgtgcccc ctgaacaagt     90960
     aaagtgcgca ggtaactgtc accggcttta gtgattttcc ccaagcagga ttttcctcca     91020
     ctgctgtatt gcgagggcgt tagacccaac caagcggcca gttggcgacc gtttctaaaa     91080
     ccatgggcgt taccgatgct ggcaaccaac gcactcgctg ttgtcggacc aatccctttg     91140
     agtttcatca aatttttact acgactatcc tgacccgcta tctttgccaa aatacgatca     91200
     tactcagtaa ttttcagatc aatggcatca atatgcccca gaagatcagc aacacactgc     91260
     cgaacccagt agggtaaagc ttccctgtgt tctgcggcca aataacgaag ctgttctgtg     91320
     cgttgcgggg caacgagacc aaattcagat agcaagccac ggagccgatt atatgaagcc     91380
     gttctttcct caataaaccc ctggcgagta cgatgcaaac actgcatcga ttgttgttct     91440
     tcatctttaa cagggacaaa gcgcatatgc ggacgctgga cagcttcaca gatggctaat     91500
     gcgtcagcgg catcattttt tccaacttta cccgccagac gatagggaga aacaaatttg     91560
     ggggccatta accggacatc atggccgtat tgccggaaca accttgccca ataatgtgcg     91620
     ccggagcagg cttccatacc gatcaggcag ggcggtaaat tagcgattaa ctcaggcagc     91680
     gcagtcctgg atactttggg tttaacaaga agaggtttgc cgttgtgatc aacaccatga     91740
     acagcaaaga tattttttgc gagatcgata cccatagttg cgatggtcat aatgaatccc     91800
     ctgtaatatg ttggttactc cccatgatgg cacggaaaat caatacagta accaaatcga     91860
     ggggaagtcc ctttcattcg ttaagccaat ttgagttgcc gcaacggcct gaattttcca     91920
     tttccaattc tggtacgact gccccacaca taatccccgg ttaaattaat gtgctcccaa     91980
     ccgagtggag acaggtactc aagtagtgat tcatcaatac cgtatccatg ctcccgtaga     92040
     ctctttactg cccgttccag gtaaaccgtg ttccataaca ctattgctgc tgtcacaaga     92100
     ttcaagccac tggcgcgata gcgttgctgc tcaaaatttc tgtcacgaat ttccccaaga     92160
     cgattgaaaa acacagcccg cgccagcgca ttacgggctt cacccttctt cagccccgcc     92220
     tgaacacgac ggcgcaattc agtactctgc aaccagtcca gaatgaacag ggttcgttca     92280
     attcggccca attcgcgcaa tgccacagcc agcccattct gacgggggta actgcttagc     92340
     tttctcagca tgagtgaagc tgtcactgta ccttgcttga tcgaggtcgc cagccgcaaa     92400
     atttcatccc aatgtgcata gacatgcctg atgttaagtg taccgccaat cattggcttc     92460
     agtgtctcat aaggggtatc gcttttcgga atatagagcc tggtgtcttt caaatcgcgg     92520
     atgcgcgggg caaaacgaaa tcccagaagg tgcatcaagg caaacacgtg atctgtaaaa     92580
     cccgctgtat cagtgtagtg ttcctcaata cgcaggtcag attcatgata tagcaggcca     92640
     tccagtacgt aagttgaatc ccgcagaccg acgttaatga ctttggtatg aaatggcgca     92700
     tcctgatcgg agatatgggt gtaaaacatg cgtcctgggc tgctaccgta tttgggattg     92760
     atgtgccccg tactctctgc tttgctgccc gcccggaaat tctgaccgtc tgacgaggat     92820
     gtcgtgccat ctccccaatg ctcagcaaaa ggatgccgta actgagcatt gaccagttcg     92880
     gccagtgcca ttgagtaggt ttcgtcgcga atatgccagg cttgcagcca ggccagcttc     92940
     gcgtaggtcg tcccggggca gcattctgtc attttagtca gccccaggtt aatggcatcg     93000
     gccaagatag tggtcagcaa cagcgtttta tccctggcaa ggtcacctga tttcagatga     93060
     gtaaagtgcc gggtgaaatc tgtccattga tcaacttcca acagcagttc ggtgatctta     93120
     acatgcggca gcaatgccgc tgtctggtcg atcagtgtct gcgctgactc gggaaccact     93180
     gtatcaagcg gcgttatctt taagcctgat tcggtaatac cggcatccgg cagttcatta     93240
     acctgtgcca tccggttgac agtagcaagt tgtgcttcca attgtgttag ccgatcctgt     93300
     aaatactgcc cgcaatcggt ggccactgcc agcggcaatt cactggcctg cctgagacgg     93360
     gcaaatttat caggtggcac cagatagtcc tcgaaatctt tgaactgacg ggaaccctgt     93420
     acccagatat caccggagcg caaagtgttt ttcagttctg aaagtgcaca cagttcatag     93480
     taacggcgat cgaggcctgt gtcggtcacc actaattttt tccaacgggg tttaataaat     93540
     tcaattgtcg cgtcagcggg caccttacgg gcattgttgc ggttcatgtt gcgtaacacg     93600
     tcaatggcat cgaggacatg tttagcggcc ggagcggcgc gtaatttaag gatgttgaga     93660
     aattctgggg tatagcggcg taacagggta aaaccctctc ccattcgata cagaaagtcg     93720
     aaatccccgg gttgtgtaag cttctgtgct tcggtgacac tttcagcaaa agaatcccag     93780
     gatataacgg tttcaatggc ggcgaacggg tcgctgccgg tttgcctggc gtcaagcagt     93840
     acttgaccaa tttgcccgag cagacgtacc ttggcattaa tggctttacc ggaagcctgg     93900
     aactgttgtt gatgcttttt cctggcatta ttgaacattt tacccaaaat acgatcatgc     93960
     agatcgatga tctcatcagt cacggtggct atcccctcaa gggtcagtgc taccagggtg     94020
     gcatagcgac gccgtggttc gaatttcgcc agatcggcag gccgcatctg ggctccctcg     94080
     cgggcaagtt taagtagccg gttttgatga accgtcaatt caataccggg aggcagttta     94140
     agcgcctgcc atactttgag gcgttcgata tgctccagta tatgccggga attgggtttc     94200
     gtcggagatt ggcgcaacca agccagccag gtcatattgc tgttttcaca acgcttaagc     94260
     agcttgtcga gactgcggtt atgcgcatct gacagaggtt cagtcaatgt atcatagatg     94320
     cgccggttag cgcgggtgag tgcttcagcg cagatacgtt caatgacacc gggcgcagga     94380
     aggagtatat gctttcggcg tagattgccc actaaggcgg tagccagaac acttccctta     94440
     tctgtttgcc aggctaaatc ctccaaacta tgaacgcaga tattacgtat ctgcccgtga     94500
     aagcaggaga agcgtattta agtctgatta cggatgcctg gtcacgtaaa atcgtggggt     94560
     atcatgttca cgataactta agcacaggct cggtcattca ggcttataaa cacgccttaa     94620
     aaagtcgaaa attgattgaa caatcgctta ttcaccattc agatagggga ttgcaatatt     94680
     gttcaaaaca ctatcaagcg ctacatcagc accatgagat tatctgttca atgacagacg     94740
     gttatgattg ctatcagcat gccctggcag agcgagttaa tggtatcctg aaaactgaat     94800
     ttttactctg taaacccgca gacctgaaag aagcggcgaa aatggtaagt gagtcgatag     94860
     atatttataa tcggtatagg cctcactgag ccttacacta taaaacgccc gatgaagtcc     94920
     atcatcaggc gttaagcaaa ataagtgtca acgtatatca ggactagaca tcattcaatt     94980
     gtcaaagtta acaagttcag ggttaaataa ttgtttatac agatgcgtag gaatttgaac     95040
     cttaacaaac tccccatcaa tgtcagcact agcgacaata tccaaaattt cgtttacggc     95100
     ttttttagga ggagtatatt ttttcggttt actcttatca gctaaggctg cattaacaga     95160
     taacttacct tgctgaataa gctttttttt ctcaatgggt aaatcgtgaa ctttcagcat     95220
     catgtagaca tgcgccgcag tctttttaac catatcagcg atttcttgca cgttctttcc     95280
     ccatgcatag aaacgatgat aaatttcggc tttctcaacg ggggttaata ctaatgaact     95340
     gctcgaactc agcatcaaga gattttgctt aacttcatcc cctttaaatt cggtcacata     95400
     cacaaactca atacctgctc cccgttcttt tgctaacatc aatcccttaa aacggtggtg     95460
     tccatcacgt atgatggctt tttgtgtatt aggatcgaac acaacgacta aaggaggaac     95520
     ccattcaccc gcttcataag cgtatgacag atttaaaaca tgttctttta cgtgctcttg     95580
     ctgccagtat tcatctgacg acatccccac accacgcgca ttgaaagtag ggtcaatgga     95640
     gataatttct ggtcttatca ttaataaatc acgtctacgt accgagtctt tatcaatttt     95700
     agctaagtcc tcaagagaaa ttaattgcaa atcggtcacc ataaccggct aataatgtat     95760
     tgatctcata ttccattgtt tcctgagtcc aggtgataaa acgtcgccag tggtatttag     95820
     cctccctcca gacgatttca atcaaattca gttctgggct gtaggcggga aggtaaagta     95880
     aaagcaggtt gtgttctcgt aaccagcgat ttttaagttt ttcatcgatc ccatgatgga     95940
     taggcgcatt atctaacacg acaaatgtca ggcgatgctc gccttgttgg gcgacctgct     96000
     ctaaaaaatc aatgacatta cttcgcgtga cactgcttga tattatctga taaaacagcc     96060
     tgttatcagt gtaatttagc gcacctagca ctgaccgtct gacagagctt tgcggctctg     96120
     cttcatgggg cttacctcgt ggactccatc catattggac cggtgggcag gcggaaaaac     96180
     ccgcctcatc aagatagagc agccgataat gacctgcccg tgcgcccgcc ttaattttat     96240
     tcagtaaggc ggctttttca gcaaattccg cttcattgcg ttttttttaa agacaggcga     96300
     gctcgcttat aggttaaccc ctgtcttttc agagtattag ccagcgtctc aagcgtacaa     96360
     ggcagtgggc catgctggtc ctcaactttc tgtgcgatcc gggctagcgt cagagactct     96420
     gcgcgagcag attcgactgc ggtggcaatc atatcaggtg tcatggcggg atatcggcct     96480
     ccgacatggc cacctaataa tccggctatc cctgaatcat gccaggcgtg aacccagtca     96540
     tagataactc tgagactaca tcctatctca tcagcgatct ggcggggttt gatgcctctg     96600
     gcaagcatga gcaaccccgt tcctcgtgta cggatgtccc gatgtatatg gttcaaagcc     96660
     agttgttgta atgtaatacg ttcaggttca gacagggtga tattcgattt cataagaaca     96720
     ggcggtaagt catcggatta ccgattttaa catcaatgca gatagtttgt ctgatcaact     96780
     tatatagata aatttaatat ttatcagaat tacatacatt aattttaggt agattcacat     96840
     actttttgca ctcgggggac gtcatgtcaa atttaccacg ataatggctt cgtacagtgc     96900
     aaaaaccgtt gctataatca tcgtgcattt atgatgtata taagtcaggt ttttgcacta     96960
     tgagtgacgg aatatcaaaa tattctccaa gtcgtgtggg gtatgcccgg gtcagtagca     97020
     tcagccaaaa tctggattca caaattgatg ccttaaaaac agcgggctgc ggaaaaatat     97080
     ttaccgacaa aatgacggtt cacgcatgaa cagaccgggc tgggaacaac ttctggccta     97140
     tttgcgtacg ggagacagtc tggtcgtgac ggaactgagc cggatgacac gttcattaat     97200
     ggatctgtta caaacctgtc aggcgctgga agcacgacac attagcctgg tctcactgag     97260
     agaaaatatc gataccacga cagcaacagg acggggtttt ctgtccatga tgggcgtcat     97320
     tcaccagatg gaacgggaac taaaagcaga acgggcagca gccggaagag cggcggctaa     97380
     agccagaggt aaaagtggtg gccgcccacg aacccacatt gagaaattag aaaacgccag     97440
     aattttgtac gaaaattcag ataaaacggc cgcagaagtt tgtgaacaga ccggcgttgg     97500
     aagacgaacc tttttttctt atcttttgca atgcaggaaa gagatcagcg aacaagctaa     97560
     agaagagccg tactgaaaat gcgattctaa tctaaaaaac attgaggcat cgttactcgt     97620
     cattttcgag agttcttccg caggacccct acttgattgg ataccatcct tttttaagca     97680
     tggcttccga atggtatgaa acttttaacg agtaaaaata accttaaatt ttgagtagat     97740
     tataaaatgt atggcattaa ttttatctta agcataattt tatttaaatg gagacttatc     97800
     atgaatatta ttcaaaaaaa ctcttcgaat ataatttggg gagatgaaac agattcgggt     97860
     caattgggac atttttatcc ttttctgttt ccctttacga ttggggatca tacgtttttt     97920
     tatggccaaa acatagaaag atctcgttat ggtagattta ttcgggaact tcaccccggt     97980
     ggcatagtga gttggacaac agatgaaaca gatataaatt atgggccttc tctttctatt     98040
     aggccggttc tttataccgt tggaaagcgt gtatttatac gtgctcaaat gattgaccat     98100
     cataagctat ggtacattca agaagtgtta ccaggtggaa cattcggctc cataataaat     98160
     caaggctatt ataatattga atattctgca cagtttccct atttaattga tgggaagaca     98220
     tttatattta atcagacttt tgatgaaaaa aaaggtaact tttatatagt tcaagaaatg     98280
     atgcccgacg gtaatcatgg tgaaataacg gacgaaggaa catggaactc gttttaccct     98340
     ttccagtttg cttatacagt tggaaagcgc actttctatt atggacaaac cagagataat     98400
     aactattggt tcattcagga acttttgcct gacggtagaa tagggagcac cactgaaagc     98460
     ggaaattggc acagttttta tgaggtgcta tttcccttca tttttaaagg gcgcactttc     98520
     tattatggac aaaccagaga taataactat tggtttattc aggaacttct ggctgacggc     98580
     aagctggcga gcagctatca atcaggatat tttgagcatt tttatgaggt tcaattcccc     98640
     ttcacttttg gagagcatac ttacttcttt cggcacagca atgataaaag gtggtttatt     98700
     caagaactac tattatagtt tgtttcactc actttcatag atagtcttgt gttcatatcc     98760
     aactcaaata tttcatagga ggattcatat gggattaaat caacgaagtt aaatccctga     98820
     agtcctccat tttcatcctt gaaagccagt ttggttcgtt aagcacatat ttgggttctg     98880
     tcgcattaaa gggagctcag gcaatatgtg accttttgca gagcgatccg tgtctttaat     98940
     tgtaagcggc tcatttagac cgtctatcgg tattcctccg gttcggggaa aatagtgtcc     99000
     atcattttta gtggacatta ttgtatgaaa tatcggacat tgctcctcga cgctttgcgc     99060
     ttacattttg atgaacacct atccagactc gatgttggcc gtcggcttgg gatccccaaa     99120
     agcaccctct gcgctctctt tgttcgcttc aaaaagctgg gaatgagctg gccgctgcct     99180
     gataacatga ccgccgataa gctcgaatcg caactttacc ccgcgcgtcc ccatgccgtc     99240
     aggcttgata tccctgcgcc tgttttaggg gttttgtgcc cgatgcatcc aaaagttcca     99300
     tggtgatgaa ttaatgtttt aaaatcattt gattatagag ttattctaaa tttttgatgg     99360
     tttttgaaac tttggatatg gtatgtctgg aacatcccaa taaataaaca atcgcgttat     99420
     aacttttttt ctctctgaga agcccttcta ttttttgatg caatttttta tccaccgggc     99480
     gacctttata tttaccttcc tgtttaaggg atttgtgccc ttcccctcgg aaagttcact     99540
     gtgcaaaatt aaatcatttt tttcagccga aagtaggtcg ctctggatat tcctgttttc     99600
     tccatcacct ctttcatcga aattttctgg gctatcattt tattggcttc ggctgtgctt     99660
     ttgtgcggtt ttcggccaaa cttgacgcct gattctttcg caaattggcg gccttcgttg     99720
     gtacgttcaa gaatacgctc acgctctgct tcagcaaccg cagccaaaat ctggatcacc     99780
     attttcccca ttgtaccttc agtgctgagg tggttgtcca aaaaacgaag gggaattccc     99840
     tttttgtagc agttatcgac aatttttatc atgtcagcgg tattccggcc taagcgatcc     99900
     attttggtgc agataatggt atcgtcccgt tctgctctgg ccagcaattt tttcagtccc     99960
     tctctgtcgt ccgtttttcc agtcatttta tccgtgaaga tccggtcttc acgaacaccg    100020
     gcctgtttca gagacgcaat ctgaatgtca agtttctgtt gtgaggtgga tacccttgca    100080
     tagcccaata atgccatttt cgtcattccc agtatcacaa gtcgatcctg ataccatcaa    100140
     gtctcataac ttgaaaaaga agatttttga tacttcctta tgtgcgttgt tatagagtat    100200
     caaattttac aaattatgat acctgaagat gacaactgac tgtaccaaga agaacgaaaa    100260
     acgacttcat attttaaacc caagtgaagt cagagaattg tatgaacgcc ctgtattcaa    100320
     tcaggccgac agagaagaat atttttcttt agacccttat acaactaata tcgttgccga    100380
     actgaataag ccggaaaccc ggatctattt tattttgtta ataggctatt ttcgggctaa    100440
     accagtcatt cccaaattta accttaatga agtcgccgaa gatgctgaat acatccgtaa    100500
     aacttacttc ccggatgaaa atccagaatg gatgactatg tctaaaagca cccgttccaa    100560
     actcgtcaac aaagccctcg acatcctgaa ttttcagcgt ttcactgagg cacattatac    100620
     tgtcctgata acccgtctaa aagatgtggt aacaatctgt accgaacccc gctatatttt    100680
     tgatgagact ctggcttttt tcggccaaaa gcgaattgca cttcccggtt acacccgctt    100740
     gcaagagctg gtgactgagg cgcttatcgc agaacaacaa cgtattgaag ccatcctttc    100800
     acaacagatg tctgaagcga ctgccgacaa actgaaacag ctcctttcta ccaaaggctt    100860
     acttaaccgt ctatccgctt acaaagggac tgcccgggat ttttcaccgt ctgaattgga    100920
     tcgagagctg gaaacacatc taaccatcaa ggatatctac cccgaactga aatcgttgat    100980
     gggttcatta ggattatcac aaggcaacac ccttcattat gcgtcaatca taaaacatac    101040
     ttctgtttat caggttcgcc attacccaca ctggcagggc ttgctgtatc tgacttgcta    101100
     tctttatttt cgctatcggg aaaccaatga caagttggtg atagcttttt gttacctgac    101160
     ccgtaaatat catgaagccg ctaaagcctt tgctaagcaa aaaatagccg atgaactgga    101220
     gctggtcagg gaaaagttaa aatatgccgg tgatattctc cactactttg ttgacgagaa    101280
     tgtcagtgat gtcgttgaat ttggcgaaat tcgccagcag gcttttagcc tgatctcgaa    101340
     agaggaaatc catgccatca gtcaacactt gggtaaaaac gattttgacc ttgccggtta    101400
     cgaatgggag tatttggata aacaatccag aaaaattgcc aattcacttc gcaagctgtt    101460
     tatcgccatc gatattgaat gtgaatctga tcagaaagta ctgtcagatc agattatgct    101520
     atcgaaacat gaacttgctg gaaaacgaaa aattattacc acgcatcagg agatgttaaa    101580
     aaaaagcgac cgtcgctatc tctggattaa tggtgaagtt catacaaaac gctttgaatt    101640
     ctatctgtat cagaaaatca gcagacaatt agatcgcggt aaggcttacg ttactgaaag    101700
     tgagaaaaat aaacgactgg aagatgacct tatcccggtc aaagactggg aaaatgacca    101760
     gattaacctc atcgagaaaa ccggtttaca acggttatca tcgccgatta ctcagacatt    101820
     gaatgaattt gaaaaacggc ttgagctgca catgaatcag gttgcggcga gtatttctgg    101880
     cgacaccaat gaatttgtca aattacagcc tcgctcaaac cagctcgcgt ggacgttagc    101940
     taaccaacgt tggcgcgatg acattgataa cccgatttat agtcagatca ggcacatggg    102000
     aattattgag attatgaatc atgtcaatcg taaaacggga ttccttggag cttttaaagg    102060
     catagccacc cgaaaacggt gtactaaagc cgaagcagat gacttaatcg cctgcatttt    102120
     tggcaatggc actaattatg ggcttcaccg tatagcggcg atttcagatc gcagcattgg    102180
     cgttttgcgg ggtgtcaacg atgcatttgt ccggcctgaa acgattagtg cagccaatga    102240
     cctcatctct aatggaatag cccgcctgcc ggttttcagg tactacaccc tcaacgaatc    102300
     atcgcccttc ggcagtatcg atggtcagaa atatgcctgt cgtatcaata cgtttaaagc    102360
     cagattctcg gcgaaatatt tccgcaaggg gaaaggtgtt tctgcaatga cattggtctc    102420
     caatcatgtt ccaatcaaaa caaccgtaat ttcaccgaat gaatatgaag ggcactatgc    102480
     ctttgattta ctgtacaaca acagcagtga tattcagcca aaatcgctgg caacggatac    102540
     gcatggtatc aataatgtca attttgctat tttggatctg ttcggttatc aattctcgcc    102600
     ccgttatgcc cggtttaaac aggcttttgc tgaacaattt gaggtcaata caggcactga    102660
     tatgactatc agcctgaaaa agcccatcaa acgtaaatta atcgagcagg aatggggaaa    102720
     tattcagcac attatctgtt cactcagccg taaagtgacc cagcaaagta ccgttgtcaa    102780
     aaagttgtcc aataacaagc gaaataaccg aaccttgtta gcccttcatg aatacgaccg    102840
     gttgattaag tgtctttatc tgttggagta tgttgataac aaaacgctgg ggcagtttgt    102900
     gcaacaagcc ctgaatagag gagaagccta tcaccagtta cgcagagcga ttgcctcggt    102960
     caatggcaat cagttccggg gtggaaatga ttatcaaatt gaacagtgga atgactgtgc    103020
     cagactcatt gccaattgta ttatttatta caattcagcc ttgttgtctg cattaattga    103080
     gaagtttcag gaagaagggg ttgtaagcgg gaagccgcca aaattttgcg ggcttgacta    103140
     tgacaacgtc agtccttcaa tcatggcgtc cagatcgagt tctttccctt cactgataaa    103200
     ggtgtaatgg ccgttcagaa agatatgctg ccaggctacg ggcgacattc gtctgagaag    103260
     agcaagtccc cgggagttac cgacattttc atacttctgc agcaaccgcg acaacagggc    103320
     ggagttataa taaataataa tgatgctgag cagccgccca cactgattgc tgatttccag    103380
     ctcaatatca ttctgacctg tcagctcttt tttaccacca acctgcgcga tcgctgaacg    103440
     aagctgatgc caggattcaa tgcgattttg cgatcgatgg ctatttctgg ccacctgcgg    103500
     gttacgaaga taccggagaa tgtaaagact acggatcagt ttatcaaact caaacaaggc    103560
     cttccttgtc gggttttccg ctgaataggt acacagtttg cggataagtg caccctgagt    103620
     aatttctttc atccccagcg tggcgacaat ctggtccagg tgtggttttt catcaatgat    103680
     aactttctga tttaactgcc ctacaggccg gataaaacat tttttataat gttccagatc    103740
     atccgcgcag tatagttctt tcagcatgtc ctctgtcgag gtaaagcggg gttcgaaacg    103800
     caggccgaac cagtgaagaa tggcgaaatt agccttgtta atactgtgca tgtcaccggt    103860
     tatcgtcgtt ggtacaatcc cgctggtatt tctgtaccag atatcgaaaa catgatgtgc    103920
     ttcatactca tgagccccaa tgagataacc attgagtgga atatggttgc atagcagggt    103980
     gtaagccacc acgcctttcc cgagcccaaa atattttttt gatgcacggg ctttgatagt    104040
     cggacgctca acgctgaatt tttgcccatc gacagcgcca tacagctccc ctaactccag    104100
     ggagtaatat gggaagacag gaagtgtctt aattccgtcg ccaatgcagt cacatgctgc    104160
     tttcagcgtg gagagacgca gatattgctc gtaggaatca ttgagcgcat ggtaaggaat    104220
     gtcgctggtc tgggacatcg tcagattacc gtgattcatg gcctgtgcca ttattaccgc    104280
     catcaggctg tctgcatcag ctcccgtttt cacatacagg ggttgtagcg gtgtcagtgc    104340
     cgacaaaaac tggcactgtt gattaacgaa gcgaaaaata tccgccaact cacacagggg    104400
     cagttgtgaa taaaaatccg tcacactgtc cgatggccct gttaaatccg acttacgcca    104460
     gcttagtttc tgtgtattat gatcaaactc cagatgtgac aacttaccct gcttaagttc    104520
     tctgttgaac gctatccact ggtcatgcag ttcgcgggcc agttcatcca gttgatgttc    104580
     gaccggagta cgtaaaaacg ggatatccat ctgggccaga atgtcggatt tttcttctac    104640
     ggaaaccagc tcatctgaaa ggtggcggtg ctgcaggctg tcatcaagat aaagttctcc    104700
     tgcctccagt cgttttctga tttgccggta aagccagaat tcatagcgat cggcatgaag    104760
     ccctgtcggc gtatcttttt catcaatgct caataaccag attcgcagtc gtggcgggag    104820
     tgtggccgga ggacattctg ctagcggtcg ctgcgtcaac cgcaactgct tagagaacgt    104880
     ctccctgacc catgtcagtg cagcaagcta gggacattca ggcgtcacac tggaaaaatt    104940
     cagagtacaa aacagcggcc gtaaatggcg tcgtatatga gccacctgag tgtcaaccgc    105000
     ctcccattgt cgtgccatcc gactggctgg tttaacccgc attcgctgtg cggtgctttg    105060
     aagagtttcc ctgggcatga ttttccaggc tcgctggcgt acctcaccaa aggggatgct    105120
     atccgtcaca tcatcatcga caaacaggga taacagccga ccgactttat tattctcctg    105180
     ctgccgttgc agaacgtctg cttcaaagtt ttttctggcc tcttccttgc agcgttcttc    105240
     ggtctgcttc atgtgccata tcatggcgct ggtgaggtta tctgacagct gacggtagcg    105300
     aagccagata tagcacgtca gatataacca ggtttgttcg gttttgaggt tacgcaaatc    105360
     atggatggta taaaagttga ccagactggc gaagtacagc aaattttgtt gcgaaatccc    105420
     gagtccggga agtaattgtc gagccttctg atatatcggt gccagctggt ttcgtttctc    105480
     cctttccctc gacatttgcc gccaccgaaa atctttcgct tcctgcttca acacagccag    105540
     tcccgacagc gcatcatctt tcttcagaag tgaattcagt gcgctctgtg tttctgtatc    105600
     gagggaggac aacagtattc ccgccaatcg ctgccgctca gttgacagtg ctttactaat    105660
     tattttctgg agtgtggaat atcctggccg aacgattttc tgttcattca gccagcagat    105720
     aagttcggta gcaacaaatc caggggtaat atcacgacgc acaatctgcg ctgcgcgggc    105780
     attcaactgc gggccaacgg agcctgacca ctgacggtac ccaaagaagt cggtaataag    105840
     cttacgctgg gcgtaatatt catgggtggt aatagttctg tcggtaaggg atacctcacg    105900
     aaagtaacgc tgaaccacaa aatcgaaatc actttccaca tccttcggtg aaaaatgaaa    105960
     gaaggcgtgt ttggccttaa aataacccgt ttgaaggata caataaatct gcgacagtat    106020
     ttcggggcga ctgtttgcca gcgccagctc atttgccgta agcgacaaat actccaactg    106080
     ctggccttca tcaaagtcag gcaggccata cagtgcgaat ttttctgcat ccgttaaaac    106140
     ggtgagtctt ttacctttat cttttcgacg ggatgtcatc ctgacctcgc actgaatatg    106200
     tccgtaagag gatcgctctg cggacggtaa aaattaaatt tgcgcttcag agaaaatcac    106260
     tgctgacgtt gtctcatata actggtacgg tatcaatctc tttcacggct ccttaaacgt    106320
     acactttatg actgaaatac ggattggcta tgcccgctgc tccacggata aacaggattt    106380
     gactgcccaa caggaagcgt tggtaaaact cggtgtctcc ccggacagaa tttacatcga    106440
     caaagggctg acgggttcaa accggcaaag gcctggtctg gatcaggcac tagctgccgt    106500
     gcgtagtgga gacacgctgg ttgttcccaa gcttgaccgc ctggcgcgtt cagtacctga    106560
     cgctcgtgaa atagctgata cattgcagtc cagagaagtg aaactggcgc ttggaaccaa    106620
     tatttatgat ccggcagacc cgatggggaa aatgttcttc aacgtactgg ccacctttgc    106680
     tgaatttgaa ggcgacctga tacgcctgcg aacccgggaa ggcatggcta ttgcgcgggc    106740
     gaaggggaaa ctgaggggaa aacaaccaaa actgtctgaa aaacaacaaa aagagttgtg    106800
     ccggatgcat gaaaccgggc agtactcgat tagcgatctg gctgagttgt tttcagtctc    106860
     aagaccaaca gtctaccgga cactttcaag agggaaaaaa tgatcgactt aaccgcagaa    106920
     cagcggcagc tggcaaagat tgtccatgat tatgcctgtc ggtttcctct gacagagaat    106980
     gacgataccc agctattgca gggctgttat gactatatga atgcctttaa acgggtgatg    107040
     gacagtgagt caaaagtcca gatggattac atctgcctgc aatatcctgg gtattttcgc    107100
     tttgcagtat ggatggaacg aatggctcag gggattgctg atggcgttat tgaagttcct    107160
     aaagatcact aaaaattacg atccggaaat tttgatgaat ttcagcttac tgcctcaggt    107220
     tcgcgagata gctgaatcta gaactgtgtg catcctagat agaccttatc aggagtgatt    107280
     tgatgctttc aatagtcgaa aaaaataagg ggtaaacaga tgtggtcaga caaggaatca    107340
     tcagaagatt acctaaattt tggagaagta tcccaattag ccgtcgatgt gctcactacc    107400
     gaaggtatgt taccagtatc gataggcatt tttggtaatt ggggtgctgg caaatcctca    107460
     ctcttgaaac tgatagagca aaaacttgag aaagatgata aggattggat tgttatcaac    107520
     tttgactcct ggctctatca aggttatgac gacgctcgag ctgcgcttct tgaagttata    107580
     gctacatcat tgacgaaagc tgcggatggg aatgcctcca tcgtctcaaa agcgaagaaa    107640
     ctccttagtc gggtagatgg atttagggca atggggttct tggctgaagg agcggcttta    107700
     tttgccggag ttcctactgg gggctttctt gctagaggtt tgggagcatt aagaaatgtt    107760
     tcagatggaa tacaaagtca ggaagagtac gaagatttag gcaatctggc taaagaaagt    107820
     aaggagaagg ttggtaattt gctcaagcca gaggtgaaaa aaagccctcc tcaacagatt    107880
     gaagctttcc gtaaggaata tggggaaatt ttagaagagc ttggtaagcc acttatagtg    107940
     ataatagata atcttgatcg ctgcctccct gctaacgcta ttcatacgct tgaagctatc    108000
     aggttattcc ttttcttaac taatactgcc tttatcattg cagcagatga ggacatgatt    108060
     cgttcttctg tgtctgatta cttcaagggg gcatcacagc gccatcagat agattatctc    108120
     gataagctca tccaggttcc tattcgggtg ccaaaagctg gagtgcgtga gattcgttca    108180
     tatctgttca tgctttatgc tattgaacat ggcttaaaag gcgaaaaact taccaatctc    108240
     cgtgatggtt tagaaagggc attacagcat tcctggaaag atgaaccaat ctcacgccag    108300
     gacgtcctga aaatgactgg tgaatccgag gatagtaatc tagctttggc atttgcacgt    108360
     gcggaccgta ttgctcctgt attagcgaac tctccaataa tccatggcaa tcccagaatc    108420
     gttaagcgtt tgctgaatgt tgtgaaaatg cgttctcaaa ttgctaagcg acgagcaatg    108480
     cctttggatg aagcaattat cactaagtta gtaatctttg aacgatgtgt cggagtagat    108540
     ggtactgctg atttatatca cctcgtggat attgaacaag gtatgcccca gctactaaaa    108600
     cagcttgagg atactaacgg tcaagtacct tcggaagcgc caaagacatg gactgataat    108660
     ccaacaacta aagctttcat tgctcaatgg gctcagcttg aaccgcgcct tggtggaatt    108720
     gatttgagag ccgctatata cctatccaga gaaactatgc caataggtgc atatgtggtc    108780
     ggtttatcac catctggacg ggaagtactg aatgcactta ttgaactgaa aaataccagt    108840
     tctcctacag cagaagacct tttgaaaacg cttcctcgtg aagagcaagt acctgtaatg    108900
     gaaggtttaa ttagccaatt aaggcaagtg tcagattggg ctcgtaaacc taagggtttt    108960
     tccggtgcat gcctcttagc ccgccattcg gcagatgcgg ccagtatatt aattcgtttt    109020
     ttgcaggagt tgcaactggg gatgaaacgg ccagcgtgga tgactgcagc actaaaagat    109080
     gagcaatgga ataaggacgc ttaatgggaa cttcacaatc aagtacaggt ccaggtggtg    109140
     gttctccact agttccacct tgggctgatg atcagccaca gcaacccttg cccccgccac    109200
     aagaaagaag gtttgcgccg ttccgggaat ctttgggaaa tgcggtttta aacggtaata    109260
     gagcagactt cagaaaagct atagggcatt acgcgcgaaa agcctctgga gggagcggta    109320
     gtgcagctcg acgattaggg agtgtcacac aggcaggggg cggattgttt ggggcattgg    109380
     cgggaatgcc tgcggctcca ggagaaccaa gcattgattt gggcagtttg gctggccttc    109440
     catgcgaaat ggcaatatca gctattgctc aagctttaac atcacaggat ggtgattcag    109500
     aaaagatttg tgcagccatg aaccatgcct tagtggaggc tctcgatggt gtagcaatct    109560
     tcgatcccca aaaaataact gatggtgtga tcgttgacac aatgatttgt tatctagctg    109620
     aaagcatttt tctgcaaatg gtcatggatt ctaacaaggc atggaataaa gcagatactc    109680
     cttcaaaagc catccatgca gaaactgaac ttcgagaatt gatcaaagtt gttgttgata    109740
     agcatatggc tccaaaactt gtcggtaaca tcagaacttt ttcgaaaaat caaatgatta    109800
     atattgagcg tcaggtaatc attgaggctt ggcaagaatg ggaggcttac caatgacaca    109860
     attagttttc catcatgatc atcgtctctt accgtcagca ggtgatagct tgttgcccgt    109920
     acagctctat ggattaagcg ggcagggtcg gggtgatata tctattattg ggaatcctgc    109980
     gattgatcga attaagcgct tgggagtcaa aattccagct caggtcatgg attttttgag    110040
     catcgcacta gcggttacag ccgccgatac cttcgttcag cgtgaaagct ctgaggatgg    110100
     ttggactcgc caattctcgt tacgacttcc ccttcatgag ccatctcgat ggattgctct    110160
     taagaaggag cttgaaagcg ctttgcattt ccttagtgga gacatctggg attttgaatt    110220
     ttgtaacggt ggttatgtac caccagaacc gtatagccag cattcaaaat ttcatctgat    110280
     taaactcaaa gatcttgact gcgtcagctt attttcgggc ggattggatt cggctattgg    110340
     cgcaatagat cttcttgcag cagggcgtgc cccgcttttg gttagtcatg cttataaagg    110400
     agacaagtca cgccaagatc agattgctga aaaattaaat ggtcgatact cacggtttga    110460
     aattaatgct gatccgcata tatatcaagg tgatactgag attacgatgc gaacgcgtag    110520
     cctcaatttt cttgcctttg cggctgttgg cgcttgtgct gtacaagaag tatctcaaca    110580
     agaaaaggtc gatctgtttg tgcctgaaaa tgggtttatc tcgctaaatg cgccactaac    110640
     cccacgaagg ataggtacgc tgagcacacg aactacacat ccacatttta ttacgagcgt    110700
     acaaaagctc tttgatgcgg ccggtattcc ttgccaaata atcaatccat atcagttcaa    110760
     aacaaagggg caaatggcct cccaatgctt gaataagcaa ctattatctg aagtcgtgga    110820
     aagtacagta tcttgcagtc attggaaacg ccggaatcag cagtgcggag tgtgtgtacc    110880
     gtgcatcatt cgacgggcat cgcttcatgc tggggggatt gataaagacg ctgattatac    110940
     ttttcagtcc ctagctaaag taataaatga aattgatcgc agggatgatc tcatggctct    111000
     taggattgcg atcgcacaga aatcgacttt gaaaatagga acatggatcg ccaaaagcgg    111060
     tcctttgcct acggcaacat tcaataattt taagcaggtg tttatagacg gcctggatga    111120
     ggtcgaaagc tacttactaa gtgagagcat agtgtgagca tcgatatgca ctgtcatctc    111180
     gacttatatt ctcagccaga acaagtggct gaggaatgca agcgtcgagg gacttatata    111240
     ctgtcggtta caacgacacc tagagcatgg catgggacct cttcactagc caaaggaagc    111300
     caacgaatcc gaacagctct tgggcttcat ccccaaatag cacatcaaag atcgcatgag    111360
     ttagagctat ttgattcact gctttcggaa actaggtaca ttggcgaaat agggcttgat    111420
     ggtggtaagg gatttaaaga gcattgggac atccagttga aggtattccg acacatactc    111480
     aataacgtaa atcgtgctgg aggcaagatt atgactatcc atagccgagg aagtgcgtca    111540
     gttgtcctcg atgagatcga aaatattgat ggggtagcag tattgcattg gttcacaggg    111600
     acacctaagc agcttgaaag ggcaatcgat ttagggtgtt ggttttcagt ggggccagca    111660
     atgctcgata caataaaggg aaagtcctta gctttgaaaa ttcccaaatc acgcattctt    111720
     acagaaacag atgggccatt tggtaagttt cgtaatgacc cactaatgcc atgggacagt    111780
     gagattgcag agaagcagct aaccacatta tgggacatga gccagatgga ggttaaagct    111840
     cagctttttg aaaattttag agagttatgt aaattgtaaa atatcgtgga tatccgttgc    111900
     catatcatgc tggaacacca cgctgacaaa attttggcgg cttccggctt acaaccccaa    111960
     aatcgcttaa aaaaacaggc cgtgcaacca gttcaagccc agcattacca aactcatcaa    112020
     ttttcagcac cgccaatccg gttttaacaa attcattcac tgcggcttta ttcgatgtaa    112080
     tatcatgacc agtatataga tttgtattcg tgtcataggt ggaattatca gaaaaactca    112140
     atggacgttg ttttacgtgg gcggacgcta tggctactat caaactaaaa aacgaattag    112200
     aattttgcat ttttagcatt gcaaacacct ttaactaaaa tctagtgata tggggcaatg    112260
     ggttaaatct tggaataact atccataaac agtccactat ccgaactttt aagtgatgta    112320
     agtggaaagt cgtcatccaa actggaatag tctataaaaa accaatcaat aggagtattt    112380
     aatgcaatgg caataatgac taaatcagtc gaagttattc ttttcttccc tgtttcatat    112440
     ctggataatg tttgttggtt catgccagcc tgtttagcca agccctgtaa ggtgacattc    112500
     agtttctttc tccgtacacg gatgcgttga ccaatatttt tagccatcat ctctaattct    112560
     ggtttatcca tgattttggt cggtgtagtc ggtaaatgac tagaagtgtt cacctctaaa    112620
     tcagggtggc aatctataaa aaaccaactg atcggaatac ctagagcaag agcgatgttc    112680
     accaaatgat ctatatgtat tctatttttc ccgtgttcat tcctggatat ttgttgttga    112740
     gacaagccaa cactgagacc taaagccgca gctgttaaca tcatggtttt ccgccatatc    112800
     tggatgcgta aaccaatatt tttagtaacc gcacctgttg ttaatgtgtc cataataaaa    112860
     ccatctgata catgcggcag cttactggca ttgctcacat ataaatcaga gtataaatcg    112920
     ataaaaaacc acccagtcgg agtattcaat ccagcagaga tttggatcaa atgagacaac    112980
     gggatgtcat ccaaccctgt ttcatacatg attaactgtg cttccgagat cccggtatgt    113040
     tgagctaaag tgtgagtcga taatcccgcc tcttttctcc gtatacagac acgttgacca    113100
     atacttttaa aaaacacatc caacattgct ttatccatta aattctctat gaaaacggtt    113160
     tgctattctg gtgttacatt cagacagcaa aaataattta cttgggagta acgcctcggc    113220
     gctttctatt aatctttggg aagacaaagc gatgtctccc aaacataaaa cccgttaaaa    113280
     attcataaaa aacccctgta aaaacagggg aatataggat agatggttaa atattatatt    113340
     gagagttgtt tcgggtaaaa ctactggtat tgtcatagaa actagttcaa cagctacatt    113400
     gtgttatcat aacaaattga aactaatttt ttccctgatg aaaatgtaac tgattataca    113460
     aattgtcgta cggatacggt gatgaatcca tgtaactaac actaatagat atattttata    113520
     aaaaactgga acttttagtc ctctgaaaag gattttgtaa tagtgataga aaatagtcaa    113580
     gctaaaacta ttcaaaaaaa tatatacatg aatgcaaata ggttaatcga agcccgaaaa    113640
     ttccgaggat tatcacaacg ggagctagga gaggcattgg ggatcactga ctcagagaca    113700
     gcggggcaac acatcagtaa atatgagcgt ggcgtgaggt taccgccata caagaccgtc    113760
     cgtgagatcg ctaaaatatt ggatatgccc ccttgttatt tttatattga tgatgatgat    113820
     ttatccgccg aagaggtgca aattttctat gaaaaatgcc tttctcataa atcggaaaga    113880
     cgcttcattt ctgaccttat agaaaaaaat caggaatatg aaaaagtgat caatagcata    113940
     aagaaaacgg taaattcggt aaaaacctcc tgagatagat acactctcaa ctatattacc    114000
     cttattcatg ccaagtatga ataagggtaa tataattcaa tgcgttataa ctaaaattta    114060
     cttccagcct ttttagcgta ttgcagctag gtagtatcca ataaaatatc ccttaccaaa    114120
     aacgtcttac gacagggctg acagaggtaa cagcgacgat tgagcatgca gcagatgcaa    114180
     tggagccagc aaggtgcgca ttacttactc cagacccgca cagccgtact taatgatgat    114240
     ttgaaaaccc aatttgagca ttggtatccg ggcataaaat taggtgacga aacggagcat    114300
     tcttggacag aaaagattgc tgcataagtg ccccacagat ttttatggtc tcgtacaaat    114360
     ggggtcggtt ccggctgggg gcgaaatgac ccccataaga atgaagttca ccctggagtt    114420
     aacagaccag ccttgcgggg ttacctgata ctccgtatcg gataaagtga aatagtattc    114480
     tcgttccgcc aaagtaaatc gaggcaggcc aaaatagtcc tgaatttcag gctgggtcag    114540
     tatagtcagg cgctttttat tggtattcat ttttttaatt cttaatatgg cagggctaca    114600
     ttgagtatgt cactttatac tttccttact acctttaata gacatagatt tatatacagt    114660
     ttatattaca tctttccctc cgtatttagg ctcaaacaag gctgtcattt aaacgttcgt    114720
     ttaactgaca catcaaaagc gagaagaaag gtttatggcg caaaaaattg atgtccgggg    114780
     tataaaagtc tctgtctttt ccgacaaaca agatgactat atatcgctat cagacatcgc    114840
     caagtacaaa gatggcgacc gcggtgatta cattctgcaa aactggatga gaaaccgcag    114900
     caccattgag tttatcggtt tgtgggaaca gctccataat cccgatttta attccatcga    114960
     attcgatgga tttaaacatg aagcgggcgc aaacagtttc tctctcacgc caaaacgctg    115020
     gatcacaacc acccatgcaa tagggatcat ctcgaaagcg ggcagatatg gcggaactta    115080
     tgcgcatcgg gatattgctt ttgagtttgc ttcctggatc agcgcggagt ttaagctcta    115140
     tctattaaaa gaattccagc ggctcaaaca agcagaaaat gaacagaaaa atctggaatg    115200
     gaatgtttcg cgcactctgg ccaaggtcaa ctatcatatt catacagagt caataaaaac    115260
     gaacattatt cccgccctgg agcttaaccc aaaagcaaga aattttgctt atgctaatga    115320
     ggccgatata ttgaatctgg cgttgtttgg caagacagcc agtgactggc gcaaagagaa    115380
     cccggaacta aaaggcaata tacgggacta tgccacactg gaacagcttg tcgtgttatc    115440
     taatttagaa agcttcaatg ctgaacttat cggacaaggc ctctctgcaa acgacaggtt    115500
     ccaaaagctg aatcgcgttg cggtcagtca aatggagatc ctgatagaaa acaaatccat    115560
     tgaaaaactt aaacaattaa aataggccgt tcatgcgaat tgggtatacc cgtgtctcca    115620
     aatctgatgg aagtcaggtg caggatctcc aactggatgc tttacttgct gccggtgtca    115680
     ataaagaaaa catctatcag gatgaaatat ccgggaaatc agacaaacgt cctggattgg    115740
     atgcctgttt gaaagccctc aggtctggcg atgtgttaat ggtatggaag cttgacaggc    115800
     ttggccgaag cttaaaacac ctggtgaaca ctatccatga tcttgcggac cgaaaaatcg    115860
     gatttaaggt actgaccggg cagggtgcag aaattgatac gacgacggcc agtggcaaat    115920
     tggtctttgg gatttttgcc gcgctggccg aatttgaacg ggagttgatc agtgaacgaa    115980
     caaaagcagg gctggcagcg gccagagcaa gaggacgtga aggtggacgt tcttttaaac    116040
     tcacaaaatc tcaggttcgc ctggcacagg cttctatgaa aagtagggat tgtagcgtat    116100
     ctgaattatg tgaagagctt ggaattagca gacaggctct ctataagtat gtagggccag    116160
     atggggaact cagagaacac ggcaaaagag tattaaaatc ttagcgctaa ctgagtaccc    116220
     atttttttcc tcatcaactt tgaaccctat cgggggatgg gcaaaaatag cccagtattg    116280
     gctcaaggtt tgggtaatca ctgggtttat catccgatta aaaagaaaaa taaagagcaa    116340
     tgctaaaaac gaagctcttt ctcaatataa ttcaatgtga tatctaaaga aggtgggact    116400
     tttggaggaa atgggcgcgg aacccctaaa agccccctaa taggagacca taaaaatctg    116460
     tggggcactt atgcagcaac tgcctctgtc caataatgat ccgttttgtc acctaatttt    116520
     atacccggat accagtgctc aaattgggct tttaaatcac cattgagtac cgctgtgcgt    116580
     gtctggagta agtaatgtgc accttgctag ctccattgca tctgctgctt tttcaccatc    116640
     cgtttagcga taacttcatt gatcgtcgat tcaacaaatg aagaggaaat tgcttcacca    116700
     tatcggtaca tttcaccgta attcgggatc atcatgctgt tattttcaat ataggtatac    116760
     atttcatcta tatgttttaa caatgattta ttattaccat aatgcgatat gtcctcatca    116820
     cacattgccg cacaatcatc caggtgttct aatgccttaa tcacatttcc atgccagata    116880
     taccattttg tgctggttaa agagtccaat aattctgcac caagttcagg ggcgtttttt    116940
     gataccctgt cccgtcctaa ataaggttga cacttttctt catccattga ggagaatgtt    117000
     atgaaatcag aaagcaaacg aactcagcgt gattattcac tggcttttaa attggccgtt    117060
     gttgatcaag ttgaaaaagg cgagatgacg tacaaacaag cccaaagtcg gtacggtatt    117120
     caagggcgtt caaccgtttt agtttggctt aggaagcatg gtcagttaga ttggagtctg    117180
     ggttggacac ctttacatcc tcaaggagct gccatgacct catcttcatc gcttacacct    117240
     gagcaacaca taaaagaact tgaacagcaa ctcactgaaa tggaaaagaa agccgagttt    117300
     tttgaggcag ttgttgaggt gttaaaacgg gattatgggg taactatcgt aaaaaagcca    117360
     cgaggcaagt cattcaggcg aaaaaagtaa ccggctttca tgtgactcaa tgttgccgtt    117420
     atctgggtat cacacggcaa gcttattatc agcaatgtca gcggacagcc atcaaagaac    117480
     aacaggaaca ggataccttg aggcaagtgc agtcaatccg cctgaagcag ccccgtattg    117540
     gcacgagaaa gcttcagtat ttgttgaatc aatcaagccc attaaaaata ggcagagaca    117600
     gcctgttcga cttactcaga acccatcatt tgttagtcag acccaaacgg gcttaccaca    117660
     aaacgacgca gagtcatcat cgtttttact gccaccctaa tttacttaaa gcgggttcta    117720
     ataagataac cccaacgggg ccagaacaag tttgggtggc tgatattacg tatcttcccg    117780
     tgaaaatggg ggaagcatat ttaagcctga ttacggatgc ctggtcacgt aaaatcgtgg    117840
     ggcatcatgt gcatgataac ttaaaaacag acgcggttat caaggcgtac aagcaggcct    117900
     taaaaaaccg aaaattagcc gaaaaatcac ggatccatca ttcagacaga gggttacaat    117960
     attgttcaaa acgctatcag gcgctacata agcaccatga agtgatttgt tcaatgacag    118020
     atggtcacga ttgctatcag aatgcgttgg cagagcgtgt taatggcatc ctgaaaacag    118080
     aatttttact cagtaaaccg tctgatcttg aagaagcgat caaaatggtg agtgaatcga    118140
     tagaaattta taatcggtat cggccgcact tagcgctaaa atataaaacg ccggatgaag    118200
     ttcatcatca ggcgttaagt aaaaatagtg tcaacgtata tcaggactag acacccctct    118260
     ggcatattgt ttcaatacgg tcagacgcat cgtgatatga aaccagtcga gtacgtgctg    118320
     ggattcgggg tacaagttaa attgcagatc cctgatatta tcggcaccat ccgataagaa    118380
     agtaatttgt tgattagcct gcataccctg tgaagataac tgggcgatga gttttcttct    118440
     ggggtgattt tccagacatt gcacaaaacc aaagcgtttg gttgggacat tagccgcgaa    118500
     tgattttccg gcgatgactt cgaaatgatg ttttctgtcg tcccggtttc tgacgtagcc    118560
     cccatcgatg cccactgtca tcggttttcc cggtttgggt aatttttccc attttctggg    118620
     atcaccgggg agaaaatccg acaacccctc taattcggct tcttgtcttt tggcggtctg    118680
     acaaaggtga tttctgactg tagcggcatt atagtgttcc cccaccggca gaatatcttt    118740
     gagcagatta gcggtcaatt cataagacat cggtcatata tccaatgcgt tgattgactc    118800
     taaatataat attctctttc aataaaagta ccgatgactt tctcatgcat ttccggcgat    118860
     tttgaatagc ccaatgtttt agggggtttg tgaccattcc ctcggaaagt tcactccccc    118920
     actaattcat gattaagcgg caagttcctc agtttcaata ttgaccagcg gatcaacgcg    118980
     ttccaacata ttgtacagat tcaacaaacc atcacgattt ccaaaaacat agtttcctga    119040
     caattggatg tgacgccagg cgactggtga aaaaccagcg atttggttga cggctttctg    119100
     attgtcctca tcctgacact tttcaattaa tgcagataac aacgcagagt tgtaataaat    119160
     aatacagttg gcaataagtc tggcgcagtc attccactgt tcgatttgat aatcacttcc    119220
     gccccggaac tgattgccat tgaccgaggc aatcgccctg cgtaactggt gataggcttc    119280
     ccctctattc agggcttgtt gcacaaactg cctcagcgtt ttattatcaa tatactccaa    119340
     tagatatagg cacttaatca gccggtcata ttcatgaagg gctaacaacg ttcggttatt    119400
     tcgtttgtcg ttggacagtt ttttgataac ggtactttgt tgggtcgctt tacggctgag    119460
     tgaacagata atatgctgaa tattttccca ttcctgcccg attaatttac ggttgatggg    119520
     ctttttcagc ctgatttcca cattcgtacc tgaattgacc tcaaattgct cagcaaaagc    119580
     ctgtttaaac cgggcataac ggggcgaaaa ctgataacca aataaatcca ggatggcaaa    119640
     attaacgtta tttatgccgt gtgtatccgt tgccagcgat tttggttgaa tgtcactgct    119700
     gttgttgtac agtaaatcaa aggcatagtg cccttcatat tcattcggtg aaatcacggt    119760
     tgtcttgatt ggaacgtggt tggagacccg tgtcattgca gagacacctt tccctttacg    119820
     gaaatatttc gccgaaaatc tggctttaaa tgtattgatg cgacaggcat atttctgacc    119880
     attgatactg ccgaaaggcg atgatccgtt gagggtgtag tgcctgaaaa ccgggaggcg    119940
     ggctgttcca ttagagatga ggtcattggc ggcgctgatt gtttcaggcc ggacaaaggc    120000
     atcgttaaca ccccgtaaaa cgccaatgct gcgatcggaa atcgccgcga tacggtgaag    120060
     tccataatta gtgccattgc caaaaataca agcgattaag tcatcttctt cggctttggt    120120
     acaccgtttt cgggtggtta tgcctttaaa aacctccaaa aatcccgttt tacgattgac    120180
     ataattcata atctcaataa tgcccatgtg ccttatctga ctataaatcg ggttatcaac    120240
     gtcgtctcgc caacgtcggt tggctaacat ccacgcgagc tggcttgaac gaggctgtaa    120300
     tttgacgaac tcattggtgt caccagaaat acttgccgca acctgatcca tgcgccgctc    120360
     aagccgtttt tcaaattcat ccagtgtttg agtaatcggc gatgacagcc gttgtaatcc    120420
     ggttttctgg atgaggttaa gcctgtcatt ttcccagtct ttgattggga taaggtcatc    120480
     ttccagtcgt ttatttttct cactttcagt gacgtaagcc ttgccacgat ctaactgtct    120540
     gctgatcata cgatacagat aaaattcaaa gcgttttgta tgaacttccc cattaatcca    120600
     aagatagcga ttgtcacttt tcttaattcc ttcctgatgc acggtgataa tttttcgttt    120660
     ttcagtcagt tcctgtttcg ataacgtaat ctgagctgac aatatttttt gatcagcctc    120720
     gcattcaatg tcgatggcaa taaacagctt acgcaatgag ttggcaattt ttctggattg    120780
     tttgtcaatg tattcccatt cgtaaccggc aaggtcaaaa tcgcgtttac ccaagtgttg    120840
     actgatggca tgaattccct ctttcggaat aaggccaaaa gcctgctggc gaatttcacc    120900
     aaattcgacg acattactga cgctctcgtc aacaaagtag tggagaatat tcccgacata    120960
     tttcaatttt tccctgatta gctccagttc atcggctatc ttttgcttgg caaaggcttt    121020
     agcggcttca tgatatttac gggtcaggta gcaaaaagcc gttaccaatt tgtcattggt    121080
     ttcccggtag cggaagtaga gataacaggt cagatacaac aaaccttgcc agtgtgggta    121140
     tcggcgtacc ttgtaaacag aagtctgttt tataatcgat gcatagtgaa taatattgcc    121200
     ttgtgacaat tctaatgatc caatcagcga ttttagttca gggtaaatcc ctttaatagc    121260
     gcgatgtgtt tccagctccc gatccaattt agacggtgaa aaatcacgag cgcttccctt    121320
     ataagccgat aaacgattaa gcaagccgtt agtagaaagg atctgtttca gtctgtcggc    121380
     agtctcttta gacatctgtt gagaaagggt agcttcaatg cgctgttgtt ctgccataag    121440
     cgcttccgtt atcatctctt gcaggcgggt gtaaccggga agagcaattc tcttctgacc    121500
     aagaaatgcc agaatctcat caaaaatata ccggggatca gtacagattg ttgccacatc    121560
     ttttagacga gttatcaaag cagaataatg cgcctcagtg aaacgctgaa aattcaggat    121620
     gtcgagggct ttgttgacga gtttggaacg ggtgctttta gacagagtta tccattcagg    121680
     attttcatcc ggaaagtagg ttttatggat gtattcggca tcttcggcaa cttcatcaag    121740
     attaaatttg ggaatgactg gtttcgcccg aaaatagccc attaacaaaa taaaatagat    121800
     ccgggtttcc ggcttattca acgctgaaac gatattggct gtatggggat ctaaagaaaa    121860
     ataatcttcc ctgtcggcct gattgaatac gggacgttca tacaattctt tgacttcaca    121920
     cgggcttaaa atatgaagtc gtttttcgtt cttcttggta cagtcagttg tcatcttcag    121980
     gtatcataat ttgtaaaatt tgatactcta taacaacgca cataaggaag tatcaaaaat    122040
     cttctttttc aagttatgag acttgatggt atcaggatcg acttgtgata ctgggaatga    122100
     cgaaaatggc attattgggc tatgcaaggg tatccacctc acaacagaaa cttgacattc    122160
     agattgcgtc tctgaaacag gccggtgttc gtgaagaccg gatcttcacg gataaaatga    122220
     ctggaaaaac ggacgacaga gagggactga aaaaattgct ggccagagca gaacgggacg    122280
     ataccattat ctgcaccaaa atggatcgct taggccggaa taccgctgac atgataaaaa    122340
     ttgtcgataa ctgctacaaa aagggaattc cccttcgttt tttggacaac cacctcagca    122400
     ctgaaggtac aatggggaaa atggtgatcc agattttggc tgcggttgct gaagcagagc    122460
     gtgagcgtat tcttgaacgt accaacgaag gccgccaatt tgcgaaagaa tcaggcgtca    122520
     agtttggccg aaaaccgcac aaaagcacag ccgaagccaa taaaatgata gcccagaaaa    122580
     tttcgatgaa agaggtgatg gagaaaacag gaatatccag agcgacctac tttcggctga    122640
     aaaaaatgat ttaattttgc acagtgaact ttccgagggg aagggcacaa atcccttaaa    122700
     caggaaggta aatataaagg tcgcccggtg gataaaaaat tgcatcaaaa aatagaaggg    122760
     cttctcagag agaaaaaaag ttataacgcg attgtttatt tattgggatg ttccagacat    122820
     accataacgc gatgctcgac tttaacatcc tataacgttg gcttgttgaa gccagtcgcg    122880
     ttgactttta ccttgtttaa aattggcaaa aatacccaac gtgtgagaaa gcagttttct    122940
     ggcaattcga ttactcaaat gccacaaatc ccgtgcccag cacttctcga tagcaaattg    123000
     tccggcgagt tgaccaatca cggtttcaat taaacggcgt ttggcgttaa tgacccttct    123060
     cgtttttctg gggatggggt cagccatatt ggctcgcacc ggggtaatca tttcaatacc    123120
     ctctgccttc atttcctgtt taaattcaac acctaaatac cctttatcgc cgagcaaaca    123180
     gtcttttatc gagccgatca catccccggt tgcttcacgc tcactgacat tggcgggcgt    123240
     cagtgtcaac ccggttacca cgccgatttc atctatcatg agatgtcctt tgaagccgta    123300
     gtaagtttcg tttttggctg cgcagtaccc ataatcggct tatcctttga aattggcaca    123360
     gccttttgct cttttgaatc cacagacggg cagcggaaat ccgtcgataa tatggaccgg    123420
     tctgtcgaat gcgcccaata atatcgccaa cttctcttgc agtttttgtt tgacaaccca    123480
     aaggttagcg gcctgtttgg caaagttggc ccgtgaacct aacccaggaa accagtcgcg    123540
     ccaatgatga caaaaatatg tccaaatccc tttatctgtt gaaaatccta agaattcacc    123600
     aatcacttcc atcgtgatga cttccgcatc actcaattta ggtgggagcc ctcggcttct    123660
     gaatcgcaca ccttgttgta actgcgttaa attgtcatct acccaacaaa acacccaaat    123720
     gataaaatct tgctgtgaca tagccttttg ttcctttatt tctctatttt tgacgactta    123780
     aagttattta taaaggagcg gctatgtcat ttcaattcat cataaaagtc gagcatcgcg    123840
     ttaccatatc caaagtttca aaaaccatca aaaatttaga ataactctat aatcaaatga    123900
     ttttaaaaca ttaattcatc accatggaac ttttggatgc atcgggcaca aaacccctaa    123960
     aacaggcgca gggatatcaa gcctgacggc atggggacgc gcggggtaaa gttgcgattc    124020
     gagcttatcg gcggtcatgt tatcaggcag cggccagctc attcccagct ttttgaagcg    124080
     aacaaagaga gcgcagaggg tgcttttggg gatcccaagc cgacggccaa catcgagtct    124140
     ggataggtgt tcatcaaaat gtaagcgcaa agcgtcgagg agcaatgtcc gatatttcat    124200
     acaataatgt ccactaaaaa tgatggacac tattttcccc gaaccggagg aataccgata    124260
     gacggtctaa atgagccgct tacaattaaa gacacggatc gctctgcaaa aggtcacata    124320
     ttgcctgagc tccctttaat gcgacagaac ccaaatatgt gcttaacgaa ccaaactggc    124380
     tttcaaggat gaaaatggag gacttcaggg atttaacttc gttgatttaa tcccatatga    124440
     atcctcctat gaaatatttg agttggatat gaacacaaga ctatctatga aagtgagtga    124500
     aacaaactat aatagtagtt cttgaataaa ccacctttta tcattgctgt gccgaaagaa    124560
     gtaagtatgc tctccaaaag tgaaggggaa ttgaacctca taaaaatgct caaaatatcc    124620
     tgattgatag ctgctcgcca gcttgccgtc agccagaagt tcctgaataa accaatagtt    124680
     attatctctg gtttgtccat aatagaaagt gcgcccttta aaaatgaagg gaaatagcac    124740
     ctcataaaaa ctgtgccaat ttccgctttc agtggtgctc cctattctac cgtcaggcaa    124800
     aagttcctga atgaaccaat agttattatc tctggtttgt ccataataga aagtgcgctt    124860
     tccaactgta taagcaaact ggaaagggta aaacgagttc catgttcctt cgtccgttat    124920
     ttcaccatga ttaccgtcgg gcatcatttc ttgaactata taaaagttac cttttttttc    124980
     atcaaaagtc tgattaaata taaatgtctt cccatcaatt aaatagggaa actgtgcaga    125040
     atattcaata ttataatagc cttgatttat tatggagccg aatgttccac ctggtaacac    125100
     ttcttgaatg taccatagct tatgatggtc aatcatttga gcacgtataa atacacgctt    125160
     tccaacggta taaagaaccg gcctaataga aagagaaggc ccataattta tatctgtttc    125220
     atctgttgtc caactcacta tgccaccggg gtgaagttcc cgaataaatc taccataacg    125280
     agatctttct atgttttggc cataaaaaaa cgtatgatcc ccaatcgtaa agggaaacag    125340
     aaaaggataa aaatgtccca attgacccga atctgtttca tctccccaaa ttatattcga    125400
     agagtttttt tgaataatat tcatgataag tctccattta aataaaatta tgcttaagat    125460
     aaaattaatg ccatacattt tataatctac tcaaaattta aggttatttt tactcgttaa    125520
     aagtttcata ccattcggaa gccatgctta aaaaaggatg gtatccaatc aagtaggggt    125580
     cctgcggaag aactctcgaa aatgacgagt aacgatgcct caatgttttt tagattagaa    125640
     tcgcattttc agtacggctc ttctttagct tgttcgctga tctctttcct gcattgcaaa    125700
     agataagaaa aaaaggttcg tcttccaacg ccggtctgtt cacaaacttc tgcggccgtt    125760
     ttatctgaat tttcgtacaa aattctggcg ttttctaatt tctcaatgtg ggttcgtggg    125820
     cggccaccac ttttacctct ggctttagcc gccgctcttc cggctgctgc ccgttctgct    125880
     tttagttccc gttccatctg gtgaatgacg cccatcatgg acagaaaacc ccgtcctgtt    125940
     gctgtcgtgg tatcgatatt ttctctcagt gagaccaggc taatgtgtcg tgcttccagc    126000
     gcctgacagg tttgtaacag atccattaat gaacgtgtca tccggctcag ttccgtcacg    126060
     accagactgt ctcccgtacg caaataggcc agaagttgtt cccagcccgg tctgttcatg    126120
     cgtgaaccgt cattttgtcg gtaaatattt ttccgcagcc cgctgttttt aaggcatcaa    126180
     tttgtgaatc cagattttgg ctgatgctac tgacccgggc ataccccaca cgacttggag    126240
     aatattttga tattccgtca ctcatagtgc aaaaacctga cttatataca tcataaatgc    126300
     acgatgatta tagcaacggt ttttgcactg tacgaagcca ttatcgtggt aaatttgaca    126360
     tgacgtcccc cgagtgcaaa aagtatgtga atctacctaa aattaatgta tgtaattctg    126420
     ataaatatta aatttatcta tatagtagta aagcaccaat ttaaccaata attcagagcg    126480
     gttgttctac gaacagtcac aatttagttc actattacaa tcgacaaacc tatgtttaat    126540
     ttggagtata aaatgaccga tcaaaagata tctcagcaat cttccaatgt tttcgcgcct    126600
     ccgtctgcag aggaaagcag tgcacatcag attatcgcaa gaagagctct ggaaaacatt    126660
     gcggcgcttg ctggtcaagc gcaatactcg acatttcgtg ccgcaagtgc caatgcgcta    126720
     tcggaaacta tttcgacatc tcagttctct cttgcctcag cccttatcca tacttgggtt    126780
     tattcaaatc caacgattaa ttattcgagc ggaaagaaag tgaagtttaa aggcgaggct    126840
     tggggtattg cgattggcgc gggggtaata tggctttctg gctggatggc accgccggat    126900
     caagtaattg gcgacgtaga tttcactctt ataacatcgc ccacgacaac ggaaatatgg    126960
     ctgcgtaaaa atggtgacac aatcggtgtg ctgattggtg gcgggataaa cgtccaggct    127020
     ggcgccgtca atggtagtgg caaaatcgaa tcggcttagt gtgggcgatc aatcagtaaa    127080
     ctgaatgaag cccttagagc ttcatacctc tcgcagagtc tgtaaaattt tttgagtaag    127140
     tggtttaacg tccaacacta ccagtcaaca cggtagcatg tgtgaccatg caacacttga    127200
     gcaactggtg gtgttgtcca atctggagaa tgtaatgagc gcatcccaat cacttagccc    127260
     cgtgctggaa ttgagaggtg aagcatggat cctctcagat ttccggtctt atagtgccta    127320
     agcgggaagc ctattgctcc ctgatggaga gcataaaaat ccttggggca ctctgttcag    127380
     ttggcgataa aatgagccat gcaacatatt tttatcgggc atcaattcat gcaaatctat    127440
     attgtgaaag tggctcttcg gaacgttagc cctatggttt ggcggcggtt cagactctca    127500
     ggaaagacct ctttagcggc ttttcactat atcattcaga ttgctcaagg atggcatgac    127560
     gaccatcttc accaattccg tatttatggc aaagattatg gtatttccta ttctggcgga    127620
     attgcgtttc ctgataaccc ttacaaagtc acgctcgatg accttgaatt tgatgccggt    127680
     gatcgtttta cttacgaata caattttttc gaaaactggc ttcacgatat ccgtattgaa    127740
     actattctcg ataattctaa cctgaaatca cctttttgtc tggccggaaa ccgaatgccc    127800
     ggggcgacgt tagccgatga aacgactaaa acactggcat tgctcaacgc gattattcat    127860
     gctgatgaaa cgaccacggt cggagaaatc cgtcccttga ttgaggctct tgataccgtc    127920
     agattcaatc gtctaaaggt taaccgccaa ttaagtcggc tcaatcttga ttcaccggaa    127980
     cttgaaccca tcgtgataaa ctgcgcggag aacgcactgg ccgaccgcct gcggatatca    128040
     gtaaactccc tcagattgac gcgctgagag cgaaaggcat taagttaaag ctagcctgtg    128100
     ataatgtggg attaggtgtt tctacgtatt ataaattgcg tcaccagtta aaaaataggg    128160
     gtataccaca gcgatagccc cgggaggaca gcatcatgca actcacgatc caaatcgcga    128220
     cggttgataa atcaggtcat cgtcatacgg agaaattact cgcgatagaa aaacagactg    128280
     attctcccaa tgacataggc ctttccctgt ctgaatctaa acagcttttg aacacagtcc    128340
     agcaatcagt gatccagaaa caggcggctg aatttctgga tgaacatcgt ccctgccctt    128400
     gctgtcagcg aaaccgccgg ataaaaggaa gacaaaaaat ccagtatcga accttatttg    128460
     gcattattcc tgtcgaggga tttcgggttt accggtgtat ttgtgagaag aattcacccc    128520
     aaacagtgaa tctgctcaat gactggtgta gtgaatatac tcatcccgaa ctcaagtata    128580
     tagaaaccaa atgggcatca ttgatggcct atggactgac cgccagtctg cttaaagata    128640
     ttctgccggt gggagaacgc tgtaatgccg ccaccatccg aaatcacctt tgtcaaaccg    128700
     ccaaaagaca agaggcagag ttagatgggc tgcctgattt tctctctggc tcccccagag    128760
     aatgggcaaa attacccaaa ccggggaaac cgatgacagt gggtattgat ggaggttatg    128820
     tcagaaatcg ggacgataaa aaacatcatt tcgaaatcat cgccggaaaa tctttctctg    128880
     ctgatgtccc cgctaaacgt ttcggatttg tgcaatgtct ggaaaatcac cccagaagaa    128940
     aactgcttgc tcaattatct tcacagggaa tgcaggctaa tcaacaaatt acctttttat    129000
     ctgatggagc cgataatctt cgggaactgc aatttaacct gtaccccgaa tcccagcaca    129060
     tacttgattg gtttcatatt acaatgcgtc tgaccgtact aaaacaatat tccaaagggg    129120
     tatctaaaaa tgatccggag cttggtacag aattattaga ttctttaacc cgtacaaaat    129180
     ggtatatctg gcatggaaat gtgattaagg cattagaaca cctggatgat tgtgcggcaa    129240
     tgtgtgatga ggacatatcg cattatggta ataataaatc attgttaaaa catatagatg    129300
     aaatgtatac ctatattgaa aataacagca tgatgatccc gaattacggt gaaatgtacc    129360
     gatatggtga agcaatttcc tcttcatttg ttgaatcgac gatcaatgaa gttatcgcta    129420
     aacggatggt gaaaaagcag cagatgcaat ggagccagca aggtgcacat tacttactcc    129480
     agacacgcac agcggtactc aatggtgatt taaaaaccca atttgagcac tggtatccgg    129540
     gtataaaatt aggtgacaaa acggatcatt attggacaga ggcagttgct gcataagtgc    129600
     cccacagatt tttatggtct ccatgtaaca aacccttctc agcacggaag ggttttgtcc    129660
     aaccgaaata atttcaatct atcttgcttt aatgtataat tacggtaatt atcgtaatta    129720
     ccgatagaaa aaaggaacgt tattatggct agaaaattag ttgagtacga cgatgtagcc    129780
     gcagcggcgc agaggctcaa agacgcaggt aaacgtccaa ctctcatcgc ggtcagagat    129840
     ctcattggca agggaagcta caccaccata tcaacatttc taaaacagtg gtcagaggaa    129900
     cattctctcg atgatgaacc cgtagaagtg attctgcctg aatcggttat gagtgatgct    129960
     cagctctttc tccagaaaat atacactgtt gcaaaagcca gtgctgatga tcagcttgaa    130020
     cgcgagcgag agcttctgcg ccaaaaagag attgagttcc aagaagacat gcagcaagcc    130080
     gtggatatgg ctaatgatgc cacagaaaaa tctgagcttt tggaagagca gcttgaggct    130140
     ataaccaaca aaaaagcaga gagtgatgct gctcttgcta aaactgagag ctcgttatca    130200
     ctcaaatctg cggagttaga acgctctcta actgacatag aaaaactaga aaagcggatc    130260
     atggatttgg aaggaaagtt ggaagcgaaa tccaccgaac ttacccgagc tcaggaccac    130320
     ttagagcaag ctgaaagcga aaatctctct ttgagccaaa aattggcaac tacagagggt    130380
     gagttatctg cccaaaaagg caagagtata gagcagactg aaaaactccg ggcagctcac    130440
     gagcaaaata aagcgttaaa agagcagctc gaaaatacac aggccaaatt ggcccaatca    130500
     caggactccc ttgccacagc caaagctcat ggcgaatcct tagaacgaga gtgccagcgt    130560
     ctatctggtg atgtccaaaa gctggaatct aaactctcta gcgccgaagc ggaagctcgc    130620
     tctcttgttc aagacaaagg cgttattgct ggtcagttac aggaaaaaga ccagcagacc    130680
     aagaaccttg aactgagact caatgaggcg ctgaccaaaa tttctgggtt agagttagaa    130740
     ctcgttaaaa ctggcaaggg agggaaaaag aaagaggaaa actgatggcg cgtaaggcta    130800
     aatattcaga agagtggcga agcagagcgg ctgctcttca agccaatatc gaggaggcta    130860
     tgaaactagc ctctgcgtct attggtaacg atgactggtt acaccggctg catgtctggg    130920
     ttgcagaagt ggtccagggt aacgcctcag actggtggac agatctggat tgtgaagtat    130980
     cactcccccg agaagaaaag cgggtcagca ccttcatctc gacacaaagg aaacgcatca    131040
     cttttcagat gtgtttggcg taggaggttt catgaagcaa ctacctcccg atacacccga    131100
     acaatcactg atcactcagt ataaagggcc tcgacttgtc gttaaggctt acgctggtac    131160
     gggtaaaaca actacgttgg ttaaatatgc ccacaacaac ctcaattcca gaatcctcta    131220
     tttggcatac aaccgagcca tccgcgacga ggccagagag aagtttcctg caaacgtgga    131280
     ctgcaaaaca tcccatcagc ttgcatacgc cactattgga agaagctatc agcataaact    131340
     caccggcaac ctaagactta ccgatatagc gcaagcggta aatacgaaga actggacctt    131400
     tgctaaagtg tattagttca gaccagatct gacacttcag tttgaaaaga agagagttac    131460
     cgactttgat taaaggtgat gaatccataa tcaaagacta agaggtcact ctcatgcttt    131520
     atactagcaa tcccatcatc aaacacaagg cgggtctgct taatctcgct gaagaactca    131580
     gtaatgtctc gagagcctgt aaagtgatgg gcgtatccag agatacgttt tatcgttatc    131640
     aggaactcgt tgaaacgggc gggattgatg cattaatcaa ccaaagcaga aaaaccccta    131700
     atctgaagaa ccgtgtggat gcggagaccg aacacgccgt tatcaactcg gccatcgaat    131760
     tcccggccta tgggcaggcc agaacgagta atgagctcag aaaagcaggc atctttgtgt    131820
     ctgccagtgg tgtccgttct atctggctca gacatcatct tgagaacttc aaaaagcgcc    131880
     tggcagccct tgaaaagaaa gtggctgacg aaggcattat cctgactgac gagcaggtcg    131940
     ccgcccttga acgtaagcag catgatgacg aagcttgtgg cgaaattgaa accgctcatc    132000
     ctggctattt agggtcgcaa gatacctttt atgtcggtaa tcttaaaggc gtgggacgct    132060
     tgtaccaaca aactttcgtc gatacttaca gtaaagtggc tttcgcgaaa ctctatacga    132120
     gtaaaacgcc cattacggcg gcggatttac tgaatgaccg tgtgctgccg ttcttcagcg    132180
     ctcatagatt gccgatgtta cgtattctga cagacagagg caccgaatat tgcgggcgtg    132240
     ttgagcacca tgattaccaa ctgtatctgg ctgtcaatga tatcgaccat accaggacaa    132300
     aggcgatgtc accgcaaacc aatggcatct gtgaacggtt tcacaaaacc atcctgaatg    132360
     aattttatca agtgacgttc agaaagaaat tgtatggctc attggatgag ttacaaaaag    132420
     atctggacaa atggatggac aattacaaca atcaccgcac tcatcaagga aaaatgtgtt    132480
     gcggccggac accaatagaa acccttcagg atgggaaatc catttgggca gaaaaaaatt    132540
     tgacccaaat ataatctgac agtcgccgat aacaaagtgg gtaactgtca gatcaagtcg    132600
     cgactagtac agatgagcgc ctcaactgac cctgtacctg aatttgtgta attgcctgtt    132660
     tttggtatgt ttaatttatc aactaaaaca ggtgaaaaga tggacgagaa aaagttacaa    132720
     attctggcta ctgagctggc taaagatctc aaaacgccgg aagatctgag ccagctctcc    132780
     cgcttcctca aaaaactgac cgttgaaacc gcccttaagg ctgaactggc tgcccatcta    132840
     ggtcatgaaa aacaccaacc gaaatcaggc tccaataccc gcaatggcta ctcaccgaag    132900
     actttgctga ccgaagacgg cgacttagcg ctgcaaattc cccgtgatcg tgaaagcacg    132960
     tttgaacccc aaattgtcag gaaaaatcaa acgcggatta cgggcatgga cagtcagata    133020
     ctggccctgt acgccagagg aatgaccacg cgtgatatcg ccggtacttt caaagaattg    133080
     tatgatgcgg atgtctcgcc gtcactgatt gcgaaagtga ccgatgccgt gaaagccgaa    133140
     gtgattgagt ggcagagccg cccactggac agtttgtatc cgattgttta tctggactgt    133200
     ctgatggtca aggtccgtca ggataaccaa attatcaata aatcggtctt tatcgcactg    133260
     gggattaata ccgaagggca taaggaactg ctggggttgt ggctcgctga aaacgaaggg    133320
     gctaaattct ggctcagtgt gctgacggaa ctctataaca ggggactcaa agacattttt    133380
     attgcctgtg ttgacgggct aaaagggttt cccgaggcaa ttaataccgt ttatccgcaa    133440
     acgcgagttc aactgtgcat tgttcacatg atacgcaata atctgcgcta tgtgtcctgg    133500
     aaagacgcaa aagcggtagt caaagatttg aaacagattt atcaggcccc gacagaagaa    133560
     gtcgcccagc aggcgttgaa ggcttttgct gaacagtggg atgaacgtta tccccaaatc    133620
     ggccgcagct ggcgagaaaa ctggggtaat ctgtccacgt tctttgcgta tccagctgaa    133680
     atcaggaaag tgatctacac cacgaatgcg attgaatcgc taaatagcgt tatccggcat    133740
     gccatcaaga aacgcaaaat atttccgtcg gatgactcga caaaaaaagt tatctggctg    133800
     gcgattcagg cagcctctaa aaagtggacg atgccgatcc aagattggcg tcttgcaatg    133860
     agtcgattta tgattgaatt cggtgaccgt ttaaacggtc acatttaatg aagatgaaaa    133920
     tggcgattac acaaaatcgt aaacagggtc cctcaacttt gcggcgctca tttttttact    133980
     ttttctgcgg tatacgaaag cgttctagct caacatgccc taacccctta aaagcatcag    134040
     ggcgacgccc ttgaccgctc caggatacgc cgtcttttga atattttgca ttatcaggtt    134100
     ctgatttgct tgtgtacatc tcgttgagaa gattgatgtc cactccacat gattccatgt    134160
     cactcattat tctctcggcc tgagctcgct tttctttttc ttcttcttct cgctttttgt    134220
     actcttcctc cagttcatta agaacacctt tcattctatc aatgatctcc cgaacttcat    134280
     ccagcgggag ccctcgtaat agagtgcgta tccggctttt tcgctttaat tctgcgatta    134340
     ttaattctct tcgctcagcc gctgatagcg tagagaattc ctcgtggtct ttcatgttat    134400
     acggaaccca tcagttttcc tttaagttga tcacgcttgg agtccagttt atcgtcaacc    134460
     tgcaactgtt caggttgaga cttagcaatt tgatgctctg aactcggttg cccaaaagac    134520
     ccaatgttgc cagaaaaacg aagagaataa agccccaata gagcaagggc gcgcagccga    134580
     tcactacgcg ccttgtgctg catctgggac agctcacgat ataactctgg aaatccttgc    134640
     tccgaaatat tcagattaga tattttccca tcccatttgc taccagccac tacgacctcc    134700
     tatctattag ccgcagtacc agaagcccct ggcattggat gccacggatt ctttgggcag    134760
     tacgatccta ctcttaggaa aaagctcttt ggctgcatcc tggtatgctt cggcaccacc    134820
     accagccagc agaacaacat cagcatccat tccgtcttcc cgcattgact tacgcatagg    134880
     gactaatgcg ttttgagcca ctttggctga cgccttctta aaataatctt tgatcgatac    134940
     cttctcacca tagagaaaaa tttcagtctt accggcgcga attgcttttt cgatcttttc    135000
     tatgccaggc gcaccaccgt ggtcctcctg gatgagtcga ttagtttctt gtagcaacat    135060
     cgacatggcc tttaggctgg tgccagatga gtgatagcga acttcaccct cttcaagcgc    135120
     aacccagtca acagagaaaa atccggggtc aataacaaca gttttccctc cctgaataat    135180
     ttcgagtagg tcatcatcct ttgttgagct gacaatatcc atgtaagcac cggcaggttg    135240
     aggcacaacc acgacagact taaccgttac cgttcgttta ggtgtaatct ggtgctcacc    135300
     ctccagccga gctttcaatg cctctctgag ttccgcttcc atgtactggc ttactggaag    135360
     acctgtcacc agtacatcaa tttccttctg ttccgacatc agaagtgcag cgtaaaaaag    135420
     agccttatac ggtttcgttg atgggtagtc accgtgaagc tcacgctccc acccttgcag    135480
     acggtcaggt tcaacaccag caacccattt ctccccatca atcacaacct gaatacaggt    135540
     cccagcgcca ccagttaact gctgtggcat cagttccagt ggaccagcgc caacaggcat    135600
     aacaacagta cgagcttctt cacctttatg acccatagcc attttcaggt tggagtagcc    135660
     aatatccaaa cccataacaa actgattcat gaaatcctcc aaagattgct ttttgattgc    135720
     ttttcgattg ttttcctctt gttggagaga gaatacagcc tgactccggc ctgtatagcc    135780
     tctgtagttg cccaaaaggg gcgtttagat tgcttttggg tggcttttgg gttttagagc    135840
     cagccataca tgtgggtatg ctgcacggat agacaaatta atgacaatag cgccccacca    135900
     cacatcaagc tctcctttac cagcctccat agtgatctcg taaatatttg gaatcttaca    135960
     gtatttatcc aatatatttg gaatcttgcc tagtgcattc acatcgggat tatgggaatc    136020
     tgaattaagg ctgtaagatt ccagatagat agaggggtat ttgacaaatt ccaaagatgg    136080
     ggtagcctag taacaggact agattccagt attggaataa tcagctttaa attccagata    136140
     gatagttatg tggataggaa ttggatagga attgggaggg ttttgaggtg agtctaccaa    136200
     aagagcgatg gctggatctg ctagatccta agctcgaaga agaacgatct gagataacag    136260
     aggatctgct tgaggcagaa ggtcgagagt ttgtcacgga gttacggagc aaactggatc    136320
     acgctatagc tgttcttgct gtcgaagcac agcaggaagc agatatgtac tggaacgcgc    136380
     acaggtctgc gcgtgaagaa gcatcggagg acgaacaagg gcgcgttggt acacgagttc    136440
     gcattctagg cgtatcactc gttgcagagt ggtatcgcaa cagatttgtc gaacaggttc    136500
     caggtcaaaa gaaaagggtt ctatcaacac atatcaagaa gggccgaggt catgcctaca    136560
     gcatgtcgca cttcaagaaa gaaccagctt gggcacaaga gcttatccag caagtagaaa    136620
     gcaggtatgc cgcgttaaga caaagagcga cagcgttagc aaaaattcgc cgggcgctca    136680
     acgagtatga gcgactgcta aacaagactc ataacgatga ggtgtaataa catgacagta    136740
     tctgtagcgg ccactgagct ggcgaagctc ggcaaatgcg aaacgatgat aaaaagattt    136800
     gctaagcatc ctcgccctgc cccagcaaaa cgcccacaat cgccacaggg gaccgataac    136860
     acccttagag gtgagttcgc ccattttcgg tatgaagctg ctgccctgcg cttcatgaac    136920
     agtgctgcgg gggctaagcg tcgcatctac cagctagtgt ttgcagcaac ggtagcagcg    136980
     ggagtattga cactgctggc ggcatggacc accagctaga tagtatcgac ggaacaatca    137040
     tgagcaagag aaccaaagac aaagacgtgg agaaactaga cgtaatcaaa gactcaccac    137100
     aaatgagcct gtttgagatc attgagtctc cggccaaaaa ggacgactac tccaacacca    137160
     tcgaaattta cgatgcgctg cccaagtaca tctgggacca aaagagagaa cacaaagacc    137220
     tttctaacgc tgtagtgacg cgacaatgct caatcagagg tcagcaattc acagtaaaag    137280
     tgaaaccagc catcatcgag aaagatgacg gtagaaccgt tctgatctat gcaggacagc    137340
     gagaggaaat ccttgaggat gcgttacgca agctcgcggt gaacggcaaa ggacatatga    137400
     tcgaaggcaa agccggagtt atgttcactc tgtacgaact ccaaaaagaa ctgtcaaaga    137460
     tgggtcacgg ttacaacctg aacgagatca aggaagccat tcaagtttgt cgcggcgcaa    137520
     cactcgaatg tattagtaat gacggcgaag ccttcatcag ctccagcttc ttcccgatgg    137580
     tgggcttgac caccagaggt gagttccgta agaaaggtgg taacgccagg tgctatgtgc    137640
     agtttaaccc tctggtaaac gaatcgatca tgaatctgtc gtttcgtcag tacaactaca    137700
     agatcggaat gcaaatccgc tcccctctcg cccggtacat ctacaaaaga atgagtcact    137760
     actggactca agcatcccca gattcgccat acacgccatc acttatcagc tttctgaccc    137820
     agagccctcg tgagctcagc ccacgtatgc cagaaaacgt cagggctatg aagctcgcgc    137880
     tggaagctct catcaaacaa gaggtcataa gtgactacga cgcgaaccag attaaggatg    137940
     gccgcaaagt catcgacgtg cgttacgtca taaggcctca cgagaacttc gtgaagcagg    138000
     taatggcatc caacaagcgt aagcagcaaa cagaactaag agccatcaag caaggcatga    138060
     ttgaccacga catcattgat gagcgccagc gcaagggacg atagctgcca gcatctcctt    138120
     gctgagggat catgaaaaag gcgctgacgc gcctttttca tgcctagagg aaactcgatc    138180
     tccaaggctt ccagtcaaat ccagaaaacg ggatgacatc agcatatggg aaacctgcac    138240
     gtatgcaacg aactggagac catatgcagc ggggactttc gctctatata tacgcaataa    138300
     acttgaagat gcatgatagg atgcaactca tattgttgat ttttaaattg ttaatttaaa    138360
     aatcaaccca gcatcttgaa gttagatgag tatatgggtt tgttgcacgc taaataacgg    138420
     tgcaacctca aaaccgtgca agctcggtag aaactctgca atagggagtc tcgcaaggcc    138480
     aaagctgaac ttgtaagacg ttgatattta aagggctgat gtgtggggga gctgcacgtt    138540
     atggggtttg atatatggga gcgctgcacg attgacaaag cagaacaaag attgacagga    138600
     caggacaaac accaaaagtg gtcaaaatta ccctgacagt ccaaagtgtg accatgttca    138660
     cgctgcgaaa ggctaaaagt tatccacatt tcctgtgtat aagcacgagg ttggtatgtg    138720
     ggtacgctgc acggctacat gtgggtatgc tgcacggtgc aaaaaacgac caaatttgat    138780
     atgtgggtac gttgcacgtt agtagaaagt atatggggcg actgcacgtt taaggacaaa    138840
     catatgggta cgttgcacga acgccaacac aaatatatgg gtacgctgca cgaaaggtct    138900
     gttttttaaa aattttgtgg aaaaaaaggg ggttccgtgt ggataacagt ggataagatc    138960
     cagaggcata tgggaacact gcacggcaac ctatgggaac gctgcacgta actatgtggg    139020
     ttctttgcac ggtataaaca ggggattgtc aataatatca atgctttgac gacatattta    139080
     gagcggctaa cctatcttta accgttttta atcctttata caaagatcaa agatctttat    139140
     atttatcctt attatcgctg aacaaaaagt aatcaacttt gtttttttag aaaaaagtct    139200
     cgtgcaatag gccaaacacg attagtatca ccaacaatgc aaacatagac agcacaaagt    139260
     aacccgactc atacagcaca gttttgatca atgaggtaat gcgtatagat cttccagaga    139320
     tcctcccaac gatccattga tatgcaacga acgaacctag accacaaagc aacactacca    139380
     ccacagaaac aaaagaatga tctctcagaa cggactcact caacagaccg tactggatac    139440
     ttaaaaatac gagtttgcct attccaaaac ccagacctaa agcaacgatt cctcgcacca    139500
     gcactacctt aaaagactga acccatgtca aatcaagatc cattgccttc cgcgaagaac    139560
     ggcgcaccag cacagtagat ataactaagc ccaaaaacac caaaagaaca aaatcaaaca    139620
     ttgtcacctc agcacaaatc aatcagaacc acaggcctct cggccaaacg caccaccagg    139680
     aagagcccac ctctgaccct caggtacgaa aatagggagt gtgtaacttt ctctggatac    139740
     ctgctccaac gcttcaatat cacttatatg tatcggcgca acagcagaac ctaaatctat    139800
     aacgtcaatt tttttccttg ataccgttac accaaaggtt tgttcatacc gagcaatatt    139860
     ccaagctcta tcaggccaat agtgacggat cgtggaccaa atccgttgtg agttgtagat    139920
     acaagtcata catgacgacc ggctccagcc aagccgatat ggaactggag ccaggatacg    139980
     atgacgctct atcacctccc acacttgctc ctcactccag tggagaactg gtctctaagc    140040
     atccactaac cgtgcagtct tcccatatct tctgtcacag gcatgggctt cgagctggtt    140100
     atacttcgat ctgtttgcac tttcctcacg tctctcacca gtgataaaga ggatcttctt    140160
     ctccttaaag cgctcctggt tattaatcgc cctgcggctc acatcaatct tcaaagcaga    140220
     tgagcaccaa cgtgtttgca atgacggcga ttgctgtgga aaacgaaggc gtgtgccagg    140280
     cttagatcta ttatggtctc tagtactaca gccgtagatt ttcgcaaatc aatgtgttat    140340
     ctgatcatcg ctaaattaag aaactatgta atttcaatct ttttatggcg gatttcctat    140400
     cgagaaatag tgttcacggc tgtagtacta ggcagcacca gaagtccctc aggcgtttct    140460
     acgcgatggg ggtggctgta ggtattctcc ttgagcattt ccccctcaaa accgccctca    140520
     agccatgaga agtacattgg gatacccagt gcatccccaa gctgacggca gtaatcacgc    140580
     ataaaggccc aatccatcaa agaactacct tcctgcccgt caacgtcatg gtgccagaat    140640
     tccacctttg acttatcaac ccccatgtct accagtcgca gatacgcagc aattgagtct    140700
     ttgccacctg acagacaaac aatgatgtgg tcgtacaaac ccaagtccac atccggagca    140760
     gagaagtacg ttgttctgtc atcacaaacc tgacttgaag atataccggt aagaaccgat    140820
     tccaaggatg gcaagaccac ctggtcatcg aacagatctc gttggttttc tcgtcttaac    140880
     ataagccgct cttttttctt tactgggttg tttttatgat ttacagtttt ataaaatgat    140940
     actgtgaaaa gtaaagtttt cagatcgact aatcactcag gagaacttga gaaacaccaa    141000
     aaagcaatct aagggtggtt tttcggtgat tggcgttcag gtggcacctg tcgcaattag    141060
     ttaaaagtca ttagaaagtg gttttttggt gggtttacag tttggagatg agtatgtggg    141120
     aacgttgcac ggataaaggg agccgcacat gaaagcgata aagcggttca tcatatgggt    141180
     taattacggg cttgagggct ggagcatttt tggttcaagc gatgactggg atgaagctgt    141240
     atccatccgc tcagaagcta tagacgaatg cagcattgat gaagatgaca tcatcctggc    141300
     tgagaacaaa aacgagctag tggtgaagcc agcggctaaa cagatgacag agtggcaccg    141360
     agagctggaa gctgtcctta tgacacttga cgactgccaa atggaatgtg acggcatgac    141420
     atgggcggta agtcacctac tgaacgaagc tggtgtcccg catgactgca tgtatggatt    141480
     tgtgcgaaac gaacagacca aggacatcgt tacacctcat ttttgggttg tcctggatga    141540
     cggttggctg gtggatctta ggcttcgcat gtggcttggc gatcacgaca acatccctca    141600
     cggggtattc cataccgata acgaacccgg atttttctac aagggagacc ctgttcaaaa    141660
     ccataaaggg atgagattgg gcaaagctgt cctggacatc atgaccgacg gaaaactttc    141720
     acatgtgaaa gttcctgaac gacaagacgg agaataatag cgtggaattt gattacgaca    141780
     aatcagtgtc aaacgcacat cttgaggccg ctggctgggg tatggatgcc tttaaccact    141840
     ccaatccatt tgagagtcat gtcatctatg tacgtgatta ccgtaacgat cacatccgtc    141900
     tgttcacaat caagcaggct gacttcgaca ccataaaact accccttcac cttacctccg    141960
     acatgctggc ttcggtgatc gctgagttcg tatcaaaggc tgcaaaagga aaattgaatg    142020
     ctaaggagtc cgatacgctg gctcccgcct tggtcggcta tgccaaatca acggaaacct    142080
     accggagctg gcgaagagtg tcagggacag cagagcgatt gcacatggta atcaacattt    142140
     acgccggttc tggattgttg aggcctttca ttgctcgggc tcctgagacc gtcctgacga    142200
     gccaagaggt gttggccttc tcatcgcagg ttaaaggcat ggatgtaact aatcatcctg    142260
     agtggtttag gggccggagg tagtcatgaa ggcagttctc tggatattcg tcctgatcat    142320
     cgcccctttc gtcattgcga aagtggacca gtggcgcaag cgcagtattg gagacacctg    142380
     ggcgtggtgg aaatcagaga acatgccgcc ggagctacga tcagccactt tgtttctgtc    142440
     cgagcaggat gtatcaacca ctctgccggt gccaatgcac ggcagggttg atcaggtgta    142500
     ccaaacaaag agaggaattc tcatccccct ggacacaaag ctacgtcaga taaaccacat    142560
     ctatgagtca gacattatcc agctctctgt ttatcaggta attctgtcac acaagtacaa    142620
     agtgcccgtt gccaagtacg gctatgtccg aaccgttgtg gaaacagcag acggagataa    142680
     agtccgttac atcaaaacaa cccttctcag cgaaaaagaa gtggtcaagc tgtggcaccg    142740
     ctaccaatcg atccgttctg gtcaggtaaa accctcctgt tcctgtggcg gaaagtttca    142800
     catgtgaaag ttttttttgt gaaaaatcgg ttgcccgaat tgggcagtta ggcggggttg    142860
     catttttaaa aagtcctgta cgctggttgg cataggaggt gaatcgtggc tcaacttaaa    142920
     cataaccgct tagtcatgtt ggggtccctg atggcaacag ttgtagctgc cgctaatggg    142980
     ttgagcttta tcacccttat ggctggtgga ataacccttc tccagttctt ggcttggaag    143040
     caacaagatg ctgtccagag tcgtttcaag gctgcgaaga atgcttttga aacgttgaac    143100
     gtcattgcgt tcgacaagca ctgggtaggt tcaaccgcga cggttgcaaa agtgtcgaac    143160
     atgcttaccc cggcagaaag acttgataaa ccttgggcgg tacaagttct ggcagtagcc    143220
     gaaggtggaa cctggttcgc agttgacctg caagtgactg gtactaacaa agttcagatg    143280
     ctcagtctcc accagctcag tgaaaaggca gcaaagacta tgttggcctt tgacctcgaa    143340
     gtgtatgaga aatttttcgg aaaacctgat gttgcatgag gaaaatgtga tggaaaaaat    143400
     caaaaacgta gatgctgtgg aattcacagt agaagataaa aaagcgatga cccatgcggc    143460
     atacgcccag tgtatcttca ttctggccca agcgcttgct ttcccttccc tggggatggc    143520
     tggcgctatg gttgcagctt tatgcggcat gatgccgtgg ctgactaaat tcgctaaaga    143580
     agccccgtcg aaagcctttg gtatggtgat ggcttcactc tgtattgcac ctgtttacgg    143640
     gaagctctgt gagcttgtga tccacgcgat tcagggagct tgagcttatg gggctagtac    143700
     gagttcccta tctcttggct gagcttaaag aacgcggcgg tgatgaatct gctctggcta    143760
     agatcatgca gcccggttgc aggattggag aggaagacct gagagcgttg gcctccaaat    143820
     tagggattga aatatcctct ctggctccag cgccagagaa tgcggccaat acccggttca    143880
     aagcaaagct gagaggaggt ttggcctcct ttctttttga gtatgacggg tgttttcgac    143940
     atgccgaagg ctccagccat gcagaaatgc tgggtatcga gcaagaagac gatattggtc    144000
     ttccgagtcg agctgctgat gccatgctcc tggaaaagac tctctaccaa gtgatagctc    144060
     gggccaaata catgctgagc aagatcgaca gcaaatttgt tcggtcagaa caggcaatag    144120
     agttccgtga acaacttgct ccagggatct tcaaacctgg ttacagaggg ttccggttca    144180
     aggaagctgc ttctggtgat ttgcctactg tcatgattga tggtcggaaa ttcaattgca    144240
     tagccagtat agccagagca catggacttg atccggttac agtgcggaga cgcattgcgg    144300
     ataccggaaa gaccgcagaa aaactcacca atgatgagtg gaaactcatc ctttcaaaga    144360
     aaaaaggtaa aggaaaaccc ttcacctacc aggatagaac ctacagcaat attgctcagt    144420
     tctgtcgtga gtatcagctc aacagcaacc ttgtttacca gaaagtcaaa gatcgggctg    144480
     atagcactga tgaagagttc tggggacaga ttattgaaac atgcaaaagg aacgactaat    144540
     ggcagaaaac aaagaaatcc cctgggagag agaactcatc gagaaataca tgttcaccct    144600
     tcacaaagag caagtgaaag atcgccgctg gcggacaatg ttgcgtgtac ttcgtgcatc    144660
     aggcttcgta cttctcatgg tcggcttcat catcctagct tccaatccag gtggaatgcc    144720
     ttggcaaagc gccaaagcag cagctcccca taccgcctac atcaacatcc gtggcgagat    144780
     tgcagcagga acgctggcag acgcggacca tcttattccg tccattcagg ctgcattcga    144840
     caaccctaac tctcaagcgg tcgttcttcg cataaacagc ccaggaggta gccctgttca    144900
     ggctggacgg atttatgagg aggtgaaggc gcagcgagct ctgcatccgg agaaaaaggt    144960
     ttacgccatc attgatgaca ttggtgcctc aggtggttac tacatcgcct cttcggcgga    145020
     tgaaatctat gcagaccgcg ccagtctggt tggttctatc ggcgttatca gctccgggtt    145080
     cgggtttacc ggcttgatgg acaagctcgg cattgagcga cgggctatca cctccggaga    145140
     gcacaaagca cttctcgatc ctttctcccc tcttaccgct gatatgaaga cgttctggga    145200
     aggagttcta tcaaaaaccc accagcagtt catcgagcga gtgaaggctg gtcgggggga    145260
     gcgactgaaa gacgaccaaa aggtgttttc tggattgctc tggaatggtg agcaggccaa    145320
     agagattggt ttgattgatg ggctgggtgg tttgaactca gtggcgcgag acgtcattca    145380
     ccagaccagc ctagtggatt acacaccaac cgaagacatc atccggagac tgactcaacg    145440
     agctaagcta gaagccagct cgttcgtgca agaactcagc gctgtgaaag tttactgata    145500
     ggagcaattt gacatgacag aacaaagtac caaaacacta cgcctcgggg ttattgccgc    145560
     cgttttttta gggcttgtag gaaccggctt cgggatttac caattcgtga aagagaaaga    145620
     gctggcgcaa gaaatcgcca gcgtgaaatc cactgtgaac caggtgaagg atgccgaagg    145680
     cgtcactttc aagagcaaag ccgagtttga tgcggctgtg gcggcaagca tcaacaagtt    145740
     tgtcgagcaa aaacagcaat cggacatcga tcaaaagtat gcccagtttg agggggctcc    145800
     cgaaaaggtt gaggatggca agcacatcta tggggacctt ggtgcccgat tcacgctggt    145860
     ggagttttct gatttggagt gtccgtactg caagcaattt catgacacac caaaacagat    145920
     tgtggatgcc agtaaaggga atgtgaactg gcagtggaag cacatgcccc tcgatttcca    145980
     taacccggct gctcacaagg aagctctggc cgctgaatgt attgcagagc agaaaggcaa    146040
     ccgaggcttc tgggtcttta ttaatgatgt attccagcgt tcccaaggta acgggcgcgg    146100
     cgttgaagac cttgcttccg ttgtcactgg cgtaggtgct gatctggatg ctttccgtga    146160
     gtgtctcagc tctggcaagt acgaagataa agttcaagct gacatccaga aagccaagag    146220
     ttacggcgtt aatggtactc cagccacctt tgttgtagac aaccagacag gcaagagtca    146280
     gttacttggt ggtgctcaac cagcacaagc catcatggcg gtgatgcgaa aaatgatgat    146340
     tgagtcgtaa caagacgact cagcgaacca ataaaacttt cacatgtgaa agtggagtga    146400
     gaactgatga tcaagacaac aactaaattg ggatgtttgc ttggggggct gcttgtcctg    146460
     tcggcttgtt ccagcgcccc tcagccaagc aacgaataca agatggctct ggatgataca    146520
     aaacagttat gtgaggcatg tgctctggtt ggtaatgacc tgctggtggc ccttaacaag    146580
     tcatgcaata ccccgatgac ccctgagagt tttaccggag tcatgaatag caacccgatg    146640
     tttgcagcaa tgatggcaat taactccatt ggtggaaccg atctctatca ggtttatcgt    146700
     gacgcggcca tagacaccct gcgttgcaat gagatggaca cttggcctga acggaccaag    146760
     attcgtttcc agcagcccga tatgcaaaag gtgctggcct tgaaggtttc tgccagacag    146820
     cagaaagcaa attaactttc acatgtgaaa gtcaggctct ccggagcctg atttcactat    146880
     gaggtgaacc aatggagtta caagaagcaa aagaggctct cgatagcctt catcctcaca    146940
     aggcctcagc gcctttgagg ttagtcatcc accagccagg tgggattggt ggaaccccta    147000
     ctgtgggggt gaaagctatt cacgcaggct ttgactggga cagcaacacc atcctgatct    147060
     atccggaaga gcagctcacc cgtttgacgc cggatgaggt cgccgccatc acaaagtcag    147120
     tatcaaaagg acagtcttgg cattcatatc agcagttaaa aaagtatcgt gagcaattgg    147180
     ccgaagccac ggaagaaatt agtaggctca aagctgagct tgaaaggtat cagaaaaatg    147240
     ggggggtaga atgctaaaac gcggaataat caacctcgct gccagttaca tcattgtcga    147300
     tgccctgctc cggaacgcgg caatttggat atttggcctg tctttctccg ttggtggtgc    147360
     ttacgttgtt ggtgaggcca gttcatgggt catctacctt gcaacctctg gagcagtgac    147420
     actctgctct gtcgtaacag cctatctgct cgttacttat caccgatggg gactgatggc    147480
     cgctagagtg tggctgttat tgagtgcctg tctaaacggt tacgccgcct acttgagtgg    147540
     tcataacatc cagttgatgg tggctctatt tgccagcttg ttcattgctc tgtggatgct    147600
     caagaccctt gagcaacccg cagtaaaggg gacatacaag gtaatcgctg atcttcactc    147660
     tcagttatgg ggaatgttaa aggggcaagc cagatgacta cgaatactca aaacgcgaac    147720
     actaaccagg ttaagtcttt acgcgacatg cttgtccccg ccctgttgtt ctatgtggtg    147780
     atgacgtcca tgtttgtggg acttgacgcc ttcatggaga aacccaccag catgaacctg    147840
     ccattcatgc cgttccttgt ctcgatggtg agttttacca gtgacgcacg tcgagcgtgg    147900
     gactggcgga acgcgatcaa ggttgtggcc gtattgactg cgaaagttgt ttgacgcatt    147960
     cggtgatgca caagaagtca cccgagaaat gcttctggag caggcggagc tcattcatac    148020
     gattagcgac aagtgtcaga gcacaggcct gtttctggac agtcaggctc gtttcaacca    148080
     gtttgttcaa gagattgagg ctgacgacaa ggtggaggat cggttgcttc atgcttggtg    148140
     ttgggtgata gaccggatag taaaggcacc aacatccttt cacatggatg gggctgtgat    148200
     tttgactatg cctctggtcg ccaaatacct gccaccggtt gaacgggagc cggaaaccat    148260
     cgtggtgaat ctcgatgagg actacaaggc tcctgtaggc aaccaaacac tctgcgagct    148320
     cattatggaa cggaggcatt ggccgcaagg tgcaacgtgt gcgacccaag aagcggacgg    148380
     gggagttctc tactgggacg ccccggttga tgtggtagag gaaggcagaa aggtcgccgg    148440
     taagcacggc atgatggccg aggttggatt aaagcatcag gtcgatgcct ggtatgctga    148500
     catggacgat atacgtctag caaccgattg gaattcctct gtcatcacgc ctcactgctt    148560
     gctgcttgcc tatcttgatg tgctccaaaa gaacaaagtg ccgtttgatg agggggtgcg    148620
     gctcgctgcc gaatgggtaa cgcaacttgg tggggagtct cgtgaagata ccgaggaaga    148680
     gccggaagct gaggctacgg ttctttccct ggggagagcc acagctcatt gcttcaaacc    148740
     ctacaggaga aacaacatgc gataccaggt atttaaaacg aaggaaggtg ggcagccggt    148800
     gtttactgca ccttggtact ggttagcctc aaccatagca aactggtcat ctcttaaatg    148860
     ggatgtttgt cgaattgtag atagcaaggt gaatgagaca aggttctgct gggccaaggc    148920
     attgcctgct gaaaaaaaca attaatttgg tggagtgact atgactatgg gttttgtgaa    148980
     aaagacgggg atttcagcgt tcctatcagc aatgctggtg ctggctcctc atgtgtgggc    149040
     agagaccttc acagcaaagg ttgtgggggt gtctgatggt gatacggtca aagttctaac    149100
     ggaacaaagc tgcgataccg ggaaagactg ccggagtggc aaggtccagt accgagtaag    149160
     gctcgcggag atcgataccc cagagaaaaa gcagccatac ggttcaaagg cgaagcaggc    149220
     cttatcagat ctggtgtttg gtcgaatgat caaagtggag caaatcgaca aagaccgtta    149280
     tggccgcctg gttgccaatc tctatgtcga tggcaagtgg gtcaatgcgg aaatggtccg    149340
     ctctggtagt gcgtgggtat accggcagta cgccaaaaca ccggagctgt tcaagctgga    149400
     ggccgaggct aaagcagata agctaggcct ttgggcatta ccagaatcag agagaacccc    149460
     cccttgggag tggcgaagaa agcactaacc acacaccaga gtatgcaggt gtaaacagta    149520
     accaagaaac caaacaggaa taacgatgaa caaaagcgaa ctgattatga aagtggccga    149580
     agacgctgac attagcaaag caaaggccga agctgcggtg aatgcgctga tcaactcagt    149640
     gacagaggag cttaaagcgg gtgggactgt ggcgctcact gggtttggta ctttccaagt    149700
     caaggaacgc gctgcgcgaa ccgggcgaaa tccccagact ggtgagaaca tccagatcgc    149760
     tgcggccaag atacctgggt ttaaagctgg taaggggctg aaagactccg tgaactagct    149820
     cttaatcatg tgacacatga ataaggttta catgaggctc cttttgtggg agccttattc    149880
     atatcagaca tgaataaggg ggcatggtga gactctcgtc aacgcagaat gatgttctgt    149940
     tcattctata cgcaattgag gctggtggaa aagcccagcc tgttcctggc gtgaaaatac    150000
     tggagatgat caactcatcg cgtcatagcg gtattcatgg aacgaatttc cgaacatcat    150060
     gccacacgct ggtggagaat ggtttattga gtaagtacag gaacccttct ctaaagctgg    150120
     cttttaagct aaccgaagat ggtagggaac gtgcaggaga gatataccgc aagcggctag    150180
     aagaagatca ggagaagtaa tacgccccgc tccggggcgt agtgcatgtt aaacagaaaa    150240
     accgtagtgg gtgccgtccg gcagttccac atcgagtcgc agcttaccgc cggatgcctc    150300
     aacgtagcgc ttaatggacg aaagttttag atctcgtcca ggtttctcca tatcagagac    150360
     tgtcggttgt ttcaccccca gagaagcagc aatttcacct tgggtgattt tcatgcgaga    150420
     acgaagctct gctaggtgga tgttcagcaa catttcagtc gccgctttct gtgctttggc    150480
     aacaacatca ggcttttctg ttgccagcat ttggtcaaga gttcttgcca taacgttcac    150540
     tccttcttta atttatccaa gtgcgccgca aattcacggt ctgcaattgg gatcattact    150600
     tcataaaatc gtttctcatc cccagtctta ttaccggcac agagaagaat ccccttacgc    150660
     tttggatcga atgcaaagaa cgctctgaga ggatctcctt tgctttgaac ccgtagctct    150720
     ttcatgttgc tgtaggatga accgttcaca gtgtcagcgt atggcctcga aagcatagga    150780
     cctctgtcac gaagtaccat catcgaagca aggacgttgg ctctgtcagt atcatccaga    150840
     gcatcgaacc actcatcaaa ggtgtcggtt gtctcgatgg cccacatgat tcctccttac    150900
     ttaatatagg cgcaatccta tatagattca aacctataat caagaaaaat cgacgactgg    150960
     ggtttgatcc aagcgagcag gtgtaaacaa gaaaactttc acatgtgaaa gtcttgcaag    151020
     gcgtcttttt attgtttaca gtatcataaa atgaatctgt aaaggtgcgc gatgaatgtg    151080
     cttccaacga aaagctggcc ttgggcgtta taactcaacc agacctgaat ggctggcggc    151140
     gtaccgaaac gcaagatgta tgagaaactc aggtaaagag cctgatgctt ctctttccgg    151200
     gatagcttgg aaggcgcaac tcattgttgc ccacgaaaga gacagaattg acaacctggc    151260
     agtccctttg gaagccagat tgatagcaaa gaacctcatc aacgagattc ttgctgagga    151320
     gaactgatgg acgaaaaaat cacctacgaa gaaatgattg aacaactcga tcagaaaggc    151380
     atccgcgtta ccaatggtgc gcgacggctt tatgtcgcgt tgaacaatgg agtaaaagct    151440
     gaggtgctgg gtaactgcgg tcccgcgaca atcagcttgg ttgacggaat aattgttgtg    151500
     gaagagcaaa ctctccacta agggcagcag tatgggcaaa aaagtacata tcatttgcgg    151560
     aaagtgtggc agtgacgaga tgaactttgt catcaatgaa cactgtccag acgatccaca    151620
     gaatgttgcc agtatgtcct gctcaaactg ttgcgaactg acaggcatag ccgagtggtc    151680
     ggaatttaat ggccgggagt tgaaaggtga agcagtcgcc ctatcagcat cggcaagcgt    151740
     gaatgctctt ctgggattgc ttcgccaggc gatggacagc gttgagtatc gcctctatgg    151800
     cggggacatg tcattgagcg gttatgatgc tgccgaactg atagacctcc aggagcgagc    151860
     agaaaaggcc ttatctgctc ttcggagtga tcagcatgag tgatttatac gaaccgcttg    151920
     agtttgtgtt ctgtggattt aggaaagggg acgctgggct ctttatctcg gtagccactt    151980
     tgcgcgatgg tgttttaggc cgtgagatgt atttttcaaa agccaaaagc aaaaggcgct    152040
     gggttgtcgg tggcatttac tcaggggcct cgttttcaga cagcggagca aagggtctgg    152100
     atgatgctcg ttacgttaaa gcatgggaag tgcagggcga caagatagag tggcaagcaa    152160
     aaagcgagca agccgaagcc ttggcgcgga gcgagaaact tgaagccgac gataggaagc    152220
     gcaatgaact cgaagaggtg atgttaccca tcaggaagca atatggggca ttaacaaaac    152280
     gtcgtgatag agcaggggcc gcagctcttg aagaagctgt cctgagagcg ctgagagcgc    152340
     ccatcaggaa ggctgaggag aaataaccgt ggagccagtc ttagctaaag cattcgccgg    152400
     ttttaaagtc gtagctgtac gtgcccatca gattggcttt gcggcttttc ttgccattag    152460
     tgtttgctgg agctggtgct ttaggggtag caagtacgcc atagaacagg atgccatcca    152520
     gttgctggaa ggaggaacta cagtgaccaa agatcgtctg aattaaccag actaaggcgt    152580
     cagcataagc tagtttgctc tgtcatcgca gccgtactca tctgtgcagg tatatatggg    152640
     atcgttgcac gtttgggctt catcctgatg gcaccatttt ttgttatcgc cttaggtgtg    152700
     ctggtcgatg cgtttctgcc aaaggtaagt tggttcttct gtgtgcggga cgtgagagac    152760
     atctttgggt ggagaaaacg atgattgtga aaagtgtttt tgtatggttg aaggccgggg    152820
     caatactggc tttcttgttc atcggcatta ttggtgctgc taacagggtt tattgggtca    152880
     acagcgaagg tctgagccaa ggtgcgatgt catccgcatt ggttatagaa aagtttggcc    152940
     tagatctcgg tgaaatgtgc cgttatgaca aaccacagca tgtcgagttc aaagtccttt    153000
     atgaccagac aatccagttt cgctgctcct ggtttgaagg tggtgggtta accttgtggc    153060
     ctttttacac cgagcataac gtaaatagtg ccgaagcaac ctctgtgttc aatggtatct    153120
     tccagagtat ggagggacat gatgagtaac cagttagagc tcttccatgt ccaagaagcg    153180
     tatgccaagg cggacaaacc tttatccaat gacgaactct acgattcagt ggcggagctc    153240
     gcagggattc ctaaaagcgc tctgaatgaa caaagtgaaa ttggcaaggc aaaggtcaag    153300
     cgaagcaagc tgaaaaggca gatccgctgg tatcagcaaa ccctcaagtc gatgaacctt    153360
     ctccaaaagg tagacggcga gcggggtgtc tgggagctat caagcaaaac caagaagggc    153420
     ctgcatgagg ctcttggcgg cgttcgactt gtcgcctatt caacaaatct tgggctggca    153480
     gtgtggtcaa acaacaagag ctttttctct gacctcgatg agccggttca tctgtgtgtt    153540
     acatcgccgc cgttcccgct ccggatacag cgtggctatg gaaacgttga tgaagccaaa    153600
     tgggtggatt tcattactca ggcgctcgaa ccgatagtca agaaccttgt gcctagtgga    153660
     agcgttgtgc tgaatgtcag caatgacatc ttcgaggcca agagcccctc cagatctctc    153720
     tacgttgaga gaatggtgct ggcgctccat gaccggctcg ggctgtctct catggataga    153780
     tggccgtgga tcaacctgtc caaaccacca agtcctaccc aatgggcttg tgtgaaccgt    153840
     taccagttgt gttccgggtg ggagcctgtt tattggttta ccaacgaccc tgatagggtg    153900
     cgctctgaca acagaagggt cttgatccct catacagaga aacatcagaa gttgatggcc    153960
     caaggcggtg atagcagggt ggtaagttac ggtgacgggg cctatcgact gagagggaac    154020
     gcattttcta atgtcacgga agggcggata ccgaaaaacg ttatccagcg cggccaccgt    154080
     tgtgcggata cgctggagct tcggaggatc gctaaagaac tgggattgcc gccgcacccg    154140
     gccatgttcc caacagacat tcctgagatg gctatccgct tcctgacaga agagggggac    154200
     ctgattgttg atccgttcag tggatcgaat aagagcgggt tggccgcaga aaggaataac    154260
     cggcgttgga tcgcttgtga catcattctg gagtacattc gcacccaggc ggaaatgttc    154320
     accggctttg atggattttg gatgaaccca gcaataggaa tggtaggaac tggagtaggg    154380
     caatattcat gaagcgtgat ttattagaat caatagggct agatgctagt cccttagaat    154440
     tggcggccaa agctgtgctt cgtgaagagt tagaccgtgt agaggttcat ccttgtgatg    154500
     aaggtgatga tgtggttgca gccaggcatt taacacaaga aatgaaaatt ttgctatccg    154560
     ctctcacggg ctataaattg tcgaactagc ttagttgata ttatttaata acaaaaagag    154620
     gtttgtatga acgtaacaaa agtccttctc attgcattga ttgcttctgt atcagcattg    154680
     ctcacgcttt gggtggcggg aggtttgact atgagcggtt ggtatattcc aattgttttt    154740
     ttagtaatag ctagtgtcat ttctgacagg ataggcttgg gttctatatc tgagttttta    154800
     aaatctaaat aattggctca gggatacggg cgcaaaggga aatcgtatgt cagcacagca    154860
     attggcagct ttactggatc aaccactttg gaaaattgag cgagctctgg cggcgctacg    154920
     agccaaaggc cttattgaaa ccaacaagta aggaatccgc aaaatgattc tgagttttct    154980
     ggatttctta atgatagcgc tcatcgttcg tggacctgag ttgctgcgcc tgtttgtgga    155040
     agtttcgcag ttcggttgta ggtttgataa ggcgcagtac gcgcttgcct gtgatgacca    155100
     tgcaaatttt cactacaaag agaagccttg cgtttggttt agagcaaagc tggcagtaaa    155160
     agcatttgtt ctaaataagt aacaggatac cgaattttga aaatggcata gagtctactg    155220
     gctgacagaa acgctgtcat gtgtaatggc tcagcccgga acgaggctct gcactgccaa    155280
     gcagttatcc cagcaattgc acggacagta caaacattgt aaaaacg                  155327
//

If you have problems or comments...

PBIL Back to PBIL home page